F494801

General Info

Members Datasets Scaffolds Average Seq Length
1568 571 1507 215

Family's Representative Sequence

Representative Sequence 3300028573|Ga0265334_10038247|Ga0265334_100382472
Length 252
Sequence MQPNAVAVETGSQRRFQEAGECRKGFAASVLGWAGTPGRSRTITLTAYSWVPPIVRGLVRDLRVRWALEEAGLPYRVELIDLQNKPDDYRDWQPWSQVPAYEEDGLRLFESGAIVLHIAEKSPALAPQDPAAKARMTCWLFAALNSVEPPMQELALLDFMHADKEWAKVRRPMIVEFVQRRLKGLADALAGREFLEGGFSAADLVMASVLRMAKLTNLVAEAGLADYLGRCEGRPAFQKALAGQLADFKDAA

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
3 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
4 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
5 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
6 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
7 2643221556 Massilia sp. Root1485 Isolate Unclassified
8 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
9 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
10 2643221638 Duganella sp. Root336D2 Isolate Unclassified
11 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
12 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
13 2643221684 Massilia sp. Root133 Isolate Unclassified
14 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
15 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
16 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
17 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
18 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
19 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
20 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
21 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
22 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
23 2922368715
24 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
25 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
26 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
27 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
28 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
29 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
30 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
31 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
32 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
33 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
34 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
35 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
36 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
37 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
38 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
39 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
40 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
41 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
42 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
43 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
44 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
45 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
46 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
47 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
48 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
49 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
50 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
51 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
52 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
53 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
54 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
55 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
56 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
57 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
58 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
59 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
60 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
61 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
62 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
63 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
64 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
65 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
66 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
67 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
68 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
69 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
70 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
71 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
72 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
73 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
74 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
75 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
76 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
77 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
78 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
79 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
80 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
81 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
82 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
83 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
84 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
85 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
86 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
87 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
88 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
89 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
90 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
91 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
92 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
93 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
94 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
95 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
96 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
97 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
98 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
99 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
100 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
101 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
102 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
103 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
104 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
105 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
106 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
107 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
108 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
109 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
110 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
111 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
112 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
113 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
114 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
115 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
116 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
117 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
118 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
119 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
120 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
121 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
122 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
123 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
124 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
125 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
126 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
127 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
128 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
129 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
130 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
131 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
132 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
133 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
134 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
135 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
136 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
137 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
138 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
139 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
140 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
141 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
142 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
143 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
144 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
145 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
146 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
147 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
148 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
149 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
150 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
151 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
152 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
153 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
154 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
155 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
156 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
157 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
158 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
159 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
160 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
161 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
162 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
163 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
164 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
165 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
166 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
167 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
168 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
169 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
170 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
171 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
172 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
173 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
174 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
175 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
176 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
177 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
178 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
179 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
180 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
181 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
182 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
183 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
184 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
185 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
186 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
187 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
188 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
189 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
190 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
191 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
192 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
193 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
194 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
195 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
196 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
197 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
198 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
199 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
200 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
201 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
202 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
203 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
204 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
205 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
206 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
208 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
209 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
212 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
213 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
214 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
216 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
217 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
218 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
219 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
220 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
222 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
223 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
289 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
290 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
291 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
293 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
297 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
298 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
299 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
300 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
301 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
302 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
303 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
304 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
305 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
306 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
307 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
308 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
309 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
310 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
311 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
312 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
313 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
314 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
315 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
316 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
317 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
318 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
319 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
320 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
321 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
322 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
323 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
324 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
325 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
326 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
327 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
328 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
329 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
330 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
331 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
332 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
333 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
334 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
335 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
336 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
337 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
338 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
339 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
340 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
341 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
342 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
343 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
344 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
345 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
346 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
347 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
348 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
349 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
350 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
351 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
352 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
353 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
354 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
355 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
356 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
357 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
358 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
359 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
360 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
361 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
362 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
363 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
364 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
365 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
366 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
367 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
368 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
369 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
370 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
371 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
372 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
373 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
374 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
375 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
376 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
377 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
378 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
379 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
380 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
381 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
382 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
383 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
384 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
385 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
386 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
387 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
388 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
389 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
390 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
391 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
392 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
393 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
394 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
395 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
396 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
397 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
398 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
399 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
400 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
401 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
402 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
403 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
404 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
405 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
406 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
407 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
408 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
409 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
410 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
411 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
412 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
413 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
414 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
415 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
416 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
417 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
418 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
419 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
420 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
421 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
422 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
423 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
424 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
425 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
426 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
427 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
428 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
429 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
430 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
431 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
432 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
433 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
434 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
435 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
436 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
437 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
438 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
439 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
440 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
441 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
442 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
443 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
444 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
445 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
446 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
447 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
448 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
449 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
450 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
451 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
452 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
453 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
454 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
455 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
456 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
457 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
458 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
459 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
460 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
461 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
462 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
463 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
464 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
465 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
466 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
467 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
468 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
469 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
470 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
471 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
472 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
473 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
474 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
475 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
476 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
477 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
478 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
479 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
480 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
481 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
482 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
483 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
484 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
485 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
486 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
487 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
488 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
489 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
490 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
491 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
492 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
493 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
494 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
495 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
496 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
497 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
498 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
499 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
500 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
501 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
502 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
503 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
504 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
505 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
506 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
507 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
508 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
509 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
510 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
511 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
512 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
513 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
514 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
515 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
516 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
517 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
518 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
519 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
520 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
521 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
522 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
523 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
524 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
525 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
526 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
527 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
528 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
529 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
530 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
531 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
532 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
533 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
534 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
535 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
536 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
537 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
538 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
539 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
540 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
541 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
542 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
543 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
544 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
545 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
546 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
547 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
548 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
549 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
550 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
551 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
552 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
553 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
554 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
555 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
556 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
557 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
558 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
559 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
560 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
561 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
562 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
563 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
564 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
565 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
566 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
567 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
568 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
569 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
570 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
571 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.6
Metatranscriptomes 0.57
Isolates 3.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.76
Nodule 2.93
Rhizoplane 4.72
Rhizosphere 78.06
Stem 0
Stem Tuber 0
Unclassified 4.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10005493 3300002067 Bacteria 4205
2 JGI25158J39367_1000436 3300002739 Bacteria 8648
3 JGI25158J39367_1001618 3300002739 Bacteria 3887
4 JGI25150J39212_1000927 3300002774 Bacteria 9514
5 JGI25159J45721_1002012 3300002987 Bacteria 8066
6 JGI25159J45721_1003938 3300002987 Bacteria 5071
7 JGI25153J46596_10022824 3300003215 Bacteria 2296
8 JGI25160J50197_1003242 3300003354 Bacteria 7340
9 JGI25160J50197_1005011 3300003354 Bacteria 5605
10 JGI25161J50226_1000895 3300003374 Bacteria 10795
11 JGI25161J50226_1002252 3300003374 Bacteria 5070
12 Ga0055525_1000179 3300003759 Bacteria 78692
13 Ga0055542_1000259 3300003762 Bacteria 59537
14 Ga0055542_1007375 3300003762 Bacteria 2238
15 Ga0055529_1000301 3300003763 Bacteria 56819
16 Ga0055526_1000807 3300003771 Bacteria 23354
17 Ga0055526_1002869 3300003771 Bacteria 11361
18 Ga0055537_1001395 3300003773 Bacteria 9576
19 Ga0055537_1002259 3300003773 Bacteria 6632
20 Ga0055537_1007604 3300003773 Bacteria 2593
21 Ga0055524_1006151 3300003775 Bacteria 5244
22 Ga0055524_1010992 3300003775 Unclassified 3564
23 Ga0055534_1005227 3300003784 Unclassified 3531
24 Ga0055534_1006819 3300003784 Unclassified 2818
25 Ga0055528_1007432 3300003790 Bacteria 4845
26 Ga0055530_10000014 3300003791 Bacteria 151346
27 Ga0055530_10002301 3300003791 Bacteria 12487
28 Ga0055530_10002731 3300003791 Bacteria 10938
29 Ga0055530_10003871 3300003791 Bacteria 8197
30 Ga0055531_10002273 3300003794 Bacteria 12998
31 Ga0055531_10006833 3300003794 Bacteria 6366
32 Ga0055531_10014393 3300003794 Bacteria 3562
33 Ga0055543_1001210 3300004625 Bacteria 10837
34 Ga0055543_1009496 3300004625 Bacteria 2087
35 Ga0065165_1000507 3300005262 Bacteria 59988
36 Ga0065165_1001235 3300005262 Bacteria 29240
37 Ga0065165_1002094 3300005262 Bacteria 18248
38 Ga0065165_1011460 3300005262 Bacteria 3695
39 Ga0065707_10184827 3300005295 Bacteria 1395
40 Ga0070658_10014808 3300005327 Bacteria 6249
41 Ga0070658_10025061 3300005327 Bacteria 4781
42 Ga0070658_10065255 3300005327 Bacteria 2970
43 Ga0070658_10112723 3300005327 Bacteria 2254
44 Ga0070658_10227060 3300005327 Bacteria 1580
45 Ga0070658_10292272 3300005327 Bacteria 1389
46 Ga0070658_10373563 3300005327 Bacteria 1222
47 Ga0070658_10628378 3300005327 Bacteria 931
48 Ga0070676_10017143 3300005328 Bacteria 4007
49 Ga0070676_10227973 3300005328 Bacteria 1234
50 Ga0070683_100073051 3300005329 Bacteria 3203
51 Ga0070683_100105971 3300005329 Bacteria 2650
52 Ga0070683_100317267 3300005329 Bacteria 1483
53 Ga0070690_100000298 3300005330 Bacteria 25583
54 Ga0070690_100012733 3300005330 Bacteria 4953
55 Ga0070670_100014734 3300005331 Bacteria 6714
56 Ga0070670_100122348 3300005331 Bacteria 2244
57 Ga0070670_100162935 3300005331 Bacteria 1933
58 Ga0070670_100173559 3300005331 Bacteria 1870
59 Ga0070677_10006512 3300005333 Bacteria 3881
60 Ga0070677_10007797 3300005333 Bacteria 3585
61 Ga0070677_10097807 3300005333 Bacteria 1288
62 Ga0070677_10140985 3300005333 Bacteria 1112
63 Ga0068869_100007668 3300005334 Bacteria 6911
64 Ga0068869_100075282 3300005334 Bacteria 2508
65 Ga0068869_100081029 3300005334 Bacteria 2423
66 Ga0068869_100234967 3300005334 Bacteria 1458
67 Ga0068869_100247877 3300005334 Bacteria 1421
68 Ga0070666_10000196 3300005335 Bacteria 41189
69 Ga0070666_10052945 3300005335 Bacteria 2736
70 Ga0070666_10119990 3300005335 Bacteria 1823
71 Ga0070680_100017574 3300005336 Bacteria 5641
72 Ga0070680_100064110 3300005336 Bacteria 3011
73 Ga0070680_100440531 3300005336 Bacteria 1112
74 Ga0070682_100089421 3300005337 Bacteria 2012
75 Ga0070682_100138696 3300005337 Bacteria 1655
76 Ga0070682_100659172 3300005337 Bacteria 834
77 Ga0070682_100666264 3300005337 Bacteria 830
78 Ga0068868_100016101 3300005338 Bacteria 5546
79 Ga0068868_100188050 3300005338 Bacteria 1717
80 Ga0070660_100278976 3300005339 Bacteria 1367
81 Ga0070660_100309191 3300005339 Bacteria 1297
82 Ga0070660_100330256 3300005339 Bacteria 1254
83 Ga0070660_100332835 3300005339 Bacteria 1249
84 Ga0070660_100407728 3300005339 Bacteria 1124
85 Ga0070689_100007863 3300005340 Bacteria 7475
86 Ga0070689_100260012 3300005340 Bacteria 1434
87 Ga0070687_100005115 3300005343 Bacteria 5287
88 Ga0070661_100010594 3300005344 Bacteria 6413
89 Ga0070661_100019305 3300005344 Bacteria 4859
90 Ga0070661_100021956 3300005344 Bacteria 4564
91 Ga0070661_100037844 3300005344 Bacteria 3510
92 Ga0070661_100223344 3300005344 Bacteria 1445
93 Ga0070661_100383819 3300005344 Bacteria 1108
94 Ga0070692_10099904 3300005345 Bacteria 1589
95 Ga0070668_100002694 3300005347 Bacteria 13064
96 Ga0070668_100005824 3300005347 Bacteria 9143
97 Ga0070668_100021704 3300005347 Bacteria 4850
98 Ga0070668_100075030 3300005347 Bacteria 2639
99 Ga0070668_100148558 3300005347 Bacteria 1893
100 Ga0070668_100272513 3300005347 Bacteria 1411
101 Ga0070668_100380701 3300005347 Bacteria 1201
102 Ga0070668_100558926 3300005347 Bacteria 997
103 Ga0070668_100784130 3300005347 Bacteria 846
104 Ga0070669_100012677 3300005353 Bacteria 5984
105 Ga0070669_100026972 3300005353 Bacteria 4134
106 Ga0070669_100066811 3300005353 Bacteria 2651
107 Ga0070669_100075053 3300005353 Bacteria 2507
108 Ga0070669_100455006 3300005353 Bacteria 1056
109 Ga0070675_100005341 3300005354 Bacteria 9822
110 Ga0070675_100019787 3300005354 Bacteria 5368
111 Ga0070675_100147726 3300005354 Bacteria 2014
112 Ga0070675_100171100 3300005354 Bacteria 1873
113 Ga0070675_100193610 3300005354 Bacteria 1763
114 Ga0070675_100201050 3300005354 Bacteria 1729
115 Ga0070675_100267181 3300005354 Bacteria 1500
116 Ga0070675_100324436 3300005354 Bacteria 1361
117 Ga0070675_100542129 3300005354 Bacteria 1051
118 Ga0070671_100002059 3300005355 Bacteria 15508
119 Ga0070671_100257341 3300005355 Bacteria 1483
120 Ga0070671_100482603 3300005355 Bacteria 1065
121 Ga0070674_100194988 3300005356 Bacteria 1560
122 Ga0070674_100226683 3300005356 Bacteria 1456
123 Ga0070674_100315419 3300005356 Unclassified 1251
124 Ga0070674_100637342 3300005356 Bacteria 904
125 Ga0070673_100005641 3300005364 Bacteria 8035
126 Ga0070673_100029162 3300005364 Unclassified 4113
127 Ga0070673_100098251 3300005364 Bacteria 2406
128 Ga0070673_100210585 3300005364 Bacteria 1679
129 Ga0070673_100792324 3300005364 Bacteria 875
130 Ga0070688_100181298 3300005365 Bacteria 1461
131 Ga0070688_100297078 3300005365 Bacteria 1166
132 Ga0070659_100043637 3300005366 Bacteria 3507
133 Ga0070659_100166761 3300005366 Bacteria 1802
134 Ga0070659_100253680 3300005366 Bacteria 1458
135 Ga0070667_100000339 3300005367 Bacteria 52285
136 Ga0070667_100019815 3300005367 Bacteria 5581
137 Ga0070667_100045935 3300005367 Bacteria 3674
138 Ga0070667_100053042 3300005367 Bacteria 3422
139 Ga0070667_100248731 3300005367 Bacteria 1589
140 Ga0070667_100623339 3300005367 Bacteria 995
141 Ga0070709_10005668 3300005434 Bacteria 6767
142 Ga0070709_10209601 3300005434 Bacteria 1385
143 Ga0070714_100111614 3300005435 Bacteria 2421
144 Ga0070713_100035075 3300005436 Bacteria 4036
145 Ga0070713_100192460 3300005436 Bacteria 1839
146 Ga0070713_100205873 3300005436 Bacteria 1779
147 Ga0070710_10002269 3300005437 Bacteria 9095
148 Ga0070701_10024694 3300005438 Unclassified 2910
149 Ga0070711_100013048 3300005439 Bacteria 5210
150 Ga0070711_100025261 3300005439 Bacteria 3884
151 Ga0070700_100013505 3300005441 Bacteria 4587
152 Ga0070700_100025680 3300005441 Bacteria 3470
153 Ga0070700_100135361 3300005441 Bacteria 1668
154 Ga0070694_100195481 3300005444 Bacteria 1505
155 Ga0070694_100287236 3300005444 Bacteria 1256
156 Ga0070708_100679272 3300005445 Bacteria 970
157 Ga0070663_100336074 3300005455 Bacteria 1219
158 Ga0070663_100515927 3300005455 Bacteria 994
159 Ga0070663_100626470 3300005455 Bacteria 907
160 Ga0070678_100004829 3300005456 Bacteria 7695
161 Ga0070678_100072043 3300005456 Bacteria 2589
162 Ga0070678_100110060 3300005456 Bacteria 2154
163 Ga0070678_100432534 3300005456 Bacteria 1149
164 Ga0070662_100005499 3300005457 Bacteria 8098
165 Ga0070662_100028581 3300005457 Bacteria 3881
166 Ga0070662_100038889 3300005457 Bacteria 3381
167 Ga0070662_100110129 3300005457 Bacteria 2097
168 Ga0070662_100548067 3300005457 Bacteria 969
169 Ga0070662_100588654 3300005457 Bacteria 935
170 Ga0070681_10058010 3300005458 Bacteria 3851
171 Ga0070681_10672257 3300005458 Bacteria 951
172 Ga0068867_100022131 3300005459 Bacteria 4542
173 Ga0068867_100035106 3300005459 Bacteria 3636
174 Ga0068867_100082522 3300005459 Bacteria 2425
175 Ga0068867_100184296 3300005459 Bacteria 1662
176 Ga0068867_100187833 3300005459 Bacteria 1647
177 Ga0068867_100279949 3300005459 Bacteria 1367
178 Ga0068867_100324830 3300005459 Bacteria 1276
179 Ga0068867_100556232 3300005459 Bacteria 994
180 Ga0070706_100116084 3300005467 Bacteria 2493
181 Ga0070699_100073414 3300005518 Bacteria 2976
182 Ga0070679_100020760 3300005530 Bacteria 6407
183 Ga0070679_100060334 3300005530 Bacteria 3780
184 Ga0070684_100012342 3300005535 Bacteria 6844
185 Ga0070684_100026787 3300005535 Bacteria 4859
186 Ga0070684_100136723 3300005535 Bacteria 2214
187 Ga0070684_100546832 3300005535 Bacteria 1074
188 Ga0068853_100096737 3300005539 Bacteria 2605
189 Ga0068853_100493909 3300005539 Bacteria 1155
190 Ga0068853_100498310 3300005539 Bacteria 1150
191 Ga0070672_100050410 3300005543 Bacteria 3241
192 Ga0070672_100081311 3300005543 Bacteria 2597
193 Ga0070672_100288263 3300005543 Bacteria 1389
194 Ga0070686_100014196 3300005544 Bacteria 4585
195 Ga0070686_100037730 3300005544 Bacteria 2999
196 Ga0070696_100578961 3300005546 Bacteria 903
197 Ga0070693_100571827 3300005547 Bacteria 812
198 Ga0070665_100002765 3300005548 Bacteria 19021
199 Ga0070665_100002853 3300005548 Bacteria 18699
200 Ga0070665_100013567 3300005548 Bacteria 8198
201 Ga0070665_100030847 3300005548 Bacteria 5396
202 Ga0070665_100062792 3300005548 Bacteria 3724
203 Ga0070665_100085245 3300005548 Bacteria 3164
204 Ga0070665_100088444 3300005548 Unclassified 3104
205 Ga0070665_100115850 3300005548 Bacteria 2683
206 Ga0070665_100222895 3300005548 Bacteria 1886
207 Ga0070665_100244774 3300005548 Bacteria 1794
208 Ga0070665_100711445 3300005548 Bacteria 1017
209 Ga0068855_100011835 3300005563 Bacteria 10547
210 Ga0068855_100057708 3300005563 Bacteria 4550
211 Ga0068855_100197792 3300005563 Bacteria 2264
212 Ga0068855_100432928 3300005563 Bacteria 1438
213 Ga0070664_100007800 3300005564 Bacteria 8645
214 Ga0070664_100026928 3300005564 Bacteria 4775
215 Ga0070664_100111929 3300005564 Bacteria 2383
216 Ga0070664_100680523 3300005564 Bacteria 957
217 Ga0068857_100060721 3300005577 Bacteria 3358
218 Ga0068857_100086184 3300005577 Bacteria 2808
219 Ga0068857_100610255 3300005577 Bacteria 1032
220 Ga0068854_100005268 3300005578 Bacteria 8161
221 Ga0068854_100430288 3300005578 Bacteria 1098
222 Ga0068856_100048274 3300005614 Bacteria 4194
223 Ga0068856_100374807 3300005614 Bacteria 1442
224 Ga0070702_100001979 3300005615 Bacteria 8625
225 Ga0070702_100048544 3300005615 Bacteria 2416
226 Ga0070702_100103836 3300005615 Bacteria 1749
227 Ga0068852_100015306 3300005616 Bacteria 5940
228 Ga0068852_100022892 3300005616 Bacteria 5019
229 Ga0068852_100114404 3300005616 Bacteria 2458
230 Ga0068852_100114583 3300005616 Bacteria 2456
231 Ga0068852_100118880 3300005616 Bacteria 2416
232 Ga0068852_101022863 3300005616 Bacteria 845
233 Ga0068859_100011717 3300005617 Bacteria 8810
234 Ga0068859_100016319 3300005617 Bacteria 7461
235 Ga0068859_100016479 3300005617 Bacteria 7422
236 Ga0068859_100037371 3300005617 Bacteria 4873
237 Ga0068859_100108306 3300005617 Bacteria 2840
238 Ga0068859_100190796 3300005617 Bacteria 2133
239 Ga0068859_100464364 3300005617 Bacteria 1362
240 Ga0068859_100617545 3300005617 Bacteria 1177
241 Ga0068864_100003974 3300005618 Bacteria 12172
242 Ga0068864_100007201 3300005618 Bacteria 9139
243 Ga0068864_100064311 3300005618 Unclassified 3181
244 Ga0068864_100088449 3300005618 Bacteria 2728
245 Ga0068864_100152806 3300005618 Bacteria 2092
246 Ga0068864_100409641 3300005618 Bacteria 1290
247 Ga0068866_10015407 3300005718 Bacteria 3396
248 Ga0068866_10028091 3300005718 Bacteria 2678
249 Ga0068866_10034856 3300005718 Bacteria 2454
250 Ga0068866_10277410 3300005718 Bacteria 1037
251 Ga0068861_100000359 3300005719 Bacteria 26065
252 Ga0068861_100002452 3300005719 Bacteria 12100
253 Ga0068861_100008723 3300005719 Bacteria 6976
254 Ga0068861_100138790 3300005719 Bacteria 1982
255 Ga0068851_10269315 3300005834 Bacteria 971
256 Ga0068870_10010010 3300005840 Bacteria 4336
257 Ga0068870_10036506 3300005840 Bacteria 2529
258 Ga0068870_10126011 3300005840 Bacteria 1481
259 Ga0068863_100000157 3300005841 Bacteria 72136
260 Ga0068863_100001989 3300005841 Bacteria 20308
261 Ga0068863_100021525 3300005841 Bacteria 6153
262 Ga0068863_100073420 3300005841 Bacteria 3236
263 Ga0068863_100100698 3300005841 Bacteria 2746
264 Ga0068863_100115166 3300005841 Bacteria 2561
265 Ga0068863_100217191 3300005841 Bacteria 1841
266 Ga0068863_100594952 3300005841 Bacteria 1094
267 Ga0068863_100922592 3300005841 Bacteria 874
268 Ga0068858_100000147 3300005842 Bacteria 74022
269 Ga0068858_100012616 3300005842 Bacteria 7966
270 Ga0068858_100015262 3300005842 Bacteria 7228
271 Ga0068858_100023307 3300005842 Bacteria 5769
272 Ga0068858_100066973 3300005842 Bacteria 3325
273 Ga0068858_100150704 3300005842 Bacteria 2187
274 Ga0068858_100481157 3300005842 Bacteria 1198
275 Ga0068858_100638289 3300005842 Bacteria 1034
276 Ga0068860_100000442 3300005843 Bacteria 52295
277 Ga0068860_100002668 3300005843 Bacteria 18581
278 Ga0068860_100066643 3300005843 Bacteria 3420
279 Ga0068860_100078750 3300005843 Bacteria 3134
280 Ga0068860_100189810 3300005843 Bacteria 1988
281 Ga0068860_100295364 3300005843 Bacteria 1586
282 Ga0068860_100457919 3300005843 Bacteria 1269
283 Ga0068860_100894005 3300005843 Bacteria 904
284 Ga0068862_100000023 3300005844 Bacteria 203389
285 Ga0068862_100002494 3300005844 Bacteria 16279
286 Ga0068862_100018296 3300005844 Bacteria 5836
287 Ga0068862_100039585 3300005844 Bacteria 4004
288 Ga0068862_100114975 3300005844 Bacteria 2366
289 Ga0068862_100123132 3300005844 Bacteria 2287
290 Ga0068862_100125553 3300005844 Bacteria 2265
291 Ga0068862_100207101 3300005844 Bacteria 1771
292 Ga0068862_100445617 3300005844 Bacteria 1219
293 Ga0068862_100502817 3300005844 Bacteria 1151
294 Ga0081455_10051635 3300005937 Bacteria 3526
295 Ga0081455_10485853 3300005937 Bacteria 834
296 Ga0081538_10150992 3300005981 Bacteria 1052
297 Ga0081539_10005457 3300005985 Bacteria 12970
298 Ga0081539_10071411 3300005985 Bacteria 1859
299 Ga0070717_10000430 3300006028 Bacteria 26747
300 Ga0075365_10146968 3300006038 Bacteria 1638
301 Ga0075365_10153701 3300006038 Unclassified 1601
302 Ga0075365_10170655 3300006038 Bacteria 1518
303 Ga0075365_10184707 3300006038 Bacteria 1458
304 Ga0075363_100067715 3300006048 Bacteria 1935
305 Ga0075364_10225774 3300006051 Bacteria 1271
306 Ga0070716_100000617 3300006173 Bacteria 15022
307 Ga0070716_100368797 3300006173 Bacteria 1022
308 Ga0070712_100001311 3300006175 Bacteria 15062
309 Ga0070712_100468550 3300006175 Bacteria 1051
310 Ga0070712_100692597 3300006175 Bacteria 868
311 Ga0070712_100747182 3300006175 Bacteria 837
312 Ga0075362_10031648 3300006177 Bacteria 2291
313 Ga0075367_10023446 3300006178 Bacteria 3473
314 Ga0075367_10108995 3300006178 Bacteria 1698
315 Ga0075367_10206222 3300006178 Bacteria 1229
316 Ga0075367_10244123 3300006178 Bacteria 1125
317 Ga0075367_10373972 3300006178 Bacteria 900
318 Ga0075369_10000236 3300006186 Bacteria 16397
319 Ga0075369_10010300 3300006186 Bacteria 3654
320 Ga0075366_10083426 3300006195 Bacteria 1910
321 Ga0097621_100043138 3300006237 Bacteria 3636
322 Ga0097621_100129431 3300006237 Bacteria 2147
323 Ga0097621_100639868 3300006237 Bacteria 975
324 Ga0097621_100674729 3300006237 Bacteria 950
325 Ga0075370_10001045 3300006353 Bacteria 11506
326 Ga0075370_10146216 3300006353 Bacteria 1383
327 Ga0068871_100017382 3300006358 Bacteria 5441
328 Ga0068871_100067158 3300006358 Unclassified 2941
329 Ga0068871_100116609 3300006358 Bacteria 2251
330 Ga0068871_100521795 3300006358 Bacteria 1073
331 Ga0075428_100017061 3300006844 Bacteria 8022
332 Ga0075428_100017741 3300006844 Bacteria 7864
333 Ga0075428_100019319 3300006844 Bacteria 7542
334 Ga0075428_100110271 3300006844 Bacteria 2998
335 Ga0075428_100928261 3300006844 Bacteria 923
336 Ga0075430_100007836 3300006846 Bacteria 9026
337 Ga0075430_100093220 3300006846 Bacteria 2518
338 Ga0075431_100000532 3300006847 Bacteria 31912
339 Ga0075431_100010534 3300006847 Bacteria 9295
340 Ga0075431_100059241 3300006847 Bacteria 3952
341 Ga0075431_100167609 3300006847 Bacteria 2257
342 Ga0075433_10297207 3300006852 Bacteria 1430
343 Ga0075433_10637214 3300006852 Bacteria 935
344 Ga0075434_100556074 3300006871 Bacteria 1167
345 Ga0075434_100731966 3300006871 Bacteria 1006
346 Ga0075429_100001302 3300006880 Bacteria 20336
347 Ga0075429_100096629 3300006880 Bacteria 2577
348 Ga0075429_100170153 3300006880 Bacteria 1908
349 Ga0068865_100006131 3300006881 Bacteria 7333
350 Ga0068865_100035448 3300006881 Bacteria 3356
351 Ga0068865_100065641 3300006881 Bacteria 2558
352 Ga0075436_100288870 3300006914 Bacteria 1174
353 Ga0097620_100011717 3300006931 Bacteria 8810
354 Ga0097620_100016320 3300006931 Bacteria 7461
355 Ga0097620_100016480 3300006931 Bacteria 7422
356 Ga0097620_100108305 3300006931 Bacteria 2840
357 Ga0097620_100190804 3300006931 Bacteria 2133
358 Ga0097620_100464361 3300006931 Bacteria 1362
359 Ga0097620_100617545 3300006931 Bacteria 1177
360 Ga0099824_1003668 3300006942 Bacteria 22410
361 Ga0075435_100210108 3300007076 Bacteria 1651
362 Ga0099794_10007808 3300007265 Bacteria 4417
363 Ga0099795_10069426 3300007788 Bacteria 1326
364 Ga0105251_10009665 3300009011 Bacteria 5670
365 Ga0105240_10099663 3300009093 Bacteria 3536
366 Ga0105240_10202548 3300009093 Bacteria 2325
367 Ga0105240_10350255 3300009093 Bacteria 1675
368 Ga0105240_10917545 3300009093 Bacteria 941
369 Ga0111539_10011155 3300009094 Bacteria 11302
370 Ga0111539_10011743 3300009094 Bacteria 10988
371 Ga0111539_10048851 3300009094 Bacteria 5050
372 Ga0111539_10360807 3300009094 Bacteria 1691
373 Ga0111539_10756141 3300009094 Bacteria 1131
374 Ga0105245_10010259 3300009098 Bacteria 8156
375 Ga0105245_10116510 3300009098 Bacteria 2491
376 Ga0105245_10430073 3300009098 Bacteria 1325
377 Ga0105245_10626417 3300009098 Bacteria 1104
378 Ga0105247_10505368 3300009101 Bacteria 881
379 Ga0114129_10007990 3300009147 Bacteria 15065
380 Ga0114129_10011196 3300009147 Bacteria 12786
381 Ga0114129_10393260 3300009147 Bacteria 1828
382 Ga0105243_10007319 3300009148 Bacteria 8489
383 Ga0105243_10020682 3300009148 Bacteria 4991
384 Ga0105243_10034109 3300009148 Bacteria 3938
385 Ga0105243_10107656 3300009148 Bacteria 2325
386 Ga0105243_10250137 3300009148 Bacteria 1582
387 Ga0105241_10010325 3300009174 Bacteria 6856
388 Ga0105241_10015721 3300009174 Bacteria 5545
389 Ga0105241_10421190 3300009174 Bacteria 1175
390 Ga0105242_10049125 3300009176 Bacteria 3432
391 Ga0105242_10109216 3300009176 Bacteria 2355
392 Ga0105242_10417951 3300009176 Bacteria 1256
393 Ga0105242_10843745 3300009176 Bacteria 911
394 Ga0105248_10013662 3300009177 Bacteria 8939
395 Ga0105248_10019614 3300009177 Bacteria 7484
396 Ga0105248_10040678 3300009177 Bacteria 5211
397 Ga0105248_10094973 3300009177 Bacteria 3357
398 Ga0105248_10142284 3300009177 Bacteria 2706
399 Ga0105248_10152873 3300009177 Unclassified 2604
400 Ga0105248_10301396 3300009177 Bacteria 1804
401 Ga0105248_10330749 3300009177 Bacteria 1716
402 Ga0105237_10197340 3300009545 Bacteria 2012
403 Ga0105237_11360584 3300009545 Bacteria 716
404 Ga0105238_10007170 3300009551 Bacteria 11147
405 Ga0105238_10098408 3300009551 Bacteria 2909
406 Ga0105249_10000004 3300009553 Bacteria 368014
407 Ga0105249_10004304 3300009553 Bacteria 12307
408 Ga0105249_10020072 3300009553 Bacteria 5970
409 Ga0105249_10107956 3300009553 Unclassified 2627
410 Ga0105249_10116229 3300009553 Bacteria 2535
411 Ga0105249_10198940 3300009553 Bacteria 1960
412 Ga0099796_10126600 3300010159 Bacteria 987
413 Ga0105239_10082759 3300010375 Bacteria 3534
414 Ga0105239_10090521 3300010375 Bacteria 3375
415 Ga0105239_10102935 3300010375 Bacteria 3160
416 Ga0105239_10191558 3300010375 Bacteria 2289
417 Ga0105239_10194788 3300010375 Bacteria 2269
418 Ga0105239_10274241 3300010375 Bacteria 1898
419 Ga0105239_10459495 3300010375 Bacteria 1445
420 Ga0105239_10903591 3300010375 Bacteria 1014
421 Ga0105246_10044527 3300011119 Bacteria 3017
422 Ga0105246_10115719 3300011119 Bacteria 1978
423 Ga0105246_10200117 3300011119 Bacteria 1552
424 Ga0105246_10417718 3300011119 Bacteria 1118
425 Ga0157341_1004641 3300012494 Bacteria 1001
426 Ga0157323_1001501 3300012495 Bacteria 1179
427 Ga0157373_10491008 3300013100 Bacteria 886
428 Ga0157371_10109285 3300013102 Bacteria 1963
429 Ga0157371_10153206 3300013102 Bacteria 1644
430 Ga0157370_10084749 3300013104 Bacteria 2978
431 Ga0157370_10582928 3300013104 Bacteria 1024
432 Ga0157369_10002034 3300013105 Bacteria 24368
433 Ga0157369_10213267 3300013105 Bacteria 2023
434 Ga0157369_10460274 3300013105 Bacteria 1317
435 Ga0157369_10488690 3300013105 Unclassified 1274
436 Ga0157369_10908157 3300013105 Bacteria 903
437 Ga0157374_10023048 3300013296 Bacteria 5563
438 Ga0157374_10516712 3300013296 Bacteria 1200
439 Ga0157378_10234360 3300013297 Bacteria 1751
440 Ga0163162_10007600 3300013306 Bacteria 10552
441 Ga0163162_10030779 3300013306 Bacteria 5318
442 Ga0163162_10242120 3300013306 Bacteria 1935
443 Ga0163162_10281536 3300013306 Bacteria 1795
444 Ga0163162_10417303 3300013306 Bacteria 1474
445 Ga0163162_10721278 3300013306 Bacteria 1118
446 Ga0157372_10594514 3300013307 Bacteria 1290
447 Ga0157372_10678293 3300013307 Bacteria 1199
448 Ga0157375_10034134 3300013308 Bacteria 4843
449 Ga0157375_10253979 3300013308 Bacteria 1919
450 Ga0157375_10375984 3300013308 Bacteria 1587
451 Ga0157375_10455448 3300013308 Bacteria 1445
452 Ga0157375_10928900 3300013308 Bacteria 1013
453 Ga0163163_10002591 3300014325 Bacteria 15320
454 Ga0163163_10027834 3300014325 Bacteria 5420
455 Ga0163163_10141410 3300014325 Bacteria 2449
456 Ga0163163_10162011 3300014325 Unclassified 2282
457 Ga0163163_10173535 3300014325 Bacteria 2202
458 Ga0163163_10343791 3300014325 Bacteria 1547
459 Ga0163163_10598974 3300014325 Bacteria 1165
460 Ga0163163_10973775 3300014325 Bacteria 912
461 Ga0163163_11628904 3300014325 Bacteria 706
462 Ga0157380_10003434 3300014326 Bacteria 10880
463 Ga0157380_10069733 3300014326 Bacteria 2838
464 Ga0157380_10190075 3300014326 Bacteria 1812
465 Ga0157380_10202545 3300014326 Bacteria 1762
466 Ga0157380_10338925 3300014326 Bacteria 1402
467 Ga0157380_10659489 3300014326 Bacteria 1045
468 Ga0157377_10007054 3300014745 Bacteria 5397
469 Ga0157377_10143606 3300014745 Bacteria 1469
470 Ga0157379_10021966 3300014968 Bacteria 5654
471 Ga0157379_10047497 3300014968 Bacteria 3829
472 Ga0157379_10077208 3300014968 Unclassified 2982
473 Ga0157379_10130440 3300014968 Bacteria 2262
474 Ga0157379_10173665 3300014968 Bacteria 1945
475 Ga0157379_10287405 3300014968 Bacteria 1497
476 Ga0157379_10349382 3300014968 Bacteria 1354
477 Ga0157379_10487024 3300014968 Bacteria 1142
478 Ga0157379_10595973 3300014968 Bacteria 1031
479 Ga0157376_10317275 3300014969 Bacteria 1481
480 Ga0157376_10321264 3300014969 Bacteria 1472
481 Ga0157376_10355338 3300014969 Bacteria 1404
482 Ga0157376_10594725 3300014969 Unclassified 1100
483 Ga0182006_1064665 3300015261 Bacteria 1371
484 Ga0163161_10035041 3300017792 Bacteria 3591
485 Ga0163161_10062357 3300017792 Bacteria 2716
486 Ga0163161_10238068 3300017792 Bacteria 1415
487 Ga0163161_10433428 3300017792 Bacteria 1060
488 Ga0206353_11634122 3300020082 Bacteria 783
489 Ga0213876_10003858 3300021384 Bacteria 8481
490 Ga0213876_10064609 3300021384 Bacteria 1931
491 Ga0209436_100900 3300025208 Bacteria 11803
492 Ga0209436_102124 3300025208 Bacteria 6208
493 Ga0209563_100143 3300025230 Bacteria 78744
494 Ga0207425_1000650 3300025245 Bacteria 19214
495 Ga0209026_1000869 3300025250 Bacteria 15786
496 Ga0209677_107287 3300025253 Bacteria 2386
497 Ga0209148_1000008 3300025254 Bacteria 1504371
498 Ga0209148_1000229 3300025254 Bacteria 91956
499 Ga0209148_1000679 3300025254 Bacteria 28441
500 Ga0209129_1003004 3300025258 Bacteria 7684
501 Ga0209233_1006703 3300025261 Bacteria 3693
502 Ga0209233_1021842 3300025261 Bacteria 1648
503 Ga0209233_1025221 3300025261 Bacteria 1474
504 Ga0209565_1001548 3300025263 Bacteria 9864
505 Ga0209565_1001935 3300025263 Bacteria 8135
506 Ga0209565_1003552 3300025263 Bacteria 4994
507 Ga0209565_1006321 3300025263 Bacteria 3334
508 Ga0209455_1000002 3300025272 Bacteria 1505459
509 Ga0209455_1004877 3300025272 Bacteria 4270
510 Ga0209673_1019887 3300025273 Bacteria 2397
511 Ga0209130_1000298 3300025284 Bacteria 60508
512 Ga0209130_1000545 3300025284 Bacteria 37692
513 Ga0209675_1002663 3300025291 Bacteria 9014
514 Ga0209675_1004422 3300025291 Bacteria 6253
515 Ga0209564_1000513 3300025295 Bacteria 63602
516 Ga0209564_1013486 3300025295 Bacteria 3466
517 Ga0209564_1019029 3300025295 Bacteria 2586
518 Ga0209758_1000817 3300025297 Bacteria 43865
519 Ga0209758_1018751 3300025297 Bacteria 3374
520 Ga0209050_1000034 3300025298 Bacteria 433906
521 Ga0209050_1000085 3300025298 Bacteria 263219
522 Ga0209050_1000984 3300025298 Bacteria 36274
523 Ga0209050_1001090 3300025298 Bacteria 32998
524 Ga0209050_1002313 3300025298 Bacteria 16765
525 Ga0209050_1024116 3300025298 Bacteria 2117
526 Ga0209256_1001916 3300025299 Bacteria 19043
527 Ga0209256_1003652 3300025299 Bacteria 10524
528 Ga0209256_1004507 3300025299 Bacteria 8699
529 Ga0209256_1025176 3300025299 Unclassified 1739
530 Ga0207426_1000605 3300025302 Bacteria 46505
531 Ga0207426_1002637 3300025302 Bacteria 11088
532 Ga0209257_1000010 3300025304 Bacteria 1158682
533 Ga0209257_1000052 3300025304 Bacteria 430947
534 Ga0209257_1001468 3300025304 Bacteria 27780
535 Ga0209257_1002829 3300025304 Bacteria 16295
536 Ga0207697_10215222 3300025315 Bacteria 847
537 Ga0207656_10211842 3300025321 Bacteria 939
538 Ga0207682_10007649 3300025893 Bacteria 4300
539 Ga0207682_10016087 3300025893 Bacteria 2915
540 Ga0207682_10093633 3300025893 Bacteria 1306
541 Ga0207642_10000675 3300025899 Bacteria 10517
542 Ga0207710_10002851 3300025900 Bacteria 7872
543 Ga0207688_10025966 3300025901 Bacteria 3219
544 Ga0207688_10085498 3300025901 Bacteria 1806
545 Ga0207688_10196264 3300025901 Bacteria 1209
546 Ga0207680_10001529 3300025903 Bacteria 10892
547 Ga0207680_10029047 3300025903 Bacteria 3101
548 Ga0207647_10004155 3300025904 Bacteria 10739
549 Ga0207647_10024093 3300025904 Bacteria 4015
550 Ga0207685_10001029 3300025905 Bacteria 5447
551 Ga0207699_10002837 3300025906 Bacteria 8208
552 Ga0207699_10078513 3300025906 Bacteria 2039
553 Ga0207645_10014806 3300025907 Bacteria 5206
554 Ga0207643_10027270 3300025908 Bacteria 3166
555 Ga0207643_10048833 3300025908 Bacteria 2398
556 Ga0207643_10058322 3300025908 Bacteria 2200
557 Ga0207643_10099159 3300025908 Bacteria 1707
558 Ga0207705_10020786 3300025909 Bacteria 4684
559 Ga0207705_10083274 3300025909 Bacteria 2334
560 Ga0207705_10168971 3300025909 Bacteria 1646
561 Ga0207705_10366710 3300025909 Bacteria 1111
562 Ga0207654_10067631 3300025911 Bacteria 2111
563 Ga0207654_10449803 3300025911 Bacteria 903
564 Ga0207654_10663139 3300025911 Bacteria 748
565 Ga0207707_10046010 3300025912 Bacteria 3800
566 Ga0207707_10545073 3300025912 Bacteria 986
567 Ga0207695_10000599 3300025913 Bacteria 72238
568 Ga0207695_10058269 3300025913 Bacteria 4009
569 Ga0207671_10010694 3300025914 Bacteria 7547
570 Ga0207671_10129597 3300025914 Bacteria 1935
571 Ga0207693_10001905 3300025915 Bacteria 18262
572 Ga0207693_10030888 3300025915 Bacteria 4231
573 Ga0207663_10003699 3300025916 Bacteria 7524
574 Ga0207663_10012613 3300025916 Bacteria 4576
575 Ga0207663_10015732 3300025916 Bacteria 4182
576 Ga0207663_10513922 3300025916 Bacteria 932
577 Ga0207660_10070749 3300025917 Bacteria 2537
578 Ga0207660_10227859 3300025917 Bacteria 1464
579 Ga0207660_10382347 3300025917 Unclassified 1132
580 Ga0207662_10001362 3300025918 Bacteria 11812
581 Ga0207657_10014518 3300025919 Bacteria 7681
582 Ga0207657_10042219 3300025919 Bacteria 4025
583 Ga0207657_10168843 3300025919 Bacteria 1773
584 Ga0207657_10207471 3300025919 Bacteria 1574
585 Ga0207657_10255068 3300025919 Bacteria 1397
586 Ga0207657_10306745 3300025919 Bacteria 1257
587 Ga0207657_10658349 3300025919 Bacteria 815
588 Ga0207649_10013851 3300025920 Bacteria 4509
589 Ga0207649_10132061 3300025920 Bacteria 1697
590 Ga0207649_10502234 3300025920 Bacteria 922
591 Ga0207649_10782545 3300025920 Bacteria 744
592 Ga0207652_10039102 3300025921 Bacteria 4025
593 Ga0207652_10576487 3300025921 Bacteria 1010
594 Ga0207681_10006184 3300025923 Bacteria 7346
595 Ga0207681_10057274 3300025923 Bacteria 2662
596 Ga0207681_10112897 3300025923 Bacteria 1980
597 Ga0207681_10145788 3300025923 Bacteria 1769
598 Ga0207694_10055050 3300025924 Bacteria 3088
599 Ga0207650_10066274 3300025925 Unclassified 2708
600 Ga0207650_10099676 3300025925 Bacteria 2234
601 Ga0207650_10170910 3300025925 Bacteria 1727
602 Ga0207650_10210064 3300025925 Bacteria 1563
603 Ga0207650_10287687 3300025925 Bacteria 1339
604 Ga0207650_10584000 3300025925 Bacteria 938
605 Ga0207659_10009908 3300025926 Bacteria 5962
606 Ga0207659_10029986 3300025926 Bacteria 3711
607 Ga0207659_10037170 3300025926 Bacteria 3379
608 Ga0207659_10042610 3300025926 Bacteria 3184
609 Ga0207659_10110364 3300025926 Bacteria 2090
610 Ga0207687_10025801 3300025927 Bacteria 3933
611 Ga0207687_10214737 3300025927 Bacteria 1511
612 Ga0207700_10099107 3300025928 Bacteria 2319
613 Ga0207664_10076808 3300025929 Bacteria 2704
614 Ga0207644_10007133 3300025931 Bacteria 7281
615 Ga0207644_10055751 3300025931 Bacteria 2850
616 Ga0207644_10056479 3300025931 Bacteria 2833
617 Ga0207644_10083612 3300025931 Bacteria 2364
618 Ga0207644_10506684 3300025931 Bacteria 996
619 Ga0207690_10022459 3300025932 Bacteria 3926
620 Ga0207690_10146604 3300025932 Bacteria 1746
621 Ga0207690_10218432 3300025932 Bacteria 1457
622 Ga0207690_10224724 3300025932 Bacteria 1438
623 Ga0207690_10672842 3300025932 Bacteria 849
624 Ga0207706_10008066 3300025933 Bacteria 9721
625 Ga0207706_10011598 3300025933 Bacteria 8028
626 Ga0207706_10018174 3300025933 Bacteria 6325
627 Ga0207706_10089552 3300025933 Bacteria 2705
628 Ga0207706_10138981 3300025933 Bacteria 2137
629 Ga0207706_10371092 3300025933 Bacteria 1243
630 Ga0207686_10020069 3300025934 Bacteria 3812
631 Ga0207686_10031459 3300025934 Bacteria 3151
632 Ga0207686_10159427 3300025934 Bacteria 1580
633 Ga0207709_10009799 3300025935 Bacteria 5278
634 Ga0207670_10021699 3300025936 Bacteria 3966
635 Ga0207670_10126835 3300025936 Bacteria 1863
636 Ga0207670_10416037 3300025936 Bacteria 1078
637 Ga0207669_10055048 3300025937 Bacteria 2407
638 Ga0207669_10158550 3300025937 Bacteria 1595
639 Ga0207669_10305198 3300025937 Bacteria 1211
640 Ga0207669_10579801 3300025937 Bacteria 909
641 Ga0207704_10026083 3300025938 Bacteria 3200
642 Ga0207704_10032793 3300025938 Bacteria 2945
643 Ga0207704_10119236 3300025938 Bacteria 1801
644 Ga0207665_10000756 3300025939 Bacteria 21750
645 Ga0207665_10137420 3300025939 Bacteria 1740
646 Ga0207691_10004440 3300025940 Bacteria 13597
647 Ga0207691_10011482 3300025940 Bacteria 8501
648 Ga0207691_10035352 3300025940 Bacteria 4639
649 Ga0207691_10035967 3300025940 Bacteria 4590
650 Ga0207691_10112703 3300025940 Unclassified 2417
651 Ga0207691_10156842 3300025940 Bacteria 1999
652 Ga0207691_10259162 3300025940 Bacteria 1499
653 Ga0207711_10020463 3300025941 Bacteria 5517
654 Ga0207711_10035717 3300025941 Bacteria 4214
655 Ga0207711_10043159 3300025941 Bacteria 3845
656 Ga0207711_10086510 3300025941 Bacteria 2748
657 Ga0207711_10088261 3300025941 Bacteria 2722
658 Ga0207711_10140262 3300025941 Bacteria 2174
659 Ga0207711_10270824 3300025941 Bacteria 1562
660 Ga0207711_10281374 3300025941 Bacteria 1532
661 Ga0207689_10001261 3300025942 Bacteria 24396
662 Ga0207689_10007160 3300025942 Bacteria 9811
663 Ga0207689_10050945 3300025942 Bacteria 3413
664 Ga0207689_10072873 3300025942 Bacteria 2821
665 Ga0207689_10296167 3300025942 Bacteria 1341
666 Ga0207661_10158002 3300025944 Bacteria 1965
667 Ga0207661_10413098 3300025944 Bacteria 1225
668 Ga0207661_10868707 3300025944 Bacteria 830
669 Ga0207679_10060680 3300025945 Unclassified 2811
670 Ga0207679_10111712 3300025945 Bacteria 2158
671 Ga0207679_10143784 3300025945 Bacteria 1932
672 Ga0207679_10160870 3300025945 Bacteria 1838
673 Ga0207679_10167151 3300025945 Bacteria 1807
674 Ga0207679_10716404 3300025945 Bacteria 909
675 Ga0207667_10004790 3300025949 Bacteria 16542
676 Ga0207667_10187208 3300025949 Bacteria 2125
677 Ga0207667_10426550 3300025949 Bacteria 1349
678 Ga0207667_11201184 3300025949 Bacteria 738
679 Ga0207651_10023419 3300025960 Bacteria 3798
680 Ga0207651_10047950 3300025960 Bacteria 2884
681 Ga0207651_10056455 3300025960 Bacteria 2702
682 Ga0207651_10082465 3300025960 Bacteria 2322
683 Ga0207712_10000008 3300025961 Bacteria 527957
684 Ga0207712_10018558 3300025961 Bacteria 4532
685 Ga0207712_10178451 3300025961 Bacteria 1666
686 Ga0207712_10276740 3300025961 Bacteria 1368
687 Ga0207712_10728370 3300025961 Bacteria 867
688 Ga0207712_10778898 3300025961 Bacteria 840
689 Ga0207668_10001751 3300025972 Bacteria 12712
690 Ga0207668_10004010 3300025972 Bacteria 8673
691 Ga0207668_10061083 3300025972 Bacteria 2648
692 Ga0207668_10102320 3300025972 Bacteria 2131
693 Ga0207668_10222810 3300025972 Bacteria 1516
694 Ga0207668_10314455 3300025972 Bacteria 1297
695 Ga0207668_10383036 3300025972 Bacteria 1184
696 Ga0207668_10750262 3300025972 Bacteria 861
697 Ga0207640_10036829 3300025981 Bacteria 3074
698 Ga0207640_10073643 3300025981 Bacteria 2309
699 Ga0207640_10171226 3300025981 Bacteria 1618
700 Ga0207658_10001778 3300025986 Bacteria 16167
701 Ga0207658_10002521 3300025986 Bacteria 13323
702 Ga0207658_10030215 3300025986 Bacteria 3834
703 Ga0207658_10164233 3300025986 Bacteria 1822
704 Ga0207658_10195415 3300025986 Bacteria 1685
705 Ga0207658_10287675 3300025986 Bacteria 1411
706 Ga0207658_10587155 3300025986 Bacteria 1000
707 Ga0207677_10018338 3300026023 Bacteria 4197
708 Ga0207703_10000050 3300026035 Bacteria 145849
709 Ga0207703_10002053 3300026035 Bacteria 17754
710 Ga0207703_10019309 3300026035 Bacteria 5324
711 Ga0207703_10029500 3300026035 Bacteria 4329
712 Ga0207703_10115854 3300026035 Bacteria 2293
713 Ga0207703_10131806 3300026035 Bacteria 2159
714 Ga0207703_10970181 3300026035 Bacteria 815
715 Ga0207639_10019801 3300026041 Bacteria 4806
716 Ga0207639_10112611 3300026041 Bacteria 2221
717 Ga0207639_10933217 3300026041 Bacteria 812
718 Ga0207678_10102814 3300026067 Bacteria 2439
719 Ga0207678_10120948 3300026067 Bacteria 2234
720 Ga0207678_10221710 3300026067 Bacteria 1619
721 Ga0207678_10225611 3300026067 Bacteria 1604
722 Ga0207678_10405779 3300026067 Bacteria 1180
723 Ga0207708_10008203 3300026075 Bacteria 7737
724 Ga0207708_10038576 3300026075 Bacteria 3639
725 Ga0207702_10303871 3300026078 Bacteria 1515
726 Ga0207641_10000118 3300026088 Bacteria 117721
727 Ga0207641_10007748 3300026088 Bacteria 8925
728 Ga0207641_10014357 3300026088 Bacteria 6490
729 Ga0207641_10015779 3300026088 Bacteria 6189
730 Ga0207641_10057024 3300026088 Unclassified 3321
731 Ga0207641_10239359 3300026088 Bacteria 1690
732 Ga0207641_10289186 3300026088 Bacteria 1544
733 Ga0207641_10375327 3300026088 Bacteria 1361
734 Ga0207641_10467027 3300026088 Bacteria 1221
735 Ga0207641_10568932 3300026088 Bacteria 1107
736 Ga0207641_11074736 3300026088 Bacteria 803
737 Ga0207648_10004911 3300026089 Bacteria 13616
738 Ga0207648_10007760 3300026089 Bacteria 10479
739 Ga0207648_10065200 3300026089 Bacteria 3175
740 Ga0207648_10120633 3300026089 Bacteria 2305
741 Ga0207648_10122691 3300026089 Bacteria 2285
742 Ga0207648_10163917 3300026089 Bacteria 1964
743 Ga0207648_10247198 3300026089 Bacteria 1590
744 Ga0207648_10304541 3300026089 Bacteria 1430
745 Ga0207648_10511549 3300026089 Bacteria 1099
746 Ga0207676_10001602 3300026095 Bacteria 16677
747 Ga0207676_10003553 3300026095 Bacteria 11029
748 Ga0207676_10021992 3300026095 Bacteria 4685
749 Ga0207676_10225628 3300026095 Bacteria 1671
750 Ga0207676_10349049 3300026095 Bacteria 1368
751 Ga0207676_10982099 3300026095 Unclassified 831
752 Ga0207674_10010837 3300026116 Bacteria 10278
753 Ga0207674_10035095 3300026116 Bacteria 5236
754 Ga0207674_10121166 3300026116 Bacteria 2583
755 Ga0207674_10326306 3300026116 Bacteria 1484
756 Ga0207674_10329393 3300026116 Bacteria 1477
757 Ga0207674_10910183 3300026116 Bacteria 848
758 Ga0207675_100000643 3300026118 Bacteria 34320
759 Ga0207675_100005938 3300026118 Bacteria 11643
760 Ga0207675_100010499 3300026118 Bacteria 8676
761 Ga0207675_100069412 3300026118 Bacteria 3294
762 Ga0207675_100101947 3300026118 Bacteria 2705
763 Ga0207675_100133086 3300026118 Bacteria 2358
764 Ga0207675_100145719 3300026118 Bacteria 2252
765 Ga0207675_100636693 3300026118 Bacteria 1072
766 Ga0207683_10018748 3300026121 Bacteria 5903
767 Ga0207683_10037272 3300026121 Bacteria 4233
768 Ga0207683_10105422 3300026121 Bacteria 2520
769 Ga0207683_10142616 3300026121 Bacteria 2159
770 Ga0207683_10144325 3300026121 Bacteria 2146
771 Ga0207698_10082992 3300026142 Bacteria 2592
772 Ga0207698_10083708 3300026142 Bacteria 2583
773 Ga0207698_10150976 3300026142 Bacteria 2016
774 Ga0207698_10320338 3300026142 Bacteria 1452
775 Ga0209389_1000426 3300027296 Bacteria 25051
776 Ga0209589_1000300 3300027357 Bacteria 63625
777 Ga0209489_103118 3300027361 Bacteria 32720
778 Ga0209179_1033969 3300027512 Unclassified 1056
779 Ga0207428_10007561 3300027907 Bacteria 9900
780 Ga0207428_10420595 3300027907 Bacteria 977
781 Ga0207428_10556329 3300027907 Bacteria 829
782 Ga0268266_10000005 3300028379 Bacteria 1448194
783 Ga0268266_10000288 3300028379 Bacteria 82716
784 Ga0268266_10064045 3300028379 Unclassified 3175
785 Ga0268266_10125849 3300028379 Bacteria 2287
786 Ga0268266_10159519 3300028379 Bacteria 2039
787 Ga0268266_10217336 3300028379 Bacteria 1755
788 Ga0268266_10335776 3300028379 Bacteria 1417
789 Ga0268266_10870016 3300028379 Bacteria 871
790 Ga0268266_11014746 3300028379 Bacteria 803
791 Ga0268265_10000035 3300028380 Bacteria 207267
792 Ga0268265_10002411 3300028380 Bacteria 14123
793 Ga0268265_10023062 3300028380 Bacteria 4383
794 Ga0268265_10028933 3300028380 Unclassified 3972
795 Ga0268265_10137679 3300028380 Bacteria 2039
796 Ga0268265_10167074 3300028380 Bacteria 1876
797 Ga0268265_10378884 3300028380 Bacteria 1301
798 Ga0268265_10621248 3300028380 Bacteria 1035
799 Ga0268265_10802858 3300028380 Bacteria 917
800 Ga0268264_10000491 3300028381 Bacteria 52312
801 Ga0268264_10007029 3300028381 Bacteria 9442
802 Ga0268264_10011027 3300028381 Bacteria 7461
803 Ga0268264_10140438 3300028381 Bacteria 2153
804 Ga0268264_10173680 3300028381 Bacteria 1951
805 Ga0268264_10350896 3300028381 Bacteria 1404
806 Ga0268264_10389301 3300028381 Bacteria 1337
807 Ga0268264_10424410 3300028381 Bacteria 1283
808 Ga0265326_10033422 3300028558 Bacteria 1464
809 Ga0265334_10038247 3300028573 Bacteria 1888
810 Ga0307517_10109798 3300028786 Bacteria 2107
811 Ga0307515_10067106 3300028794 Bacteria 4954
812 Ga0307515_10355380 3300028794 Bacteria 1109
813 Ga0307515_10548533 3300028794 Unclassified 766
814 Ga0265338_10002138 3300028800 Bacteria 30367
815 Ga0265338_10023678 3300028800 Bacteria 6300
816 Ga0265338_10056488 3300028800 Bacteria 3480
817 Ga0265338_10151404 3300028800 Bacteria 1802
818 Ga0265325_10266619 3300031241 Bacteria 771
819 Ga0265340_10013717 3300031247 Bacteria 4250
820 Ga0265339_10071070 3300031249 Bacteria 1855
821 Ga0265339_10278955 3300031249 Bacteria 802
822 Ga0265327_10153164 3300031251 Bacteria 1069
823 Ga0307513_10040898 3300031456 Bacteria 5121
824 Ga0307513_10049887 3300031456 Bacteria 4530
825 Ga0307408_100000191 3300031548 Bacteria 66129
826 Ga0307408_100004007 3300031548 Bacteria 10040
827 Ga0307408_100035379 3300031548 Bacteria 3505
828 Ga0307408_100063120 3300031548 Bacteria 2709
829 Ga0307408_100156791 3300031548 Unclassified 1804
830 Ga0307408_100972501 3300031548 Bacteria 781
831 Ga0307508_10212462 3300031616 Bacteria 1535
832 Ga0265314_10013871 3300031711 Bacteria 6486
833 Ga0265314_10051702 3300031711 Bacteria 2861
834 Ga0265314_10127827 3300031711 Bacteria 1589
835 Ga0307405_10010908 3300031731 Bacteria 4737
836 Ga0307405_10499302 3300031731 Bacteria 975
837 Ga0307413_10276517 3300031824 Unclassified 1260
838 Ga0307413_10404903 3300031824 Bacteria 1070
839 Ga0307410_10066439 3300031852 Bacteria 2484
840 Ga0307410_10126005 3300031852 Bacteria 1875
841 Ga0307406_10062785 3300031901 Bacteria 2404
842 Ga0307406_10112729 3300031901 Bacteria 1876
843 Ga0307406_10184735 3300031901 Bacteria 1521
844 Ga0307412_10069337 3300031911 Bacteria 2400
845 Ga0307412_10091253 3300031911 Bacteria 2132
846 Ga0307412_10621256 3300031911 Bacteria 918
847 Ga0307412_10962566 3300031911 Bacteria 752
848 Ga0307409_100006462 3300031995 Bacteria 6890
849 Ga0307416_100000756 3300032002 Bacteria 16924
850 Ga0307416_100016817 3300032002 Bacteria 5097
851 Ga0307416_100090494 3300032002 Bacteria 2624
852 Ga0307416_100306190 3300032002 Bacteria 1582
853 Ga0307416_100540419 3300032002 Bacteria 1237
854 Ga0307416_100919169 3300032002 Bacteria 976
855 Ga0307414_10073777 3300032004 Bacteria 2470
856 Ga0307414_10182115 3300032004 Bacteria 1691
857 Ga0307411_10080865 3300032005 Bacteria 2236
858 Ga0307411_10569723 3300032005 Bacteria 969
859 Ga0307415_100003711 3300032126 Bacteria 7814
860 Ga0307415_100239058 3300032126 Unclassified 1468
861 Ga0307510_10032122 3300033180 Bacteria 5920
862 Ga0307510_10133109 3300033180 Bacteria 2152
863 Ga0307510_10425955 3300033180 Bacteria 769
864 Ga0373944_0038855 3300035089 Bacteria 1463
865 Ga0373949_0003619 3300035090 Bacteria 3633
866 Ga0373951_0010325 3300035091 Bacteria 2096
867 Ga0373952_0053918 3300035092 Bacteria 966
868 Ga0373952_0148759 3300035092 Bacteria 655
869 Ga0373923_0056425 3300035111 Bacteria 1658
870 Ga0373932_0032707 3300035112 Bacteria 1456
871 Ga0373936_0000491 3300035113 Bacteria 13386
872 Ga0373945_0015489 3300035116 Bacteria 2566
873 Ga0373953_0111503 3300035117 Bacteria 1157
874 Ga0373954_0001395 3300035118 Bacteria 9793
875 Ga0373954_0028954 3300035118 Bacteria 2549
876 Ga0373943_0005755 3300035170 Bacteria 5563
877 Ga0373943_0051702 3300035170 Bacteria 2024
878 Ga0373943_0184572 3300035170 Unclassified 1148
879 Ga0373946_0001418 3300035171 Bacteria 8314
880 Ga0373946_0198410 3300035171 Bacteria 960
881 Ga0373955_0016549 3300035172 Bacteria 3632
882 Ga0373955_0447039 3300035172 Bacteria 788
883 Ga0373962_0011920 3300035242 Bacteria 2185
884 Ga0373931_0033007 3300035691 Bacteria 2681
885 Ga0373931_0056599 3300035691 Bacteria 2101
886 Ga0373931_0190755 3300035691 Bacteria 1219
887 Ga0373935_0004417 3300035692 Bacteria 8259
888 Ga0373935_0162401 3300035692 Bacteria 1523
889 Ga0373935_0195280 3300035692 Bacteria 1396
890 Ga0373935_0722558 3300035692 Bacteria 733
891 Ga0373927_0020645 3300035695 Bacteria 4319
892 Ga0373927_0054090 3300035695 Bacteria 2596
893 Ga0373927_0299613 3300035695 Bacteria 1058
894 Ga0373933_0010617 3300035724 Bacteria 5050
895 Ga0373933_0097828 3300035724 Bacteria 1818
896 Ga0373947_0001131 3300035725 Bacteria 16382
897 Ga0373947_0027374 3300035725 Bacteria 3336
898 Ga0373937_0000389 3300036401 Bacteria 40860
899 Ga0373937_0043317 3300036401 Bacteria 4107
900 Ga0373937_0151886 3300036401 Bacteria 2169
901 Ga0373925_0005021 3300037068 Bacteria 9928
902 Ga0373925_0005303 3300037068 Bacteria 9625
903 Ga0373925_0084626 3300037068 Bacteria 2417
904 Ga0395899_0010351 3300037312 Bacteria 7148
905 Ga0395899_0023855 3300037312 Bacteria 4628
906 Ga0395899_0238184 3300037312 Bacteria 1253
907 Ga0395899_0581796 3300037312 Bacteria 715
908 Ga0395900_0001245 3300037418 Bacteria 31261
909 Ga0395900_0037621 3300037418 Bacteria 4988
910 Ga0395900_0038144 3300037418 Bacteria 4954
911 Ga0395900_0061382 3300037418 Bacteria 3864
912 Ga0395900_0100189 3300037418 Bacteria 2976
913 Ga0395900_0149091 3300037418 Bacteria 2390
914 Ga0395900_0722649 3300037418 Bacteria 928
915 Ga0395898_0020269 3300037466 Bacteria 6754
916 Ga0395898_0049078 3300037466 Bacteria 4137
917 Ga0395898_0063314 3300037466 Bacteria 3589
918 Ga0395898_0310030 3300037466 Bacteria 1505
919 Ga0395898_0314740 3300037466 Bacteria 1493
920 Ga0395898_0916915 3300037466 Bacteria 814
921 Ga0395905_0001336 3300037471 Bacteria 30043
922 Ga0395905_0006098 3300037471 Bacteria 12178
923 Ga0395905_0020632 3300037471 Bacteria 6239
924 Ga0395905_0072599 3300037471 Bacteria 3226
925 Ga0395905_0186731 3300037471 Bacteria 1945
926 Ga0395905_0190187 3300037471 Bacteria 1925
927 Ga0395905_0210180 3300037471 Unclassified 1823
928 Ga0395905_0316634 3300037471 Bacteria 1449
929 Ga0395901_0000227 3300038443 Bacteria 70721
930 Ga0395901_0012516 3300038443 Bacteria 8607
931 Ga0395901_0110450 3300038443 Bacteria 2886
932 Ga0395901_0324492 3300038443 Bacteria 1592
933 Ga0395901_0441262 3300038443 Bacteria 1332
934 Ga0395901_0523591 3300038443 Bacteria 1204
935 Ga0395901_0622036 3300038443 Bacteria 1086
936 Ga0395901_0897009 3300038443 Bacteria 869
937 Ga0436365_0472919 3300039437 Bacteria 2230
938 Ga0436365_1201434 3300039437 Bacteria 113887
939 Ga0436365_1367961 3300039437 Bacteria 8702
940 Ga0436360_0317454 3300039438 Bacteria 2515
941 Ga0436361_0515518 3300039447 Bacteria 2349
942 Ga0436363_0794016 3300039450 Bacteria 7079
943 Ga0436362_1180156 3300039453 Unclassified 2369
944 Ga0451849_1473880 3300041505 Bacteria 791
945 Ga0439445_0049864 3300042004 Bacteria 1128
946 Ga0439448_0001683 3300042005 Bacteria 5809
947 Ga0439448_0006886 3300042005 Bacteria 3279
948 Ga0439448_0131260 3300042005 Bacteria 863
949 Ga0439449_0061417 3300042007 Bacteria 1386
950 Ga0439455_0010698 3300042012 Bacteria 2024
951 Ga0439455_0058485 3300042012 Bacteria 1018
952 Ga0439455_0078729 3300042012 Bacteria 893
953 Ga0450890_023546 3300042127 Bacteria 847
954 Ga0439458_0058672 3300042157 Bacteria 958
955 Ga0439459_0011856 3300042438 Bacteria 1543
956 Ga0466969_0030750 3300044656 Bacteria 2735
957 Ga0466972_0000781 3300044658 Bacteria 15086
958 Ga0466972_0020772 3300044658 Bacteria 3279
959 Ga0466972_0077983 3300044658 Bacteria 1578
960 Ga0453683_0034774 3300044673 Bacteria 3176
961 Ga0466965_0032941 3300044683 Bacteria 2532
962 Ga0466965_0039757 3300044683 Bacteria 2313
963 Ga0466966_0024382 3300044684 Bacteria 3957
964 Ga0466966_0043862 3300044684 Bacteria 2865
965 Ga0466966_0048631 3300044684 Bacteria 2701
966 Ga0466966_0440111 3300044684 Bacteria 783
967 Ga0466961_0019560 3300044693 Bacteria 4356
968 Ga0466961_0327345 3300044693 Bacteria 934
969 Ga0466963_0030954 3300044694 Bacteria 3456
970 Ga0466964_0000202 3300044706 Bacteria 16760
971 Ga0466964_0070882 3300044706 Bacteria 1473
972 Ga0466964_0111751 3300044706 Bacteria 1219
973 Ga0466971_0055343 3300044719 Bacteria 1788
974 Ga0466968_0000639 3300044735 Bacteria 11995
975 Ga0466968_0074112 3300044735 Bacteria 1486
976 Ga0466968_0161081 3300044735 Bacteria 1035
977 Ga0466970_0148827 3300044765 Bacteria 1292
978 Ga0466970_0216612 3300044765 Bacteria 1068
979 Ga0466970_0250359 3300044765 Bacteria 992
980 Ga0466957_0000288 3300044842 Bacteria 24625
981 Ga0466957_0004295 3300044842 Bacteria 7907
982 Ga0466957_0004715 3300044842 Bacteria 7632
983 Ga0466960_0015132 3300044901 Bacteria 3321
984 Ga0466959_0004876 3300045049 Bacteria 9080
985 Ga0466959_0105268 3300045049 Bacteria 2017
986 Ga0466959_0121626 3300045049 Bacteria 1855
987 Ga0451576_0018965 3300045051 Bacteria 7515
988 Ga0451576_0310740 3300045051 Bacteria 1649
989 Ga0466958_0135171 3300045836 Bacteria 1550
990 Ga0466958_0200026 3300045836 Bacteria 1271
991 Ga0466958_0249780 3300045836 Bacteria 1134
992 Ga0466967_0011400 3300045976 Bacteria 6731
993 Ga0466967_0040616 3300045976 Bacteria 4006
994 Ga0466967_0098582 3300045976 Bacteria 2668
995 Ga0466967_0807575 3300045976 Bacteria 931
996 Ga0495617_004456 3300046452 Bacteria 5096
997 Ga0495627_003852 3300046453 Bacteria 6440
998 Ga0495603_0018570 3300046455 Bacteria 4206
999 Ga0495603_0024175 3300046455 Bacteria 3674
1000 Ga0495603_0109813 3300046455 Bacteria 1609
1001 Ga0495590_0000134 3300046457 Bacteria 43957
1002 Ga0495590_0005201 3300046457 Bacteria 5171
1003 Ga0495590_0011435 3300046457 Bacteria 3319
1004 Ga0495590_0261246 3300046457 Bacteria 646
1005 Ga0495591_002132 3300046458 Bacteria 11370
1006 Ga0495591_004885 3300046458 Bacteria 6379
1007 Ga0495629_0001316 3300046459 Bacteria 19535
1008 Ga0495629_0462363 3300046459 Bacteria 858
1009 Ga0495638_0000545 3300046460 Bacteria 43284
1010 Ga0495638_0023729 3300046460 Bacteria 4006
1011 Ga0495638_0182589 3300046460 Bacteria 1196
1012 Ga0495641_0030458 3300046461 Bacteria 2588
1013 Ga0495651_0004833 3300046462 Bacteria 10309
1014 Ga0495653_0002640 3300046463 Bacteria 14272
1015 Ga0495650_0025538 3300046471 Bacteria 2766
1016 Ga0495650_0077010 3300046471 Bacteria 1295
1017 Ga0495580_0016830 3300046472 Bacteria 5485
1018 Ga0495580_0049419 3300046472 Bacteria 2976
1019 Ga0495580_0297590 3300046472 Bacteria 1099
1020 Ga0495582_0003861 3300046473 Bacteria 8435
1021 Ga0495582_0009972 3300046473 Bacteria 5229
1022 Ga0495605_0000648 3300046474 Bacteria 26615
1023 Ga0495605_0001492 3300046474 Bacteria 15272
1024 Ga0495605_0033053 3300046474 Bacteria 2629
1025 Ga0495605_0041680 3300046474 Bacteria 2286
1026 Ga0495605_0073987 3300046474 Bacteria 1604
1027 Ga0495605_0120283 3300046474 Bacteria 1190
1028 Ga0495639_0119870 3300046475 Bacteria 1254
1029 Ga0495639_0252768 3300046475 Bacteria 872
1030 Ga0495584_0000276 3300046491 Bacteria 36518
1031 Ga0495584_0000360 3300046491 Bacteria 31720
1032 Ga0495584_0016236 3300046491 Bacteria 3797
1033 Ga0495585_0007706 3300046492 Bacteria 6562
1034 Ga0495585_0010621 3300046492 Bacteria 5472
1035 Ga0495585_0018992 3300046492 Bacteria 3966
1036 Ga0495585_0071627 3300046492 Bacteria 1889
1037 Ga0495594_0006527 3300046499 Bacteria 5999
1038 Ga0495594_0021257 3300046499 Bacteria 3463
1039 Ga0495594_0067893 3300046499 Bacteria 1979
1040 Ga0495594_0196844 3300046499 Bacteria 1148
1041 Ga0495594_0257580 3300046499 Bacteria 994
1042 Ga0495594_0302873 3300046499 Bacteria 910
1043 Ga0495596_0001238 3300046500 Bacteria 14862
1044 Ga0495596_0001797 3300046500 Bacteria 11937
1045 Ga0495596_0005557 3300046500 Bacteria 5928
1046 Ga0495596_0006399 3300046500 Bacteria 5424
1047 Ga0495596_0030837 3300046500 Bacteria 2144
1048 Ga0495596_0052042 3300046500 Bacteria 1603
1049 Ga0495596_0102336 3300046500 Bacteria 1112
1050 Ga0495607_0002183 3300046501 Bacteria 16253
1051 Ga0495607_0003483 3300046501 Bacteria 12046
1052 Ga0495607_0005327 3300046501 Bacteria 9241
1053 Ga0495607_0034039 3300046501 Bacteria 3094
1054 Ga0495607_0066295 3300046501 Bacteria 2032
1055 Ga0495607_0191366 3300046501 Bacteria 1019
1056 Ga0495583_0002792 3300046506 Bacteria 14379
1057 Ga0495583_0037710 3300046506 Bacteria 2289
1058 Ga0495583_0044645 3300046506 Bacteria 2054
1059 Ga0495583_0088099 3300046506 Bacteria 1340
1060 Ga0495583_0145193 3300046506 Bacteria 986
1061 Ga0495606_0001390 3300046507 Bacteria 32713
1062 Ga0495606_0006099 3300046507 Bacteria 11253
1063 Ga0495606_0019204 3300046507 Bacteria 5094
1064 Ga0495606_0026638 3300046507 Bacteria 4118
1065 Ga0495606_0034768 3300046507 Bacteria 3455
1066 Ga0495606_0087505 3300046507 Bacteria 1923
1067 Ga0495606_0169220 3300046507 Bacteria 1269
1068 Ga0495608_0038408 3300046511 Bacteria 3215
1069 Ga0495610_0001121 3300046512 Bacteria 24422
1070 Ga0495610_0001163 3300046512 Bacteria 23950
1071 Ga0495610_0047980 3300046512 Bacteria 2098
1072 Ga0495616_0000838 3300046513 Bacteria 22407
1073 Ga0495616_0001306 3300046513 Bacteria 17424
1074 Ga0495616_0013671 3300046513 Bacteria 4571
1075 Ga0495616_0016590 3300046513 Bacteria 4073
1076 Ga0495616_0049936 3300046513 Bacteria 2094
1077 Ga0495616_0086184 3300046513 Bacteria 1494
1078 Ga0495618_0082606 3300046514 Bacteria 2051
1079 Ga0495620_0046849 3300046515 Bacteria 1865
1080 Ga0495628_0011219 3300046516 Bacteria 7582
1081 Ga0495628_0292709 3300046516 Bacteria 1207
1082 Ga0495630_0033947 3300046517 Bacteria 3806
1083 Ga0495631_0000279 3300046518 Bacteria 35571
1084 Ga0495631_0006260 3300046518 Bacteria 6165
1085 Ga0495631_0006574 3300046518 Bacteria 5988
1086 Ga0495631_0013083 3300046518 Bacteria 4035
1087 Ga0495631_0032862 3300046518 Bacteria 2336
1088 Ga0495631_0068450 3300046518 Bacteria 1535
1089 Ga0495632_0000630 3300046519 Bacteria 32470
1090 Ga0495632_0001071 3300046519 Bacteria 23465
1091 Ga0495632_0001258 3300046519 Bacteria 21488
1092 Ga0495632_0007310 3300046519 Bacteria 6959
1093 Ga0495632_0026589 3300046519 Bacteria 3044
1094 Ga0495632_0143545 3300046519 Bacteria 1106
1095 Ga0495632_0231991 3300046519 Bacteria 832
1096 Ga0495637_0000349 3300046520 Bacteria 35312
1097 Ga0495637_0017595 3300046520 Bacteria 3328
1098 Ga0495637_0068319 3300046520 Bacteria 1440
1099 Ga0495637_0098352 3300046520 Bacteria 1146
1100 Ga0495643_0002769 3300046522 Bacteria 13408
1101 Ga0495643_0004691 3300046522 Bacteria 9488
1102 Ga0495643_0005957 3300046522 Bacteria 8135
1103 Ga0495643_0017729 3300046522 Bacteria 4155
1104 Ga0495643_0038705 3300046522 Bacteria 2610
1105 Ga0495644_0005634 3300046523 Bacteria 4884
1106 Ga0495644_0007182 3300046523 Bacteria 4303
1107 Ga0495644_0010211 3300046523 Bacteria 3618
1108 Ga0495644_0061411 3300046523 Bacteria 1412
1109 Ga0495648_0011719 3300046524 Bacteria 6579
1110 Ga0495648_0032709 3300046524 Bacteria 3408
1111 Ga0495648_0038570 3300046524 Bacteria 3053
1112 Ga0495648_0117826 3300046524 Bacteria 1433
1113 Ga0495648_0197672 3300046524 Bacteria 1009
1114 Ga0495648_0313011 3300046524 Bacteria 731
1115 Ga0495666_0116935 3300046526 Bacteria 1250
1116 Ga0495666_0126095 3300046526 Bacteria 1197
1117 Ga0495642_0001118 3300046528 Bacteria 12362
1118 Ga0495642_0002710 3300046528 Bacteria 7116
1119 Ga0495642_0016302 3300046528 Bacteria 2894
1120 Ga0495642_0140234 3300046528 Bacteria 1043
1121 Ga0495654_0025003 3300046530 Bacteria 3080
1122 Ga0495640_0153690 3300046533 Bacteria 1477
1123 Ga0495598_0143319 3300046537 Bacteria 828
1124 Ga0495609_0000005 3300046538 Bacteria 439165
1125 Ga0495609_0001506 3300046538 Bacteria 15365
1126 Ga0495609_0001754 3300046538 Bacteria 13939
1127 Ga0495597_0014777 3300046542 Bacteria 3712
1128 Ga0495645_0023470 3300046543 Bacteria 4467
1129 Ga0495622_0052482 3300046557 Bacteria 1892
1130 Ga0495622_0053543 3300046557 Bacteria 1872
1131 Ga0495622_0096650 3300046557 Bacteria 1355
1132 Ga0495633_0002683 3300046558 Bacteria 12369
1133 Ga0495667_0149953 3300046559 Bacteria 1501
1134 Ga0495656_0039625 3300046615 Bacteria 1959
1135 Ga0495656_0233518 3300046615 Bacteria 924
1136 Ga0495668_0005226 3300046616 Bacteria 8897
1137 Ga0495668_0006201 3300046616 Bacteria 7898
1138 Ga0495668_0033688 3300046616 Bacteria 2876
1139 Ga0495668_0035639 3300046616 Bacteria 2789
1140 Ga0495668_0049671 3300046616 Bacteria 2326
1141 Ga0495668_0052550 3300046616 Bacteria 2254
1142 Ga0495668_0084498 3300046616 Bacteria 1740
1143 Ga0495668_0145693 3300046616 Bacteria 1296
1144 Ga0495668_0147872 3300046616 Bacteria 1286
1145 Ga0495668_0183989 3300046616 Bacteria 1144
1146 Ga0495611_0000780 3300046648 Bacteria 17711
1147 Ga0495611_0002724 3300046648 Bacteria 7949
1148 Ga0495611_0041838 3300046648 Bacteria 2044
1149 Ga0495611_0054670 3300046648 Bacteria 1805
1150 Ga0495611_0166136 3300046648 Bacteria 1031
1151 Ga0495611_0276177 3300046648 Bacteria 776
1152 Ga0495625_0019447 3300046660 Bacteria 5267
1153 Ga0495625_0025099 3300046660 Bacteria 4524
1154 Ga0495625_0124066 3300046660 Bacteria 1755
1155 Ga0495625_0193286 3300046660 Bacteria 1347
1156 Ga0495625_0495893 3300046660 Bacteria 747
1157 Ga0495661_0000578 3300046665 Bacteria 38058
1158 Ga0495661_0000794 3300046665 Bacteria 29925
1159 Ga0495661_0003143 3300046665 Bacteria 12366
1160 Ga0495661_0028427 3300046665 Bacteria 3579
1161 Ga0495661_0060085 3300046665 Bacteria 2259
1162 Ga0495661_0304920 3300046665 Bacteria 796
1163 Ga0495588_0000059 3300046674 Bacteria 263358
1164 Ga0495588_0021970 3300046674 Bacteria 3150
1165 Ga0495588_0051038 3300046674 Bacteria 2129
1166 Ga0495588_0091182 3300046674 Bacteria 1596
1167 Ga0495588_0231071 3300046674 Bacteria 976
1168 Ga0495623_0017762 3300046679 Bacteria 4595
1169 Ga0495623_0093561 3300046679 Bacteria 1840
1170 Ga0495623_0228728 3300046679 Bacteria 1056
1171 Ga0495646_0122132 3300046680 Bacteria 1473
1172 Ga0495647_0006784 3300046681 Bacteria 3813
1173 Ga0495647_0012955 3300046681 Bacteria 2880
1174 Ga0495658_0000324 3300046683 Bacteria 26774
1175 Ga0495658_0050232 3300046683 Bacteria 2358
1176 Ga0495658_0248903 3300046683 Bacteria 1117
1177 Ga0495669_0001610 3300046684 Bacteria 9268
1178 Ga0495669_0003182 3300046684 Bacteria 6759
1179 Ga0495669_0018683 3300046684 Bacteria 2982
1180 Ga0495669_0035145 3300046684 Bacteria 2212
1181 Ga0495669_0087567 3300046684 Bacteria 1435
1182 Ga0495613_0001421 3300046689 Bacteria 18261
1183 Ga0495613_0068159 3300046689 Bacteria 2595
1184 Ga0495624_0035047 3300046690 Bacteria 3241
1185 Ga0495670_0015441 3300046691 Bacteria 3752
1186 Ga0495670_0028479 3300046691 Bacteria 2769
1187 Ga0495671_0001997 3300046692 Bacteria 13116
1188 Ga0495671_0039422 3300046692 Bacteria 2385
1189 Ga0495671_0047293 3300046692 Bacteria 2150
1190 Ga0495671_0061384 3300046692 Bacteria 1854
1191 Ga0495671_0111085 3300046692 Bacteria 1339
1192 Ga0495649_0001486 3300046694 Bacteria 17605
1193 Ga0495649_0202776 3300046694 Bacteria 1029
1194 Ga0495649_0328118 3300046694 Bacteria 776
1195 Ga0495589_0000212 3300046794 Bacteria 49440
1196 Ga0495589_0000277 3300046794 Bacteria 41776
1197 Ga0495589_0031000 3300046794 Bacteria 2692
1198 Ga0495589_0082270 3300046794 Bacteria 1565
1199 Ga0495589_0205095 3300046794 Bacteria 929
1200 Ga0495600_0005626 3300046809 Bacteria 7568
1201 Ga0495660_0000789 3300046810 Bacteria 23709
1202 Ga0495660_0001934 3300046810 Bacteria 13490
1203 Ga0495660_0029835 3300046810 Bacteria 3075
1204 Ga0495660_0043726 3300046810 Bacteria 2468
1205 Ga0495660_0045146 3300046810 Bacteria 2420
1206 Ga0495660_0051838 3300046810 Bacteria 2231
1207 Ga0495660_0069713 3300046810 Bacteria 1868
1208 Ga0495581_0003825 3300047315 Bacteria 8656
1209 Ga0495581_0050920 3300047315 Bacteria 2392
1210 Ga0495604_0203006 3300047317 Bacteria 1374
1211 Ga0495672_0000529 3300047320 Bacteria 43533
1212 Ga0495672_0000769 3300047320 Bacteria 34882
1213 Ga0495672_0054885 3300047320 Bacteria 2326
1214 Ga0495676_0020464 3300047321 Bacteria 5804
1215 Ga0495680_0007685 3300047322 Bacteria 9841
1216 Ga0495680_0017789 3300047322 Bacteria 6051
1217 Ga0495683_0000843 3300047323 Bacteria 21776
1218 Ga0495683_0027472 3300047323 Bacteria 2909
1219 Ga0495683_0083109 3300047323 Bacteria 1559
1220 Ga0495687_000221 3300047443 Bacteria 80968
1221 Ga0495687_000821 3300047443 Bacteria 33210
1222 Ga0495687_000828 3300047443 Bacteria 33075
1223 Ga0495687_001176 3300047443 Bacteria 25213
1224 Ga0495675_0102309 3300047444 Bacteria 1792
1225 Ga0495677_0000060 3300047445 Bacteria 61831
1226 Ga0495677_0000482 3300047445 Bacteria 16922
1227 Ga0495677_0000641 3300047445 Bacteria 14108
1228 Ga0495677_0016168 3300047445 Bacteria 2708
1229 Ga0495677_0022969 3300047445 Bacteria 2264
1230 Ga0495677_0093173 3300047445 Bacteria 1136
1231 Ga0495679_005612 3300047446 Bacteria 5534
1232 Ga0495679_046944 3300047446 Bacteria 1312
1233 Ga0495679_050150 3300047446 Bacteria 1256
1234 Ga0495685_001601 3300047447 Bacteria 6976
1235 Ga0495685_014299 3300047447 Bacteria 2697
1236 Ga0495685_113227 3300047447 Bacteria 892
1237 Ga0495673_0003436 3300047469 Bacteria 10437
1238 Ga0495673_0141328 3300047469 Bacteria 938
1239 Ga0495681_0008156 3300047470 Bacteria 6593
1240 Ga0495681_0012708 3300047470 Bacteria 4931
1241 Ga0495681_0030239 3300047470 Bacteria 2760
1242 Ga0495684_0000281 3300047471 Bacteria 41079
1243 Ga0495686_0002080 3300047472 Bacteria 19680
1244 Ga0495686_0002128 3300047472 Bacteria 19378
1245 Ga0495686_0005253 3300047472 Bacteria 10286
1246 Ga0495686_0005263 3300047472 Bacteria 10270
1247 Ga0495686_0015733 3300047472 Bacteria 5153
1248 Ga0495686_0039294 3300047472 Bacteria 3023
1249 Ga0495686_0042501 3300047472 Bacteria 2890
1250 Ga0495686_0114917 3300047472 Bacteria 1610
1251 Ga0495593_0001313 3300047673 Bacteria 14566
1252 Ga0495593_0012414 3300047673 Bacteria 4871
1253 Ga0495602_0039354 3300048088 Bacteria 4355
1254 Ga0495602_0084164 3300048088 Bacteria 2662
1255 Ga0495602_0094916 3300048088 Bacteria 2464
1256 Ga0495614_0156119 3300048089 Bacteria 1019
1257 Ga0495626_0000004 3300048091 Bacteria 356599
1258 Ga0495626_0001058 3300048091 Bacteria 23533
1259 Ga0495626_0001912 3300048091 Bacteria 15491
1260 Ga0495626_0003018 3300048091 Bacteria 11108
1261 Ga0495626_0008343 3300048091 Bacteria 5690
1262 Ga0495626_0018425 3300048091 Bacteria 3506
1263 Ga0495626_0055934 3300048091 Bacteria 1807
1264 Ga0496100_0093783 3300048903 Bacteria 2054
1265 Ga0496100_0215834 3300048903 Bacteria 1406
1266 Ga0496100_0605628 3300048903 Bacteria 851
1267 Ga0496100_0785878 3300048903 Bacteria 745
1268 Ga0496101_0030387 3300048904 Bacteria 3787
1269 Ga0496101_0040954 3300048904 Bacteria 3301
1270 Ga0496101_0107301 3300048904 Bacteria 2098
1271 Ga0496101_0432558 3300048904 Bacteria 1038
1272 Ga0496101_1124423 3300048904 Bacteria 616
1273 Ga0496102_0026915 3300048905 Bacteria 5134
1274 Ga0496102_0060877 3300048905 Bacteria 3454
1275 Ga0496102_0262417 3300048905 Bacteria 1628
1276 Ga0496102_0399297 3300048905 Bacteria 1292
1277 Ga0496102_0455868 3300048905 Bacteria 1199
1278 Ga0496102_0594610 3300048905 Bacteria 1029
1279 Ga0496103_0004533 3300048906 Bacteria 8412
1280 Ga0496103_0119990 3300048906 Bacteria 1674
1281 Ga0496104_0033359 3300048907 Bacteria 4795
1282 Ga0496104_0056082 3300048907 Bacteria 3726
1283 Ga0496104_0092699 3300048907 Bacteria 2888
1284 Ga0496104_0178707 3300048907 Bacteria 2032
1285 Ga0496104_0182400 3300048907 Bacteria 2009
1286 Ga0496104_0313257 3300048907 Bacteria 1482
1287 Ga0496105_0078584 3300048908 Bacteria 2724
1288 Ga0496105_0200123 3300048908 Bacteria 1630
1289 Ga0496105_0211543 3300048908 Bacteria 1580
1290 Ga0496105_0273406 3300048908 Bacteria 1364
1291 Ga0496105_0363211 3300048908 Bacteria 1155
1292 Ga0496106_0018137 3300048909 Bacteria 5205
1293 Ga0496106_0043272 3300048909 Bacteria 3378
1294 Ga0496106_0052408 3300048909 Bacteria 3078
1295 Ga0496106_0137687 3300048909 Bacteria 1919
1296 Ga0496106_0184615 3300048909 Bacteria 1657
1297 Ga0496106_0289350 3300048909 Bacteria 1313
1298 Ga0496106_0342895 3300048909 Bacteria 1200
1299 Ga0496107_0000113 3300048910 Bacteria 39326
1300 Ga0496107_0004681 3300048910 Bacteria 9288
1301 Ga0496107_0122879 3300048910 Bacteria 1913
1302 Ga0496107_0859189 3300048910 Bacteria 662
1303 Ga0496108_0029338 3300048911 Bacteria 4554
1304 Ga0496108_0081438 3300048911 Bacteria 2743
1305 Ga0496108_0211637 3300048911 Bacteria 1683
1306 Ga0496108_0537045 3300048911 Bacteria 1020
1307 Ga0496109_0041666 3300048912 Bacteria 4159
1308 Ga0496109_0068766 3300048912 Unclassified 3246
1309 Ga0496109_0109185 3300048912 Bacteria 2571
1310 Ga0496109_0175191 3300048912 Bacteria 2013
1311 Ga0496109_0220951 3300048912 Bacteria 1781
1312 Ga0496109_0510418 3300048912 Bacteria 1135
1313 Ga0496110_0083643 3300048913 Bacteria 2847
1314 Ga0496110_0089065 3300048913 Bacteria 2758
1315 Ga0496110_0135587 3300048913 Bacteria 2224
1316 Ga0496110_0233991 3300048913 Bacteria 1671
1317 Ga0496110_0492386 3300048913 Bacteria 1116
1318 Ga0496110_0850139 3300048913 Bacteria 818
1319 Ga0496111_0510456 3300048914 Bacteria 884
1320 Ga0496112_0187325 3300048915 Bacteria 2032
1321 Ga0496112_0195621 3300048915 Bacteria 1983
1322 Ga0496112_0278955 3300048915 Bacteria 1619
1323 Ga0496112_0313109 3300048915 Bacteria 1515
1324 Ga0496112_1053605 3300048915 Bacteria 732
1325 Ga0496112_1135079 3300048915 Bacteria 699
1326 Ga0496112_1344113 3300048915 Bacteria 630
1327 Ga0496113_0013567 3300048916 Bacteria 5527
1328 Ga0496113_0019802 3300048916 Bacteria 4716
1329 Ga0496113_0049599 3300048916 Bacteria 3127
1330 Ga0496113_0073537 3300048916 Bacteria 2604
1331 Ga0496113_0364705 3300048916 Bacteria 1159
1332 Ga0496114_0110938 3300048917 Bacteria 2350
1333 Ga0496114_0232954 3300048917 Bacteria 1618
1334 Ga0496114_0278067 3300048917 Bacteria 1475
1335 Ga0496114_0901673 3300048917 Bacteria 765
1336 Ga0496115_0006976 3300048918 Bacteria 8296
1337 Ga0496115_0597546 3300048918 Bacteria 878
1338 Ga0496116_0093144 3300048919 Bacteria 1825
1339 Ga0496117_0002744 3300048920 Bacteria 21590
1340 Ga0496117_0010332 3300048920 Bacteria 8530
1341 Ga0496117_0102606 3300048920 Bacteria 1805
1342 Ga0496118_0000310 3300048921 Bacteria 84607
1343 Ga0496118_0002674 3300048921 Bacteria 23560
1344 Ga0496120_0181026 3300048923 Bacteria 1035
1345 Ga0496121_0000042 3300048924 Bacteria 342304
1346 Ga0496121_0013415 3300048924 Bacteria 8807
1347 Ga0496121_0028907 3300048924 Bacteria 5147
1348 Ga0496121_0073508 3300048924 Bacteria 2739
1349 Ga0496121_0111517 3300048924 Bacteria 2085
1350 Ga0496121_0145623 3300048924 Bacteria 1751
1351 Ga0496121_0286601 3300048924 Bacteria 1124
1352 Ga0496121_0387346 3300048924 Bacteria 920
1353 Ga0496122_0001792 3300048925 Bacteria 32883
1354 Ga0496122_0003733 3300048925 Bacteria 19656
1355 Ga0496122_0076150 3300048925 Bacteria 2362
1356 Ga0496122_0292936 3300048925 Bacteria 882
1357 Ga0496123_0014236 3300048926 Bacteria 6610
1358 Ga0496123_0036242 3300048926 Bacteria 3501
1359 Ga0496123_0051716 3300048926 Bacteria 2733
1360 Ga0496123_0181386 3300048926 Bacteria 1099
1361 Ga0496124_0039125 3300048927 Bacteria 4113
1362 Ga0496124_0040582 3300048927 Bacteria 4024
1363 Ga0496124_0066695 3300048927 Bacteria 2996
1364 Ga0496124_0130487 3300048927 Bacteria 1997
1365 Ga0496124_0202472 3300048927 Bacteria 1508
1366 Ga0496124_0266773 3300048927 Bacteria 1256
1367 Ga0496124_0452620 3300048927 Bacteria 875
1368 Ga0496125_0001742 3300048928 Bacteria 30235
1369 Ga0496125_0107017 3300048928 Bacteria 2039
1370 Ga0496125_0239405 3300048928 Bacteria 1153
1371 Ga0496126_0001767 3300048929 Bacteria 31993
1372 Ga0496126_0090862 3300048929 Bacteria 2686
1373 Ga0496126_0590977 3300048929 Bacteria 876
1374 Ga0495678_000146 3300049459 Bacteria 85995
1375 Ga0495678_000749 3300049459 Bacteria 29488
1376 Ga0495678_001260 3300049459 Bacteria 20572
1377 Ga0495678_001614 3300049459 Bacteria 17233
1378 Ga0495682_0003958 3300049460 Bacteria 6460
1379 Ga0495682_0009174 3300049460 Bacteria 3872
1380 Ga0495682_0021466 3300049460 Bacteria 2419
1381 Ga0495682_0028690 3300049460 Bacteria 2061
1382 Ga0495682_0030674 3300049460 Bacteria 1988
1383 Ga0501299_007208 3300049522 Bacteria 1767
1384 Ga0501031_0023956 3300049568 Bacteria 3980
1385 Ga0501032_0228486 3300049569 Bacteria 1210
1386 Ga0501033_0004162 3300049570 Bacteria 11651
1387 Ga0501033_0193957 3300049570 Bacteria 1453
1388 Ga0501034_0005442 3300049571 Bacteria 13914
1389 Ga0501034_0039793 3300049571 Bacteria 4761
1390 Ga0501037_0010408 3300049573 Bacteria 6827
1391 Ga0501038_0075955 3300049574 Bacteria 2839
1392 Ga0501039_0268678 3300049575 Bacteria 1340
1393 Ga0501043_0056816 3300049579 Bacteria 3074
1394 Ga0501047_0121865 3300049581 Bacteria 2489
1395 Ga0501074_0060980 3300049590 Bacteria 2718
1396 Ga0501202_097402 3300049652 Bacteria 712
1397 Ga0501208_070808 3300049655 Bacteria 701
1398 Ga0501227_024578 3300049665 Bacteria 1407
1399 Ga0501249_000847 3300049679 Bacteria 6783
1400 Ga0501225_0036265 3300049705 Unclassified 1359
1401 Ga0501083_0083943 3300049744 Bacteria 2109
1402 Ga0501269_010335 3300049766 Bacteria 1134
1403 Ga0501273_045917 3300049770 Bacteria 657
1404 Ga0501279_005340 3300049775 Bacteria 1687
1405 Ga0501035_0005850 3300049822 Bacteria 11599
1406 Ga0501035_0071035 3300049822 Bacteria 3083
1407 Ga0501044_0001671 3300049823 Bacteria 26049
1408 nmdc:mga03683_27168_c2 3300050489 Bacteria 1381
1409 nmdc:mga03683_51024_c1 3300050489 Bacteria 1725
1410 nmdc:mga03683_7353_c1 3300050489 Bacteria 3280
1411 nmdc:mga03683_73906_c1 3300050489 Bacteria 1462
1412 nmdc:mga03n38_102138_c1 3300050490 Bacteria 1384
1413 nmdc:mga00v17_287507_c1 3300050491 Bacteria 1067
1414 nmdc:mga0yw44_100040_c1 3300050492 Bacteria 1846
1415 nmdc:mga0yw44_156397_c1 3300050492 Bacteria 1490
1416 nmdc:mga0yw44_249988_c1 3300050492 Unclassified 1180
1417 nmdc:mga0yw44_64770_c1 3300050492 Bacteria 2250
1418 nmdc:mga0k408_17501_c1 3300050493 Bacteria 3993
1419 nmdc:mga0k408_19877_c1 3300050493 Bacteria 3759
1420 nmdc:mga0k408_38890_c1 3300050493 Bacteria 2731
1421 nmdc:mga0k408_62569_c1 3300050493 Bacteria 2164
1422 nmdc:mga06z11_16900_c1 3300050494 Bacteria 3298
1423 nmdc:mga06z11_181609_c1 3300050494 Bacteria 1213
1424 nmdc:mga06z11_31919_c1 3300050494 Bacteria 2564
1425 nmdc:mga06z11_4701_c1 3300050494 Bacteria 5395
1426 nmdc:mga07m45_274440_c1 3300050496 Bacteria 981
1427 nmdc:mga07m45_78673_c1 3300050496 Bacteria 1882
1428 nmdc:mga05p37_1109595_c1 3300050507 Bacteria 827
1429 nmdc:mga05p37_19337_c1 3300050507 Bacteria 8238
1430 nmdc:mga05p37_19792_c1 3300050507 Bacteria 8143
1431 nmdc:mga09592_103142_c1 3300050508 Bacteria 2444
1432 nmdc:mga09592_109187_c1 3300050508 Bacteria 2373
1433 nmdc:mga09592_363_c1 3300050508 Bacteria 33165
1434 nmdc:mga0qj67_30578_c1 3300050509 Bacteria 4193
1435 nmdc:mga0qj67_9196_c1 3300050509 Bacteria 7340
1436 nmdc:mga06r32_19474_c1 3300050510 Bacteria 6230
1437 nmdc:mga06r32_21977_c1 3300050510 Bacteria 5892
1438 nmdc:mga06r32_247407_c1 3300050510 Bacteria 1770
1439 nmdc:mga06r32_9406_c1 3300050510 Bacteria 8816
1440 nmdc:mga08y16_11836_c1 3300050511 Bacteria 9164
1441 nmdc:mga08y16_121009_c1 3300050511 Bacteria 2724
1442 nmdc:mga08y16_703021_c1 3300050511 Bacteria 1010
1443 nmdc:mga08y16_713877_c1 3300050511 Bacteria 1001
1444 nmdc:mga08y16_7461_c1 3300050511 Bacteria 11454
1445 nmdc:mga08y16_80440_c1 3300050511 Bacteria 3397
1446 nmdc:mga0n895_269347_c1 3300050512 Bacteria 1728
1447 nmdc:mga0n895_325811_c1 3300050512 Bacteria 1556
1448 nmdc:mga0n895_817177_c1 3300050512 Bacteria 922
1449 nmdc:mga0rr50_140867_c1 3300050513 Bacteria 1940
1450 nmdc:mga0rr50_264323_c1 3300050513 Bacteria 1432
1451 nmdc:mga0rr50_27180_c1 3300050513 Bacteria 4002
1452 nmdc:mga08x19_25294_c1 3300050514 Bacteria 3697
1453 nmdc:mga08x19_254934_c1 3300050514 Bacteria 1212
1454 nmdc:mga0a205_331992_c2 3300050515 Bacteria 973
1455 nmdc:mga0a205_397317_c1 3300050515 Bacteria 1242
1456 nmdc:mga0sz30_129_c1 3300050516 Bacteria 27866
1457 nmdc:mga0sz30_6397_c1 3300050516 Bacteria 4370
1458 Ga0495601_0198971 3300053077 Bacteria 1309
1459 Ga0495612_0169322 3300053078 Bacteria 956
1460 Ga0495655_0037839 3300053083 Bacteria 1214
1461 Ga0495655_0041804 3300053083 Unclassified 1174
1462 Ga0495595_0004678 3300053084 Bacteria 5506
1463 Ga0495595_0039650 3300053084 Bacteria 2150
1464 Ga0495619_0001224 3300053085 Bacteria 16809
1465 Ga0495619_0190220 3300053085 Bacteria 1420
1466 Ga0500578_0000171 3300053086 Bacteria 77445
1467 Ga0500643_000227 3300053087 Bacteria 52101
1468 Ga0500643_008702 3300053087 Bacteria 3961
1469 Ga0500647_0149677 3300053091 Bacteria 1090
1470 Ga0500583_0023188 3300053092 Bacteria 2612
1471 Ga0500566_0026827 3300053094 Bacteria 3372
1472 Ga0500641_0004715 3300053096 Bacteria 4819
1473 Ga0500555_011188 3300053103 Bacteria 2576
1474 Ga0500556_0000053 3300053104 Bacteria 117389
1475 Ga0500556_0002622 3300053104 Bacteria 5633
1476 Ga0500557_019523 3300053105 Bacteria 1912
1477 Ga0500562_003508 3300053108 Bacteria 3933
1478 Ga0500562_015431 3300053108 Bacteria 1959
1479 Ga0500572_001044 3300053111 Bacteria 8261
1480 Ga0500594_0000180 3300053118 Bacteria 16058
1481 Ga0500595_019174 3300053119 Bacteria 2487
1482 Ga0500608_004094 3300053122 Bacteria 5587
1483 Ga0500642_0000001 3300053130 Bacteria 1468402
1484 Ga0500642_0001183 3300053130 Bacteria 7472
1485 Ga0500642_0029411 3300053130 Bacteria 2276
1486 Ga0500652_153365 3300053131 Bacteria 955
1487 Ga0500559_0000005 3300053136 Bacteria 230231
1488 Ga0500568_0014816 3300053139 Bacteria 3507
1489 Ga0500616_0160149 3300053153 Bacteria 1033
1490 Ga0500622_0000588 3300053156 Bacteria 33052
1491 Ga0500622_0015922 3300053156 Bacteria 4024
1492 Ga0500645_000236 3300053730 Bacteria 41553
1493 Ga0500645_002123 3300053730 Bacteria 9144
1494 Ga0500645_003470 3300053730 Bacteria 6381
1495 Ga0500645_006515 3300053730 Bacteria 4153
1496 Ga0500645_050547 3300053730 Bacteria 1213
1497 Ga0500599_002879 3300053736 Bacteria 2085
1498 Ga0500661_000688 3300055283 Bacteria 6344
1499 Ga0587066_020630 3300059490 Bacteria 1085
1500 Ga0587073_0019577 3300059492 Bacteria 1280
1501 Ga0587083_0009472 3300059505 Bacteria 1553
1502 Ga0587088_021807 3300059508 Bacteria 1075
1503 Ga0587069_017715 3300059642 Unclassified 1034
1504 Ga0587075_004802 3300059644 Bacteria 1587
1505 Ga0587078_007937 3300059646 Bacteria 1181
1506 Ga0587102_008584 3300059649 Unclassified 975
1507 Ga0501082_0122864 3300060353 Bacteria 2251

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048915 Ga0496112_1344113 Ga0496112_1344113_101_619 166
2 3300048924 Ga0496121_0387346 Ga0496121_0387346_12_560 166
3 3300046457 Ga0495590_0261246 Ga0495590_0261246_14_580 172
4 3300048917 Ga0496114_0901673 Ga0496114_0901673_200_739 173
5 3300048927 Ga0496124_0452620 Ga0496124_0452620_323_862 173
6 3300005937 Ga0081455_10485853 Ga0081455_104858531 176
7 3300046665 Ga0495661_0028427 Ga0495661_0028427_1054_1704 176
8 3300047317 Ga0495604_0203006 Ga0495604_0203006_782_1351 176
9 3300053131 Ga0500652_153365 Ga0500652_153365_324_905 176
10 3300035092 Ga0373952_0148759 Ga0373952_0148759_43_600 179
11 3300046461 Ga0495641_0030458 Ga0495641_0030458_1977_2534 179
12 3300047315 Ga0495581_0050920 Ga0495581_0050920_40_597 179
13 3300048904 Ga0496101_1124423 Ga0496101_1124423_27_584 179
14 3300048910 Ga0496107_0859189 Ga0496107_0859189_68_625 179
15 3300053119 Ga0500595_019174 Ga0500595_019174_1047_1631 181
16 3300048915 Ga0496112_1135079 Ga0496112_1135079_11_613 182
17 3300046506 Ga0495583_0088099 Ga0495583_0088099_14_616 184
18 3300046455 Ga0495603_0018570 Ga0495603_0018570_1698_2348 185
19 3300046474 Ga0495605_0073987 Ga0495605_0073987_570_1220 185
20 3300046492 Ga0495585_0071627 Ga0495585_0071627_304_954 185
21 3300046499 Ga0495594_0067893 Ga0495594_0067893_703_1353 185
22 3300046519 Ga0495632_0001258 Ga0495632_0001258_5828_6478 185
23 3300046524 Ga0495648_0197672 Ga0495648_0197672_162_812 185
24 3300046528 Ga0495642_0002710 Ga0495642_0002710_582_1232 185
25 3300046674 Ga0495588_0051038 Ga0495588_0051038_557_1207 185
26 3300046684 Ga0495669_0003182 Ga0495669_0003182_313_963 185
27 3300046692 Ga0495671_0039422 Ga0495671_0039422_1547_2197 185
28 3300046692 Ga0495671_0047293 Ga0495671_0047293_301_933 185
29 3300013105 Ga0157369_10908157 Ga0157369_109081572 187
30 3300026067 Ga0207678_10405779 Ga0207678_104057791 187
31 3300046500 Ga0495596_0001238 Ga0495596_0001238_9320_9970 187
32 3300049770 Ga0501273_045917 Ga0501273_045917_15_593 187
33 3300035113 Ga0373936_0000491 Ga0373936_0000491_3872_4456 188
34 3300035116 Ga0373945_0015489 Ga0373945_0015489_691_1275 188
35 3300035117 Ga0373953_0111503 Ga0373953_0111503_57_641 188
36 3300035118 Ga0373954_0028954 Ga0373954_0028954_1586_2170 188
37 3300035170 Ga0373943_0005755 Ga0373943_0005755_4075_4659 188
38 3300035171 Ga0373946_0001418 Ga0373946_0001418_4125_4709 188
39 3300035172 Ga0373955_0016549 Ga0373955_0016549_2538_3122 188
40 3300035692 Ga0373935_0162401 Ga0373935_0162401_331_915 188
41 3300035695 Ga0373927_0054090 Ga0373927_0054090_1811_2395 188
42 3300035725 Ga0373947_0027374 Ga0373947_0027374_691_1275 188
43 3300037068 Ga0373925_0005021 Ga0373925_0005021_5011_5595 188
44 3300046462 Ga0495651_0004833 Ga0495651_0004833_4843_5427 188
45 3300046463 Ga0495653_0002640 Ga0495653_0002640_10333_10917 188
46 3300046472 Ga0495580_0016830 Ga0495580_0016830_3605_4189 188
47 3300046473 Ga0495582_0009972 Ga0495582_0009972_2778_3362 188
48 3300046475 Ga0495639_0119870 Ga0495639_0119870_196_780 188
49 3300046511 Ga0495608_0038408 Ga0495608_0038408_822_1406 188
50 3300046513 Ga0495616_0001306 Ga0495616_0001306_12896_13546 188
51 3300046514 Ga0495618_0082606 Ga0495618_0082606_1345_1929 188
52 3300046516 Ga0495628_0011219 Ga0495628_0011219_1810_2394 188
53 3300046517 Ga0495630_0033947 Ga0495630_0033947_2994_3578 188
54 3300046533 Ga0495640_0153690 Ga0495640_0153690_419_1003 188
55 3300046538 Ga0495609_0001506 Ga0495609_0001506_12326_12976 188
56 3300046542 Ga0495597_0014777 Ga0495597_0014777_325_975 188
57 3300046543 Ga0495645_0023470 Ga0495645_0023470_3553_4137 188
58 3300046557 Ga0495622_0053543 Ga0495622_0053543_347_931 188
59 3300046559 Ga0495667_0149953 Ga0495667_0149953_602_1186 188
60 3300046665 Ga0495661_0003143 Ga0495661_0003143_1731_2393 188
61 3300046681 Ga0495647_0006784 Ga0495647_0006784_2493_3077 188
62 3300046683 Ga0495658_0050232 Ga0495658_0050232_1652_2236 188
63 3300046689 Ga0495613_0068159 Ga0495613_0068159_201_785 188
64 3300046690 Ga0495624_0035047 Ga0495624_0035047_165_749 188
65 3300046691 Ga0495670_0028479 Ga0495670_0028479_1618_2268 188
66 3300046809 Ga0495600_0005626 Ga0495600_0005626_1867_2451 188
67 3300047315 Ga0495581_0003825 Ga0495581_0003825_2646_3230 188
68 3300047322 Ga0495680_0007685 Ga0495680_0007685_3588_4172 188
69 3300047471 Ga0495684_0000281 Ga0495684_0000281_13619_14203 188
70 3300047673 Ga0495593_0001313 Ga0495593_0001313_8646_9230 188
71 3300048088 Ga0495602_0094916 Ga0495602_0094916_1558_2142 188
72 3300048089 Ga0495614_0156119 Ga0495614_0156119_201_785 188
73 3300048912 Ga0496109_0041666 Ga0496109_0041666_936_1598 188
74 3300048916 Ga0496113_0019802 Ga0496113_0019802_853_1515 188
75 3300048925 Ga0496122_0001792 Ga0496122_0001792_5986_6648 188
76 3300048926 Ga0496123_0014236 Ga0496123_0014236_4390_5052 188
77 3300048928 Ga0496125_0001742 Ga0496125_0001742_3401_4063 188
78 3300053077 Ga0495601_0198971 Ga0495601_0198971_123_707 188
79 3300053084 Ga0495595_0004678 Ga0495595_0004678_1683_2267 188
80 3300048929 Ga0496126_0001767 Ga0496126_0001767_19998_20579 189
81 3300047446 Ga0495679_046944 Ga0495679_046944_259_909 190
82 iso_pu_bacteria 8019586578 8019588946 191
83 3300045836 Ga0466958_0135171 Ga0466958_0135171_925_1521 193
84 3300046665 Ga0495661_0304920 Ga0495661_0304920_12_659 194
85 3300046692 Ga0495671_0001997 Ga0495671_0001997_8812_9459 194
86 3300003762 Ga0055542_1000259 Ga0055542_100025964 195
87 3300003763 Ga0055529_1000301 Ga0055529_10003016 195
88 3300005843 Ga0068860_100078750 Ga0068860_1000787502 195
89 3300006844 Ga0075428_100928261 Ga0075428_1009282611 195
90 3300009098 Ga0105245_10430073 Ga0105245_104300732 195
91 3300009545 Ga0105237_11360584 Ga0105237_113605841 195
92 3300025254 Ga0209148_1000008 Ga0209148_1000008326 195
93 3300025272 Ga0209455_1000002 Ga0209455_10000021097 195
94 3300025911 Ga0207654_10067631 Ga0207654_100676312 195
95 3300025949 Ga0207667_10426550 Ga0207667_104265501 195
96 3300028381 Ga0268264_10011027 Ga0268264_100110278 195
97 3300035691 Ga0373931_0033007 Ga0373931_0033007_1759_2397 195
98 3300035724 Ga0373933_0010617 Ga0373933_0010617_770_1408 195
99 3300036401 Ga0373937_0151886 Ga0373937_0151886_509_1147 195
100 3300046507 Ga0495606_0169220 Ga0495606_0169220_378_1016 195
101 3300046679 Ga0495623_0093561 Ga0495623_0093561_706_1344 195
102 3300048088 Ga0495602_0084164 Ga0495602_0084164_904_1542 195
103 3300053083 Ga0495655_0037839 Ga0495655_0037839_320_958 195
104 3300053091 Ga0500647_0149677 Ga0500647_0149677_159_797 195
105 iso_pu_bacteria 2508501009 2508543752 195
106 iso_pu_bacteria 2513237095 2513646201 195
107 iso_pu_bacteria 2517093001 2517103568 195
108 iso_pu_bacteria 2816332527 2818241460 195
109 iso_pu_bacteria 2888378607 2888382864 195
110 3300005548 Ga0070665_100062792 Ga0070665_1000627922 196
111 3300025920 Ga0207649_10782545 Ga0207649_107825451 196
112 3300037418 Ga0395900_0722649 Ga0395900_0722649_61_708 196
113 3300037471 Ga0395905_0020632 Ga0395905_0020632_5310_5957 196
114 3300038443 Ga0395901_0897009 Ga0395901_0897009_109_756 196
115 3300053730 Ga0500645_002123 Ga0500645_002123_6720_7367 196
116 iso_pu_bacteria 2528768022 2528854160 196
117 iso_pu_bacteria 2593339239 2595452292 196
118 iso_pu_bacteria 2841957949 2841962286 196
119 iso_pu_bacteria 2874612657 2874615605 196
120 iso_pu_bacteria 2881665667 2881672880 196
121 iso_pu_bacteria 2885409591 2885413019 196
122 iso_pu_bacteria 2922368715 2922373068 196
123 iso_pu_bacteria 2929615660 2929615865 196
124 iso_pu_bacteria 2929624759 2929630478 196
125 iso_pu_bacteria 2932818245 2932819495 196
126 iso_pu_bacteria 2932828146 2932833797 196
127 iso_pu_bacteria 2933577622 2933578849 196
128 iso_pu_bacteria 2935638405 2935644484 196
129 iso_pu_bacteria 2935665750 2935673625 196
130 iso_pu_bacteria 2935675223 2935678519 196
131 iso_pu_bacteria 2935684952 2935687984 196
132 iso_pu_bacteria 2935694250 2935701404 196
133 iso_pu_bacteria 2935703347 2935708341 196
134 iso_pu_bacteria 2935713505 2935715004 196
135 iso_pu_bacteria 2935722832 2935726431 196
136 iso_pu_bacteria 2935732158 2935733822 196
137 iso_pu_bacteria 2935741537 2935743201 196
138 iso_pu_bacteria 2935750917 2935754760 196
139 iso_pu_bacteria 2935760218 2935765467 196
140 iso_pu_bacteria 2935801545 2935805421 196
141 iso_pu_bacteria 2935810662 2935816714 196
142 iso_pu_bacteria 2935827899 2935833767 196
143 iso_pu_bacteria 2935837841 2935839547 196
144 iso_pu_bacteria 2935864058 2935871134 196
145 iso_pu_bacteria 2935873716 2935876363 196
146 iso_pu_bacteria 2936002035 2936007186 196
147 iso_pu_bacteria 2936037263 2936043024 196
148 iso_pu_bacteria 2940556831 2940559863 196
149 iso_pu_bacteria 2941538514 2941540236 196
150 iso_pu_bacteria 3005710791 3005713791 196
151 iso_pu_bacteria 3005718088 3005721302 196
152 iso_pu_bacteria 8016511872 8016514638 196
153 iso_pu_bacteria 8017057580 8017061794 196
154 iso_pu_bacteria 8019576017 8019581320 196
155 iso_pu_bacteria 8019597564 8019602290 196
156 iso_pu_bacteria 8019608314 8019616275 196
157 iso_pu_bacteria 8055742211 8055747512 196
158 3300005353 Ga0070669_100075053 Ga0070669_1000750533 197
159 3300005548 Ga0070665_100030847 Ga0070665_1000308476 197
160 3300005844 Ga0068862_100207101 Ga0068862_1002071012 197
161 3300025941 Ga0207711_10270824 Ga0207711_102708242 197
162 3300026088 Ga0207641_10289186 Ga0207641_102891861 197
163 3300028379 Ga0268266_10159519 Ga0268266_101595192 197
164 3300028786 Ga0307517_10109798 Ga0307517_101097982 197
165 3300046660 Ga0495625_0193286 Ga0495625_0193286_337_981 197
166 3300048915 Ga0496112_0278955 Ga0496112_0278955_16_624 197
167 3300048920 Ga0496117_0002744 Ga0496117_0002744_14918_15562 197
168 3300048921 Ga0496118_0000310 Ga0496118_0000310_34196_34840 197
169 3300048927 Ga0496124_0066695 Ga0496124_0066695_343_987 197
170 3300005347 Ga0070668_100148558 Ga0070668_1001485582 198
171 3300005548 Ga0070665_100085245 Ga0070665_1000852453 198
172 3300005937 Ga0081455_10051635 Ga0081455_100516353 198
173 3300006353 Ga0075370_10001045 Ga0075370_100010452 198
174 3300009177 Ga0105248_10013662 Ga0105248_100136627 198
175 3300014325 Ga0163163_10027834 Ga0163163_100278349 198
176 3300025904 Ga0207647_10004155 Ga0207647_1000415510 198
177 3300025941 Ga0207711_10140262 Ga0207711_101402622 198
178 3300028379 Ga0268266_10335776 Ga0268266_103357762 198
179 3300028379 Ga0268266_10870016 Ga0268266_108700161 198
180 3300037312 Ga0395899_0581796 Ga0395899_0581796_35_679 198
181 3300037418 Ga0395900_0038144 Ga0395900_0038144_4297_4941 198
182 3300037466 Ga0395898_0049078 Ga0395898_0049078_518_1162 198
183 3300046512 Ga0495610_0047980 Ga0495610_0047980_495_1142 198
184 3300046522 Ga0495643_0004691 Ga0495643_0004691_8603_9250 198
185 3300048905 Ga0496102_0455868 Ga0496102_0455868_238_885 198
186 3300048906 Ga0496103_0004533 Ga0496103_0004533_6375_7022 198
187 3300048907 Ga0496104_0033359 Ga0496104_0033359_4074_4721 198
188 3300048911 Ga0496108_0081438 Ga0496108_0081438_1878_2525 198
189 3300050489 nmdc:mga03683_51024_c1 nmdc:mga03683_51024_c1_342_989 198
190 3300050493 nmdc:mga0k408_19877_c1 nmdc:mga0k408_19877_c1_3100_3747 198
191 3300050494 nmdc:mga06z11_4701_c1 nmdc:mga06z11_4701_c1_971_1618 198
192 3300050496 nmdc:mga07m45_78673_c1 nmdc:mga07m45_78673_c1_18_665 198
193 3300003354 JGI25160J50197_1003242 JGI25160J50197_10032423 199
194 3300005335 Ga0070666_10119990 Ga0070666_101199902 199
195 3300005347 Ga0070668_100075030 Ga0070668_1000750304 199
196 3300005548 Ga0070665_100013567 Ga0070665_1000135675 199
197 3300005616 Ga0068852_100118880 Ga0068852_1001188805 199
198 3300006051 Ga0075364_10225774 Ga0075364_102257742 199
199 3300006178 Ga0075367_10108995 Ga0075367_101089953 199
200 3300006178 Ga0075367_10373972 Ga0075367_103739721 199
201 3300006871 Ga0075434_100556074 Ga0075434_1005560742 199
202 3300006914 Ga0075436_100288870 Ga0075436_1002888702 199
203 3300006942 Ga0099824_1003668 Ga0099824_10036686 199
204 3300007076 Ga0075435_100210108 Ga0075435_1002101082 199
205 3300009093 Ga0105240_10917545 Ga0105240_109175452 199
206 3300009174 Ga0105241_10421190 Ga0105241_104211901 199
207 3300009176 Ga0105242_10843745 Ga0105242_108437452 199
208 3300009177 Ga0105248_10142284 Ga0105248_101422842 199
209 3300009545 Ga0105237_10197340 Ga0105237_101973404 199
210 3300010375 Ga0105239_10090521 Ga0105239_100905212 199
211 3300010375 Ga0105239_10102935 Ga0105239_101029355 199
212 3300010375 Ga0105239_10191558 Ga0105239_101915583 199
213 3300010375 Ga0105239_10459495 Ga0105239_104594952 199
214 3300013307 Ga0157372_10678293 Ga0157372_106782931 199
215 3300025254 Ga0209148_1000679 Ga0209148_10006792 199
216 3300025258 Ga0209129_1003004 Ga0209129_10030042 199
217 3300025261 Ga0209233_1021842 Ga0209233_10218423 199
218 3300025272 Ga0209455_1004877 Ga0209455_10048772 199
219 3300025295 Ga0209564_1019029 Ga0209564_10190293 199
220 3300025297 Ga0209758_1018751 Ga0209758_10187512 199
221 3300025299 Ga0209256_1003652 Ga0209256_100365211 199
222 3300025302 Ga0207426_1000605 Ga0207426_100060534 199
223 3300025913 Ga0207695_10000599 Ga0207695_1000059944 199
224 3300025914 Ga0207671_10010694 Ga0207671_100106949 199
225 3300025972 Ga0207668_10001751 Ga0207668_1000175113 199
226 3300026116 Ga0207674_10121166 Ga0207674_101211663 199
227 3300027296 Ga0209389_1000426 Ga0209389_10004269 199
228 3300027357 Ga0209589_1000300 Ga0209589_100030065 199
229 3300027361 Ga0209489_103118 Ga0209489_10311813 199
230 3300033180 Ga0307510_10032122 Ga0307510_100321225 199
231 3300033180 Ga0307510_10133109 Ga0307510_101331092 199
232 3300033180 Ga0307510_10425955 Ga0307510_104259551 199
233 3300035170 Ga0373943_0184572 Ga0373943_0184572_511_1131 199
234 3300039437 Ga0436365_0472919 Ga0436365_0472919_528_1187 199
235 3300044658 Ga0466972_0020772 Ga0466972_0020772_1237_1890 199
236 3300044735 Ga0466968_0161081 Ga0466968_0161081_300_953 199
237 3300044901 Ga0466960_0015132 Ga0466960_0015132_2086_2739 199
238 3300046474 Ga0495605_0120283 Ga0495605_0120283_113_754 199
239 3300046501 Ga0495607_0191366 Ga0495607_0191366_116_772 199
240 3300046506 Ga0495583_0145193 Ga0495583_0145193_171_824 199
241 3300046507 Ga0495606_0006099 Ga0495606_0006099_6317_6958 199
242 3300046516 Ga0495628_0292709 Ga0495628_0292709_175_816 199
243 3300046524 Ga0495648_0038570 Ga0495648_0038570_1077_1718 199
244 3300046616 Ga0495668_0052550 Ga0495668_0052550_1550_2206 199
245 3300046692 Ga0495671_0111085 Ga0495671_0111085_561_1217 199
246 3300047469 Ga0495673_0141328 Ga0495673_0141328_110_766 199
247 3300047472 Ga0495686_0005263 Ga0495686_0005263_3701_4363 199
248 3300047472 Ga0495686_0039294 Ga0495686_0039294_1294_1938 199
249 3300047472 Ga0495686_0042501 Ga0495686_0042501_1567_2208 199
250 3300048909 Ga0496106_0342895 Ga0496106_0342895_58_714 199
251 3300048913 Ga0496110_0083643 Ga0496110_0083643_1726_2382 199
252 3300048920 Ga0496117_0102606 Ga0496117_0102606_322_972 199
253 3300048923 Ga0496120_0181026 Ga0496120_0181026_167_823 199
254 3300048924 Ga0496121_0013415 Ga0496121_0013415_4205_4858 199
255 3300048924 Ga0496121_0073508 Ga0496121_0073508_1499_2152 199
256 3300048924 Ga0496121_0111517 Ga0496121_0111517_476_1132 199
257 3300048924 Ga0496121_0286601 Ga0496121_0286601_373_1017 199
258 3300048929 Ga0496126_0090862 Ga0496126_0090862_557_1195 199
259 3300048929 Ga0496126_0590977 Ga0496126_0590977_168_809 199
260 3300049460 Ga0495682_0028690 Ga0495682_0028690_1150_1791 199
261 3300050512 nmdc:mga0n895_269347_c1 nmdc:mga0n895_269347_c1_887_1546 199
262 3300050513 nmdc:mga0rr50_140867_c1 nmdc:mga0rr50_140867_c1_534_1193 199
263 3300050514 nmdc:mga08x19_254934_c1 nmdc:mga08x19_254934_c1_437_1096 199
264 3300053087 Ga0500643_000227 Ga0500643_000227_6389_7042 199
265 3300053092 Ga0500583_0023188 Ga0500583_0023188_1338_1991 199
266 3300053094 Ga0500566_0026827 Ga0500566_0026827_2267_2920 199
267 3300053103 Ga0500555_011188 Ga0500555_011188_1468_2121 199
268 3300053104 Ga0500556_0002622 Ga0500556_0002622_3669_4322 199
269 3300053108 Ga0500562_015431 Ga0500562_015431_1013_1666 199
270 3300053130 Ga0500642_0001183 Ga0500642_0001183_4803_5456 199
271 3300053139 Ga0500568_0014816 Ga0500568_0014816_1022_1675 199
272 3300053156 Ga0500622_0015922 Ga0500622_0015922_2353_3006 199
273 3300053730 Ga0500645_003470 Ga0500645_003470_4737_5399 199
274 3300053736 Ga0500599_002879 Ga0500599_002879_734_1387 199
275 3300046500 Ga0495596_0030837 Ga0495596_0030837_1100_1750 200
276 3300046616 Ga0495668_0035639 Ga0495668_0035639_1250_1918 200
277 3300047472 Ga0495686_0002128 Ga0495686_0002128_12203_12853 200
278 3300049460 Ga0495682_0009174 Ga0495682_0009174_2245_2895 200
279 3300049665 Ga0501227_024578 Ga0501227_024578_316_933 200
280 3300013104 Ga0157370_10084749 Ga0157370_100847492 201
281 3300049652 Ga0501202_097402 Ga0501202_097402_16_639 201
282 iso_pu_bacteria 2740892503 2743738618 201
283 iso_pu_bacteria 2923153595 2923157682 201
284 3300014325 Ga0163163_11628904 Ga0163163_116289041 203
285 3300028800 Ga0265338_10002138 Ga0265338_1000213824 203
286 3300005336 Ga0070680_100440531 Ga0070680_1004405311 204
287 3300005434 Ga0070709_10209601 Ga0070709_102096012 204
288 3300005539 Ga0068853_100493909 Ga0068853_1004939092 204
289 3300005563 Ga0068855_100197792 Ga0068855_1001977923 204
290 3300006175 Ga0070712_100747182 Ga0070712_1007471822 204
291 3300013100 Ga0157373_10491008 Ga0157373_104910081 204
292 3300025906 Ga0207699_10078513 Ga0207699_100785132 204
293 3300025921 Ga0207652_10576487 Ga0207652_105764872 204
294 3300026041 Ga0207639_10112611 Ga0207639_101126112 204
295 3300028558 Ga0265326_10033422 Ga0265326_100334222 204
296 3300028573 Ga0265334_10038247 Ga0265334_100382472 204
297 3300028800 Ga0265338_10056488 Ga0265338_100564882 204
298 3300028800 Ga0265338_10151404 Ga0265338_101514042 204
299 3300031249 Ga0265339_10278955 Ga0265339_102789551 204
300 3300031251 Ga0265327_10153164 Ga0265327_101531642 204
301 3300031711 Ga0265314_10051702 Ga0265314_100517023 204
302 3300009098 Ga0105245_10116510 Ga0105245_101165102 205
303 3300013308 Ga0157375_10928900 Ga0157375_109289002 205
304 3300028800 Ga0265338_10023678 Ga0265338_100236782 205
305 3300031247 Ga0265340_10013717 Ga0265340_100137174 205
306 3300031711 Ga0265314_10013871 Ga0265314_100138714 205
307 3300031711 Ga0265314_10127827 Ga0265314_101278271 205
308 3300046507 Ga0495606_0001390 Ga0495606_0001390_30178_30831 205
309 3300053111 Ga0500572_001044 Ga0500572_001044_699_1334 205
310 3300005339 Ga0070660_100332835 Ga0070660_1003328351 206
311 3300005347 Ga0070668_100784130 Ga0070668_1007841301 206
312 3300005364 Ga0070673_100098251 Ga0070673_1000982515 206
313 3300005444 Ga0070694_100287236 Ga0070694_1002872362 206
314 3300005459 Ga0068867_100187833 Ga0068867_1001878332 206
315 3300005518 Ga0070699_100073414 Ga0070699_1000734143 206
316 3300005548 Ga0070665_100115850 Ga0070665_1001158503 206
317 3300005617 Ga0068859_100464364 Ga0068859_1004643642 206
318 3300005981 Ga0081538_10150992 Ga0081538_101509921 206
319 3300005985 Ga0081539_10005457 Ga0081539_1000545714 206
320 3300006038 Ga0075365_10146968 Ga0075365_101469682 206
321 3300006173 Ga0070716_100368797 Ga0070716_1003687972 206
322 3300006178 Ga0075367_10206222 Ga0075367_102062223 206
323 3300006178 Ga0075367_10244123 Ga0075367_102441231 206
324 3300006186 Ga0075369_10000236 Ga0075369_1000023616 206
325 3300006931 Ga0097620_100464361 Ga0097620_1004643612 206
326 3300009147 Ga0114129_10393260 Ga0114129_103932602 206
327 3300009176 Ga0105242_10049125 Ga0105242_100491253 206
328 3300013306 Ga0163162_10030779 Ga0163162_100307794 206
329 3300013308 Ga0157375_10375984 Ga0157375_103759842 206
330 3300025304 Ga0209257_1001468 Ga0209257_100146821 206
331 3300025960 Ga0207651_10082465 Ga0207651_100824653 206
332 3300025972 Ga0207668_10383036 Ga0207668_103830362 206
333 3300026041 Ga0207639_10933217 Ga0207639_109332171 206
334 3300026089 Ga0207648_10122691 Ga0207648_101226912 206
335 3300026089 Ga0207648_10511549 Ga0207648_105115492 206
336 3300026118 Ga0207675_100145719 Ga0207675_1001457193 206
337 3300028794 Ga0307515_10355380 Ga0307515_103553802 206
338 3300031241 Ga0265325_10266619 Ga0265325_102666191 206
339 3300031249 Ga0265339_10071070 Ga0265339_100710702 206
340 3300031731 Ga0307405_10499302 Ga0307405_104993021 206
341 3300039438 Ga0436360_0317454 Ga0436360_0317454_607_1239 206
342 3300046519 Ga0495632_0000630 Ga0495632_0000630_30369_31004 206
343 3300046665 Ga0495661_0060085 Ga0495661_0060085_71_706 206
344 3300046694 Ga0495649_0202776 Ga0495649_0202776_306_938 206
345 3300046810 Ga0495660_0069713 Ga0495660_0069713_1019_1651 206
346 3300050489 nmdc:mga03683_27168_c2 nmdc:mga03683_27168_c2_25_669 206
347 3300050489 nmdc:mga03683_7353_c1 nmdc:mga03683_7353_c1_70_714 206
348 3300050491 nmdc:mga00v17_287507_c1 nmdc:mga00v17_287507_c1_43_687 206
349 3300050492 nmdc:mga0yw44_156397_c1 nmdc:mga0yw44_156397_c1_28_672 206
350 3300050492 nmdc:mga0yw44_64770_c1 nmdc:mga0yw44_64770_c1_1322_1981 206
351 3300050493 nmdc:mga0k408_62569_c1 nmdc:mga0k408_62569_c1_673_1317 206
352 3300050494 nmdc:mga06z11_31919_c1 nmdc:mga06z11_31919_c1_1892_2536 206
353 3300050507 nmdc:mga05p37_1109595_c1 nmdc:mga05p37_1109595_c1_166_807 206
354 3300050516 nmdc:mga0sz30_129_c1 nmdc:mga0sz30_129_c1_20741_21385 206
355 iso_pu_bacteria 2643221554 2643787694 206
356 iso_pu_bacteria 2643221638 2644213427 206
357 iso_pu_bacteria 2738543031 2739349520 206
358 3300005330 Ga0070690_100012733 Ga0070690_1000127333 207
359 3300005333 Ga0070677_10007797 Ga0070677_100077974 207
360 3300005334 Ga0068869_100007668 Ga0068869_1000076682 207
361 3300005335 Ga0070666_10000196 Ga0070666_1000019620 207
362 3300005335 Ga0070666_10052945 Ga0070666_100529452 207
363 3300005343 Ga0070687_100005115 Ga0070687_1000051156 207
364 3300005347 Ga0070668_100005824 Ga0070668_1000058247 207
365 3300005353 Ga0070669_100026972 Ga0070669_1000269724 207
366 3300005354 Ga0070675_100147726 Ga0070675_1001477261 207
367 3300005356 Ga0070674_100226683 Ga0070674_1002266832 207
368 3300005367 Ga0070667_100019815 Ga0070667_1000198153 207
369 3300005367 Ga0070667_100248731 Ga0070667_1002487312 207
370 3300005456 Ga0070678_100072043 Ga0070678_1000720433 207
371 3300005457 Ga0070662_100028581 Ga0070662_1000285814 207
372 3300005459 Ga0068867_100022131 Ga0068867_1000221313 207
373 3300005544 Ga0070686_100037730 Ga0070686_1000377303 207
374 3300005548 Ga0070665_100244774 Ga0070665_1002447743 207
375 3300005563 Ga0068855_100011835 Ga0068855_10001183514 207
376 3300005578 Ga0068854_100430288 Ga0068854_1004302882 207
377 3300005616 Ga0068852_100015306 Ga0068852_1000153065 207
378 3300005617 Ga0068859_100016479 Ga0068859_1000164794 207
379 3300005718 Ga0068866_10015407 Ga0068866_100154073 207
380 3300005719 Ga0068861_100002452 Ga0068861_1000024522 207
381 3300005841 Ga0068863_100021525 Ga0068863_1000215253 207
382 3300005842 Ga0068858_100066973 Ga0068858_1000669732 207
383 3300005843 Ga0068860_100002668 Ga0068860_1000026684 207
384 3300005844 Ga0068862_100018296 Ga0068862_1000182962 207
385 3300006237 Ga0097621_100639868 Ga0097621_1006398682 207
386 3300006881 Ga0068865_100006131 Ga0068865_1000061315 207
387 3300006931 Ga0097620_100016480 Ga0097620_1000164804 207
388 3300009094 Ga0111539_10360807 Ga0111539_103608072 207
389 3300009101 Ga0105247_10505368 Ga0105247_105053681 207
390 3300009148 Ga0105243_10020682 Ga0105243_100206823 207
391 3300009176 Ga0105242_10417951 Ga0105242_104179512 207
392 3300009177 Ga0105248_10019614 Ga0105248_100196147 207
393 3300009553 Ga0105249_10020072 Ga0105249_100200724 207
394 3300013306 Ga0163162_10007600 Ga0163162_100076005 207
395 3300013308 Ga0157375_10253979 Ga0157375_102539792 207
396 3300014326 Ga0157380_10003434 Ga0157380_100034349 207
397 3300014968 Ga0157379_10021966 Ga0157379_100219666 207
398 3300017792 Ga0163161_10062357 Ga0163161_100623572 207
399 3300025321 Ga0207656_10211842 Ga0207656_102118422 207
400 3300025893 Ga0207682_10016087 Ga0207682_100160872 207
401 3300025899 Ga0207642_10000675 Ga0207642_100006753 207
402 3300025901 Ga0207688_10085498 Ga0207688_100854982 207
403 3300025903 Ga0207680_10001529 Ga0207680_1000152910 207
404 3300025903 Ga0207680_10029047 Ga0207680_100290472 207
405 3300025907 Ga0207645_10014806 Ga0207645_100148064 207
406 3300025918 Ga0207662_10001362 Ga0207662_100013627 207
407 3300025923 Ga0207681_10057274 Ga0207681_100572743 207
408 3300025926 Ga0207659_10042610 Ga0207659_100426103 207
409 3300025933 Ga0207706_10008066 Ga0207706_100080669 207
410 3300025934 Ga0207686_10020069 Ga0207686_100200692 207
411 3300025935 Ga0207709_10009799 Ga0207709_100097994 207
412 3300025937 Ga0207669_10305198 Ga0207669_103051982 207
413 3300025938 Ga0207704_10119236 Ga0207704_101192362 207
414 3300025940 Ga0207691_10011482 Ga0207691_100114826 207
415 3300025941 Ga0207711_10086510 Ga0207711_100865101 207
416 3300025942 Ga0207689_10007160 Ga0207689_100071606 207
417 3300025949 Ga0207667_10187208 Ga0207667_101872082 207
418 3300025961 Ga0207712_10018558 Ga0207712_100185582 207
419 3300025981 Ga0207640_10073643 Ga0207640_100736432 207
420 3300025986 Ga0207658_10002521 Ga0207658_100025216 207
421 3300025986 Ga0207658_10287675 Ga0207658_102876752 207
422 3300026035 Ga0207703_10002053 Ga0207703_1000205311 207
423 3300026067 Ga0207678_10102814 Ga0207678_101028142 207
424 3300026075 Ga0207708_10038576 Ga0207708_100385762 207
425 3300026088 Ga0207641_10014357 Ga0207641_100143575 207
426 3300026089 Ga0207648_10007760 Ga0207648_100077607 207
427 3300026118 Ga0207675_100005938 Ga0207675_1000059383 207
428 3300026121 Ga0207683_10142616 Ga0207683_101426162 207
429 3300028379 Ga0268266_11014746 Ga0268266_110147462 207
430 3300028380 Ga0268265_10023062 Ga0268265_100230622 207
431 3300028381 Ga0268264_10007029 Ga0268264_100070293 207
432 3300047472 Ga0495686_0002080 Ga0495686_0002080_18851_19492 207
433 iso_pu_bacteria 2643221556 2643797148 207
434 iso_pu_bacteria 2643221684 2644469748 207
435 iso_pu_bacteria 2808606418 2809147450 207
436 iso_pu_bacteria 8047673197 8047676565 207
437 3300003215 JGI25153J46596_10022824 JGI25153J46596_100228242 208
438 3300003791 Ga0055530_10000014 Ga0055530_10000014128 208
439 3300003794 Ga0055531_10002273 Ga0055531_100022736 208
440 3300004625 Ga0055543_1009496 Ga0055543_10094962 208
441 3300005262 Ga0065165_1001235 Ga0065165_100123524 208
442 3300005436 Ga0070713_100192460 Ga0070713_1001924603 208
443 3300005439 Ga0070711_100025261 Ga0070711_1000252614 208
444 3300005458 Ga0070681_10058010 Ga0070681_100580103 208
445 3300005530 Ga0070679_100060334 Ga0070679_1000603346 208
446 3300005842 Ga0068858_100150704 Ga0068858_1001507042 208
447 3300006175 Ga0070712_100001311 Ga0070712_1000013119 208
448 3300006175 Ga0070712_100468550 Ga0070712_1004685502 208
449 3300010375 Ga0105239_10082759 Ga0105239_100827594 208
450 3300014968 Ga0157379_10173665 Ga0157379_101736652 208
451 3300025250 Ga0209026_1000869 Ga0209026_10008693 208
452 3300025297 Ga0209758_1000817 Ga0209758_100081719 208
453 3300025298 Ga0209050_1000034 Ga0209050_100003419 208
454 3300025304 Ga0209257_1000052 Ga0209257_1000052391 208
455 3300025912 Ga0207707_10046010 Ga0207707_100460103 208
456 3300025915 Ga0207693_10001905 Ga0207693_1000190512 208
457 3300025916 Ga0207663_10003699 Ga0207663_100036992 208
458 3300025916 Ga0207663_10015732 Ga0207663_100157322 208
459 3300025917 Ga0207660_10382347 Ga0207660_103823471 208
460 3300025928 Ga0207700_10099107 Ga0207700_100991073 208
461 3300025939 Ga0207665_10137420 Ga0207665_101374202 208
462 3300026035 Ga0207703_10131806 Ga0207703_101318062 208
463 3300031616 Ga0307508_10212462 Ga0307508_102124623 208
464 3300032004 Ga0307414_10182115 Ga0307414_101821152 208
465 3300035692 Ga0373935_0722558 Ga0373935_0722558_42_689 208
466 3300035695 Ga0373927_0299613 Ga0373927_0299613_88_735 208
467 3300036401 Ga0373937_0000389 Ga0373937_0000389_16706_17353 208
468 3300037068 Ga0373925_0084626 Ga0373925_0084626_1002_1649 208
469 3300037471 Ga0395905_0001336 Ga0395905_0001336_2271_2915 208
470 3300037471 Ga0395905_0072599 Ga0395905_0072599_1900_2544 208
471 3300044673 Ga0453683_0034774 Ga0453683_0034774_1992_2666 208
472 3300049568 Ga0501031_0023956 Ga0501031_0023956_2752_3396 208
473 3300049575 Ga0501039_0268678 Ga0501039_0268678_458_1102 208
474 3300049655 Ga0501208_070808 Ga0501208_070808_11_658 208
475 3300050513 nmdc:mga0rr50_264323_c1 nmdc:mga0rr50_264323_c1_38_712 208
476 3300050514 nmdc:mga08x19_25294_c1 nmdc:mga08x19_25294_c1_1924_2598 208
477 3300053130 Ga0500642_0029411 Ga0500642_0029411_1295_2104 208
478 iso_pu_bacteria 2643221598 2644001612 208
479 iso_pu_bacteria 2643221614 2644087962 208
480 iso_pu_bacteria 2643221661 2644344151 208
481 iso_pu_bacteria 2643221666 2644367319 208
482 3300005327 Ga0070658_10292272 Ga0070658_102922722 209
483 3300005328 Ga0070676_10017143 Ga0070676_100171432 209
484 3300005328 Ga0070676_10227973 Ga0070676_102279731 209
485 3300005329 Ga0070683_100317267 Ga0070683_1003172671 209
486 3300005330 Ga0070690_100000298 Ga0070690_1000002986 209
487 3300005331 Ga0070670_100014734 Ga0070670_1000147345 209
488 3300005333 Ga0070677_10097807 Ga0070677_100978071 209
489 3300005334 Ga0068869_100075282 Ga0068869_1000752822 209
490 3300005336 Ga0070680_100064110 Ga0070680_1000641102 209
491 3300005338 Ga0068868_100188050 Ga0068868_1001880502 209
492 3300005339 Ga0070660_100278976 Ga0070660_1002789761 209
493 3300005340 Ga0070689_100007863 Ga0070689_1000078632 209
494 3300005344 Ga0070661_100021956 Ga0070661_1000219562 209
495 3300005345 Ga0070692_10099904 Ga0070692_100999042 209
496 3300005347 Ga0070668_100021704 Ga0070668_1000217042 209
497 3300005347 Ga0070668_100272513 Ga0070668_1002725131 209
498 3300005353 Ga0070669_100012677 Ga0070669_1000126772 209
499 3300005354 Ga0070675_100005341 Ga0070675_1000053412 209
500 3300005356 Ga0070674_100194988 Ga0070674_1001949881 209
501 3300005364 Ga0070673_100005641 Ga0070673_1000056416 209
502 3300005365 Ga0070688_100181298 Ga0070688_1001812981 209
503 3300005367 Ga0070667_100000339 Ga0070667_10000033957 209
504 3300005438 Ga0070701_10024694 Ga0070701_100246942 209
505 3300005441 Ga0070700_100013505 Ga0070700_1000135054 209
506 3300005441 Ga0070700_100025680 Ga0070700_1000256802 209
507 3300005444 Ga0070694_100195481 Ga0070694_1001954811 209
508 3300005455 Ga0070663_100626470 Ga0070663_1006264701 209
509 3300005457 Ga0070662_100005499 Ga0070662_1000054992 209
510 3300005457 Ga0070662_100110129 Ga0070662_1001101292 209
511 3300005459 Ga0068867_100184296 Ga0068867_1001842962 209
512 3300005535 Ga0070684_100012342 Ga0070684_1000123423 209
513 3300005544 Ga0070686_100014196 Ga0070686_1000141962 209
514 3300005547 Ga0070693_100571827 Ga0070693_1005718271 209
515 3300005548 Ga0070665_100002853 Ga0070665_10000285316 209
516 3300005548 Ga0070665_100088444 Ga0070665_1000884442 209
517 3300005564 Ga0070664_100007800 Ga0070664_1000078007 209
518 3300005564 Ga0070664_100026928 Ga0070664_1000269284 209
519 3300005577 Ga0068857_100060721 Ga0068857_1000607213 209
520 3300005577 Ga0068857_100086184 Ga0068857_1000861842 209
521 3300005615 Ga0070702_100001979 Ga0070702_1000019792 209
522 3300005616 Ga0068852_101022863 Ga0068852_1010228631 209
523 3300005617 Ga0068859_100016319 Ga0068859_1000163197 209
524 3300005617 Ga0068859_100108306 Ga0068859_1001083063 209
525 3300005618 Ga0068864_100064311 Ga0068864_1000643112 209
526 3300005718 Ga0068866_10034856 Ga0068866_100348563 209
527 3300005719 Ga0068861_100000359 Ga0068861_10000035916 209
528 3300005719 Ga0068861_100008723 Ga0068861_1000087231 209
529 3300005719 Ga0068861_100138790 Ga0068861_1001387902 209
530 3300005840 Ga0068870_10010010 Ga0068870_100100102 209
531 3300005840 Ga0068870_10126011 Ga0068870_101260111 209
532 3300005841 Ga0068863_100001989 Ga0068863_10000198922 209
533 3300005841 Ga0068863_100073420 Ga0068863_1000734202 209
534 3300005842 Ga0068858_100012616 Ga0068858_1000126162 209
535 3300005842 Ga0068858_100481157 Ga0068858_1004811571 209
536 3300005843 Ga0068860_100000442 Ga0068860_10000044257 209
537 3300005843 Ga0068860_100066643 Ga0068860_1000666432 209
538 3300005844 Ga0068862_100002494 Ga0068862_10000249411 209
539 3300005844 Ga0068862_100039585 Ga0068862_1000395852 209
540 3300005844 Ga0068862_100502817 Ga0068862_1005028171 209
541 3300006237 Ga0097621_100043138 Ga0097621_1000431383 209
542 3300006358 Ga0068871_100067158 Ga0068871_1000671581 209
543 3300006844 Ga0075428_100017061 Ga0075428_1000170613 209
544 3300006844 Ga0075428_100017741 Ga0075428_1000177417 209
545 3300006844 Ga0075428_100019319 Ga0075428_1000193198 209
546 3300006844 Ga0075428_100110271 Ga0075428_1001102712 209
547 3300006846 Ga0075430_100007836 Ga0075430_1000078362 209
548 3300006846 Ga0075430_100093220 Ga0075430_1000932202 209
549 3300006847 Ga0075431_100000532 Ga0075431_10000053210 209
550 3300006847 Ga0075431_100010534 Ga0075431_1000105342 209
551 3300006847 Ga0075431_100059241 Ga0075431_1000592412 209
552 3300006847 Ga0075431_100167609 Ga0075431_1001676092 209
553 3300006880 Ga0075429_100001302 Ga0075429_10000130211 209
554 3300006880 Ga0075429_100096629 Ga0075429_1000966291 209
555 3300006880 Ga0075429_100170153 Ga0075429_1001701532 209
556 3300006931 Ga0097620_100016320 Ga0097620_1000163207 209
557 3300006931 Ga0097620_100108305 Ga0097620_1001083052 209
558 3300007265 Ga0099794_10007808 Ga0099794_100078087 209
559 3300007788 Ga0099795_10069426 Ga0099795_100694261 209
560 3300009093 Ga0105240_10350255 Ga0105240_103502552 209
561 3300009094 Ga0111539_10011743 Ga0111539_100117432 209
562 3300009094 Ga0111539_10048851 Ga0111539_100488514 209
563 3300009098 Ga0105245_10626417 Ga0105245_106264172 209
564 3300009147 Ga0114129_10007990 Ga0114129_100079909 209
565 3300009147 Ga0114129_10011196 Ga0114129_100111967 209
566 3300009148 Ga0105243_10034109 Ga0105243_100341093 209
567 3300009148 Ga0105243_10250137 Ga0105243_102501372 209
568 3300009177 Ga0105248_10040678 Ga0105248_100406783 209
569 3300009553 Ga0105249_10004304 Ga0105249_100043045 209
570 3300009553 Ga0105249_10107956 Ga0105249_101079562 209
571 3300010159 Ga0099796_10126600 Ga0099796_101266001 209
572 3300010375 Ga0105239_10274241 Ga0105239_102742412 209
573 3300011119 Ga0105246_10115719 Ga0105246_101157191 209
574 3300013105 Ga0157369_10488690 Ga0157369_104886901 209
575 3300014325 Ga0163163_10002591 Ga0163163_100025913 209
576 3300014745 Ga0157377_10007054 Ga0157377_100070544 209
577 3300014968 Ga0157379_10077208 Ga0157379_100772082 209
578 3300025893 Ga0207682_10093633 Ga0207682_100936332 209
579 3300025908 Ga0207643_10027270 Ga0207643_100272701 209
580 3300025908 Ga0207643_10099159 Ga0207643_100991592 209
581 3300025913 Ga0207695_10058269 Ga0207695_100582696 209
582 3300025917 Ga0207660_10227859 Ga0207660_102278592 209
583 3300025919 Ga0207657_10306745 Ga0207657_103067451 209
584 3300025920 Ga0207649_10013851 Ga0207649_100138513 209
585 3300025923 Ga0207681_10006184 Ga0207681_100061844 209
586 3300025923 Ga0207681_10112897 Ga0207681_101128972 209
587 3300025925 Ga0207650_10066274 Ga0207650_100662742 209
588 3300025925 Ga0207650_10170910 Ga0207650_101709101 209
589 3300025926 Ga0207659_10009908 Ga0207659_100099084 209
590 3300025931 Ga0207644_10055751 Ga0207644_100557511 209
591 3300025932 Ga0207690_10146604 Ga0207690_101466042 209
592 3300025933 Ga0207706_10011598 Ga0207706_100115983 209
593 3300025933 Ga0207706_10018174 Ga0207706_100181743 209
594 3300025936 Ga0207670_10126835 Ga0207670_101268352 209
595 3300025937 Ga0207669_10158550 Ga0207669_101585501 209
596 3300025940 Ga0207691_10112703 Ga0207691_101127032 209
597 3300025941 Ga0207711_10088261 Ga0207711_100882612 209
598 3300025942 Ga0207689_10050945 Ga0207689_100509452 209
599 3300025944 Ga0207661_10413098 Ga0207661_104130982 209
600 3300025945 Ga0207679_10060680 Ga0207679_100606802 209
601 3300025945 Ga0207679_10167151 Ga0207679_101671512 209
602 3300025960 Ga0207651_10023419 Ga0207651_100234193 209
603 3300025961 Ga0207712_10178451 Ga0207712_101784512 209
604 3300025961 Ga0207712_10728370 Ga0207712_107283701 209
605 3300025972 Ga0207668_10061083 Ga0207668_100610832 209
606 3300025972 Ga0207668_10314455 Ga0207668_103144552 209
607 3300025986 Ga0207658_10001778 Ga0207658_100017786 209
608 3300025986 Ga0207658_10195415 Ga0207658_101954152 209
609 3300026035 Ga0207703_10019309 Ga0207703_100193093 209
610 3300026035 Ga0207703_10970181 Ga0207703_109701812 209
611 3300026067 Ga0207678_10221710 Ga0207678_102217101 209
612 3300026075 Ga0207708_10008203 Ga0207708_100082032 209
613 3300026088 Ga0207641_10007748 Ga0207641_100077487 209
614 3300026088 Ga0207641_10057024 Ga0207641_100570242 209
615 3300026089 Ga0207648_10004911 Ga0207648_100049113 209
616 3300026095 Ga0207676_10003553 Ga0207676_1000355310 209
617 3300026116 Ga0207674_10010837 Ga0207674_100108374 209
618 3300026116 Ga0207674_10035095 Ga0207674_100350953 209
619 3300026118 Ga0207675_100000643 Ga0207675_10000064319 209
620 3300026118 Ga0207675_100010499 Ga0207675_1000104996 209
621 3300026118 Ga0207675_100636693 Ga0207675_1006366931 209
622 3300026121 Ga0207683_10037272 Ga0207683_100372723 209
623 3300027512 Ga0209179_1033969 Ga0209179_10339692 209
624 3300027907 Ga0207428_10007561 Ga0207428_100075615 209
625 3300027907 Ga0207428_10556329 Ga0207428_105563291 209
626 3300028379 Ga0268266_10000005 Ga0268266_10000005640 209
627 3300028379 Ga0268266_10064045 Ga0268266_100640452 209
628 3300028380 Ga0268265_10002411 Ga0268265_100024115 209
629 3300028380 Ga0268265_10028933 Ga0268265_100289332 209
630 3300028380 Ga0268265_10802858 Ga0268265_108028582 209
631 3300028381 Ga0268264_10000491 Ga0268264_100004916 209
632 3300028381 Ga0268264_10173680 Ga0268264_101736802 209
633 3300031548 Ga0307408_100063120 Ga0307408_1000631202 209
634 3300031548 Ga0307408_100156791 Ga0307408_1001567912 209
635 3300031901 Ga0307406_10184735 Ga0307406_101847351 209
636 3300031911 Ga0307412_10091253 Ga0307412_100912532 209
637 3300032002 Ga0307416_100016817 Ga0307416_1000168173 209
638 3300032002 Ga0307416_100090494 Ga0307416_1000904942 209
639 3300032005 Ga0307411_10080865 Ga0307411_100808651 209
640 3300032126 Ga0307415_100239058 Ga0307415_1002390583 209
641 3300035691 Ga0373931_0190755 Ga0373931_0190755_389_1039 209
642 3300045051 Ga0451576_0018965 Ga0451576_0018965_6254_6904 209
643 3300046500 Ga0495596_0006399 Ga0495596_0006399_4514_5158 209
644 3300046513 Ga0495616_0013671 Ga0495616_0013671_3075_3719 209
645 3300046518 Ga0495631_0006260 Ga0495631_0006260_1319_1963 209
646 3300046523 Ga0495644_0061411 Ga0495644_0061411_680_1324 209
647 3300046684 Ga0495669_0087567 Ga0495669_0087567_405_1055 209
648 3300046692 Ga0495671_0061384 Ga0495671_0061384_813_1457 209
649 3300046794 Ga0495589_0031000 Ga0495589_0031000_548_1192 209
650 3300047470 Ga0495681_0008156 Ga0495681_0008156_2734_3378 209
651 3300048907 Ga0496104_0313257 Ga0496104_0313257_17_664 209
652 3300048911 Ga0496108_0211637 Ga0496108_0211637_767_1417 209
653 3300048912 Ga0496109_0068766 Ga0496109_0068766_627_1277 209
654 3300048912 Ga0496109_0510418 Ga0496109_0510418_240_887 209
655 3300048914 Ga0496111_0510456 Ga0496111_0510456_87_737 209
656 3300048915 Ga0496112_0313109 Ga0496112_0313109_621_1271 209
657 3300048917 Ga0496114_0232954 Ga0496114_0232954_943_1590 209
658 3300048918 Ga0496115_0006976 Ga0496115_0006976_5384_6037 209
659 3300049459 Ga0495678_001260 Ga0495678_001260_4538_5182 209
660 3300049460 Ga0495682_0003958 Ga0495682_0003958_4845_5489 209
661 3300049522 Ga0501299_007208 Ga0501299_007208_1045_1695 209
662 3300050507 nmdc:mga05p37_19337_c1 nmdc:mga05p37_19337_c1_3809_4459 209
663 3300050507 nmdc:mga05p37_19792_c1 nmdc:mga05p37_19792_c1_2091_2738 209
664 3300050508 nmdc:mga09592_103142_c1 nmdc:mga09592_103142_c1_318_965 209
665 3300050508 nmdc:mga09592_109187_c1 nmdc:mga09592_109187_c1_1277_1927 209
666 3300050508 nmdc:mga09592_363_c1 nmdc:mga09592_363_c1_29449_30099 209
667 3300050509 nmdc:mga0qj67_30578_c1 nmdc:mga0qj67_30578_c1_2797_3447 209
668 3300050509 nmdc:mga0qj67_9196_c1 nmdc:mga0qj67_9196_c1_4794_5441 209
669 3300050510 nmdc:mga06r32_19474_c1 nmdc:mga06r32_19474_c1_3893_4543 209
670 3300050510 nmdc:mga06r32_21977_c1 nmdc:mga06r32_21977_c1_4509_5156 209
671 3300050510 nmdc:mga06r32_247407_c1 nmdc:mga06r32_247407_c1_489_1139 209
672 3300050510 nmdc:mga06r32_9406_c1 nmdc:mga06r32_9406_c1_5755_6405 209
673 3300050511 nmdc:mga08y16_121009_c1 nmdc:mga08y16_121009_c1_1249_1896 209
674 3300050511 nmdc:mga08y16_7461_c1 nmdc:mga08y16_7461_c1_1935_2585 209
675 3300050511 nmdc:mga08y16_80440_c1 nmdc:mga08y16_80440_c1_2581_3231 209
676 3300053078 Ga0495612_0169322 Ga0495612_0169322_226_873 209
677 3300053084 Ga0495595_0039650 Ga0495595_0039650_28_675 209
678 3300053085 Ga0495619_0190220 Ga0495619_0190220_710_1357 209
679 3300002739 JGI25158J39367_1000436 JGI25158J39367_10004363 210
680 3300002739 JGI25158J39367_1001618 JGI25158J39367_10016186 210
681 3300002774 JGI25150J39212_1000927 JGI25150J39212_10009274 210
682 3300002987 JGI25159J45721_1002012 JGI25159J45721_100201210 210
683 3300002987 JGI25159J45721_1003938 JGI25159J45721_10039384 210
684 3300003354 JGI25160J50197_1005011 JGI25160J50197_10050114 210
685 3300003374 JGI25161J50226_1000895 JGI25161J50226_10008954 210
686 3300003374 JGI25161J50226_1002252 JGI25161J50226_10022523 210
687 3300003771 Ga0055526_1000807 Ga0055526_10008077 210
688 3300003771 Ga0055526_1002869 Ga0055526_100286911 210
689 3300003773 Ga0055537_1001395 Ga0055537_10013952 210
690 3300003773 Ga0055537_1002259 Ga0055537_10022594 210
691 3300003773 Ga0055537_1007604 Ga0055537_10076044 210
692 3300003775 Ga0055524_1006151 Ga0055524_10061515 210
693 3300003775 Ga0055524_1010992 Ga0055524_10109922 210
694 3300003784 Ga0055534_1005227 Ga0055534_10052272 210
695 3300003784 Ga0055534_1006819 Ga0055534_10068192 210
696 3300003790 Ga0055528_1007432 Ga0055528_10074326 210
697 3300003791 Ga0055530_10002301 Ga0055530_100023013 210
698 3300003791 Ga0055530_10002731 Ga0055530_100027312 210
699 3300003791 Ga0055530_10003871 Ga0055530_100038717 210
700 3300003794 Ga0055531_10006833 Ga0055531_100068333 210
701 3300003794 Ga0055531_10014393 Ga0055531_100143934 210
702 3300004625 Ga0055543_1001210 Ga0055543_10012104 210
703 3300005262 Ga0065165_1000507 Ga0065165_100050746 210
704 3300005331 Ga0070670_100173559 Ga0070670_1001735592 210
705 3300005334 Ga0068869_100081029 Ga0068869_1000810292 210
706 3300005337 Ga0070682_100089421 Ga0070682_1000894212 210
707 3300005338 Ga0068868_100016101 Ga0068868_1000161016 210
708 3300005340 Ga0070689_100260012 Ga0070689_1002600122 210
709 3300005344 Ga0070661_100037844 Ga0070661_1000378442 210
710 3300005354 Ga0070675_100324436 Ga0070675_1003244362 210
711 3300005355 Ga0070671_100257341 Ga0070671_1002573412 210
712 3300005367 Ga0070667_100053042 Ga0070667_1000530424 210
713 3300005434 Ga0070709_10005668 Ga0070709_100056688 210
714 3300005436 Ga0070713_100035075 Ga0070713_1000350752 210
715 3300005437 Ga0070710_10002269 Ga0070710_100022699 210
716 3300005439 Ga0070711_100013048 Ga0070711_1000130486 210
717 3300005441 Ga0070700_100135361 Ga0070700_1001353612 210
718 3300005455 Ga0070663_100515927 Ga0070663_1005159271 210
719 3300005456 Ga0070678_100110060 Ga0070678_1001100603 210
720 3300005457 Ga0070662_100548067 Ga0070662_1005480672 210
721 3300005459 Ga0068867_100082522 Ga0068867_1000825222 210
722 3300005467 Ga0070706_100116084 Ga0070706_1001160842 210
723 3300005535 Ga0070684_100546832 Ga0070684_1005468322 210
724 3300005546 Ga0070696_100578961 Ga0070696_1005789612 210
725 3300005548 Ga0070665_100711445 Ga0070665_1007114452 210
726 3300005615 Ga0070702_100048544 Ga0070702_1000485442 210
727 3300005618 Ga0068864_100088449 Ga0068864_1000884495 210
728 3300005718 Ga0068866_10028091 Ga0068866_100280913 210
729 3300005841 Ga0068863_100100698 Ga0068863_1001006981 210
730 3300005842 Ga0068858_100638289 Ga0068858_1006382892 210
731 3300005843 Ga0068860_100189810 Ga0068860_1001898102 210
732 3300005844 Ga0068862_100445617 Ga0068862_1004456171 210
733 3300006028 Ga0070717_10000430 Ga0070717_1000043027 210
734 3300006173 Ga0070716_100000617 Ga0070716_10000061714 210
735 3300006195 Ga0075366_10083426 Ga0075366_100834263 210
736 3300006358 Ga0068871_100017382 Ga0068871_1000173824 210
737 3300006358 Ga0068871_100116609 Ga0068871_1001166093 210
738 3300006852 Ga0075433_10297207 Ga0075433_102972072 210
739 3300006852 Ga0075433_10637214 Ga0075433_106372142 210
740 3300009011 Ga0105251_10009665 Ga0105251_100096659 210
741 3300009094 Ga0111539_10011155 Ga0111539_100111552 210
742 3300009094 Ga0111539_10756141 Ga0111539_107561412 210
743 3300009098 Ga0105245_10010259 Ga0105245_100102592 210
744 3300009174 Ga0105241_10015721 Ga0105241_100157214 210
745 3300009177 Ga0105248_10094973 Ga0105248_100949733 210
746 3300009553 Ga0105249_10198940 Ga0105249_101989402 210
747 3300010375 Ga0105239_10194788 Ga0105239_101947884 210
748 3300011119 Ga0105246_10044527 Ga0105246_100445274 210
749 3300012494 Ga0157341_1004641 Ga0157341_10046412 210
750 3300012495 Ga0157323_1001501 Ga0157323_10015012 210
751 3300013307 Ga0157372_10594514 Ga0157372_105945141 210
752 3300014325 Ga0163163_10343791 Ga0163163_103437912 210
753 3300014325 Ga0163163_10598974 Ga0163163_105989742 210
754 3300014968 Ga0157379_10349382 Ga0157379_103493822 210
755 3300014968 Ga0157379_10595973 Ga0157379_105959732 210
756 3300014969 Ga0157376_10355338 Ga0157376_103553382 210
757 3300017792 Ga0163161_10035041 Ga0163161_100350414 210
758 3300020082 Ga0206353_11634122 Ga0206353_116341221 210
759 3300021384 Ga0213876_10003858 Ga0213876_100038586 210
760 3300025208 Ga0209436_100900 Ga0209436_10090010 210
761 3300025208 Ga0209436_102124 Ga0209436_1021242 210
762 3300025245 Ga0207425_1000650 Ga0207425_10006505 210
763 3300025263 Ga0209565_1001548 Ga0209565_10015485 210
764 3300025263 Ga0209565_1001935 Ga0209565_10019357 210
765 3300025263 Ga0209565_1003552 Ga0209565_10035522 210
766 3300025263 Ga0209565_1006321 Ga0209565_10063214 210
767 3300025273 Ga0209673_1019887 Ga0209673_10198872 210
768 3300025284 Ga0209130_1000298 Ga0209130_100029845 210
769 3300025284 Ga0209130_1000545 Ga0209130_100054542 210
770 3300025291 Ga0209675_1002663 Ga0209675_10026631 210
771 3300025291 Ga0209675_1004422 Ga0209675_10044227 210
772 3300025295 Ga0209564_1000513 Ga0209564_100051354 210
773 3300025295 Ga0209564_1013486 Ga0209564_10134863 210
774 3300025298 Ga0209050_1000085 Ga0209050_100008514 210
775 3300025298 Ga0209050_1000984 Ga0209050_100098411 210
776 3300025298 Ga0209050_1001090 Ga0209050_100109013 210
777 3300025298 Ga0209050_1002313 Ga0209050_100231313 210
778 3300025299 Ga0209256_1001916 Ga0209256_100191616 210
779 3300025299 Ga0209256_1004507 Ga0209256_10045073 210
780 3300025299 Ga0209256_1025176 Ga0209256_10251762 210
781 3300025302 Ga0207426_1002637 Ga0207426_10026379 210
782 3300025304 Ga0209257_1000010 Ga0209257_1000010737 210
783 3300025304 Ga0209257_1002829 Ga0209257_100282913 210
784 3300025900 Ga0207710_10002851 Ga0207710_100028518 210
785 3300025901 Ga0207688_10196264 Ga0207688_101962641 210
786 3300025905 Ga0207685_10001029 Ga0207685_100010297 210
787 3300025906 Ga0207699_10002837 Ga0207699_100028373 210
788 3300025911 Ga0207654_10663139 Ga0207654_106631391 210
789 3300025915 Ga0207693_10030888 Ga0207693_100308886 210
790 3300025916 Ga0207663_10012613 Ga0207663_100126134 210
791 3300025916 Ga0207663_10513922 Ga0207663_105139222 210
792 3300025919 Ga0207657_10168843 Ga0207657_101688431 210
793 3300025920 Ga0207649_10502234 Ga0207649_105022342 210
794 3300025925 Ga0207650_10584000 Ga0207650_105840001 210
795 3300025927 Ga0207687_10025801 Ga0207687_100258014 210
796 3300025929 Ga0207664_10076808 Ga0207664_100768084 210
797 3300025931 Ga0207644_10007133 Ga0207644_100071334 210
798 3300025934 Ga0207686_10031459 Ga0207686_100314592 210
799 3300025936 Ga0207670_10021699 Ga0207670_100216996 210
800 3300025939 Ga0207665_10000756 Ga0207665_1000075615 210
801 3300025940 Ga0207691_10259162 Ga0207691_102591622 210
802 3300025941 Ga0207711_10020463 Ga0207711_100204636 210
803 3300025942 Ga0207689_10296167 Ga0207689_102961672 210
804 3300025945 Ga0207679_10111712 Ga0207679_101117122 210
805 3300025960 Ga0207651_10056455 Ga0207651_100564551 210
806 3300025961 Ga0207712_10778898 Ga0207712_107788981 210
807 3300025986 Ga0207658_10030215 Ga0207658_100302153 210
808 3300026035 Ga0207703_10029500 Ga0207703_100295004 210
809 3300026067 Ga0207678_10120948 Ga0207678_101209482 210
810 3300026088 Ga0207641_10375327 Ga0207641_103753273 210
811 3300026088 Ga0207641_10467027 Ga0207641_104670272 210
812 3300026088 Ga0207641_11074736 Ga0207641_110747361 210
813 3300026089 Ga0207648_10163917 Ga0207648_101639173 210
814 3300026095 Ga0207676_10021992 Ga0207676_100219927 210
815 3300026095 Ga0207676_10982099 Ga0207676_109820991 210
816 3300026118 Ga0207675_100101947 Ga0207675_1001019474 210
817 3300026121 Ga0207683_10144325 Ga0207683_101443253 210
818 3300027907 Ga0207428_10420595 Ga0207428_104205951 210
819 3300028380 Ga0268265_10378884 Ga0268265_103788842 210
820 3300028381 Ga0268264_10350896 Ga0268264_103508962 210
821 3300031548 Ga0307408_100000191 Ga0307408_10000019111 210
822 3300031548 Ga0307408_100004007 Ga0307408_1000040073 210
823 3300031548 Ga0307408_100035379 Ga0307408_1000353793 210
824 3300031911 Ga0307412_10621256 Ga0307412_106212561 210
825 3300035089 Ga0373944_0038855 Ga0373944_0038855_791_1441 210
826 3300035090 Ga0373949_0003619 Ga0373949_0003619_1109_1759 210
827 3300035091 Ga0373951_0010325 Ga0373951_0010325_971_1621 210
828 3300035112 Ga0373932_0032707 Ga0373932_0032707_28_678 210
829 3300035170 Ga0373943_0051702 Ga0373943_0051702_206_856 210
830 3300035242 Ga0373962_0011920 Ga0373962_0011920_861_1511 210
831 3300035692 Ga0373935_0004417 Ga0373935_0004417_926_1576 210
832 3300035695 Ga0373927_0020645 Ga0373927_0020645_2117_2767 210
833 3300035725 Ga0373947_0001131 Ga0373947_0001131_10545_11195 210
834 3300037068 Ga0373925_0005303 Ga0373925_0005303_5069_5719 210
835 3300039437 Ga0436365_1201434 Ga0436365_1201434_110915_111565 210
836 3300039447 Ga0436361_0515518 Ga0436361_0515518_777_1442 210
837 3300044656 Ga0466969_0030750 Ga0466969_0030750_84_731 210
838 3300044683 Ga0466965_0032941 Ga0466965_0032941_1719_2366 210
839 3300044684 Ga0466966_0048631 Ga0466966_0048631_1929_2576 210
840 3300044684 Ga0466966_0440111 Ga0466966_0440111_90_737 210
841 3300044693 Ga0466961_0019560 Ga0466961_0019560_2484_3131 210
842 3300044765 Ga0466970_0216612 Ga0466970_0216612_186_833 210
843 3300045049 Ga0466959_0004876 Ga0466959_0004876_3157_3804 210
844 3300045049 Ga0466959_0105268 Ga0466959_0105268_375_1022 210
845 3300046455 Ga0495603_0109813 Ga0495603_0109813_65_715 210
846 3300046459 Ga0495629_0001316 Ga0495629_0001316_17550_18200 210
847 3300046460 Ga0495638_0023729 Ga0495638_0023729_2051_2704 210
848 3300046472 Ga0495580_0049419 Ga0495580_0049419_1915_2568 210
849 3300046472 Ga0495580_0297590 Ga0495580_0297590_249_899 210
850 3300046473 Ga0495582_0003861 Ga0495582_0003861_5503_6153 210
851 3300046475 Ga0495639_0252768 Ga0495639_0252768_144_794 210
852 3300046499 Ga0495594_0021257 Ga0495594_0021257_923_1573 210
853 3300046500 Ga0495596_0102336 Ga0495596_0102336_170_817 210
854 3300046506 Ga0495583_0044645 Ga0495583_0044645_347_994 210
855 3300046519 Ga0495632_0001071 Ga0495632_0001071_17900_18547 210
856 3300046557 Ga0495622_0052482 Ga0495622_0052482_882_1532 210
857 3300046616 Ga0495668_0084498 Ga0495668_0084498_972_1619 210
858 3300046616 Ga0495668_0147872 Ga0495668_0147872_192_839 210
859 3300046674 Ga0495588_0231071 Ga0495588_0231071_126_776 210
860 3300046681 Ga0495647_0012955 Ga0495647_0012955_2036_2686 210
861 3300046683 Ga0495658_0000324 Ga0495658_0000324_2296_2946 210
862 3300046689 Ga0495613_0001421 Ga0495613_0001421_12358_13008 210
863 3300046810 Ga0495660_0001934 Ga0495660_0001934_1296_1943 210
864 3300047321 Ga0495676_0020464 Ga0495676_0020464_3005_3655 210
865 3300047322 Ga0495680_0017789 Ga0495680_0017789_3076_3726 210
866 3300047445 Ga0495677_0093173 Ga0495677_0093173_273_920 210
867 3300047673 Ga0495593_0012414 Ga0495593_0012414_2666_3316 210
868 3300048091 Ga0495626_0018425 Ga0495626_0018425_1087_1734 210
869 3300048903 Ga0496100_0093783 Ga0496100_0093783_1104_1754 210
870 3300048904 Ga0496101_0030387 Ga0496101_0030387_680_1330 210
871 3300048905 Ga0496102_0262417 Ga0496102_0262417_55_705 210
872 3300048905 Ga0496102_0399297 Ga0496102_0399297_98_748 210
873 3300048906 Ga0496103_0119990 Ga0496103_0119990_799_1449 210
874 3300048907 Ga0496104_0092699 Ga0496104_0092699_614_1264 210
875 3300048907 Ga0496104_0182400 Ga0496104_0182400_816_1466 210
876 3300048908 Ga0496105_0200123 Ga0496105_0200123_748_1398 210
877 3300048908 Ga0496105_0211543 Ga0496105_0211543_56_706 210
878 3300048908 Ga0496105_0363211 Ga0496105_0363211_161_811 210
879 3300048909 Ga0496106_0018137 Ga0496106_0018137_4391_5047 210
880 3300048909 Ga0496106_0289350 Ga0496106_0289350_303_953 210
881 3300048910 Ga0496107_0000113 Ga0496107_0000113_27882_28538 210
882 3300048910 Ga0496107_0004681 Ga0496107_0004681_5360_6010 210
883 3300048911 Ga0496108_0029338 Ga0496108_0029338_1612_2262 210
884 3300048911 Ga0496108_0537045 Ga0496108_0537045_287_937 210
885 3300048912 Ga0496109_0109185 Ga0496109_0109185_1571_2221 210
886 3300048912 Ga0496109_0220951 Ga0496109_0220951_233_883 210
887 3300048913 Ga0496110_0089065 Ga0496110_0089065_138_788 210
888 3300048913 Ga0496110_0135587 Ga0496110_0135587_147_797 210
889 3300048913 Ga0496110_0492386 Ga0496110_0492386_337_987 210
890 3300048915 Ga0496112_0187325 Ga0496112_0187325_822_1472 210
891 3300048916 Ga0496113_0073537 Ga0496113_0073537_1437_2087 210
892 3300048917 Ga0496114_0278067 Ga0496114_0278067_168_818 210
893 3300048924 Ga0496121_0028907 Ga0496121_0028907_2685_3341 210
894 3300049459 Ga0495678_001614 Ga0495678_001614_13618_14265 210
895 3300049569 Ga0501032_0228486 Ga0501032_0228486_84_734 210
896 3300049570 Ga0501033_0004162 Ga0501033_0004162_3135_3851 210
897 3300049571 Ga0501034_0039793 Ga0501034_0039793_198_848 210
898 3300049573 Ga0501037_0010408 Ga0501037_0010408_2683_3357 210
899 3300049574 Ga0501038_0075955 Ga0501038_0075955_2026_2676 210
900 3300049581 Ga0501047_0121865 Ga0501047_0121865_375_1025 210
901 3300049590 Ga0501074_0060980 Ga0501074_0060980_72_722 210
902 3300049679 Ga0501249_000847 Ga0501249_000847_1833_2483 210
903 3300049744 Ga0501083_0083943 Ga0501083_0083943_1180_1830 210
904 3300049823 Ga0501044_0001671 Ga0501044_0001671_8350_9024 210
905 3300050493 nmdc:mga0k408_17501_c1 nmdc:mga0k408_17501_c1_464_1114 210
906 3300050511 nmdc:mga08y16_11836_c1 nmdc:mga08y16_11836_c1_1609_2262 210
907 3300050511 nmdc:mga08y16_703021_c1 nmdc:mga08y16_703021_c1_198_848 210
908 3300050512 nmdc:mga0n895_817177_c1 nmdc:mga0n895_817177_c1_43_693 210
909 3300050513 nmdc:mga0rr50_27180_c1 nmdc:mga0rr50_27180_c1_1217_1867 210
910 3300050515 nmdc:mga0a205_331992_c2 nmdc:mga0a205_331992_c2_192_845 210
911 3300050515 nmdc:mga0a205_397317_c1 nmdc:mga0a205_397317_c1_375_1025 210
912 3300053085 Ga0495619_0001224 Ga0495619_0001224_4571_5221 210
913 3300053153 Ga0500616_0160149 Ga0500616_0160149_204_854 210
914 3300060353 Ga0501082_0122864 Ga0501082_0122864_1380_2030 210
915 3300003759 Ga0055525_1000179 Ga0055525_100017944 211
916 3300003762 Ga0055542_1007375 Ga0055542_10073752 211
917 3300005262 Ga0065165_1002094 Ga0065165_10020948 211
918 3300005262 Ga0065165_1011460 Ga0065165_10114604 211
919 3300005295 Ga0065707_10184827 Ga0065707_101848272 211
920 3300005327 Ga0070658_10373563 Ga0070658_103735632 211
921 3300005327 Ga0070658_10628378 Ga0070658_106283781 211
922 3300005331 Ga0070670_100162935 Ga0070670_1001629352 211
923 3300005333 Ga0070677_10006512 Ga0070677_100065123 211
924 3300005334 Ga0068869_100247877 Ga0068869_1002478771 211
925 3300005337 Ga0070682_100138696 Ga0070682_1001386963 211
926 3300005337 Ga0070682_100659172 Ga0070682_1006591722 211
927 3300005339 Ga0070660_100407728 Ga0070660_1004077282 211
928 3300005347 Ga0070668_100380701 Ga0070668_1003807011 211
929 3300005353 Ga0070669_100066811 Ga0070669_1000668115 211
930 3300005354 Ga0070675_100019787 Ga0070675_1000197876 211
931 3300005354 Ga0070675_100171100 Ga0070675_1001711003 211
932 3300005354 Ga0070675_100201050 Ga0070675_1002010503 211
933 3300005356 Ga0070674_100315419 Ga0070674_1003154191 211
934 3300005356 Ga0070674_100637342 Ga0070674_1006373422 211
935 3300005364 Ga0070673_100029162 Ga0070673_1000291624 211
936 3300005364 Ga0070673_100792324 Ga0070673_1007923241 211
937 3300005365 Ga0070688_100297078 Ga0070688_1002970782 211
938 3300005366 Ga0070659_100253680 Ga0070659_1002536802 211
939 3300005367 Ga0070667_100623339 Ga0070667_1006233391 211
940 3300005456 Ga0070678_100004829 Ga0070678_1000048295 211
941 3300005457 Ga0070662_100038889 Ga0070662_1000388892 211
942 3300005457 Ga0070662_100588654 Ga0070662_1005886541 211
943 3300005458 Ga0070681_10672257 Ga0070681_106722571 211
944 3300005459 Ga0068867_100556232 Ga0068867_1005562321 211
945 3300005543 Ga0070672_100050410 Ga0070672_1000504106 211
946 3300005563 Ga0068855_100057708 Ga0068855_1000577082 211
947 3300005564 Ga0070664_100111929 Ga0070664_1001119292 211
948 3300005577 Ga0068857_100610255 Ga0068857_1006102552 211
949 3300005616 Ga0068852_100114583 Ga0068852_1001145832 211
950 3300005617 Ga0068859_100011717 Ga0068859_1000117178 211
951 3300005617 Ga0068859_100037371 Ga0068859_1000373714 211
952 3300005618 Ga0068864_100152806 Ga0068864_1001528062 211
953 3300005618 Ga0068864_100409641 Ga0068864_1004096412 211
954 3300005718 Ga0068866_10277410 Ga0068866_102774102 211
955 3300005840 Ga0068870_10036506 Ga0068870_100365064 211
956 3300005841 Ga0068863_100594952 Ga0068863_1005949522 211
957 3300005841 Ga0068863_100922592 Ga0068863_1009225921 211
958 3300005843 Ga0068860_100457919 Ga0068860_1004579192 211
959 3300005844 Ga0068862_100000023 Ga0068862_10000002351 211
960 3300005844 Ga0068862_100123132 Ga0068862_1001231321 211
961 3300005985 Ga0081539_10071411 Ga0081539_100714112 211
962 3300006038 Ga0075365_10153701 Ga0075365_101537013 211
963 3300006038 Ga0075365_10170655 Ga0075365_101706552 211
964 3300006038 Ga0075365_10184707 Ga0075365_101847072 211
965 3300006237 Ga0097621_100129431 Ga0097621_1001294314 211
966 3300006881 Ga0068865_100035448 Ga0068865_1000354484 211
967 3300006931 Ga0097620_100011717 Ga0097620_1000117178 211
968 3300009093 Ga0105240_10202548 Ga0105240_102025481 211
969 3300009148 Ga0105243_10007319 Ga0105243_100073193 211
970 3300009148 Ga0105243_10107656 Ga0105243_101076563 211
971 3300009174 Ga0105241_10010325 Ga0105241_100103256 211
972 3300009176 Ga0105242_10109216 Ga0105242_101092162 211
973 3300009177 Ga0105248_10152873 Ga0105248_101528732 211
974 3300009553 Ga0105249_10000004 Ga0105249_10000004324 211
975 3300010375 Ga0105239_10903591 Ga0105239_109035911 211
976 3300011119 Ga0105246_10200117 Ga0105246_102001171 211
977 3300013297 Ga0157378_10234360 Ga0157378_102343602 211
978 3300013306 Ga0163162_10417303 Ga0163162_104173032 211
979 3300013308 Ga0157375_10034134 Ga0157375_100341347 211
980 3300014325 Ga0163163_10162011 Ga0163163_101620114 211
981 3300014325 Ga0163163_10973775 Ga0163163_109737752 211
982 3300014326 Ga0157380_10659489 Ga0157380_106594892 211
983 3300014968 Ga0157379_10287405 Ga0157379_102874053 211
984 3300014969 Ga0157376_10321264 Ga0157376_103212641 211
985 3300014969 Ga0157376_10594725 Ga0157376_105947252 211
986 3300015261 Ga0182006_1064665 Ga0182006_10646652 211
987 3300025230 Ga0209563_100143 Ga0209563_10014333 211
988 3300025253 Ga0209677_107287 Ga0209677_1072872 211
989 3300025254 Ga0209148_1000229 Ga0209148_100022952 211
990 3300025261 Ga0209233_1025221 Ga0209233_10252212 211
991 3300025893 Ga0207682_10007649 Ga0207682_100076494 211
992 3300025908 Ga0207643_10048833 Ga0207643_100488333 211
993 3300025909 Ga0207705_10366710 Ga0207705_103667101 211
994 3300025912 Ga0207707_10545073 Ga0207707_105450732 211
995 3300025917 Ga0207660_10070749 Ga0207660_100707492 211
996 3300025919 Ga0207657_10014518 Ga0207657_100145182 211
997 3300025919 Ga0207657_10042219 Ga0207657_100422192 211
998 3300025919 Ga0207657_10207471 Ga0207657_102074711 211
999 3300025923 Ga0207681_10145788 Ga0207681_101457882 211
1000 3300025926 Ga0207659_10029986 Ga0207659_100299866 211
1001 3300025926 Ga0207659_10110364 Ga0207659_101103642 211
1002 3300025927 Ga0207687_10214737 Ga0207687_102147372 211
1003 3300025932 Ga0207690_10218432 Ga0207690_102184322 211
1004 3300025932 Ga0207690_10672842 Ga0207690_106728421 211
1005 3300025933 Ga0207706_10089552 Ga0207706_100895522 211
1006 3300025933 Ga0207706_10371092 Ga0207706_103710922 211
1007 3300025934 Ga0207686_10159427 Ga0207686_101594272 211
1008 3300025936 Ga0207670_10416037 Ga0207670_104160372 211
1009 3300025937 Ga0207669_10055048 Ga0207669_100550481 211
1010 3300025937 Ga0207669_10579801 Ga0207669_105798012 211
1011 3300025938 Ga0207704_10026083 Ga0207704_100260834 211
1012 3300025940 Ga0207691_10004440 Ga0207691_100044404 211
1013 3300025940 Ga0207691_10035967 Ga0207691_100359674 211
1014 3300025941 Ga0207711_10281374 Ga0207711_102813743 211
1015 3300025942 Ga0207689_10072873 Ga0207689_100728733 211
1016 3300025945 Ga0207679_10143784 Ga0207679_101437842 211
1017 3300025949 Ga0207667_10004790 Ga0207667_100047908 211
1018 3300025961 Ga0207712_10000008 Ga0207712_10000008455 211
1019 3300025972 Ga0207668_10222810 Ga0207668_102228103 211
1020 3300025972 Ga0207668_10750262 Ga0207668_107502621 211
1021 3300025986 Ga0207658_10587155 Ga0207658_105871552 211
1022 3300026078 Ga0207702_10303871 Ga0207702_103038712 211
1023 3300026088 Ga0207641_10568932 Ga0207641_105689322 211
1024 3300026089 Ga0207648_10065200 Ga0207648_100652004 211
1025 3300026089 Ga0207648_10304541 Ga0207648_103045412 211
1026 3300026095 Ga0207676_10349049 Ga0207676_103490492 211
1027 3300026116 Ga0207674_10326306 Ga0207674_103263062 211
1028 3300026118 Ga0207675_100069412 Ga0207675_1000694124 211
1029 3300026118 Ga0207675_100133086 Ga0207675_1001330862 211
1030 3300026121 Ga0207683_10018748 Ga0207683_100187483 211
1031 3300026142 Ga0207698_10083708 Ga0207698_100837081 211
1032 3300028380 Ga0268265_10000035 Ga0268265_1000003548 211
1033 3300028381 Ga0268264_10424410 Ga0268264_104244102 211
1034 3300028794 Ga0307515_10548533 Ga0307515_105485331 211
1035 3300031456 Ga0307513_10040898 Ga0307513_100408984 211
1036 3300031456 Ga0307513_10049887 Ga0307513_100498873 211
1037 3300032002 Ga0307416_100540419 Ga0307416_1005404192 211
1038 3300037312 Ga0395899_0010351 Ga0395899_0010351_1352_2002 211
1039 3300037312 Ga0395899_0023855 Ga0395899_0023855_1773_2423 211
1040 3300037312 Ga0395899_0238184 Ga0395899_0238184_485_1135 211
1041 3300037418 Ga0395900_0001245 Ga0395900_0001245_11053_11703 211
1042 3300037418 Ga0395900_0037621 Ga0395900_0037621_2432_3082 211
1043 3300037418 Ga0395900_0061382 Ga0395900_0061382_2244_2894 211
1044 3300037418 Ga0395900_0149091 Ga0395900_0149091_1653_2303 211
1045 3300037466 Ga0395898_0020269 Ga0395898_0020269_777_1427 211
1046 3300037466 Ga0395898_0063314 Ga0395898_0063314_2078_2728 211
1047 3300037466 Ga0395898_0310030 Ga0395898_0310030_375_1025 211
1048 3300037466 Ga0395898_0314740 Ga0395898_0314740_248_898 211
1049 3300037471 Ga0395905_0006098 Ga0395905_0006098_5703_6353 211
1050 3300037471 Ga0395905_0186731 Ga0395905_0186731_1063_1713 211
1051 3300037471 Ga0395905_0190187 Ga0395905_0190187_138_788 211
1052 3300037471 Ga0395905_0316634 Ga0395905_0316634_264_914 211
1053 3300038443 Ga0395901_0000227 Ga0395901_0000227_18932_19582 211
1054 3300038443 Ga0395901_0012516 Ga0395901_0012516_6022_6672 211
1055 3300038443 Ga0395901_0110450 Ga0395901_0110450_387_1037 211
1056 3300038443 Ga0395901_0324492 Ga0395901_0324492_134_784 211
1057 3300038443 Ga0395901_0441262 Ga0395901_0441262_654_1304 211
1058 3300038443 Ga0395901_0523591 Ga0395901_0523591_487_1137 211
1059 3300038443 Ga0395901_0622036 Ga0395901_0622036_131_781 211
1060 3300042005 Ga0439448_0006886 Ga0439448_0006886_2167_2817 211
1061 3300042005 Ga0439448_0131260 Ga0439448_0131260_199_849 211
1062 3300042012 Ga0439455_0010698 Ga0439455_0010698_1161_1811 211
1063 3300042012 Ga0439455_0058485 Ga0439455_0058485_159_809 211
1064 3300042012 Ga0439455_0078729 Ga0439455_0078729_225_875 211
1065 3300042127 Ga0450890_023546 Ga0450890_023546_171_821 211
1066 3300042157 Ga0439458_0058672 Ga0439458_0058672_43_693 211
1067 3300042438 Ga0439459_0011856 Ga0439459_0011856_877_1533 211
1068 3300044658 Ga0466972_0000781 Ga0466972_0000781_2320_2970 211
1069 3300044658 Ga0466972_0077983 Ga0466972_0077983_610_1293 211
1070 3300044683 Ga0466965_0039757 Ga0466965_0039757_303_953 211
1071 3300044684 Ga0466966_0024382 Ga0466966_0024382_1314_1964 211
1072 3300044684 Ga0466966_0043862 Ga0466966_0043862_1351_2001 211
1073 3300044693 Ga0466961_0327345 Ga0466961_0327345_39_689 211
1074 3300044694 Ga0466963_0030954 Ga0466963_0030954_719_1369 211
1075 3300044706 Ga0466964_0000202 Ga0466964_0000202_7577_8227 211
1076 3300044706 Ga0466964_0111751 Ga0466964_0111751_228_878 211
1077 3300044719 Ga0466971_0055343 Ga0466971_0055343_810_1493 211
1078 3300044735 Ga0466968_0000639 Ga0466968_0000639_9441_10091 211
1079 3300044735 Ga0466968_0074112 Ga0466968_0074112_343_1026 211
1080 3300044765 Ga0466970_0250359 Ga0466970_0250359_182_865 211
1081 3300044842 Ga0466957_0000288 Ga0466957_0000288_5026_5676 211
1082 3300044842 Ga0466957_0004715 Ga0466957_0004715_1371_2021 211
1083 3300045049 Ga0466959_0121626 Ga0466959_0121626_992_1642 211
1084 3300045836 Ga0466958_0200026 Ga0466958_0200026_238_888 211
1085 3300045836 Ga0466958_0249780 Ga0466958_0249780_215_865 211
1086 3300045976 Ga0466967_0011400 Ga0466967_0011400_1726_2376 211
1087 3300045976 Ga0466967_0040616 Ga0466967_0040616_33_683 211
1088 3300045976 Ga0466967_0098582 Ga0466967_0098582_982_1632 211
1089 3300046452 Ga0495617_004456 Ga0495617_004456_890_1540 211
1090 3300046453 Ga0495627_003852 Ga0495627_003852_2730_3380 211
1091 3300046457 Ga0495590_0000134 Ga0495590_0000134_12200_12850 211
1092 3300046457 Ga0495590_0011435 Ga0495590_0011435_1134_1784 211
1093 3300046458 Ga0495591_002132 Ga0495591_002132_4789_5439 211
1094 3300046458 Ga0495591_004885 Ga0495591_004885_4122_4772 211
1095 3300046459 Ga0495629_0462363 Ga0495629_0462363_119_778 211
1096 3300046460 Ga0495638_0182589 Ga0495638_0182589_437_1096 211
1097 3300046471 Ga0495650_0077010 Ga0495650_0077010_178_828 211
1098 3300046474 Ga0495605_0000648 Ga0495605_0000648_16950_17600 211
1099 3300046474 Ga0495605_0001492 Ga0495605_0001492_13334_13984 211
1100 3300046474 Ga0495605_0033053 Ga0495605_0033053_504_1154 211
1101 3300046474 Ga0495605_0041680 Ga0495605_0041680_896_1546 211
1102 3300046491 Ga0495584_0000276 Ga0495584_0000276_4761_5411 211
1103 3300046491 Ga0495584_0000360 Ga0495584_0000360_5776_6426 211
1104 3300046491 Ga0495584_0016236 Ga0495584_0016236_2297_2947 211
1105 3300046492 Ga0495585_0007706 Ga0495585_0007706_3426_4076 211
1106 3300046492 Ga0495585_0010621 Ga0495585_0010621_3215_3865 211
1107 3300046492 Ga0495585_0018992 Ga0495585_0018992_557_1207 211
1108 3300046499 Ga0495594_0006527 Ga0495594_0006527_4837_5487 211
1109 3300046499 Ga0495594_0196844 Ga0495594_0196844_281_931 211
1110 3300046499 Ga0495594_0257580 Ga0495594_0257580_304_954 211
1111 3300046499 Ga0495594_0302873 Ga0495594_0302873_32_691 211
1112 3300046500 Ga0495596_0001797 Ga0495596_0001797_8262_8912 211
1113 3300046500 Ga0495596_0005557 Ga0495596_0005557_3007_3657 211
1114 3300046500 Ga0495596_0052042 Ga0495596_0052042_643_1293 211
1115 3300046501 Ga0495607_0002183 Ga0495607_0002183_9752_10402 211
1116 3300046501 Ga0495607_0003483 Ga0495607_0003483_6376_7026 211
1117 3300046501 Ga0495607_0005327 Ga0495607_0005327_3702_4352 211
1118 3300046501 Ga0495607_0034039 Ga0495607_0034039_515_1165 211
1119 3300046501 Ga0495607_0066295 Ga0495607_0066295_887_1537 211
1120 3300046506 Ga0495583_0002792 Ga0495583_0002792_12232_12882 211
1121 3300046506 Ga0495583_0037710 Ga0495583_0037710_322_972 211
1122 3300046507 Ga0495606_0019204 Ga0495606_0019204_4434_5084 211
1123 3300046507 Ga0495606_0026638 Ga0495606_0026638_2042_2692 211
1124 3300046507 Ga0495606_0034768 Ga0495606_0034768_2590_3240 211
1125 3300046507 Ga0495606_0087505 Ga0495606_0087505_888_1538 211
1126 3300046512 Ga0495610_0001163 Ga0495610_0001163_6807_7457 211
1127 3300046513 Ga0495616_0000838 Ga0495616_0000838_2013_2663 211
1128 3300046513 Ga0495616_0016590 Ga0495616_0016590_1603_2253 211
1129 3300046513 Ga0495616_0049936 Ga0495616_0049936_680_1330 211
1130 3300046513 Ga0495616_0086184 Ga0495616_0086184_454_1104 211
1131 3300046515 Ga0495620_0046849 Ga0495620_0046849_216_875 211
1132 3300046518 Ga0495631_0000279 Ga0495631_0000279_3838_4488 211
1133 3300046518 Ga0495631_0006574 Ga0495631_0006574_370_1020 211
1134 3300046518 Ga0495631_0013083 Ga0495631_0013083_2669_3319 211
1135 3300046518 Ga0495631_0032862 Ga0495631_0032862_538_1188 211
1136 3300046518 Ga0495631_0068450 Ga0495631_0068450_47_697 211
1137 3300046519 Ga0495632_0007310 Ga0495632_0007310_4732_5382 211
1138 3300046519 Ga0495632_0143545 Ga0495632_0143545_171_821 211
1139 3300046519 Ga0495632_0231991 Ga0495632_0231991_76_735 211
1140 3300046520 Ga0495637_0000349 Ga0495637_0000349_3570_4220 211
1141 3300046520 Ga0495637_0068319 Ga0495637_0068319_205_855 211
1142 3300046520 Ga0495637_0098352 Ga0495637_0098352_38_688 211
1143 3300046522 Ga0495643_0002769 Ga0495643_0002769_3191_3841 211
1144 3300046522 Ga0495643_0005957 Ga0495643_0005957_3540_4190 211
1145 3300046522 Ga0495643_0017729 Ga0495643_0017729_801_1451 211
1146 3300046522 Ga0495643_0038705 Ga0495643_0038705_951_1601 211
1147 3300046523 Ga0495644_0005634 Ga0495644_0005634_2318_2968 211
1148 3300046523 Ga0495644_0007182 Ga0495644_0007182_2466_3116 211
1149 3300046523 Ga0495644_0010211 Ga0495644_0010211_1334_1984 211
1150 3300046524 Ga0495648_0011719 Ga0495648_0011719_449_1099 211
1151 3300046524 Ga0495648_0032709 Ga0495648_0032709_298_948 211
1152 3300046524 Ga0495648_0117826 Ga0495648_0117826_342_992 211
1153 3300046526 Ga0495666_0116935 Ga0495666_0116935_363_1013 211
1154 3300046526 Ga0495666_0126095 Ga0495666_0126095_73_756 211
1155 3300046528 Ga0495642_0001118 Ga0495642_0001118_8804_9454 211
1156 3300046528 Ga0495642_0016302 Ga0495642_0016302_815_1465 211
1157 3300046528 Ga0495642_0140234 Ga0495642_0140234_105_755 211
1158 3300046537 Ga0495598_0143319 Ga0495598_0143319_88_750 211
1159 3300046538 Ga0495609_0000005 Ga0495609_0000005_406784_407434 211
1160 3300046538 Ga0495609_0001754 Ga0495609_0001754_11885_12535 211
1161 3300046557 Ga0495622_0096650 Ga0495622_0096650_111_761 211
1162 3300046558 Ga0495633_0002683 Ga0495633_0002683_4459_5109 211
1163 3300046615 Ga0495656_0039625 Ga0495656_0039625_519_1169 211
1164 3300046615 Ga0495656_0233518 Ga0495656_0233518_133_792 211
1165 3300046616 Ga0495668_0033688 Ga0495668_0033688_421_1071 211
1166 3300046616 Ga0495668_0049671 Ga0495668_0049671_121_771 211
1167 3300046616 Ga0495668_0145693 Ga0495668_0145693_347_997 211
1168 3300046648 Ga0495611_0000780 Ga0495611_0000780_11962_12612 211
1169 3300046648 Ga0495611_0002724 Ga0495611_0002724_4813_5463 211
1170 3300046648 Ga0495611_0041838 Ga0495611_0041838_1306_1956 211
1171 3300046648 Ga0495611_0166136 Ga0495611_0166136_348_998 211
1172 3300046648 Ga0495611_0276177 Ga0495611_0276177_93_743 211
1173 3300046660 Ga0495625_0019447 Ga0495625_0019447_497_1156 211
1174 3300046665 Ga0495661_0000578 Ga0495661_0000578_5634_6284 211
1175 3300046665 Ga0495661_0000794 Ga0495661_0000794_2643_3293 211
1176 3300046674 Ga0495588_0000059 Ga0495588_0000059_244885_245535 211
1177 3300046674 Ga0495588_0021970 Ga0495588_0021970_109_759 211
1178 3300046674 Ga0495588_0091182 Ga0495588_0091182_228_878 211
1179 3300046679 Ga0495623_0228728 Ga0495623_0228728_298_948 211
1180 3300046680 Ga0495646_0122132 Ga0495646_0122132_780_1463 211
1181 3300046683 Ga0495658_0248903 Ga0495658_0248903_402_1061 211
1182 3300046684 Ga0495669_0001610 Ga0495669_0001610_1289_1939 211
1183 3300046684 Ga0495669_0018683 Ga0495669_0018683_1069_1719 211
1184 3300046684 Ga0495669_0035145 Ga0495669_0035145_555_1205 211
1185 3300046691 Ga0495670_0015441 Ga0495670_0015441_1381_2031 211
1186 3300046694 Ga0495649_0001486 Ga0495649_0001486_12799_13449 211
1187 3300046694 Ga0495649_0328118 Ga0495649_0328118_65_715 211
1188 3300046794 Ga0495589_0000212 Ga0495589_0000212_452_1102 211
1189 3300046794 Ga0495589_0000277 Ga0495589_0000277_9390_10040 211
1190 3300046794 Ga0495589_0082270 Ga0495589_0082270_401_1051 211
1191 3300046794 Ga0495589_0205095 Ga0495589_0205095_246_896 211
1192 3300046810 Ga0495660_0000789 Ga0495660_0000789_16692_17342 211
1193 3300046810 Ga0495660_0029835 Ga0495660_0029835_1551_2201 211
1194 3300046810 Ga0495660_0043726 Ga0495660_0043726_804_1454 211
1195 3300046810 Ga0495660_0045146 Ga0495660_0045146_1411_2061 211
1196 3300046810 Ga0495660_0051838 Ga0495660_0051838_1067_1717 211
1197 3300047320 Ga0495672_0000529 Ga0495672_0000529_36652_37302 211
1198 3300047320 Ga0495672_0000769 Ga0495672_0000769_3140_3790 211
1199 3300047320 Ga0495672_0054885 Ga0495672_0054885_1461_2111 211
1200 3300047323 Ga0495683_0000843 Ga0495683_0000843_18123_18773 211
1201 3300047323 Ga0495683_0027472 Ga0495683_0027472_626_1276 211
1202 3300047323 Ga0495683_0083109 Ga0495683_0083109_527_1177 211
1203 3300047443 Ga0495687_000221 Ga0495687_000221_31927_32577 211
1204 3300047443 Ga0495687_000821 Ga0495687_000821_23837_24487 211
1205 3300047443 Ga0495687_000828 Ga0495687_000828_6112_6762 211
1206 3300047443 Ga0495687_001176 Ga0495687_001176_5353_6003 211
1207 3300047444 Ga0495675_0102309 Ga0495675_0102309_690_1373 211
1208 3300047445 Ga0495677_0000060 Ga0495677_0000060_29401_30051 211
1209 3300047445 Ga0495677_0000482 Ga0495677_0000482_11543_12193 211
1210 3300047445 Ga0495677_0000641 Ga0495677_0000641_5719_6369 211
1211 3300047445 Ga0495677_0016168 Ga0495677_0016168_294_944 211
1212 3300047445 Ga0495677_0022969 Ga0495677_0022969_390_1040 211
1213 3300047446 Ga0495679_005612 Ga0495679_005612_28_678 211
1214 3300047446 Ga0495679_050150 Ga0495679_050150_480_1130 211
1215 3300047447 Ga0495685_001601 Ga0495685_001601_4408_5058 211
1216 3300047447 Ga0495685_014299 Ga0495685_014299_184_834 211
1217 3300047447 Ga0495685_113227 Ga0495685_113227_43_693 211
1218 3300047469 Ga0495673_0003436 Ga0495673_0003436_6724_7374 211
1219 3300047470 Ga0495681_0030239 Ga0495681_0030239_532_1182 211
1220 3300047472 Ga0495686_0015733 Ga0495686_0015733_161_811 211
1221 3300047472 Ga0495686_0114917 Ga0495686_0114917_520_1179 211
1222 3300048091 Ga0495626_0001058 Ga0495626_0001058_3841_4491 211
1223 3300048091 Ga0495626_0001912 Ga0495626_0001912_5947_6597 211
1224 3300048091 Ga0495626_0003018 Ga0495626_0003018_10437_11087 211
1225 3300048091 Ga0495626_0008343 Ga0495626_0008343_3033_3683 211
1226 3300048091 Ga0495626_0055934 Ga0495626_0055934_782_1432 211
1227 3300048903 Ga0496100_0785878 Ga0496100_0785878_50_700 211
1228 3300048904 Ga0496101_0107301 Ga0496101_0107301_115_765 211
1229 3300048905 Ga0496102_0026915 Ga0496102_0026915_613_1263 211
1230 3300048905 Ga0496102_0594610 Ga0496102_0594610_258_908 211
1231 3300048907 Ga0496104_0056082 Ga0496104_0056082_1388_2038 211
1232 3300048908 Ga0496105_0273406 Ga0496105_0273406_82_732 211
1233 3300048909 Ga0496106_0043272 Ga0496106_0043272_1939_2589 211
1234 3300048909 Ga0496106_0137687 Ga0496106_0137687_636_1286 211
1235 3300048910 Ga0496107_0122879 Ga0496107_0122879_948_1598 211
1236 3300048913 Ga0496110_0850139 Ga0496110_0850139_81_731 211
1237 3300048915 Ga0496112_1053605 Ga0496112_1053605_42_692 211
1238 3300048916 Ga0496113_0013567 Ga0496113_0013567_3934_4584 211
1239 3300048916 Ga0496113_0364705 Ga0496113_0364705_235_885 211
1240 3300048918 Ga0496115_0597546 Ga0496115_0597546_21_671 211
1241 3300048924 Ga0496121_0145623 Ga0496121_0145623_719_1369 211
1242 3300048925 Ga0496122_0003733 Ga0496122_0003733_5637_6287 211
1243 3300048925 Ga0496122_0076150 Ga0496122_0076150_28_678 211
1244 3300048925 Ga0496122_0292936 Ga0496122_0292936_106_756 211
1245 3300048926 Ga0496123_0036242 Ga0496123_0036242_1394_2044 211
1246 3300048926 Ga0496123_0051716 Ga0496123_0051716_1494_2144 211
1247 3300048926 Ga0496123_0181386 Ga0496123_0181386_187_837 211
1248 3300048927 Ga0496124_0039125 Ga0496124_0039125_2514_3164 211
1249 3300048927 Ga0496124_0040582 Ga0496124_0040582_94_744 211
1250 3300048927 Ga0496124_0130487 Ga0496124_0130487_868_1518 211
1251 3300048927 Ga0496124_0202472 Ga0496124_0202472_756_1406 211
1252 3300048928 Ga0496125_0107017 Ga0496125_0107017_1107_1757 211
1253 3300049459 Ga0495678_000146 Ga0495678_000146_54236_54886 211
1254 3300049460 Ga0495682_0021466 Ga0495682_0021466_1121_1771 211
1255 3300049460 Ga0495682_0030674 Ga0495682_0030674_532_1182 211
1256 3300049705 Ga0501225_0036265 Ga0501225_0036265_182_841 211
1257 3300049775 Ga0501279_005340 Ga0501279_005340_917_1567 211
1258 3300049822 Ga0501035_0005850 Ga0501035_0005850_10388_11038 211
1259 3300050492 nmdc:mga0yw44_249988_c1 nmdc:mga0yw44_249988_c1_505_1161 211
1260 3300050493 nmdc:mga0k408_38890_c1 nmdc:mga0k408_38890_c1_1344_2000 211
1261 3300050494 nmdc:mga06z11_181609_c1 nmdc:mga06z11_181609_c1_336_992 211
1262 3300050511 nmdc:mga08y16_713877_c1 nmdc:mga08y16_713877_c1_51_707 211
1263 3300053083 Ga0495655_0041804 Ga0495655_0041804_503_1156 211
1264 3300053096 Ga0500641_0004715 Ga0500641_0004715_653_1312 211
1265 3300059505 Ga0587083_0009472 Ga0587083_0009472_553_1203 211
1266 3300005331 Ga0070670_100122348 Ga0070670_1001223482 212
1267 3300005334 Ga0068869_100234967 Ga0068869_1002349672 212
1268 3300005339 Ga0070660_100309191 Ga0070660_1003091912 212
1269 3300005347 Ga0070668_100002694 Ga0070668_1000026946 212
1270 3300005353 Ga0070669_100455006 Ga0070669_1004550062 212
1271 3300005354 Ga0070675_100193610 Ga0070675_1001936103 212
1272 3300005355 Ga0070671_100002059 Ga0070671_1000020593 212
1273 3300005367 Ga0070667_100045935 Ga0070667_1000459352 212
1274 3300005539 Ga0068853_100498310 Ga0068853_1004983101 212
1275 3300005543 Ga0070672_100081311 Ga0070672_1000813111 212
1276 3300005548 Ga0070665_100002765 Ga0070665_1000027658 212
1277 3300005548 Ga0070665_100222895 Ga0070665_1002228952 212
1278 3300005617 Ga0068859_100190796 Ga0068859_1001907962 212
1279 3300005617 Ga0068859_100617545 Ga0068859_1006175452 212
1280 3300005841 Ga0068863_100115166 Ga0068863_1001151662 212
1281 3300005842 Ga0068858_100015262 Ga0068858_1000152626 212
1282 3300005843 Ga0068860_100295364 Ga0068860_1002953642 212
1283 3300005843 Ga0068860_100894005 Ga0068860_1008940051 212
1284 3300005844 Ga0068862_100114975 Ga0068862_1001149752 212
1285 3300005844 Ga0068862_100125553 Ga0068862_1001255533 212
1286 3300006048 Ga0075363_100067715 Ga0075363_1000677152 212
1287 3300006175 Ga0070712_100692597 Ga0070712_1006925972 212
1288 3300006177 Ga0075362_10031648 Ga0075362_100316482 212
1289 3300006178 Ga0075367_10023446 Ga0075367_100234464 212
1290 3300006186 Ga0075369_10010300 Ga0075369_100103004 212
1291 3300006237 Ga0097621_100674729 Ga0097621_1006747291 212
1292 3300006881 Ga0068865_100065641 Ga0068865_1000656414 212
1293 3300006931 Ga0097620_100190804 Ga0097620_1001908042 212
1294 3300006931 Ga0097620_100617545 Ga0097620_1006175452 212
1295 3300009093 Ga0105240_10099663 Ga0105240_100996633 212
1296 3300009177 Ga0105248_10301396 Ga0105248_103013963 212
1297 3300009553 Ga0105249_10116229 Ga0105249_101162293 212
1298 3300011119 Ga0105246_10417718 Ga0105246_104177182 212
1299 3300013306 Ga0163162_10242120 Ga0163162_102421202 212
1300 3300013306 Ga0163162_10281536 Ga0163162_102815364 212
1301 3300013308 Ga0157375_10455448 Ga0157375_104554483 212
1302 3300014326 Ga0157380_10190075 Ga0157380_101900752 212
1303 3300014326 Ga0157380_10202545 Ga0157380_102025452 212
1304 3300014968 Ga0157379_10130440 Ga0157379_101304403 212
1305 3300025261 Ga0209233_1006703 Ga0209233_10067033 212
1306 3300025315 Ga0207697_10215222 Ga0207697_102152221 212
1307 3300025919 Ga0207657_10255068 Ga0207657_102550682 212
1308 3300025925 Ga0207650_10287687 Ga0207650_102876871 212
1309 3300025931 Ga0207644_10083612 Ga0207644_100836122 212
1310 3300025938 Ga0207704_10032793 Ga0207704_100327934 212
1311 3300025940 Ga0207691_10035352 Ga0207691_100353525 212
1312 3300025961 Ga0207712_10276740 Ga0207712_102767402 212
1313 3300025972 Ga0207668_10004010 Ga0207668_100040101 212
1314 3300025972 Ga0207668_10102320 Ga0207668_101023203 212
1315 3300025986 Ga0207658_10164233 Ga0207658_101642332 212
1316 3300026035 Ga0207703_10115854 Ga0207703_101158542 212
1317 3300026088 Ga0207641_10015779 Ga0207641_100157799 212
1318 3300026089 Ga0207648_10120633 Ga0207648_101206333 212
1319 3300028379 Ga0268266_10000288 Ga0268266_1000028811 212
1320 3300028379 Ga0268266_10217336 Ga0268266_102173362 212
1321 3300028380 Ga0268265_10137679 Ga0268265_101376793 212
1322 3300028380 Ga0268265_10167074 Ga0268265_101670742 212
1323 3300028381 Ga0268264_10140438 Ga0268264_101404382 212
1324 3300028381 Ga0268264_10389301 Ga0268264_103893011 212
1325 3300039450 Ga0436363_0794016 Ga0436363_0794016_3312_3971 212
1326 3300039453 Ga0436362_1180156 Ga0436362_1180156_561_1217 212
1327 3300041505 Ga0451849_1473880 Ga0451849_1473880_61_720 212
1328 3300042005 Ga0439448_0001683 Ga0439448_0001683_2593_3249 212
1329 3300046524 Ga0495648_0313011 Ga0495648_0313011_19_693 212
1330 3300046648 Ga0495611_0054670 Ga0495611_0054670_922_1581 212
1331 3300048928 Ga0496125_0239405 Ga0496125_0239405_346_1002 212
1332 3300049579 Ga0501043_0056816 Ga0501043_0056816_2021_2680 212
1333 3300049822 Ga0501035_0071035 Ga0501035_0071035_1418_2077 212
1334 3300050489 nmdc:mga03683_73906_c1 nmdc:mga03683_73906_c1_539_1198 212
1335 3300050490 nmdc:mga03n38_102138_c1 nmdc:mga03n38_102138_c1_166_825 212
1336 3300050492 nmdc:mga0yw44_100040_c1 nmdc:mga0yw44_100040_c1_209_868 212
1337 3300050494 nmdc:mga06z11_16900_c1 nmdc:mga06z11_16900_c1_1177_1836 212
1338 3300050516 nmdc:mga0sz30_6397_c1 nmdc:mga0sz30_6397_c1_1373_2032 212
1339 3300053730 Ga0500645_006515 Ga0500645_006515_1316_1975 212
1340 3300055283 Ga0500661_000688 Ga0500661_000688_925_1608 212
1341 3300005327 Ga0070658_10065255 Ga0070658_100652554 213
1342 3300005327 Ga0070658_10112723 Ga0070658_101127233 213
1343 3300005355 Ga0070671_100482603 Ga0070671_1004826031 213
1344 3300005366 Ga0070659_100166761 Ga0070659_1001667613 213
1345 3300005445 Ga0070708_100679272 Ga0070708_1006792722 213
1346 3300005456 Ga0070678_100432534 Ga0070678_1004325342 213
1347 3300005459 Ga0068867_100035106 Ga0068867_1000351062 213
1348 3300005459 Ga0068867_100324830 Ga0068867_1003248301 213
1349 3300005618 Ga0068864_100007201 Ga0068864_1000072011 213
1350 3300005841 Ga0068863_100000157 Ga0068863_1000001571 213
1351 3300005841 Ga0068863_100217191 Ga0068863_1002171912 213
1352 3300005842 Ga0068858_100000147 Ga0068858_1000001474 213
1353 3300006358 Ga0068871_100521795 Ga0068871_1005217951 213
1354 3300009551 Ga0105238_10007170 Ga0105238_1000717013 213
1355 3300014325 Ga0163163_10141410 Ga0163163_101414104 213
1356 3300014326 Ga0157380_10069733 Ga0157380_100697334 213
1357 3300014326 Ga0157380_10338925 Ga0157380_103389252 213
1358 3300014968 Ga0157379_10047497 Ga0157379_100474975 213
1359 3300021384 Ga0213876_10064609 Ga0213876_100646094 213
1360 3300025298 Ga0209050_1024116 Ga0209050_10241162 213
1361 3300025909 Ga0207705_10020786 Ga0207705_100207866 213
1362 3300025909 Ga0207705_10168971 Ga0207705_101689713 213
1363 3300025911 Ga0207654_10449803 Ga0207654_104498032 213
1364 3300025924 Ga0207694_10055050 Ga0207694_100550505 213
1365 3300025925 Ga0207650_10210064 Ga0207650_102100641 213
1366 3300025931 Ga0207644_10056479 Ga0207644_100564792 213
1367 3300025941 Ga0207711_10035717 Ga0207711_100357175 213
1368 3300026035 Ga0207703_10000050 Ga0207703_1000005072 213
1369 3300026088 Ga0207641_10000118 Ga0207641_1000011874 213
1370 3300026088 Ga0207641_10239359 Ga0207641_102393592 213
1371 3300026095 Ga0207676_10001602 Ga0207676_1000160210 213
1372 3300026116 Ga0207674_10329393 Ga0207674_103293932 213
1373 3300031824 Ga0307413_10276517 Ga0307413_102765172 213
1374 3300031852 Ga0307410_10126005 Ga0307410_101260052 213
1375 3300031901 Ga0307406_10112729 Ga0307406_101127294 213
1376 3300031911 Ga0307412_10962566 Ga0307412_109625661 213
1377 3300035172 Ga0373955_0447039 Ga0373955_0447039_34_702 213
1378 3300037418 Ga0395900_0100189 Ga0395900_0100189_485_1150 213
1379 3300037466 Ga0395898_0916915 Ga0395898_0916915_110_775 213
1380 3300039437 Ga0436365_1367961 Ga0436365_1367961_3327_3986 213
1381 3300042004 Ga0439445_0049864 Ga0439445_0049864_392_1051 213
1382 3300042007 Ga0439449_0061417 Ga0439449_0061417_607_1287 213
1383 3300044842 Ga0466957_0004295 Ga0466957_0004295_4286_4996 213
1384 3300046519 Ga0495632_0026589 Ga0495632_0026589_544_1209 213
1385 3300046616 Ga0495668_0006201 Ga0495668_0006201_5316_5984 213
1386 3300046616 Ga0495668_0183989 Ga0495668_0183989_24_689 213
1387 3300047470 Ga0495681_0012708 Ga0495681_0012708_3359_4024 213
1388 3300048903 Ga0496100_0215834 Ga0496100_0215834_277_936 213
1389 3300048903 Ga0496100_0605628 Ga0496100_0605628_101_769 213
1390 3300048904 Ga0496101_0432558 Ga0496101_0432558_101_769 213
1391 3300048905 Ga0496102_0060877 Ga0496102_0060877_1844_2503 213
1392 3300048907 Ga0496104_0178707 Ga0496104_0178707_1232_1900 213
1393 3300048908 Ga0496105_0078584 Ga0496105_0078584_1032_1700 213
1394 3300048909 Ga0496106_0184615 Ga0496106_0184615_549_1208 213
1395 3300048912 Ga0496109_0175191 Ga0496109_0175191_64_726 213
1396 3300048915 Ga0496112_0195621 Ga0496112_0195621_741_1403 213
1397 3300048917 Ga0496114_0110938 Ga0496114_0110938_1245_1913 213
1398 3300048919 Ga0496116_0093144 Ga0496116_0093144_950_1609 213
1399 3300048920 Ga0496117_0010332 Ga0496117_0010332_6051_6710 213
1400 3300048921 Ga0496118_0002674 Ga0496118_0002674_13935_14594 213
1401 3300048924 Ga0496121_0000042 Ga0496121_0000042_1611_2270 213
1402 3300048927 Ga0496124_0266773 Ga0496124_0266773_446_1102 213
1403 3300049570 Ga0501033_0193957 Ga0501033_0193957_346_1008 213
1404 3300005327 Ga0070658_10025061 Ga0070658_100250613 214
1405 3300005329 Ga0070683_100073051 Ga0070683_1000730512 214
1406 3300005329 Ga0070683_100105971 Ga0070683_1001059712 214
1407 3300005333 Ga0070677_10140985 Ga0070677_101409852 214
1408 3300005336 Ga0070680_100017574 Ga0070680_1000175742 214
1409 3300005337 Ga0070682_100666264 Ga0070682_1006662641 214
1410 3300005339 Ga0070660_100330256 Ga0070660_1003302561 214
1411 3300005344 Ga0070661_100019305 Ga0070661_1000193052 214
1412 3300005344 Ga0070661_100223344 Ga0070661_1002233442 214
1413 3300005347 Ga0070668_100558926 Ga0070668_1005589261 214
1414 3300005354 Ga0070675_100267181 Ga0070675_1002671812 214
1415 3300005354 Ga0070675_100542129 Ga0070675_1005421292 214
1416 3300005364 Ga0070673_100210585 Ga0070673_1002105852 214
1417 3300005366 Ga0070659_100043637 Ga0070659_1000436372 214
1418 3300005459 Ga0068867_100279949 Ga0068867_1002799491 214
1419 3300005530 Ga0070679_100020760 Ga0070679_1000207605 214
1420 3300005535 Ga0070684_100026787 Ga0070684_1000267874 214
1421 3300005535 Ga0070684_100136723 Ga0070684_1001367233 214
1422 3300005539 Ga0068853_100096737 Ga0068853_1000967372 214
1423 3300005543 Ga0070672_100288263 Ga0070672_1002882632 214
1424 3300005563 Ga0068855_100432928 Ga0068855_1004329282 214
1425 3300005564 Ga0070664_100680523 Ga0070664_1006805232 214
1426 3300005578 Ga0068854_100005268 Ga0068854_1000052683 214
1427 3300005614 Ga0068856_100048274 Ga0068856_1000482743 214
1428 3300005614 Ga0068856_100374807 Ga0068856_1003748072 214
1429 3300005615 Ga0070702_100103836 Ga0070702_1001038362 214
1430 3300005616 Ga0068852_100022892 Ga0068852_1000228923 214
1431 3300005616 Ga0068852_100114404 Ga0068852_1001144041 214
1432 3300005618 Ga0068864_100003974 Ga0068864_10000397411 214
1433 3300005834 Ga0068851_10269315 Ga0068851_102693151 214
1434 3300005842 Ga0068858_100023307 Ga0068858_1000233077 214
1435 3300006871 Ga0075434_100731966 Ga0075434_1007319662 214
1436 3300009177 Ga0105248_10330749 Ga0105248_103307492 214
1437 3300009551 Ga0105238_10098408 Ga0105238_100984083 214
1438 3300013102 Ga0157371_10153206 Ga0157371_101532062 214
1439 3300013105 Ga0157369_10213267 Ga0157369_102132672 214
1440 3300013105 Ga0157369_10460274 Ga0157369_104602742 214
1441 3300013296 Ga0157374_10516712 Ga0157374_105167122 214
1442 3300013306 Ga0163162_10721278 Ga0163162_107212782 214
1443 3300014325 Ga0163163_10173535 Ga0163163_101735352 214
1444 3300014745 Ga0157377_10143606 Ga0157377_101436062 214
1445 3300014968 Ga0157379_10487024 Ga0157379_104870242 214
1446 3300014969 Ga0157376_10317275 Ga0157376_103172752 214
1447 3300017792 Ga0163161_10238068 Ga0163161_102380682 214
1448 3300017792 Ga0163161_10433428 Ga0163161_104334281 214
1449 3300025901 Ga0207688_10025966 Ga0207688_100259664 214
1450 3300025908 Ga0207643_10058322 Ga0207643_100583223 214
1451 3300025909 Ga0207705_10083274 Ga0207705_100832742 214
1452 3300025914 Ga0207671_10129597 Ga0207671_101295971 214
1453 3300025919 Ga0207657_10658349 Ga0207657_106583491 214
1454 3300025921 Ga0207652_10039102 Ga0207652_100391022 214
1455 3300025925 Ga0207650_10099676 Ga0207650_100996762 214
1456 3300025926 Ga0207659_10037170 Ga0207659_100371703 214
1457 3300025931 Ga0207644_10506684 Ga0207644_105066841 214
1458 3300025932 Ga0207690_10022459 Ga0207690_100224596 214
1459 3300025932 Ga0207690_10224724 Ga0207690_102247241 214
1460 3300025933 Ga0207706_10138981 Ga0207706_101389812 214
1461 3300025940 Ga0207691_10156842 Ga0207691_101568422 214
1462 3300025941 Ga0207711_10043159 Ga0207711_100431595 214
1463 3300025942 Ga0207689_10001261 Ga0207689_1000126119 214
1464 3300025944 Ga0207661_10158002 Ga0207661_101580023 214
1465 3300025944 Ga0207661_10868707 Ga0207661_108687071 214
1466 3300025945 Ga0207679_10160870 Ga0207679_101608702 214
1467 3300025945 Ga0207679_10716404 Ga0207679_107164042 214
1468 3300025949 Ga0207667_11201184 Ga0207667_112011841 214
1469 3300025960 Ga0207651_10047950 Ga0207651_100479502 214
1470 3300025981 Ga0207640_10036829 Ga0207640_100368293 214
1471 3300025981 Ga0207640_10171226 Ga0207640_101712262 214
1472 3300026023 Ga0207677_10018338 Ga0207677_100183386 214
1473 3300026041 Ga0207639_10019801 Ga0207639_100198012 214
1474 3300026089 Ga0207648_10247198 Ga0207648_102471982 214
1475 3300026095 Ga0207676_10225628 Ga0207676_102256282 214
1476 3300026116 Ga0207674_10910183 Ga0207674_109101831 214
1477 3300026121 Ga0207683_10105422 Ga0207683_101054222 214
1478 3300026142 Ga0207698_10082992 Ga0207698_100829922 214
1479 3300026142 Ga0207698_10150976 Ga0207698_101509762 214
1480 3300026142 Ga0207698_10320338 Ga0207698_103203382 214
1481 3300028379 Ga0268266_10125849 Ga0268266_101258493 214
1482 3300028380 Ga0268265_10621248 Ga0268265_106212482 214
1483 3300028794 Ga0307515_10067106 Ga0307515_100671065 214
1484 3300031731 Ga0307405_10010908 Ga0307405_100109083 214
1485 3300031824 Ga0307413_10404903 Ga0307413_104049032 214
1486 3300031911 Ga0307412_10069337 Ga0307412_100693373 214
1487 3300031995 Ga0307409_100006462 Ga0307409_1000064626 214
1488 3300032002 Ga0307416_100000756 Ga0307416_1000007561 214
1489 3300032126 Ga0307415_100003711 Ga0307415_1000037117 214
1490 3300035092 Ga0373952_0053918 Ga0373952_0053918_78_743 214
1491 3300035171 Ga0373946_0198410 Ga0373946_0198410_202_867 214
1492 3300045051 Ga0451576_0310740 Ga0451576_0310740_353_1018 214
1493 3300046455 Ga0495603_0024175 Ga0495603_0024175_2751_3416 214
1494 3300046457 Ga0495590_0005201 Ga0495590_0005201_3094_3753 214
1495 3300046460 Ga0495638_0000545 Ga0495638_0000545_25549_26220 214
1496 3300046471 Ga0495650_0025538 Ga0495650_0025538_169_828 214
1497 3300046512 Ga0495610_0001121 Ga0495610_0001121_2359_3018 214
1498 3300046530 Ga0495654_0025003 Ga0495654_0025003_986_1645 214
1499 3300046616 Ga0495668_0005226 Ga0495668_0005226_3709_4368 214
1500 3300046660 Ga0495625_0124066 Ga0495625_0124066_235_894 214
1501 3300048091 Ga0495626_0000004 Ga0495626_0000004_23820_24482 214
1502 3300048904 Ga0496101_0040954 Ga0496101_0040954_2571_3236 214
1503 3300048909 Ga0496106_0052408 Ga0496106_0052408_1838_2503 214
1504 3300048913 Ga0496110_0233991 Ga0496110_0233991_382_1047 214
1505 3300048916 Ga0496113_0049599 Ga0496113_0049599_2367_3032 214
1506 3300049459 Ga0495678_000749 Ga0495678_000749_23561_24220 214
1507 3300050512 nmdc:mga0n895_325811_c1 nmdc:mga0n895_325811_c1_609_1274 214
1508 3300053086 Ga0500578_0000171 Ga0500578_0000171_17966_18625 214
1509 3300053108 Ga0500562_003508 Ga0500562_003508_2125_2784 214
1510 3300053118 Ga0500594_0000180 Ga0500594_0000180_4450_5109 214
1511 3300053136 Ga0500559_0000005 Ga0500559_0000005_216043_216711 214
1512 3300053156 Ga0500622_0000588 Ga0500622_0000588_19849_20508 214
1513 3300046520 Ga0495637_0017595 Ga0495637_0017595_691_1353 215
1514 3300047472 Ga0495686_0005253 Ga0495686_0005253_3629_4291 215
1515 3300035691 Ga0373931_0056599 Ga0373931_0056599_1328_1993 216
1516 3300006353 Ga0075370_10146216 Ga0075370_101462163 218
1517 3300032005 Ga0307411_10569723 Ga0307411_105697232 218
1518 3300037471 Ga0395905_0210180 Ga0395905_0210180_382_1053 218
1519 3300046660 Ga0495625_0025099 Ga0495625_0025099_685_1356 218
1520 3300046660 Ga0495625_0495893 Ga0495625_0495893_21_692 218
1521 3300049766 Ga0501269_010335 Ga0501269_010335_51_722 218
1522 3300050496 nmdc:mga07m45_274440_c1 nmdc:mga07m45_274440_c1_246_917 218
1523 3300053087 Ga0500643_008702 Ga0500643_008702_1533_2204 218
1524 3300053104 Ga0500556_0000053 Ga0500556_0000053_48526_49197 218
1525 3300053105 Ga0500557_019523 Ga0500557_019523_991_1662 218
1526 3300053122 Ga0500608_004094 Ga0500608_004094_1619_2290 218
1527 3300053130 Ga0500642_0000001 Ga0500642_0000001_239987_240658 218
1528 3300053730 Ga0500645_000236 Ga0500645_000236_15312_15983 218
1529 3300053730 Ga0500645_050547 Ga0500645_050547_374_1042 218
1530 3300044765 Ga0466970_0148827 Ga0466970_0148827_600_1274 219
1531 3300031548 Ga0307408_100972501 Ga0307408_1009725011 220
1532 3300031852 Ga0307410_10066439 Ga0307410_100664393 220
1533 3300031901 Ga0307406_10062785 Ga0307406_100627852 220
1534 3300032002 Ga0307416_100306190 Ga0307416_1003061902 220
1535 3300032002 Ga0307416_100919169 Ga0307416_1009191691 220
1536 3300032004 Ga0307414_10073777 Ga0307414_100737773 220
1537 3300049571 Ga0501034_0005442 Ga0501034_0005442_7365_8042 220
1538 3300002067 JGI24735J21928_10005493 JGI24735J21928_100054934 221
1539 3300005327 Ga0070658_10014808 Ga0070658_100148089 221
1540 3300005327 Ga0070658_10227060 Ga0070658_102270602 221
1541 3300005344 Ga0070661_100010594 Ga0070661_1000105948 221
1542 3300005344 Ga0070661_100383819 Ga0070661_1003838192 221
1543 3300005435 Ga0070714_100111614 Ga0070714_1001116143 221
1544 3300005436 Ga0070713_100205873 Ga0070713_1002058732 221
1545 3300005455 Ga0070663_100336074 Ga0070663_1003360742 221
1546 3300013102 Ga0157371_10109285 Ga0157371_101092852 221
1547 3300013104 Ga0157370_10582928 Ga0157370_105829281 221
1548 3300013105 Ga0157369_10002034 Ga0157369_1000203418 221
1549 3300013296 Ga0157374_10023048 Ga0157374_100230487 221
1550 3300025904 Ga0207647_10024093 Ga0207647_100240934 221
1551 3300025920 Ga0207649_10132061 Ga0207649_101320613 221
1552 3300026067 Ga0207678_10225611 Ga0207678_102256113 221
1553 3300035111 Ga0373923_0056425 Ga0373923_0056425_635_1312 221
1554 3300035118 Ga0373954_0001395 Ga0373954_0001395_4523_5200 221
1555 3300035692 Ga0373935_0195280 Ga0373935_0195280_97_774 221
1556 3300035724 Ga0373933_0097828 Ga0373933_0097828_474_1151 221
1557 3300036401 Ga0373937_0043317 Ga0373937_0043317_2855_3532 221
1558 3300044706 Ga0466964_0070882 Ga0466964_0070882_408_1091 221
1559 3300045976 Ga0466967_0807575 Ga0466967_0807575_169_852 221
1560 3300046679 Ga0495623_0017762 Ga0495623_0017762_1602_2279 221
1561 3300048088 Ga0495602_0039354 Ga0495602_0039354_1833_2510 221
1562 3300059490 Ga0587066_020630 Ga0587066_020630_109_786 221
1563 3300059492 Ga0587073_0019577 Ga0587073_0019577_306_983 221
1564 3300059508 Ga0587088_021807 Ga0587088_021807_137_814 221
1565 3300059642 Ga0587069_017715 Ga0587069_017715_111_788 221
1566 3300059644 Ga0587075_004802 Ga0587075_004802_222_899 221
1567 3300059646 Ga0587078_007937 Ga0587078_007937_159_836 221
1568 3300059649 Ga0587102_008584 Ga0587102_008584_108_785 221

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

62

128

0.97

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

62

121

0.95

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

44

120

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lq7-assembly1.cif.gz_B crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9773 9 215
3lq7-assembly1.cif.gz_A crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9667 9 214
3lq7-assembly2.cif.gz_C-2 crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9566 9 212
2ycd-assembly1.cif.gz_A-2 structure of a novel glutathione transferase from agrobacterium tumefaciens. 0.9538 6 214
3lq7-assembly1.cif.gz_B crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9482 9 215
ID Description Score Start End Superfamily
3lq7B02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9684 91 206 1.20.1050.10
2ycdA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9647 91 206 1.20.1050.10
3lq7C02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9619 91 206 1.20.1050.10
3lq7B02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9444 91 206 1.20.1050.10
2ycdA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9409 91 206 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A346N4Z6-F1-model_v4 Glutathione S-transferase family protein 0.9783 1 213 GO:0016740
AF-A0A6L4A036-F1-model_v4 deleted 0.975 1 190
AF-A0A519KRG8-F1-model_v4 Glutathione S-transferase family protein 0.9744 9 206 GO:0016740
AF-A0A3A1WLM7-F1-model_v4 Glutathione S-transferase family protein 0.9741 9 214 GO:0016740
AF-A0A418WA53-F1-model_v4 Glutathione S-transferase family protein 0.9738 9 215 GO:0016740

Feature Viewer

pLDDT pTM Quality
94.12 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map