F494802

General Info

Members Datasets Scaffolds Average Seq Length
1568 720 3136 430

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1260219|Ga0436365_1260219_567_1952
Length 461
Sequence MTPAARLSAAIEVIDTIEAQRSPAAQALKEWGTSHRFAGSGDRAAIAGLVWDVLRRRASSAWVMDDDAPRSRVLGMLKVERGLDAEAIAALCDGGRFAPGPLTEAEHGALATRSPADAPAPIAGDYPEWLDPYLAKVFGEDRAAEAAAMASRAPLDLRVNTLKAKREKVLASLKHLGAHETPWSPMGLRIELGADAKNPGVHAEEDFIKGLVEVQDEGSQLAALFSAAKPGEQVIDLCAGAGGKTLALAAMMQGKGRLIATDHDKRQLVPIHQRLSRAGVHNAEVRTPKGEAETLSDIKASADLVLIDAPCTGTGTWRRNPDAKWRMRPGALEIRVKDQIEVLDRAAAMVKPGGRIAYITCSVLPEENSEQVRAFVARHPAFAIASPGETVGVLWDKADAFAEAALRLPEGWLMTPRRTGTDGFFVAILRRTSRSAPQTTLIVSRGTSPSPARRRGQAGAN

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
89 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
90 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
91 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
92 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
93 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
94 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
95 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
96 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
97 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
98 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
99 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
100 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
101 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
102 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
112 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
113 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
114 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
146 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
147 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
148 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
149 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
150 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
151 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
152 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
155 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
158 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
160 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
162 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
231 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
232 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
233 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
234 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
238 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
242 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
243 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
244 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
245 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
246 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
247 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
248 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
249 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
250 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
251 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
252 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
253 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
254 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
255 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
256 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
257 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
258 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
259 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
260 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
261 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
262 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
263 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
264 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
265 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
266 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
267 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
268 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
269 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
270 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
271 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
272 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
273 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
274 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
275 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
276 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
277 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
278 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
279 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
280 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
281 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
282 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
283 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
284 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
285 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
286 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
287 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
288 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
289 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
290 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
291 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
292 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
293 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
294 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
295 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
296 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
297 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
298 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
299 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
300 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
301 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
302 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
303 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
304 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
305 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
306 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
307 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
308 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
309 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
310 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
311 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
312 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
313 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
314 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
315 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
316 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
317 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
318 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
319 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
320 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
321 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
322 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
323 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
324 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
325 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
326 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
327 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
328 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
329 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
330 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
331 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
332 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
333 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
334 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
335 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
336 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
337 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
338 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
339 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
340 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
341 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
342 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
343 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
344 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
345 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
346 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
347 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
348 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
349 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
350 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
351 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
352 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
353 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
354 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
355 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
356 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
357 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
358 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
359 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
360 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
361 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
362 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
363 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
364 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
365 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
366 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
367 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
368 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
369 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
370 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
371 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
372 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
373 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
374 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
375 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
376 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
377 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
378 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
379 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
380 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
381 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
382 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
383 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
384 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
385 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
386 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
387 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
388 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
389 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
390 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
391 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
392 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
393 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
394 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
395 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
396 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
397 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
398 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
399 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
400 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
401 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
402 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
403 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
404 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
405 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
406 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
407 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
408 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
409 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
410 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
413 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
415 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
419 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
423 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
424 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
425 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
426 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
427 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
428 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
429 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
430 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
431 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
432 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
433 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
434 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
435 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
436 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
439 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
440 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
441 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
442 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
443 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
444 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
445 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
446 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
447 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
448 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
449 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
450 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
451 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
452 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
453 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
454 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
455 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
456 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
457 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
458 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
459 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
460 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
461 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
462 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
463 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
464 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
465 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
466 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
467 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
468 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
469 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
470 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
471 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
472 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
473 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
474 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
475 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
476 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
477 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
478 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
479 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
480 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
481 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
482 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
483 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
484 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
485 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
486 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
487 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
488 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
489 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
490 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
491 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
492 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
493 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
494 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
495 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
496 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
497 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
498 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
499 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
500 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
501 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
502 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
503 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
504 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
505 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
506 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
507 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
508 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
509 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
510 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
511 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
512 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
513 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
514 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
515 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
516 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
517 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
518 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
519 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
520 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
521 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
522 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
523 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
524 2643221651 Afipia sp. Root123D2 Isolate Unclassified
525 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
526 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
527 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
528 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
529 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
530 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
531 2791355199
532 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
533 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
534 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
535 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
536 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
537 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
538 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
539 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
540 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
541 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
542 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
543 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
544 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
545 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
546 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
547 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
548 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
549 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
550 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
551 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
552 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
553 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
554 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
555 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
556 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
557 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
558 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
559 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
560 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
561 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
562 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
563 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
564 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
565 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
566 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
567 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
568 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
569 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
570 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
571 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
572 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
573 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
574 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
575 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
576 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
577 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
578 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
579 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
580 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
581 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
582 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
583 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
584 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
585 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
586 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
587 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
588 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
589 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
590 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
591 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
592 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
593 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
594 2904699407
595 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
596 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
597 2906610324
598 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
599 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
600 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
601 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
602 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
603 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
604 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
605 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
606 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
607 2922368715
608 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
609 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
610 2922425934
611 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
612 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
613 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
614 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
615 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
616 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
617 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
618 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
619 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
620 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
621 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
622 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
623 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
624 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
625 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
626 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
627 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
628 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
629 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
630 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
631 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
632 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
633 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
634 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
635 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
636 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
637 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
638 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
639 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
640 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
641 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
642 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
643 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
644 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
645 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
646 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
647 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
648 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
649 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
650 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
651 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
652 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
653 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
654 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
655 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
656 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
657 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
658 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
659 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
660 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
661 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
662 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
663 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
664 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
665 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
666 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
667 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
668 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
669 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
670 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
671 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
672 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
673 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
674 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
675 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
676 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
677 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
678 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
679 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
680 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
681 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
682 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
683 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
684 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
685 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
686 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
687 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
688 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
689 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
690 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
691 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
692 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
693 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
694 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
695 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
696 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
697 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
698 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
699 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
700 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
701 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
702 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
703 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
704 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
705 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
706 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
707 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
708 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
709 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
710 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
711 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
712 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
713 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
714 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
715 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
716 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
717 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
718 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
719 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
720 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.92
Metatranscriptomes 0.06
Isolates 14.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.48
Nodule 11.42
Rhizoplane 6.06
Rhizosphere 66.65
Stem 0
Stem Tuber 0
Unclassified 0.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1260219 3300039437 Bacteria 4209
2 2214745197 2209111006 Bacteria 17059
3 ARcpr5oldR_c000160 3300000041 Bacteria 11755
4 ARSoilYngRDRAFT_c00063 3300000042 Bacteria 17542
5 ARcpr5yngRDRAFT_c000034 3300000043 Bacteria 21574
6 ARSoilOldRDRAFT_c000147 3300000044 Bacteria 11995
7 JGI24737J22298_10000521 3300001990 Bacteria 13498
8 JGI24750J21931_1000637 3300002070 Bacteria 5248
9 JGI24035J26624_1000503 3300002126 Bacteria 3639
10 JGI24742J22300_10001833 3300002244 Bacteria 3386
11 JGI24751J29686_10009828 3300002459 Bacteria 1971
12 JGI25406J46586_10000047 3300003203 Bacteria 54770
13 JGI25153J46596_10000740 3300003215 Bacteria 20002
14 JGI25153J46596_10003653 3300003215 Bacteria 8519
15 JGI25160J50197_1001080 3300003354 Bacteria 13978
16 Ga0055531_10003612 3300003794 Bacteria 9778
17 Ga0065165_1025653 3300005262 Bacteria 1955
18 Ga0065712_10001661 3300005290 Bacteria 8971
19 Ga0065715_10004531 3300005293 Bacteria 5629
20 Ga0065715_10090446 3300005293 Bacteria 6991
21 Ga0070658_10059686 3300005327 Bacteria 3106
22 Ga0070658_10098944 3300005327 Bacteria 2410
23 Ga0070676_10000905 3300005328 Bacteria 14682
24 Ga0070683_100022201 3300005329 Bacteria 5669
25 Ga0070683_100089578 3300005329 Bacteria 2887
26 Ga0070690_100002135 3300005330 Bacteria 10564
27 Ga0070690_100004750 3300005330 Bacteria 7581
28 Ga0070670_100077822 3300005331 Bacteria 2849
29 Ga0070670_100096468 3300005331 Bacteria 2544
30 Ga0070677_10006219 3300005333 Bacteria 3964
31 Ga0068869_100008696 3300005334 Bacteria 6558
32 Ga0068869_100028213 3300005334 Bacteria 3921
33 Ga0070666_10005333 3300005335 Bacteria 7881
34 Ga0070666_10007448 3300005335 Bacteria 6748
35 Ga0070680_100011041 3300005336 Bacteria 6980
36 Ga0070680_100018350 3300005336 Bacteria 5526
37 Ga0070680_100162923 3300005336 Bacteria 1874
38 Ga0070682_100002763 3300005337 Bacteria 9720
39 Ga0070682_100028035 3300005337 Bacteria 3385
40 Ga0070682_100032890 3300005337 Bacteria 3147
41 Ga0068868_100009579 3300005338 Bacteria 6982
42 Ga0068868_100018639 3300005338 Bacteria 5193
43 Ga0068868_100031028 3300005338 Bacteria 4102
44 Ga0068868_100276285 3300005338 Bacteria 1420
45 Ga0070660_100000985 3300005339 Bacteria 19067
46 Ga0070660_100026110 3300005339 Bacteria 4347
47 Ga0070660_100035104 3300005339 Bacteria 3794
48 Ga0070660_100049723 3300005339 Bacteria 3224
49 Ga0070689_100010818 3300005340 Bacteria 6520
50 Ga0070689_100049462 3300005340 Bacteria 3246
51 Ga0070689_100067341 3300005340 Bacteria 2791
52 Ga0070689_100092019 3300005340 Bacteria 2392
53 Ga0070689_100109297 3300005340 Bacteria 2198
54 Ga0070691_10000060 3300005341 Bacteria 30257
55 Ga0070687_100001608 3300005343 Bacteria 8043
56 Ga0070687_100087956 3300005343 Bacteria 1712
57 Ga0070661_100024705 3300005344 Bacteria 4311
58 Ga0070661_100141724 3300005344 Bacteria 1812
59 Ga0070692_10002122 3300005345 Bacteria 7584
60 Ga0070692_10019414 3300005345 Bacteria 3280
61 Ga0070668_100004462 3300005347 Bacteria 10383
62 Ga0070668_100020450 3300005347 Bacteria 4995
63 Ga0070669_100001173 3300005353 Bacteria 19124
64 Ga0070675_100008084 3300005354 Bacteria 8154
65 Ga0070675_100025493 3300005354 Bacteria 4739
66 Ga0070675_100073782 3300005354 Bacteria 2833
67 Ga0070671_100000349 3300005355 Bacteria 31741
68 Ga0070671_100098641 3300005355 Bacteria 2451
69 Ga0070671_100201469 3300005355 Bacteria 1688
70 Ga0070674_100013947 3300005356 Bacteria 4983
71 Ga0070674_100032577 3300005356 Bacteria 3462
72 Ga0070674_100047762 3300005356 Bacteria 2935
73 Ga0070674_100064813 3300005356 Bacteria 2562
74 Ga0070673_100007101 3300005364 Bacteria 7355
75 Ga0070673_100055829 3300005364 Bacteria 3113
76 Ga0070673_100153399 3300005364 Bacteria 1953
77 Ga0070688_100000475 3300005365 Bacteria 20349
78 Ga0070688_100005391 3300005365 Bacteria 6731
79 Ga0070688_100013195 3300005365 Bacteria 4653
80 Ga0070659_100006503 3300005366 Bacteria 8436
81 Ga0070667_100000810 3300005367 Bacteria 29225
82 Ga0070667_100009653 3300005367 Bacteria 8006
83 Ga0070667_100015010 3300005367 Bacteria 6400
84 Ga0070667_100148326 3300005367 Bacteria 2058
85 Ga0070703_10007949 3300005406 Bacteria 2983
86 Ga0070709_10011165 3300005434 Bacteria 4996
87 Ga0070709_10021489 3300005434 Bacteria 3759
88 Ga0070709_10029765 3300005434 Bacteria 3270
89 Ga0070709_10068774 3300005434 Bacteria 2279
90 Ga0070714_100048569 3300005435 Bacteria 3610
91 Ga0070714_100051098 3300005435 Bacteria 3524
92 Ga0070714_100102147 3300005435 Bacteria 2527
93 Ga0070714_100111893 3300005435 Bacteria 2419
94 Ga0070714_100257729 3300005435 Bacteria 1614
95 Ga0070713_100012585 3300005436 Bacteria 6213
96 Ga0070713_100028354 3300005436 Bacteria 4421
97 Ga0070713_100029886 3300005436 Bacteria 4321
98 Ga0070713_100046807 3300005436 Bacteria 3551
99 Ga0070710_10001849 3300005437 Bacteria 9973
100 Ga0070710_10127488 3300005437 Bacteria 1548
101 Ga0070701_10005299 3300005438 Bacteria 5311
102 Ga0070701_10009325 3300005438 Bacteria 4295
103 Ga0070711_100020708 3300005439 Bacteria 4242
104 Ga0070711_100063443 3300005439 Bacteria 2579
105 Ga0070705_100015365 3300005440 Bacteria 3957
106 Ga0070700_100000664 3300005441 Bacteria 17024
107 Ga0070700_100032022 3300005441 Bacteria 3157
108 Ga0070700_100070960 3300005441 Bacteria 2222
109 Ga0070700_100116164 3300005441 Bacteria 1786
110 Ga0070694_100005788 3300005444 Bacteria 7498
111 Ga0070663_100003715 3300005455 Bacteria 8849
112 Ga0070663_100025035 3300005455 Bacteria 4025
113 Ga0070663_100034160 3300005455 Bacteria 3520
114 Ga0070663_100105892 3300005455 Bacteria 2106
115 Ga0070678_100003479 3300005456 Bacteria 8774
116 Ga0070678_100033155 3300005456 Bacteria 3582
117 Ga0070678_100038499 3300005456 Bacteria 3367
118 Ga0070678_100046523 3300005456 Bacteria 3111
119 Ga0070662_100005798 3300005457 Bacteria 7916
120 Ga0070662_100007680 3300005457 Bacteria 6996
121 Ga0070662_100086845 3300005457 Bacteria 2340
122 Ga0070681_10015477 3300005458 Bacteria 7595
123 Ga0070681_10021129 3300005458 Bacteria 6522
124 Ga0070681_10040444 3300005458 Bacteria 4671
125 Ga0070681_10115998 3300005458 Bacteria 2615
126 Ga0070681_10258209 3300005458 Bacteria 1654
127 Ga0068867_100002762 3300005459 Bacteria 12366
128 Ga0068867_100110168 3300005459 Bacteria 2114
129 Ga0068867_100118206 3300005459 Bacteria 2045
130 Ga0070685_10004766 3300005466 Bacteria 6867
131 Ga0070685_10009588 3300005466 Bacteria 5007
132 Ga0070679_100015288 3300005530 Bacteria 7374
133 Ga0070679_100029125 3300005530 Bacteria 5446
134 Ga0070679_100050504 3300005530 Bacteria 4143
135 Ga0070679_100062725 3300005530 Bacteria 3705
136 Ga0070679_100141517 3300005530 Bacteria 2385
137 Ga0070679_100148690 3300005530 Bacteria 2320
138 Ga0070679_100161968 3300005530 Bacteria 2211
139 Ga0070679_100188559 3300005530 Bacteria 2032
140 Ga0070684_100000464 3300005535 Bacteria 27749
141 Ga0070684_100010906 3300005535 Bacteria 7221
142 Ga0070684_100012560 3300005535 Bacteria 6794
143 Ga0070684_100026872 3300005535 Bacteria 4852
144 Ga0070697_100086517 3300005536 Bacteria 2586
145 Ga0068853_100003829 3300005539 Bacteria 11523
146 Ga0068853_100025347 3300005539 Bacteria 4976
147 Ga0068853_100073806 3300005539 Bacteria 2975
148 Ga0068853_100095505 3300005539 Bacteria 2621
149 Ga0070672_100145150 3300005543 Bacteria 1960
150 Ga0070672_100148853 3300005543 Bacteria 1936
151 Ga0070686_100001439 3300005544 Bacteria 13446
152 Ga0070686_100016485 3300005544 Bacteria 4300
153 Ga0070686_100044137 3300005544 Bacteria 2800
154 Ga0070686_100048141 3300005544 Bacteria 2700
155 Ga0070686_100063471 3300005544 Bacteria 2393
156 Ga0070695_100001320 3300005545 Bacteria 13725
157 Ga0070695_100001619 3300005545 Bacteria 12621
158 Ga0070695_100008441 3300005545 Bacteria 6112
159 Ga0070696_100011085 3300005546 Bacteria 6033
160 Ga0070693_100000266 3300005547 Bacteria 24669
161 Ga0070665_100083382 3300005548 Bacteria 3201
162 Ga0070665_100104524 3300005548 Bacteria 2834
163 Ga0070665_100147673 3300005548 Bacteria 2354
164 Ga0070665_100221489 3300005548 Bacteria 1892
165 Ga0070704_100001701 3300005549 Bacteria 11987
166 Ga0070704_100002112 3300005549 Bacteria 11059
167 Ga0068855_100034429 3300005563 Bacteria 6041
168 Ga0068855_100034770 3300005563 Bacteria 6006
169 Ga0068855_100059531 3300005563 Bacteria 4468
170 Ga0068855_100160757 3300005563 Bacteria 2549
171 Ga0068855_100208295 3300005563 Bacteria 2199
172 Ga0068855_100209137 3300005563 Bacteria 2193
173 Ga0068855_100277971 3300005563 Bacteria 1860
174 Ga0070664_100012689 3300005564 Bacteria 6860
175 Ga0070664_100155908 3300005564 Bacteria 2018
176 Ga0068857_100006833 3300005577 Bacteria 9820
177 Ga0068857_100049167 3300005577 Bacteria 3742
178 Ga0068854_100005898 3300005578 Bacteria 7758
179 Ga0068854_100024241 3300005578 Bacteria 4152
180 Ga0068856_100000020 3300005614 Bacteria 146775
181 Ga0068856_100149477 3300005614 Bacteria 2344
182 Ga0070702_100004216 3300005615 Bacteria 6541
183 Ga0068852_100005120 3300005616 Bacteria 9342
184 Ga0068852_100007306 3300005616 Bacteria 8056
185 Ga0068852_100015569 3300005616 Bacteria 5905
186 Ga0068852_100015717 3300005616 Bacteria 5882
187 Ga0068852_100042670 3300005616 Bacteria 3841
188 Ga0068852_100081153 3300005616 Bacteria 2878
189 Ga0068859_100013817 3300005617 Bacteria 8096
190 Ga0068859_100037907 3300005617 Bacteria 4837
191 Ga0068859_100046985 3300005617 Bacteria 4336
192 Ga0068859_100077641 3300005617 Bacteria 3361
193 Ga0068864_100019484 3300005618 Bacteria 5673
194 Ga0068864_100046630 3300005618 Bacteria 3719
195 Ga0068864_100129170 3300005618 Bacteria 2268
196 Ga0068864_100262673 3300005618 Bacteria 1606
197 Ga0068866_10000694 3300005718 Bacteria 15306
198 Ga0068866_10029627 3300005718 Bacteria 2619
199 Ga0068861_100013181 3300005719 Bacteria 5783
200 Ga0068861_100023990 3300005719 Bacteria 4406
201 Ga0068861_100110233 3300005719 Bacteria 2204
202 Ga0068870_10009104 3300005840 Bacteria 4499
203 Ga0068863_100001201 3300005841 Bacteria 25868
204 Ga0068863_100007995 3300005841 Bacteria 10337
205 Ga0068863_100076014 3300005841 Bacteria 3177
206 Ga0068858_100016234 3300005842 Bacteria 6995
207 Ga0068858_100023790 3300005842 Bacteria 5708
208 Ga0068858_100051014 3300005842 Bacteria 3828
209 Ga0068858_100067510 3300005842 Bacteria 3313
210 Ga0068860_100001359 3300005843 Bacteria 26585
211 Ga0068860_100001708 3300005843 Bacteria 23464
212 Ga0068860_100024209 3300005843 Bacteria 5870
213 Ga0068860_100081370 3300005843 Bacteria 3080
214 Ga0068860_100132560 3300005843 Bacteria 2392
215 Ga0068862_100005931 3300005844 Bacteria 10175
216 Ga0068862_100042098 3300005844 Bacteria 3889
217 Ga0068862_100058981 3300005844 Bacteria 3294
218 Ga0081455_10000009 3300005937 Bacteria 249885
219 Ga0081455_10006680 3300005937 Bacteria 12325
220 Ga0081455_10030306 3300005937 Bacteria 4916
221 Ga0081455_10096354 3300005937 Bacteria 2386
222 Ga0081540_1000143 3300005983 Bacteria 74581
223 Ga0081540_1002154 3300005983 Bacteria 16364
224 Ga0081540_1002625 3300005983 Bacteria 14612
225 Ga0081540_1003015 3300005983 Bacteria 13484
226 Ga0081540_1005422 3300005983 Bacteria 9519
227 Ga0081540_1006906 3300005983 Bacteria 8187
228 Ga0081540_1011009 3300005983 Bacteria 6074
229 Ga0081540_1016111 3300005983 Bacteria 4699
230 Ga0081540_1023632 3300005983 Bacteria 3589
231 Ga0081540_1028760 3300005983 Bacteria 3113
232 Ga0081539_10000140 3300005985 Bacteria 166746
233 Ga0081539_10002339 3300005985 Bacteria 27248
234 Ga0081539_10018773 3300005985 Bacteria 4774
235 Ga0070717_10001862 3300006028 Bacteria 14744
236 Ga0070717_10045194 3300006028 Bacteria 3600
237 Ga0075365_10041177 3300006038 Bacteria 3017
238 Ga0075365_10127397 3300006038 Bacteria 1760
239 Ga0075368_10014162 3300006042 Bacteria 2941
240 Ga0075363_100004915 3300006048 Bacteria 5910
241 Ga0075363_100046915 3300006048 Bacteria 2293
242 Ga0075364_10024537 3300006051 Bacteria 3830
243 Ga0070715_10003038 3300006163 Bacteria 5257
244 Ga0070715_10012125 3300006163 Bacteria 3125
245 Ga0070715_10065946 3300006163 Bacteria 1604
246 Ga0070716_100003599 3300006173 Bacteria 7323
247 Ga0070712_100004909 3300006175 Bacteria 8269
248 Ga0070712_100027618 3300006175 Bacteria 3790
249 Ga0070712_100029025 3300006175 Bacteria 3706
250 Ga0070712_100048375 3300006175 Bacteria 2947
251 Ga0070712_100061706 3300006175 Bacteria 2649
252 Ga0070712_100220162 3300006175 Bacteria 1502
253 Ga0075362_10003689 3300006177 Bacteria 5406
254 Ga0075362_10025532 3300006177 Bacteria 2517
255 Ga0075362_10036285 3300006177 Bacteria 2156
256 Ga0075367_10005474 3300006178 Bacteria 6311
257 Ga0075367_10018220 3300006178 Bacteria 3870
258 Ga0075367_10026576 3300006178 Bacteria 3285
259 Ga0075369_10045777 3300006186 Bacteria 1882
260 Ga0075366_10059614 3300006195 Bacteria 2267
261 Ga0097621_100001359 3300006237 Bacteria 16830
262 Ga0097621_100085119 3300006237 Bacteria 2636
263 Ga0075370_10047579 3300006353 Bacteria 2429
264 Ga0075370_10075879 3300006353 Bacteria 1927
265 Ga0075370_10103009 3300006353 Bacteria 1653
266 Ga0068871_100003508 3300006358 Bacteria 10795
267 Ga0068871_100081780 3300006358 Bacteria 2677
268 Ga0075430_100000244 3300006846 Bacteria 37691
269 Ga0075434_100026091 3300006871 Bacteria 5722
270 Ga0075434_100097339 3300006871 Bacteria 2947
271 Ga0068865_100001830 3300006881 Bacteria 12495
272 Ga0068865_100025798 3300006881 Bacteria 3870
273 Ga0068865_100079400 3300006881 Bacteria 2350
274 Ga0075436_100004211 3300006914 Bacteria 9869
275 Ga0075436_100031832 3300006914 Bacteria 3634
276 Ga0097620_100013818 3300006931 Bacteria 8096
277 Ga0097620_100037906 3300006931 Bacteria 4837
278 Ga0097620_100046986 3300006931 Bacteria 4336
279 Ga0097620_100077644 3300006931 Bacteria 3361
280 Ga0099824_1007930 3300006942 Bacteria 13807
281 Ga0099824_1015115 3300006942 Bacteria 7438
282 Ga0075435_100013273 3300007076 Bacteria 6121
283 Ga0075435_100191542 3300007076 Bacteria 1731
284 Ga0099795_10025171 3300007788 Bacteria 1993
285 Ga0105250_10045953 3300009092 Bacteria 1751
286 Ga0105240_10017915 3300009093 Bacteria 9527
287 Ga0105240_10038025 3300009093 Bacteria 6178
288 Ga0105240_10045568 3300009093 Bacteria 5562
289 Ga0105240_10047264 3300009093 Bacteria 5446
290 Ga0105240_10073684 3300009093 Bacteria 4216
291 Ga0105240_10173056 3300009093 Bacteria 2555
292 Ga0105240_10275619 3300009093 Bacteria 1935
293 Ga0111539_10000173 3300009094 Bacteria 74781
294 Ga0111539_10018558 3300009094 Bacteria 8616
295 Ga0111539_10078446 3300009094 Bacteria 3885
296 Ga0111539_10084268 3300009094 Bacteria 3738
297 Ga0111539_10087823 3300009094 Bacteria 3653
298 Ga0111539_10186184 3300009094 Bacteria 2424
299 Ga0105245_10003312 3300009098 Bacteria 14462
300 Ga0105245_10021446 3300009098 Bacteria 5668
301 Ga0105245_10106651 3300009098 Bacteria 2600
302 Ga0105247_10024725 3300009101 Bacteria 3621
303 Ga0105247_10026306 3300009101 Bacteria 3512
304 Ga0114129_10187696 3300009147 Bacteria 2809
305 Ga0114129_10354797 3300009147 Bacteria 1942
306 Ga0105243_10011575 3300009148 Bacteria 6675
307 Ga0105243_10130437 3300009148 Bacteria 2132
308 Ga0105241_10009656 3300009174 Bacteria 7091
309 Ga0105241_10126238 3300009174 Bacteria 2066
310 Ga0105242_10000399 3300009176 Bacteria 34466
311 Ga0105242_10033580 3300009176 Bacteria 4109
312 Ga0105242_10163493 3300009176 Unclassified 1950
313 Ga0105248_10013945 3300009177 Bacteria 8843
314 Ga0105248_10032551 3300009177 Bacteria 5827
315 Ga0105248_10235723 3300009177 Bacteria 2060
316 Ga0105248_10241572 3300009177 Bacteria 2033
317 Ga0105248_10283693 3300009177 Bacteria 1864
318 Ga0105237_10034867 3300009545 Bacteria 5092
319 Ga0105237_10062673 3300009545 Bacteria 3718
320 Ga0105237_10184625 3300009545 Bacteria 2086
321 Ga0105237_10386896 3300009545 Bacteria 1404
322 Ga0105238_10008599 3300009551 Bacteria 10215
323 Ga0105238_10018493 3300009551 Bacteria 7090
324 Ga0105238_10072194 3300009551 Bacteria 3448
325 Ga0105238_10082718 3300009551 Bacteria 3200
326 Ga0105238_10145210 3300009551 Bacteria 2349
327 Ga0105249_10029823 3300009553 Bacteria 4928
328 Ga0105239_10067902 3300010375 Bacteria 3917
329 Ga0105239_10080663 3300010375 Bacteria 3580
330 Ga0105239_10082676 3300010375 Bacteria 3537
331 Ga0105239_10108616 3300010375 Bacteria 3074
332 Ga0105239_10201369 3300010375 Bacteria 2230
333 Ga0105239_10279979 3300010375 Bacteria 1877
334 Ga0105246_10000033 3300011119 Bacteria 50575
335 Ga0105246_10023862 3300011119 Bacteria 3964
336 Ga0157373_10005894 3300013100 Bacteria 9167
337 Ga0157371_10031668 3300013102 Bacteria 3811
338 Ga0157370_10128904 3300013104 Bacteria 2360
339 Ga0157370_10186971 3300013104 Bacteria 1923
340 Ga0157369_10010862 3300013105 Bacteria 10373
341 Ga0157369_10088464 3300013105 Bacteria 3306
342 Ga0157369_10097519 3300013105 Bacteria 3136
343 Ga0157374_10018913 3300013296 Bacteria 6090
344 Ga0157374_10087148 3300013296 Bacteria 2971
345 Ga0157378_10009284 3300013297 Bacteria 8568
346 Ga0157378_10057957 3300013297 Bacteria 3454
347 Ga0157378_10073594 3300013297 Bacteria 3072
348 Ga0163162_10007926 3300013306 Bacteria 10355
349 Ga0163162_10049822 3300013306 Bacteria 4199
350 Ga0163162_10126869 3300013306 Bacteria 2658
351 Ga0163162_10312021 3300013306 Bacteria 1705
352 Ga0157372_10001162 3300013307 Bacteria 28497
353 Ga0157372_10067851 3300013307 Bacteria 4009
354 Ga0157372_10154780 3300013307 Bacteria 2647
355 Ga0157375_10018904 3300013308 Bacteria 6255
356 Ga0157375_10021748 3300013308 Bacteria 5889
357 Ga0157375_10033246 3300013308 Bacteria 4898
358 Ga0157375_10141304 3300013308 Bacteria 2535
359 Ga0157375_10321881 3300013308 Bacteria 1711
360 Ga0163163_10001787 3300014325 Bacteria 18120
361 Ga0163163_10060072 3300014325 Bacteria 3763
362 Ga0163163_10098726 3300014325 Bacteria 2941
363 Ga0163163_10152441 3300014325 Bacteria 2355
364 Ga0157380_10064729 3300014326 Bacteria 2936
365 Ga0157377_10000740 3300014745 Bacteria 13498
366 Ga0157377_10024449 3300014745 Bacteria 3211
367 Ga0157379_10003378 3300014968 Bacteria 13509
368 Ga0157379_10097715 3300014968 Bacteria 2636
369 Ga0157376_10005599 3300014969 Bacteria 8786
370 Ga0157376_10229775 3300014969 Bacteria 1723
371 Ga0163161_10008117 3300017792 Bacteria 7261
372 Ga0163161_10008394 3300017792 Bacteria 7148
373 Ga0206356_10558017 3300020070 Bacteria 1731
374 Ga0214544_1000002 3300021320 Bacteria 753857
375 Ga0214542_1000001 3300021321 Bacteria 1018696
376 Ga0214545_1000001 3300021324 Bacteria 1092817
377 Ga0214543_1000001 3300021327 Bacteria 776921
378 Ga0213872_10023205 3300021361 Bacteria 2855
379 Ga0213876_10009439 3300021384 Bacteria 5251
380 Ga0213876_10056797 3300021384 Bacteria 2066
381 Ga0213875_10000007 3300021388 Bacteria 562717
382 Ga0209677_102829 3300025253 Bacteria 6135
383 Ga0209148_1000428 3300025254 Bacteria 46613
384 Ga0209233_1000804 3300025261 Bacteria 14031
385 Ga0209233_1006202 3300025261 Bacteria 3874
386 Ga0209233_1008608 3300025261 Bacteria 3145
387 Ga0207666_1000006 3300025271 Bacteria 51882
388 Ga0207666_1001276 3300025271 Bacteria 2975
389 Ga0209455_1002286 3300025272 Bacteria 7540
390 Ga0207673_1000712 3300025290 Bacteria 3559
391 Ga0209564_1001578 3300025295 Bacteria 22285
392 Ga0209564_1003479 3300025295 Bacteria 10734
393 Ga0209564_1026529 3300025295 Bacteria 1910
394 Ga0209758_1000140 3300025297 Bacteria 174267
395 Ga0209758_1000321 3300025297 Bacteria 92591
396 Ga0209758_1001092 3300025297 Bacteria 35145
397 Ga0209758_1001514 3300025297 Bacteria 26963
398 Ga0209758_1001968 3300025297 Bacteria 22196
399 Ga0209758_1002659 3300025297 Bacteria 17684
400 Ga0209758_1003492 3300025297 Bacteria 14221
401 Ga0209758_1008964 3300025297 Bacteria 6338
402 Ga0209758_1017349 3300025297 Bacteria 3592
403 Ga0209256_1005434 3300025299 Bacteria 7340
404 Ga0207426_1000278 3300025302 Bacteria 105775
405 Ga0207426_1000378 3300025302 Bacteria 76958
406 Ga0207426_1002170 3300025302 Bacteria 13286
407 Ga0207426_1018412 3300025302 Bacteria 2460
408 Ga0207426_1023520 3300025302 Bacteria 2101
409 Ga0209257_1000522 3300025304 Bacteria 66723
410 Ga0207697_10000009 3300025315 Bacteria 67526
411 Ga0207697_10004408 3300025315 Bacteria 6729
412 Ga0207656_10012199 3300025321 Bacteria 3262
413 Ga0207653_10036515 3300025885 Bacteria 1601
414 Ga0207682_10000301 3300025893 Bacteria 22279
415 Ga0207692_10000849 3300025898 Bacteria 10974
416 Ga0207692_10006397 3300025898 Bacteria 4775
417 Ga0207692_10017678 3300025898 Bacteria 3184
418 Ga0207692_10034555 3300025898 Bacteria 2448
419 Ga0207642_10043027 3300025899 Bacteria 1989
420 Ga0207710_10018364 3300025900 Bacteria 2974
421 Ga0207688_10000012 3300025901 Bacteria 60353
422 Ga0207688_10000263 3300025901 Bacteria 23901
423 Ga0207688_10041797 3300025901 Bacteria 2551
424 Ga0207680_10007512 3300025903 Bacteria 5322
425 Ga0207680_10020383 3300025903 Bacteria 3567
426 Ga0207680_10029543 3300025903 Bacteria 3081
427 Ga0207647_10002921 3300025904 Bacteria 12870
428 Ga0207647_10006251 3300025904 Bacteria 8674
429 Ga0207647_10033866 3300025904 Bacteria 3267
430 Ga0207685_10004719 3300025905 Bacteria 3504
431 Ga0207699_10007610 3300025906 Bacteria 5303
432 Ga0207699_10017739 3300025906 Bacteria 3756
433 Ga0207699_10025811 3300025906 Bacteria 3231
434 Ga0207645_10000124 3300025907 Bacteria 58746
435 Ga0207645_10022280 3300025907 Bacteria 4123
436 Ga0207645_10056703 3300025907 Bacteria 2501
437 Ga0207645_10086454 3300025907 Bacteria 2015
438 Ga0207643_10000046 3300025908 Bacteria 80736
439 Ga0207643_10000889 3300025908 Bacteria 18002
440 Ga0207705_10075165 3300025909 Bacteria 2453
441 Ga0207705_10115555 3300025909 Bacteria 1986
442 Ga0207684_10003987 3300025910 Bacteria 14129
443 Ga0207684_10133715 3300025910 Bacteria 2129
444 Ga0207654_10004889 3300025911 Bacteria 6780
445 Ga0207654_10015528 3300025911 Bacteria 3953
446 Ga0207707_10009522 3300025912 Bacteria 8427
447 Ga0207707_10011411 3300025912 Bacteria 7738
448 Ga0207707_10024737 3300025912 Bacteria 5253
449 Ga0207707_10027011 3300025912 Bacteria 5017
450 Ga0207707_10033774 3300025912 Bacteria 4477
451 Ga0207707_10059952 3300025912 Bacteria 3311
452 Ga0207707_10294682 3300025912 Bacteria 1403
453 Ga0207695_10000008 3300025913 Bacteria 1058268
454 Ga0207695_10008039 3300025913 Bacteria 13279
455 Ga0207695_10081943 3300025913 Bacteria 3264
456 Ga0207695_10120229 3300025913 Bacteria 2596
457 Ga0207671_10007118 3300025914 Bacteria 9772
458 Ga0207671_10044503 3300025914 Bacteria 3283
459 Ga0207671_10120545 3300025914 Bacteria 2005
460 Ga0207693_10001080 3300025915 Bacteria 24461
461 Ga0207693_10001875 3300025915 Bacteria 18415
462 Ga0207693_10007332 3300025915 Bacteria 9072
463 Ga0207693_10018304 3300025915 Bacteria 5582
464 Ga0207693_10050341 3300025915 Bacteria 3272
465 Ga0207693_10055325 3300025915 Bacteria 3113
466 Ga0207693_10174151 3300025915 Bacteria 1694
467 Ga0207663_10000347 3300025916 Bacteria 20128
468 Ga0207663_10010022 3300025916 Bacteria 5022
469 Ga0207663_10021116 3300025916 Bacteria 3701
470 Ga0207663_10143834 3300025916 Bacteria 1665
471 Ga0207660_10071085 3300025917 Bacteria 2531
472 Ga0207660_10109729 3300025917 Bacteria 2074
473 Ga0207660_10133279 3300025917 Bacteria 1893
474 Ga0207660_10160578 3300025917 Bacteria 1733
475 Ga0207662_10000154 3300025918 Bacteria 32501
476 Ga0207662_10000222 3300025918 Bacteria 26332
477 Ga0207662_10032507 3300025918 Bacteria 3038
478 Ga0207662_10144063 3300025918 Bacteria 1511
479 Ga0207657_10000162 3300025919 Bacteria 68121
480 Ga0207657_10030200 3300025919 Bacteria 4922
481 Ga0207657_10060302 3300025919 Bacteria 3256
482 Ga0207657_10071568 3300025919 Bacteria 2936
483 Ga0207657_10152882 3300025919 Bacteria 1879
484 Ga0207649_10000798 3300025920 Bacteria 20284
485 Ga0207652_10021470 3300025921 Bacteria 5329
486 Ga0207652_10045919 3300025921 Bacteria 3725
487 Ga0207652_10117589 3300025921 Bacteria 2362
488 Ga0207652_10122151 3300025921 Bacteria 2318
489 Ga0207652_10308076 3300025921 Bacteria 1429
490 Ga0207681_10007488 3300025923 Bacteria 6687
491 Ga0207681_10094623 3300025923 Bacteria 2141
492 Ga0207694_10018170 3300025924 Bacteria 5317
493 Ga0207694_10048738 3300025924 Bacteria 3278
494 Ga0207650_10054665 3300025925 Bacteria 2963
495 Ga0207659_10000762 3300025926 Bacteria 19116
496 Ga0207659_10140306 3300025926 Bacteria 1875
497 Ga0207659_10199744 3300025926 Bacteria 1596
498 Ga0207687_10008325 3300025927 Bacteria 6787
499 Ga0207687_10023134 3300025927 Bacteria 4140
500 Ga0207687_10131080 3300025927 Bacteria 1890
501 Ga0207700_10000290 3300025928 Bacteria 29736
502 Ga0207700_10078975 3300025928 Bacteria 2561
503 Ga0207700_10082443 3300025928 Bacteria 2515
504 Ga0207700_10102014 3300025928 Bacteria 2290
505 Ga0207700_10178814 3300025928 Bacteria 1775
506 Ga0207664_10010393 3300025929 Bacteria 6574
507 Ga0207664_10011397 3300025929 Bacteria 6318
508 Ga0207664_10029434 3300025929 Bacteria 4183
509 Ga0207664_10096420 3300025929 Bacteria 2434
510 Ga0207664_10097259 3300025929 Bacteria 2425
511 Ga0207644_10024576 3300025931 Bacteria 4137
512 Ga0207644_10056409 3300025931 Bacteria 2835
513 Ga0207690_10006396 3300025932 Bacteria 6981
514 Ga0207690_10100607 3300025932 Bacteria 2063
515 Ga0207706_10000929 3300025933 Bacteria 30046
516 Ga0207706_10020484 3300025933 Bacteria 5944
517 Ga0207706_10155385 3300025933 Bacteria 2012
518 Ga0207686_10084159 3300025934 Bacteria 2083
519 Ga0207686_10090123 3300025934 Bacteria 2023
520 Ga0207709_10000256 3300025935 Bacteria 63853
521 Ga0207709_10106054 3300025935 Bacteria 1869
522 Ga0207670_10003293 3300025936 Bacteria 8558
523 Ga0207670_10010584 3300025936 Bacteria 5320
524 Ga0207670_10020290 3300025936 Bacteria 4081
525 Ga0207670_10066843 3300025936 Bacteria 2471
526 Ga0207669_10001769 3300025937 Bacteria 9164
527 Ga0207669_10045983 3300025937 Bacteria 2576
528 Ga0207669_10051306 3300025937 Bacteria 2471
529 Ga0207669_10078648 3300025937 Bacteria 2102
530 Ga0207669_10096367 3300025937 Bacteria 1942
531 Ga0207669_10109797 3300025937 Bacteria 1845
532 Ga0207704_10021960 3300025938 Bacteria 3410
533 Ga0207704_10037137 3300025938 Bacteria 2811
534 Ga0207665_10000719 3300025939 Bacteria 22485
535 Ga0207665_10043622 3300025939 Bacteria 2999
536 Ga0207665_10105306 3300025939 Bacteria 1975
537 Ga0207691_10006340 3300025940 Bacteria 11426
538 Ga0207691_10006425 3300025940 Bacteria 11355
539 Ga0207691_10015435 3300025940 Bacteria 7265
540 Ga0207691_10118759 3300025940 Bacteria 2346
541 Ga0207711_10036622 3300025941 Bacteria 4164
542 Ga0207711_10053917 3300025941 Bacteria 3449
543 Ga0207711_10182249 3300025941 Bacteria 1910
544 Ga0207689_10000109 3300025942 Bacteria 67941
545 Ga0207689_10031109 3300025942 Bacteria 4446
546 Ga0207689_10051147 3300025942 Bacteria 3406
547 Ga0207689_10052656 3300025942 Bacteria 3353
548 Ga0207661_10001655 3300025944 Bacteria 15191
549 Ga0207661_10006709 3300025944 Bacteria 8143
550 Ga0207661_10093766 3300025944 Bacteria 2506
551 Ga0207661_10096435 3300025944 Bacteria 2474
552 Ga0207661_10115604 3300025944 Bacteria 2276
553 Ga0207661_10148070 3300025944 Bacteria 2027
554 Ga0207679_10000763 3300025945 Bacteria 21224
555 Ga0207679_10027676 3300025945 Bacteria 3924
556 Ga0207679_10039187 3300025945 Bacteria 3382
557 Ga0207679_10210571 3300025945 Bacteria 1630
558 Ga0207667_10021843 3300025949 Bacteria 7083
559 Ga0207667_10034067 3300025949 Bacteria 5471
560 Ga0207667_10109822 3300025949 Bacteria 2845
561 Ga0207667_10119538 3300025949 Bacteria 2715
562 Ga0207667_10123233 3300025949 Bacteria 2671
563 Ga0207667_10164754 3300025949 Bacteria 2279
564 Ga0207667_10170068 3300025949 Bacteria 2240
565 Ga0207651_10000900 3300025960 Bacteria 13066
566 Ga0207651_10004250 3300025960 Bacteria 7184
567 Ga0207651_10130307 3300025960 Bacteria 1924
568 Ga0207712_10010883 3300025961 Bacteria 5790
569 Ga0207712_10022037 3300025961 Bacteria 4190
570 Ga0207712_10030069 3300025961 Bacteria 3650
571 Ga0207712_10040854 3300025961 Bacteria 3186
572 Ga0207668_10015835 3300025972 Bacteria 4694
573 Ga0207668_10030283 3300025972 Bacteria 3555
574 Ga0207640_10004377 3300025981 Bacteria 7650
575 Ga0207658_10018594 3300025986 Bacteria 4802
576 Ga0207658_10034145 3300025986 Bacteria 3633
577 Ga0207677_10007601 3300026023 Bacteria 6012
578 Ga0207677_10010239 3300026023 Bacteria 5300
579 Ga0207677_10011127 3300026023 Bacteria 5117
580 Ga0207703_10012561 3300026035 Bacteria 6602
581 Ga0207703_10013883 3300026035 Bacteria 6279
582 Ga0207703_10028301 3300026035 Bacteria 4417
583 Ga0207703_10060311 3300026035 Bacteria 3102
584 Ga0207639_10039190 3300026041 Bacteria 3529
585 Ga0207639_10053845 3300026041 Bacteria 3072
586 Ga0207639_10195327 3300026041 Bacteria 1731
587 Ga0207678_10004447 3300026067 Bacteria 12606
588 Ga0207678_10006545 3300026067 Bacteria 10328
589 Ga0207678_10008261 3300026067 Bacteria 9171
590 Ga0207678_10029694 3300026067 Bacteria 4773
591 Ga0207678_10034437 3300026067 Bacteria 4411
592 Ga0207678_10056317 3300026067 Bacteria 3384
593 Ga0207708_10000098 3300026075 Bacteria 67005
594 Ga0207708_10002092 3300026075 Bacteria 14690
595 Ga0207708_10006322 3300026075 Bacteria 8779
596 Ga0207708_10012533 3300026075 Bacteria 6321
597 Ga0207708_10109972 3300026075 Bacteria 2138
598 Ga0207702_10000002 3300026078 Bacteria 491507
599 Ga0207702_10002142 3300026078 Bacteria 18978
600 Ga0207702_10114296 3300026078 Bacteria 2405
601 Ga0207702_10115998 3300026078 Bacteria 2389
602 Ga0207641_10038224 3300026088 Bacteria 4011
603 Ga0207641_10135346 3300026088 Bacteria 2217
604 Ga0207641_10150619 3300026088 Bacteria 2106
605 Ga0207648_10001639 3300026089 Bacteria 24530
606 Ga0207648_10002003 3300026089 Bacteria 22234
607 Ga0207648_10010667 3300026089 Bacteria 8687
608 Ga0207648_10059959 3300026089 Bacteria 3318
609 Ga0207676_10017955 3300026095 Bacteria 5133
610 Ga0207676_10031583 3300026095 Bacteria 3983
611 Ga0207676_10095444 3300026095 Bacteria 2452
612 Ga0207674_10000420 3300026116 Bacteria 55287
613 Ga0207674_10003611 3300026116 Bacteria 18863
614 Ga0207674_10033144 3300026116 Bacteria 5409
615 Ga0207674_10044894 3300026116 Bacteria 4550
616 Ga0207675_100002543 3300026118 Bacteria 18056
617 Ga0207675_100008008 3300026118 Bacteria 9959
618 Ga0207675_100124538 3300026118 Bacteria 2441
619 Ga0207675_100196290 3300026118 Bacteria 1937
620 Ga0207683_10000004 3300026121 Bacteria 188086
621 Ga0207683_10001293 3300026121 Bacteria 22621
622 Ga0207683_10015556 3300026121 Bacteria 6478
623 Ga0207683_10020374 3300026121 Bacteria 5672
624 Ga0207683_10035723 3300026121 Bacteria 4323
625 Ga0207698_10004120 3300026142 Bacteria 8830
626 Ga0207698_10017188 3300026142 Bacteria 4900
627 Ga0209389_1000032 3300027296 Bacteria 134064
628 Ga0209389_1000995 3300027296 Bacteria 18828
629 Ga0209589_1000001 3300027357 Bacteria 794224
630 Ga0209589_1000211 3300027357 Bacteria 69316
631 Ga0209489_100001 3300027361 Bacteria 794224
632 Ga0209489_100006 3300027361 Bacteria 475698
633 Ga0209489_111765 3300027361 Bacteria 8620
634 Ga0209700_100001 3300027363 Bacteria 794224
635 Ga0209700_100005 3300027363 Bacteria 573969
636 Ga0209966_1001208 3300027695 Bacteria 4603
637 Ga0209998_10002107 3300027717 Bacteria 4636
638 Ga0209998_10003369 3300027717 Bacteria 3507
639 Ga0209974_10009223 3300027876 Bacteria 3349
640 Ga0207428_10000303 3300027907 Bacteria 65124
641 Ga0207428_10019216 3300027907 Bacteria 5826
642 Ga0268266_10044379 3300028379 Bacteria 3800
643 Ga0268266_10047490 3300028379 Bacteria 3678
644 Ga0268266_10056381 3300028379 Bacteria 3380
645 Ga0268265_10012335 3300028380 Bacteria 5790
646 Ga0268264_10000149 3300028381 Bacteria 163972
647 Ga0268264_10073523 3300028381 Bacteria 2902
648 Ga0268264_10102135 3300028381 Bacteria 2495
649 Ga0268264_10198647 3300028381 Bacteria 1833
650 Ga0268264_10226639 3300028381 Bacteria 1723
651 Ga0265337_1000539 3300028556 Bacteria 20178
652 Ga0265334_10045848 3300028573 Bacteria 1692
653 Ga0265318_10012129 3300028577 Bacteria 3679
654 Ga0265336_10013212 3300028666 Bacteria 2756
655 Ga0307517_10000249 3300028786 Bacteria 91911
656 Ga0307515_10050561 3300028794 Bacteria 6221
657 Ga0265338_10000665 3300028800 Bacteria 59449
658 Ga0265338_10010360 3300028800 Bacteria 10945
659 Ga0265338_10085175 3300028800 Bacteria 2635
660 Ga0265330_10012435 3300031235 Bacteria 3979
661 Ga0265332_10001409 3300031238 Bacteria 13560
662 Ga0265320_10011080 3300031240 Bacteria 5323
663 Ga0265325_10000603 3300031241 Bacteria 26174
664 Ga0265325_10008234 3300031241 Bacteria 6166
665 Ga0265325_10055536 3300031241 Bacteria 2024
666 Ga0265340_10011380 3300031247 Bacteria 4727
667 Ga0265340_10011777 3300031247 Bacteria 4640
668 Ga0265340_10023020 3300031247 Bacteria 3179
669 Ga0265339_10000465 3300031249 Bacteria 31657
670 Ga0265339_10016860 3300031249 Bacteria 4341
671 Ga0265339_10036117 3300031249 Bacteria 2767
672 Ga0265339_10048704 3300031249 Bacteria 2323
673 Ga0265339_10086086 3300031249 Bacteria 1654
674 Ga0265331_10025769 3300031250 Bacteria 2965
675 Ga0265331_10029591 3300031250 Bacteria 2731
676 Ga0307509_10004311 3300031507 Bacteria 20669
677 Ga0307408_100024489 3300031548 Bacteria 4123
678 Ga0265313_10000006 3300031595 Bacteria 183184
679 Ga0265313_10010630 3300031595 Bacteria 5796
680 Ga0307508_10000018 3300031616 Bacteria 202701
681 Ga0307508_10109943 3300031616 Bacteria 2355
682 Ga0265314_10002127 3300031711 Bacteria 20778
683 Ga0265314_10019317 3300031711 Bacteria 5282
684 Ga0265342_10001132 3300031712 Bacteria 25514
685 Ga0265342_10002171 3300031712 Bacteria 17254
686 Ga0265342_10094300 3300031712 Bacteria 1713
687 Ga0316576_10157855 3300031727 Bacteria 1710
688 Ga0307516_10011365 3300031730 Bacteria 9683
689 Ga0307516_10153301 3300031730 Bacteria 2062
690 Ga0307410_10176024 3300031852 Bacteria 1616
691 Ga0307412_10058553 3300031911 Bacteria 2578
692 Ga0307412_10135882 3300031911 Bacteria 1794
693 Ga0307416_100142142 3300032002 Bacteria 2184
694 Ga0307411_10187957 3300032005 Bacteria 1574
695 Ga0307507_10022838 3300033179 Bacteria 6892
696 Ga0307510_10013733 3300033180 Bacteria 9600
697 Ga0307510_10033134 3300033180 Bacteria 5807
698 Ga0307510_10048914 3300033180 Bacteria 4504
699 Ga0315911_1000006 3300033442 Bacteria 414563
700 Ga0316215_1003036 3300033544 Bacteria 1594
701 Ga0373958_0001300 3300034819 Bacteria 3339
702 Ga0373938_0000022 3300034957 Bacteria 20030
703 Ga0373929_0000472 3300035085 Bacteria 7704
704 Ga0373934_0005378 3300035086 Bacteria 4741
705 Ga0373940_0000137 3300035088 Bacteria 9375
706 Ga0373949_0000261 3300035090 Bacteria 19624
707 Ga0373951_0002760 3300035091 Bacteria 4393
708 Ga0373952_0003517 3300035092 Bacteria 2825
709 Ga0373932_0002247 3300035112 Bacteria 4945
710 Ga0373939_0000463 3300035114 Bacteria 10276
711 Ga0373939_0003813 3300035114 Bacteria 3553
712 Ga0373941_0000221 3300035115 Bacteria 10967
713 Ga0373941_0000589 3300035115 Bacteria 7345
714 Ga0373945_0015340 3300035116 Bacteria 2576
715 Ga0373953_0040881 3300035117 Bacteria 1843
716 Ga0373954_0003471 3300035118 Bacteria 6687
717 Ga0373954_0054642 3300035118 Bacteria 1878
718 Ga0373956_0002490 3300035119 Bacteria 7496
719 Ga0373956_0024869 3300035119 Bacteria 2585
720 Ga0373957_0009403 3300035120 Bacteria 3198
721 Ga0373960_0000800 3300035121 Bacteria 6614
722 Ga0373960_0002104 3300035121 Bacteria 4482
723 Ga0373943_0000061 3300035170 Bacteria 37449
724 Ga0373943_0022381 3300035170 Bacteria 2928
725 Ga0373946_0025537 3300035171 Bacteria 2324
726 Ga0373955_0013625 3300035172 Bacteria 3938
727 Ga0373955_0020458 3300035172 Bacteria 3327
728 Ga0373942_0006530 3300035207 Bacteria 2695
729 Ga0373961_0005825 3300035241 Bacteria 2960
730 Ga0373961_0008356 3300035241 Bacteria 2517
731 Ga0373962_0003673 3300035242 Bacteria 3691
732 Ga0373962_0013120 3300035242 Bacteria 2094
733 Ga0373924_0008696 3300035410 Bacteria 3701
734 Ga0373924_0011814 3300035410 Bacteria 3250
735 Ga0373931_0000750 3300035691 Bacteria 13546
736 Ga0373935_0001116 3300035692 Bacteria 14637
737 Ga0373935_0015189 3300035692 Bacteria 4651
738 Ga0373935_0068802 3300035692 Bacteria 2279
739 Ga0373935_0105033 3300035692 Bacteria 1867
740 Ga0373927_0000275 3300035695 Bacteria 40382
741 Ga0373927_0001437 3300035695 Bacteria 17974
742 Ga0373927_0004277 3300035695 Bacteria 10020
743 Ga0373927_0020807 3300035695 Bacteria 4300
744 Ga0373927_0053127 3300035695 Bacteria 2620
745 Ga0373927_0059425 3300035695 Bacteria 2472
746 Ga0373933_0001880 3300035724 Bacteria 12123
747 Ga0373933_0003392 3300035724 Bacteria 8881
748 Ga0373933_0053271 3300035724 Bacteria 2423
749 Ga0373933_0081011 3300035724 Bacteria 1991
750 Ga0373947_0000187 3300035725 Bacteria 34086
751 Ga0373947_0003173 3300035725 Bacteria 9781
752 Ga0373947_0028877 3300035725 Bacteria 3253
753 Ga0373947_0084669 3300035725 Bacteria 1968
754 Ga0373937_0016414 3300036401 Bacteria 6577
755 Ga0373937_0020656 3300036401 Bacteria 5905
756 Ga0373937_0065794 3300036401 Bacteria 3337
757 Ga0373925_0000791 3300037068 Bacteria 29167
758 Ga0373925_0006458 3300037068 Bacteria 8624
759 Ga0373925_0021188 3300037068 Bacteria 4736
760 Ga0373925_0075820 3300037068 Bacteria 2549
761 Ga0373925_0083593 3300037068 Bacteria 2432
762 Ga0373925_0133663 3300037068 Bacteria 1936
763 Ga0373925_0145606 3300037068 Bacteria 1857
764 Ga0395899_0007661 3300037312 Bacteria 8324
765 Ga0395899_0048874 3300037312 Bacteria 3146
766 Ga0395900_0002820 3300037418 Bacteria 18968
767 Ga0395900_0132770 3300037418 Bacteria 2551
768 Ga0395900_0183877 3300037418 Bacteria 2122
769 Ga0395900_0224298 3300037418 Bacteria 1893
770 Ga0395900_0504171 3300037418 Bacteria 1160
771 Ga0395898_0035823 3300037466 Bacteria 4932
772 Ga0395898_0037214 3300037466 Bacteria 4829
773 Ga0395898_0114923 3300037466 Bacteria 2579
774 Ga0395898_0116527 3300037466 Bacteria 2560
775 Ga0395898_0256323 3300037466 Bacteria 1668
776 Ga0395905_0013848 3300037471 Bacteria 7715
777 Ga0436364_0009242 3300037853 Bacteria 1668
778 Ga0436364_0565423 3300037853 Bacteria 13235
779 Ga0436364_1381345 3300037853 Bacteria 2017
780 Ga0395901_0073052 3300038443 Bacteria 3577
781 Ga0395901_0102522 3300038443 Bacteria 3003
782 Ga0395901_0206396 3300038443 Bacteria 2058
783 Ga0395901_0217750 3300038443 Bacteria 1996
784 Ga0395901_0281687 3300038443 Bacteria 1727
785 Ga0436365_0244105 3300039437 Bacteria 7287
786 Ga0436365_0552397 3300039437 Bacteria 18046
787 Ga0436365_0712843 3300039437 Bacteria 3690
788 Ga0436361_0476110 3300039447 Bacteria 14479
789 Ga0436363_0312479 3300039450 Bacteria 6730
790 Ga0436363_1211778 3300039450 Bacteria 5063
791 Ga0466972_0000160 3300044658 Bacteria 54154
792 Ga0466972_0041245 3300044658 Bacteria 2248
793 Ga0453683_0000499 3300044673 Bacteria 44878
794 Ga0466965_0068895 3300044683 Bacteria 1777
795 Ga0466966_0000669 3300044684 Bacteria 21779
796 Ga0466961_0000208 3300044693 Bacteria 39439
797 Ga0466961_0049061 3300044693 Bacteria 2699
798 Ga0466963_0051971 3300044694 Bacteria 2718
799 Ga0466957_0304793 3300044842 Bacteria 1071
800 Ga0466960_0004027 3300044901 Bacteria 5712
801 Ga0466959_0000832 3300045049 Bacteria 18217
802 Ga0466959_0065541 3300045049 Bacteria 2636
803 Ga0466967_0007808 3300045976 Bacteria 7773
804 Ga0495592_0002109 3300046454 Bacteria 14021
805 Ga0495592_0010077 3300046454 Bacteria 7118
806 Ga0495603_0001086 3300046455 Bacteria 15788
807 Ga0495603_0005459 3300046455 Bacteria 7590
808 Ga0495603_0012614 3300046455 Bacteria 5113
809 Ga0495603_0025716 3300046455 Bacteria 3559
810 Ga0495629_0000329 3300046459 Bacteria 40545
811 Ga0495629_0000726 3300046459 Bacteria 26748
812 Ga0495629_0008557 3300046459 Bacteria 7535
813 Ga0495629_0073225 3300046459 Bacteria 2392
814 Ga0495629_0145998 3300046459 Bacteria 1645
815 Ga0495638_0078657 3300046460 Bacteria 2006
816 Ga0495641_0000747 3300046461 Bacteria 27535
817 Ga0495641_0009078 3300046461 Bacteria 5957
818 Ga0495651_0000528 3300046462 Bacteria 29605
819 Ga0495651_0001234 3300046462 Bacteria 19776
820 Ga0495653_0000358 3300046463 Bacteria 36893
821 Ga0495653_0024434 3300046463 Bacteria 4870
822 Ga0495653_0120003 3300046463 Bacteria 1875
823 Ga0495582_0000416 3300046473 Bacteria 23251
824 Ga0495582_0018577 3300046473 Bacteria 3801
825 Ga0495582_0039151 3300046473 Bacteria 2610
826 Ga0495605_0058321 3300046474 Bacteria 1856
827 Ga0495605_0077055 3300046474 Bacteria 1565
828 Ga0495639_0000165 3300046475 Bacteria 34551
829 Ga0495639_0042460 3300046475 Bacteria 2051
830 Ga0495662_0000066 3300046476 Bacteria 36870
831 Ga0495662_0007797 3300046476 Bacteria 5271
832 Ga0495662_0055096 3300046476 Bacteria 1921
833 Ga0495664_0000510 3300046477 Bacteria 19398
834 Ga0495664_0003203 3300046477 Bacteria 8886
835 Ga0495664_0025954 3300046477 Bacteria 3411
836 Ga0495585_0050021 3300046492 Bacteria 2319
837 Ga0495594_0000441 3300046499 Bacteria 20981
838 Ga0495594_0104469 3300046499 Bacteria 1595
839 Ga0495607_0055693 3300046501 Bacteria 2274
840 Ga0495606_0001663 3300046507 Bacteria 28893
841 Ga0495606_0045553 3300046507 Bacteria 2905
842 Ga0495608_0002274 3300046511 Bacteria 13858
843 Ga0495608_0002377 3300046511 Bacteria 13537
844 Ga0495608_0025275 3300046511 Bacteria 4054
845 Ga0495608_0041729 3300046511 Bacteria 3069
846 Ga0495618_0002751 3300046514 Bacteria 11183
847 Ga0495618_0020274 3300046514 Bacteria 4093
848 Ga0495620_0049417 3300046515 Bacteria 1800
849 Ga0495628_0019406 3300046516 Bacteria 5622
850 Ga0495628_0020389 3300046516 Bacteria 5469
851 Ga0495628_0022251 3300046516 Bacteria 5209
852 Ga0495628_0146998 3300046516 Bacteria 1796
853 Ga0495630_0008582 3300046517 Bacteria 7332
854 Ga0495631_0019145 3300046518 Bacteria 3213
855 Ga0495642_0056699 3300046528 Bacteria 1619
856 Ga0495652_0002427 3300046529 Bacteria 19218
857 Ga0495652_0005186 3300046529 Bacteria 12313
858 Ga0495652_0020974 3300046529 Bacteria 5807
859 Ga0495652_0066937 3300046529 Bacteria 3012
860 Ga0495665_0000802 3300046531 Bacteria 16451
861 Ga0495665_0001233 3300046531 Bacteria 13656
862 Ga0495640_0003534 3300046533 Bacteria 12566
863 Ga0495640_0009403 3300046533 Bacteria 7612
864 Ga0495640_0027787 3300046533 Bacteria 4077
865 Ga0495640_0065735 3300046533 Bacteria 2448
866 Ga0495586_0014173 3300046535 Bacteria 4237
867 Ga0495586_0099032 3300046535 Bacteria 1617
868 Ga0495587_0001337 3300046536 Bacteria 16369
869 Ga0495587_0024608 3300046536 Bacteria 3688
870 Ga0495587_0030214 3300046536 Bacteria 3286
871 Ga0495609_0071603 3300046538 Bacteria 1523
872 Ga0495645_0008975 3300046543 Bacteria 6983
873 Ga0495645_0034306 3300046543 Bacteria 3702
874 Ga0495645_0050362 3300046543 Bacteria 3032
875 Ga0495645_0112011 3300046543 Bacteria 1930
876 Ga0495622_0004915 3300046557 Bacteria 6190
877 Ga0495622_0019370 3300046557 Bacteria 3168
878 Ga0495622_0032366 3300046557 Bacteria 2442
879 Ga0495667_0002234 3300046559 Bacteria 12951
880 Ga0495667_0060233 3300046559 Bacteria 2490
881 Ga0495634_0002191 3300046642 Bacteria 16415
882 Ga0495634_0002979 3300046642 Bacteria 13815
883 Ga0495634_0015120 3300046642 Bacteria 5547
884 Ga0495625_0048927 3300046660 Bacteria 3041
885 Ga0495625_0086437 3300046660 Bacteria 2175
886 Ga0495635_0000527 3300046663 Bacteria 24259
887 Ga0495635_0001696 3300046663 Bacteria 14837
888 Ga0495635_0002022 3300046663 Bacteria 13767
889 Ga0495635_0031514 3300046663 Bacteria 3680
890 Ga0495635_0088227 3300046663 Bacteria 2122
891 Ga0495635_0138618 3300046663 Bacteria 1657
892 Ga0495659_0044852 3300046664 Bacteria 1591
893 Ga0495588_0055784 3300046674 Bacteria 2039
894 Ga0495657_0001550 3300046675 Bacteria 19763
895 Ga0495657_0007232 3300046675 Bacteria 8604
896 Ga0495657_0053087 3300046675 Bacteria 2714
897 Ga0495599_0002310 3300046678 Bacteria 11080
898 Ga0495599_0013701 3300046678 Bacteria 5012
899 Ga0495599_0097191 3300046678 Bacteria 1836
900 Ga0495599_0133702 3300046678 Bacteria 1540
901 Ga0495623_0003518 3300046679 Bacteria 10364
902 Ga0495646_0017484 3300046680 Bacteria 4549
903 Ga0495646_0022612 3300046680 Bacteria 3965
904 Ga0495646_0044539 3300046680 Bacteria 2713
905 Ga0495646_0057438 3300046680 Bacteria 2329
906 Ga0495646_0067909 3300046680 Bacteria 2106
907 Ga0495646_0101890 3300046680 Bacteria 1645
908 Ga0495647_0001835 3300046681 Bacteria 6580
909 Ga0495647_0002668 3300046681 Bacteria 5665
910 Ga0495647_0004959 3300046681 Bacteria 4358
911 Ga0495658_0004889 3300046683 Bacteria 6576
912 Ga0495658_0027133 3300046683 Bacteria 3078
913 Ga0495658_0109867 3300046683 Bacteria 1657
914 Ga0495613_0002281 3300046689 Bacteria 14509
915 Ga0495613_0003015 3300046689 Bacteria 12608
916 Ga0495613_0016014 3300046689 Bacteria 5582
917 Ga0495624_0005449 3300046690 Bacteria 9169
918 Ga0495624_0006912 3300046690 Bacteria 8002
919 Ga0495624_0030168 3300046690 Bacteria 3533
920 Ga0495624_0055194 3300046690 Bacteria 2503
921 Ga0495670_0044264 3300046691 Bacteria 2222
922 Ga0495589_0040148 3300046794 Bacteria 2338
923 Ga0495600_0001526 3300046809 Bacteria 12864
924 Ga0495600_0001732 3300046809 Bacteria 12197
925 Ga0495600_0034421 3300046809 Bacteria 3288
926 Ga0495600_0079095 3300046809 Bacteria 2147
927 Ga0495581_0000530 3300047315 Bacteria 19591
928 Ga0495581_0014680 3300047315 Bacteria 4543
929 Ga0495604_0002815 3300047317 Bacteria 13967
930 Ga0495604_0165071 3300047317 Bacteria 1562
931 Ga0495674_0000138 3300047319 Bacteria 55916
932 Ga0495674_0001486 3300047319 Bacteria 22968
933 Ga0495674_0069326 3300047319 Bacteria 3049
934 Ga0495674_0090443 3300047319 Bacteria 2615
935 Ga0495674_0119459 3300047319 Bacteria 2228
936 Ga0495674_0273753 3300047319 Bacteria 1385
937 Ga0495672_0019216 3300047320 Bacteria 4512
938 Ga0495672_0034108 3300047320 Bacteria 3147
939 Ga0495672_0046474 3300047320 Bacteria 2589
940 Ga0495676_0045353 3300047321 Bacteria 3579
941 Ga0495676_0095528 3300047321 Bacteria 2211
942 Ga0495680_0011728 3300047322 Bacteria 7741
943 Ga0495680_0061251 3300047322 Bacteria 2896
944 Ga0495680_0085190 3300047322 Bacteria 2380
945 Ga0495680_0130739 3300047322 Bacteria 1845
946 Ga0495683_0027742 3300047323 Bacteria 2895
947 Ga0495687_014951 3300047443 Bacteria 3967
948 Ga0495675_0012926 3300047444 Bacteria 5261
949 Ga0495675_0017016 3300047444 Bacteria 4603
950 Ga0495675_0087339 3300047444 Bacteria 1959
951 Ga0495684_0001215 3300047471 Bacteria 20690
952 Ga0495684_0019302 3300047471 Bacteria 5246
953 Ga0495684_0027385 3300047471 Bacteria 4376
954 Ga0495684_0032837 3300047471 Bacteria 3987
955 Ga0495684_0114104 3300047471 Bacteria 2037
956 Ga0495686_0193125 3300047472 Bacteria 1172
957 Ga0495593_0000345 3300047673 Bacteria 25682
958 Ga0495602_0012463 3300048088 Bacteria 8737
959 Ga0495602_0053861 3300048088 Bacteria 3558
960 Ga0495614_0023407 3300048089 Bacteria 2665
961 Ga0495615_0013853 3300048090 Bacteria 1693
962 Ga0495615_0022097 3300048090 Bacteria 1443
963 Ga0496100_0007042 3300048903 Bacteria 6170
964 Ga0496100_0054311 3300048903 Bacteria 2612
965 Ga0496100_0061728 3300048903 Bacteria 2470
966 Ga0496101_0001619 3300048904 Bacteria 13525
967 Ga0496101_0004213 3300048904 Bacteria 9009
968 Ga0496101_0068477 3300048904 Bacteria 2595
969 Ga0496101_0138739 3300048904 Bacteria 1852
970 Ga0496101_0221241 3300048904 Bacteria 1469
971 Ga0496102_0006904 3300048905 Bacteria 9684
972 Ga0496102_0023343 3300048905 Bacteria 5492
973 Ga0496103_0003429 3300048906 Bacteria 9692
974 Ga0496103_0062407 3300048906 Bacteria 2319
975 Ga0496103_0072235 3300048906 Bacteria 2161
976 Ga0496104_0006123 3300048907 Bacteria 10560
977 Ga0496104_0009040 3300048907 Bacteria 8859
978 Ga0496104_0067046 3300048907 Bacteria 3409
979 Ga0496104_0068763 3300048907 Bacteria 3365
980 Ga0496104_0149939 3300048907 Bacteria 2239
981 Ga0496105_0004225 3300048908 Bacteria 10790
982 Ga0496105_0035275 3300048908 Bacteria 4116
983 Ga0496105_0036082 3300048908 Bacteria 4071
984 Ga0496105_0039020 3300048908 Bacteria 3913
985 Ga0496105_0046279 3300048908 Bacteria 3591
986 Ga0496106_0000587 3300048909 Bacteria 25963
987 Ga0496106_0004983 3300048909 Bacteria 9830
988 Ga0496106_0012623 3300048909 Bacteria 6241
989 Ga0496106_0018998 3300048909 Bacteria 5093
990 Ga0496106_0059119 3300048909 Bacteria 2903
991 Ga0496106_0113223 3300048909 Bacteria 2114
992 Ga0496107_0002981 3300048910 Bacteria 11211
993 Ga0496107_0008057 3300048910 Bacteria 7275
994 Ga0496107_0037062 3300048910 Bacteria 3499
995 Ga0496108_0000517 3300048911 Bacteria 30206
996 Ga0496108_0005354 3300048911 Bacteria 10373
997 Ga0496108_0008243 3300048911 Bacteria 8457
998 Ga0496108_0014716 3300048911 Bacteria 6385
999 Ga0496108_0021192 3300048911 Bacteria 5341
1000 Ga0496108_0024182 3300048911 Bacteria 5001
1001 Ga0496108_0056517 3300048911 Bacteria 3297
1002 Ga0496109_0001287 3300048912 Bacteria 20815
1003 Ga0496109_0001899 3300048912 Bacteria 17343
1004 Ga0496109_0003767 3300048912 Bacteria 12667
1005 Ga0496109_0015266 3300048912 Bacteria 6687
1006 Ga0496109_0022363 3300048912 Bacteria 5600
1007 Ga0496109_0033944 3300048912 Bacteria 4592
1008 Ga0496109_0042157 3300048912 Bacteria 4133
1009 Ga0496109_0049200 3300048912 Bacteria 3837
1010 Ga0496109_0080204 3300048912 Bacteria 3007
1011 Ga0496109_0134155 3300048912 Bacteria 2312
1012 Ga0496109_0168887 3300048912 Bacteria 2052
1013 Ga0496109_0275439 3300048912 Bacteria 1585
1014 Ga0496109_0318284 3300048912 Bacteria 1468
1015 Ga0496110_0001638 3300048913 Bacteria 16435
1016 Ga0496110_0018515 3300048913 Bacteria 5840
1017 Ga0496110_0035267 3300048913 Bacteria 4339
1018 Ga0496110_0051151 3300048913 Bacteria 3630
1019 Ga0496110_0114130 3300048913 Bacteria 2430
1020 Ga0496110_0139915 3300048913 Bacteria 2188
1021 Ga0496110_0165008 3300048913 Bacteria 2008
1022 Ga0496110_0257807 3300048913 Bacteria 1587
1023 Ga0496110_0398155 3300048913 Bacteria 1255
1024 Ga0496111_0001713 3300048914 Bacteria 12814
1025 Ga0496111_0003286 3300048914 Bacteria 9989
1026 Ga0496111_0105893 3300048914 Bacteria 2070
1027 Ga0496111_0108437 3300048914 Bacteria 2044
1028 Ga0496111_0123339 3300048914 Bacteria 1914
1029 Ga0496112_0000004 3300048915 Bacteria 553294
1030 Ga0496112_0004435 3300048915 Bacteria 11889
1031 Ga0496112_0017567 3300048915 Bacteria 6724
1032 Ga0496112_0022393 3300048915 Bacteria 6023
1033 Ga0496112_0033460 3300048915 Bacteria 4997
1034 Ga0496112_0034589 3300048915 Bacteria 4917
1035 Ga0496112_0037988 3300048915 Bacteria 4701
1036 Ga0496112_0048275 3300048915 Bacteria 4174
1037 Ga0496112_0058807 3300048915 Bacteria 3786
1038 Ga0496112_0060042 3300048915 Bacteria 3746
1039 Ga0496112_0176529 3300048915 Bacteria 2101
1040 Ga0496113_0002800 3300048916 Bacteria 10265
1041 Ga0496113_0006800 3300048916 Bacteria 7289
1042 Ga0496113_0014818 3300048916 Bacteria 5334
1043 Ga0496113_0033117 3300048916 Bacteria 3760
1044 Ga0496113_0060308 3300048916 Bacteria 2859
1045 Ga0496114_0008606 3300048917 Bacteria 8086
1046 Ga0496114_0011846 3300048917 Bacteria 6977
1047 Ga0496114_0039109 3300048917 Bacteria 3925
1048 Ga0496114_0083373 3300048917 Bacteria 2705
1049 Ga0496114_0378579 3300048917 Bacteria 1253
1050 Ga0496115_0002504 3300048918 Bacteria 13204
1051 Ga0496115_0006400 3300048918 Bacteria 8627
1052 Ga0496115_0021895 3300048918 Bacteria 4943
1053 Ga0496115_0053770 3300048918 Bacteria 3232
1054 Ga0496115_0061200 3300048918 Bacteria 3035
1055 Ga0496115_0271458 3300048918 Bacteria 1393
1056 Ga0496116_0028721 3300048919 Bacteria 4023
1057 Ga0496117_0071071 3300048920 Bacteria 2334
1058 Ga0496118_0039892 3300048921 Bacteria 3741
1059 Ga0496119_0016774 3300048922 Bacteria 5548
1060 Ga0496119_0048622 3300048922 Bacteria 2629
1061 Ga0496120_0041707 3300048923 Bacteria 2686
1062 Ga0496120_0065797 3300048923 Bacteria 2007
1063 Ga0496121_0000458 3300048924 Bacteria 80207
1064 Ga0496121_0001749 3300048924 Bacteria 35439
1065 Ga0496121_0002564 3300048924 Bacteria 27512
1066 Ga0496121_0004375 3300048924 Bacteria 19087
1067 Ga0496121_0009926 3300048924 Bacteria 10838
1068 Ga0496121_0017689 3300048924 Bacteria 7256
1069 Ga0496121_0044385 3300048924 Bacteria 3835
1070 Ga0496121_0070359 3300048924 Bacteria 2819
1071 Ga0496121_0074115 3300048924 Bacteria 2724
1072 Ga0496121_0132223 3300048924 Bacteria 1865
1073 Ga0496121_0197402 3300048924 Bacteria 1437
1074 Ga0496122_0017860 3300048925 Bacteria 6593
1075 Ga0496122_0058303 3300048925 Bacteria 2860
1076 Ga0496123_0088166 3300048926 Bacteria 1854
1077 Ga0496124_0010603 3300048927 Bacteria 9314
1078 Ga0496125_0000951 3300048928 Bacteria 45511
1079 Ga0496125_0001462 3300048928 Bacteria 34212
1080 Ga0496125_0002254 3300048928 Bacteria 25623
1081 Ga0496125_0095051 3300048928 Bacteria 2218
1082 Ga0496126_0018663 3300048929 Bacteria 6864
1083 Ga0496126_0025235 3300048929 Bacteria 5722
1084 Ga0496126_0040762 3300048929 Bacteria 4303
1085 Ga0496126_0046444 3300048929 Bacteria 3983
1086 Ga0496126_0098652 3300048929 Bacteria 2559
1087 Ga0496126_0100548 3300048929 Bacteria 2530
1088 Ga0496126_0120639 3300048929 Bacteria 2274
1089 Ga0496126_0171016 3300048929 Bacteria 1851
1090 Ga0501031_0004867 3300049568 Bacteria 8730
1091 Ga0501031_0029474 3300049568 Bacteria 3579
1092 Ga0501031_0036678 3300049568 Bacteria 3198
1093 Ga0501031_0055369 3300049568 Bacteria 2584
1094 Ga0501032_0001822 3300049569 Bacteria 16845
1095 Ga0501032_0006705 3300049569 Bacteria 8452
1096 Ga0501032_0061313 3300049569 Bacteria 2521
1097 Ga0501032_0071711 3300049569 Bacteria 2308
1098 Ga0501033_0000827 3300049570 Bacteria 28243
1099 Ga0501033_0001583 3300049570 Bacteria 20018
1100 Ga0501033_0014098 3300049570 Bacteria 6078
1101 Ga0501033_0016530 3300049570 Bacteria 5585
1102 Ga0501033_0137995 3300049570 Bacteria 1764
1103 Ga0501034_0000032 3300049571 Bacteria 243763
1104 Ga0501034_0002449 3300049571 Bacteria 22384
1105 Ga0501034_0063969 3300049571 Bacteria 3693
1106 Ga0501034_0077338 3300049571 Bacteria 3333
1107 Ga0501034_0125024 3300049571 Bacteria 2557
1108 Ga0501034_0126594 3300049571 Bacteria 2539
1109 Ga0501034_0161501 3300049571 Bacteria 2211
1110 Ga0501034_0348099 3300049571 Bacteria 1410
1111 Ga0501036_0000149 3300049572 Bacteria 45598
1112 Ga0501036_0000674 3300049572 Bacteria 25113
1113 Ga0501036_0004945 3300049572 Bacteria 10773
1114 Ga0501036_0037467 3300049572 Bacteria 4102
1115 Ga0501036_0051485 3300049572 Bacteria 3486
1116 Ga0501036_0063926 3300049572 Bacteria 3115
1117 Ga0501036_0164909 3300049572 Bacteria 1868
1118 Ga0501037_0000153 3300049573 Bacteria 64239
1119 Ga0501037_0000888 3300049573 Bacteria 22320
1120 Ga0501037_0007710 3300049573 Bacteria 7879
1121 Ga0501037_0017413 3300049573 Bacteria 5291
1122 Ga0501037_0023391 3300049573 Bacteria 4569
1123 Ga0501037_0025967 3300049573 Bacteria 4327
1124 Ga0501037_0051032 3300049573 Bacteria 3025
1125 Ga0501037_0116080 3300049573 Bacteria 1926
1126 Ga0501038_0000138 3300049574 Bacteria 62493
1127 Ga0501038_0001121 3300049574 Bacteria 24319
1128 Ga0501038_0009574 3300049574 Bacteria 8887
1129 Ga0501038_0032799 3300049574 Bacteria 4578
1130 Ga0501038_0044769 3300049574 Bacteria 3843
1131 Ga0501038_0086561 3300049574 Bacteria 2632
1132 Ga0501038_0125019 3300049574 Bacteria 2117
1133 Ga0501039_0000842 3300049575 Bacteria 22166
1134 Ga0501039_0003466 3300049575 Bacteria 11782
1135 Ga0501039_0151491 3300049575 Bacteria 1822
1136 Ga0501039_0158354 3300049575 Bacteria 1779
1137 Ga0501042_0001932 3300049578 Bacteria 12476
1138 Ga0501042_0075397 3300049578 Bacteria 2414
1139 Ga0501043_0006630 3300049579 Bacteria 9261
1140 Ga0501043_0008464 3300049579 Bacteria 8098
1141 Ga0501043_0018007 3300049579 Bacteria 5540
1142 Ga0501043_0019806 3300049579 Bacteria 5283
1143 Ga0501043_0045301 3300049579 Bacteria 3459
1144 Ga0501043_0094042 3300049579 Bacteria 2356
1145 Ga0501043_0098002 3300049579 Bacteria 2304
1146 Ga0501043_0158632 3300049579 Bacteria 1768
1147 Ga0501046_0021327 3300049580 Bacteria 5347
1148 Ga0501046_0029266 3300049580 Bacteria 4478
1149 Ga0501046_0062318 3300049580 Bacteria 2914
1150 Ga0501046_0079255 3300049580 Bacteria 2539
1151 Ga0501046_0177177 3300049580 Bacteria 1596
1152 Ga0501047_0000010 3300049581 Bacteria 429357
1153 Ga0501047_0001785 3300049581 Bacteria 20809
1154 Ga0501047_0004062 3300049581 Bacteria 13761
1155 Ga0501047_0012519 3300049581 Bacteria 8035
1156 Ga0501047_0048611 3300049581 Bacteria 4096
1157 Ga0501047_0119186 3300049581 Bacteria 2521
1158 Ga0501047_0127100 3300049581 Bacteria 2429
1159 Ga0501047_0141576 3300049581 Bacteria 2283
1160 Ga0501047_0201508 3300049581 Bacteria 1851
1161 Ga0501047_0250797 3300049581 Bacteria 1618
1162 Ga0501048_0000396 3300049582 Bacteria 30302
1163 Ga0501048_0000653 3300049582 Bacteria 24953
1164 Ga0501067_0019432 3300049583 Bacteria 3761
1165 Ga0501067_0037938 3300049583 Bacteria 2676
1166 Ga0501067_0085856 3300049583 Bacteria 1746
1167 Ga0501068_0004084 3300049584 Bacteria 7922
1168 Ga0501068_0020465 3300049584 Bacteria 3854
1169 Ga0501068_0024884 3300049584 Bacteria 3518
1170 Ga0501068_0031994 3300049584 Bacteria 3126
1171 Ga0501068_0052257 3300049584 Bacteria 2472
1172 Ga0501068_0083832 3300049584 Bacteria 1960
1173 Ga0501069_0005888 3300049585 Bacteria 6388
1174 Ga0501070_0002230 3300049586 Bacteria 17026
1175 Ga0501070_0029990 3300049586 Bacteria 4557
1176 Ga0501070_0031212 3300049586 Bacteria 4463
1177 Ga0501070_0038371 3300049586 Bacteria 3996
1178 Ga0501070_0041037 3300049586 Bacteria 3856
1179 Ga0501070_0060813 3300049586 Bacteria 3130
1180 Ga0501070_0086286 3300049586 Bacteria 2598
1181 Ga0501071_0026342 3300049587 Bacteria 4080
1182 Ga0501072_0001051 3300049588 Bacteria 20459
1183 Ga0501072_0002565 3300049588 Bacteria 13617
1184 Ga0501072_0066504 3300049588 Bacteria 2843
1185 Ga0501072_0149988 3300049588 Bacteria 1859
1186 Ga0501073_0000221 3300049589 Bacteria 37338
1187 Ga0501073_0030234 3300049589 Bacteria 3868
1188 Ga0501073_0035819 3300049589 Bacteria 3526
1189 Ga0501073_0050655 3300049589 Bacteria 2910
1190 Ga0501073_0050877 3300049589 Bacteria 2902
1191 Ga0501073_0060342 3300049589 Bacteria 2647
1192 Ga0501073_0082683 3300049589 Bacteria 2234
1193 Ga0501073_0173309 3300049589 Bacteria 1493
1194 Ga0501074_0015795 3300049590 Bacteria 5489
1195 Ga0501074_0018904 3300049590 Bacteria 5004
1196 Ga0501074_0054256 3300049590 Bacteria 2890
1197 Ga0501076_0126782 3300049592 Bacteria 2069
1198 Ga0501077_0046592 3300049593 Bacteria 2754
1199 Ga0501079_0050115 3300049741 Bacteria 3223
1200 Ga0501080_0003063 3300049742 Bacteria 14759
1201 Ga0501080_0011359 3300049742 Bacteria 8154
1202 Ga0501080_0026159 3300049742 Bacteria 5420
1203 Ga0501080_0067483 3300049742 Bacteria 3326
1204 Ga0501080_0071767 3300049742 Bacteria 3221
1205 Ga0501080_0092246 3300049742 Bacteria 2813
1206 Ga0501080_0452977 3300049742 Bacteria 1150
1207 Ga0501083_0001423 3300049744 Bacteria 16322
1208 Ga0501083_0008402 3300049744 Bacteria 7299
1209 Ga0501083_0025847 3300049744 Bacteria 4064
1210 Ga0501083_0035733 3300049744 Bacteria 3393
1211 Ga0501083_0089514 3300049744 Bacteria 2033
1212 Ga0501035_0001426 3300049822 Bacteria 24484
1213 Ga0501035_0004322 3300049822 Bacteria 13496
1214 Ga0501035_0007645 3300049822 Bacteria 10098
1215 Ga0501035_0012953 3300049822 Bacteria 7697
1216 Ga0501035_0045651 3300049822 Bacteria 3941
1217 Ga0501035_0059092 3300049822 Bacteria 3414
1218 Ga0501035_0065875 3300049822 Bacteria 3215
1219 Ga0501035_0145794 3300049822 Bacteria 2056
1220 Ga0501035_0163108 3300049822 Bacteria 1928
1221 Ga0501035_0208445 3300049822 Bacteria 1673
1222 Ga0501044_0000369 3300049823 Bacteria 56363
1223 Ga0501044_0013258 3300049823 Bacteria 8923
1224 Ga0501044_0013456 3300049823 Bacteria 8849
1225 Ga0501044_0018430 3300049823 Bacteria 7479
1226 Ga0501044_0075210 3300049823 Bacteria 3429
1227 Ga0501044_0136215 3300049823 Bacteria 2447
1228 Ga0501045_0064688 3300049824 Bacteria 2685
1229 Ga0501045_0081311 3300049824 Bacteria 2389
1230 Ga0501045_0092737 3300049824 Bacteria 2234
1231 nmdc:mga03n38_6896_c1 3300050490 Bacteria 3985
1232 nmdc:mga00v17_9599_c1 3300050491 Bacteria 5244
1233 nmdc:mga0yw44_1008_c1 3300050492 Bacteria 10779
1234 nmdc:mga0yw44_27628_c1 3300050492 Bacteria 3253
1235 nmdc:mga0yw44_4407_c1 3300050492 Bacteria 6449
1236 nmdc:mga0yw44_7568_c1 3300050492 Bacteria 5352
1237 nmdc:mga0k408_41747_c1 3300050493 Bacteria 2641
1238 nmdc:mga0k408_71478_c1 3300050493 Bacteria 2025
1239 nmdc:mga06z11_23196_c1 3300050494 Bacteria 2911
1240 nmdc:mga06z11_5654_c1 3300050494 Bacteria 5036
1241 nmdc:mga04h51_53107_c1 3300050495 Bacteria 1366
1242 nmdc:mga07m45_1367_c1 3300050496 Bacteria 11128
1243 nmdc:mga08y16_172_c1 3300050511 Bacteria 56716
1244 nmdc:mga08y16_55900_c1 3300050511 Bacteria 4124
1245 nmdc:mga0n895_24014_c1 3300050512 Bacteria 5739
1246 nmdc:mga0rr50_180782_c1 3300050513 Bacteria 1724
1247 nmdc:mga08x19_4_c2 3300050514 Bacteria 202063
1248 nmdc:mga08x19_89926_c1 3300050514 Bacteria 2025
1249 nmdc:mga0sz30_8294_c1 3300050516 Bacteria 3919
1250 Ga0495601_0002574 3300053077 Bacteria 10312
1251 Ga0495601_0015114 3300053077 Bacteria 4662
1252 Ga0495601_0036761 3300053077 Bacteria 3060
1253 Ga0495601_0047852 3300053077 Bacteria 2693
1254 Ga0495601_0054332 3300053077 Bacteria 2534
1255 Ga0495612_0004857 3300053078 Bacteria 5566
1256 Ga0495612_0085424 3300053078 Bacteria 1330
1257 Ga0500610_0142077 3300053079 Bacteria 1211
1258 Ga0500635_0027246 3300053080 Bacteria 1815
1259 Ga0495655_0001288 3300053083 Bacteria 3860
1260 Ga0495595_0025302 3300053084 Bacteria 2629
1261 Ga0495595_0100767 3300053084 Bacteria 1394
1262 Ga0495619_0000609 3300053085 Bacteria 23652
1263 Ga0495619_0000757 3300053085 Bacteria 21079
1264 Ga0495619_0000799 3300053085 Bacteria 20602
1265 Ga0495619_0001114 3300053085 Bacteria 17646
1266 Ga0495619_0026157 3300053085 Bacteria 3753
1267 Ga0495619_0048425 3300053085 Bacteria 2800
1268 Ga0500643_000032 3300053087 Bacteria 200350
1269 Ga0500644_0000786 3300053088 Bacteria 10824
1270 Ga0500647_0023164 3300053091 Bacteria 2911
1271 Ga0500583_0048761 3300053092 Bacteria 1956
1272 Ga0500651_0027621 3300053093 Bacteria 3569
1273 Ga0500566_0000006 3300053094 Bacteria 153632
1274 Ga0500566_0002123 3300053094 Bacteria 11677
1275 Ga0500566_0011398 3300053094 Bacteria 5236
1276 Ga0500566_0017517 3300053094 Bacteria 4210
1277 Ga0500640_003111 3300053095 Bacteria 5688
1278 Ga0500641_0011598 3300053096 Bacteria 3201
1279 Ga0500650_0000167 3300053098 Bacteria 16961
1280 Ga0500555_002027 3300053103 Bacteria 5966
1281 Ga0500556_0000030 3300053104 Bacteria 165098
1282 Ga0500557_000004 3300053105 Bacteria 202318
1283 Ga0500572_000870 3300053111 Bacteria 9372
1284 Ga0500572_001481 3300053111 Bacteria 6343
1285 Ga0500595_000002 3300053119 Bacteria 1074388
1286 Ga0500595_000306 3300053119 Bacteria 32239
1287 Ga0500595_001964 3300053119 Bacteria 10563
1288 Ga0500595_002618 3300053119 Bacteria 8762
1289 Ga0500595_006167 3300053119 Bacteria 5129
1290 Ga0500595_007411 3300053119 Bacteria 4553
1291 Ga0500595_009208 3300053119 Bacteria 3996
1292 Ga0500595_030128 3300053119 Bacteria 1832
1293 Ga0500595_033571 3300053119 Bacteria 1702
1294 Ga0500595_038239 3300053119 Bacteria 1560
1295 Ga0500608_010820 3300053122 Bacteria 3933
1296 Ga0500608_066101 3300053122 Bacteria 1724
1297 Ga0500614_000745 3300053123 Bacteria 8292
1298 Ga0500642_0000080 3300053130 Bacteria 52024
1299 Ga0500642_0000302 3300053130 Bacteria 17637
1300 Ga0500652_000003 3300053131 Bacteria 221528
1301 Ga0500652_001787 3300053131 Bacteria 6519
1302 Ga0500652_007383 3300053131 Bacteria 3597
1303 Ga0500655_011446 3300053133 Bacteria 1608
1304 Ga0500559_0000714 3300053136 Bacteria 21826
1305 Ga0500559_0002857 3300053136 Bacteria 8726
1306 Ga0500559_0004788 3300053136 Bacteria 6337
1307 Ga0500568_0000001 3300053139 Bacteria 988705
1308 Ga0500568_0000978 3300053139 Bacteria 19672
1309 Ga0500568_0012491 3300053139 Bacteria 3903
1310 Ga0500577_0000263 3300053142 Bacteria 13754
1311 Ga0500586_001063 3300053145 Bacteria 5668
1312 Ga0500590_082201 3300053148 Bacteria 1580
1313 Ga0500603_000163 3300053150 Bacteria 16654
1314 Ga0500603_000339 3300053150 Bacteria 12234
1315 Ga0500616_0000002 3300053153 Bacteria 1611257
1316 Ga0500616_0000252 3300053153 Bacteria 83060
1317 Ga0500616_0000696 3300053153 Bacteria 39234
1318 Ga0500616_0004537 3300053153 Bacteria 9843
1319 Ga0500616_0012792 3300053153 Bacteria 4899
1320 Ga0500616_0016773 3300053153 Bacteria 4163
1321 Ga0500622_0003870 3300053156 Bacteria 9716
1322 Ga0500630_000788 3300053159 Bacteria 14585
1323 Ga0500633_0016195 3300053160 Bacteria 2158
1324 Ga0500638_084353 3300053162 Bacteria 1505
1325 Ga0500639_000765 3300053163 Bacteria 16347
1326 Ga0500636_0000066 3300053177 Bacteria 51367
1327 Ga0500636_0013143 3300053177 Bacteria 4858
1328 Ga0500636_0015097 3300053177 Bacteria 4546
1329 Ga0500636_0036362 3300053177 Bacteria 2915
1330 Ga0500637_0003078 3300053178 Bacteria 7601
1331 Ga0500637_0009851 3300053178 Bacteria 4886
1332 Ga0500637_0074348 3300053178 Bacteria 1958
1333 Ga0500625_043521 3300053729 Bacteria 2104
1334 Ga0500645_000385 3300053730 Bacteria 30984
1335 Ga0500596_004638 3300053735 Bacteria 2503
1336 Ga0500596_005269 3300053735 Bacteria 2296
1337 Ga0500596_005521 3300053735 Bacteria 2213
1338 Ga0500599_001124 3300053736 Bacteria 3028
1339 Ga0501084_0011449 3300054114 Bacteria 7345
1340 Ga0501084_0170783 3300054114 Bacteria 1835
1341 Ga0501084_0250095 3300054114 Bacteria 1496
1342 Ga0501082_0000183 3300060353 Bacteria 54241
1343 Ga0501082_0016777 3300060353 Bacteria 6306
1344 Ga0501082_0094903 3300060353 Bacteria 2578
1345 2507508360 2507262055 Bacteria 8048963
1346 2508542435 2508501009 Bacteria 7784016
1347 2508691802 2508501042 Bacteria 8719808
1348 2509150486 2508501128 Bacteria 8613869
1349 2511399885 2511231028 Bacteria 8046582
1350 2513625090 2513237092 Bacteria 8341956
1351 2513645612 2513237095 Bacteria 8976980
1352 2513657925 2513237096 Bacteria 8722461
1353 2513674458 2513237098 Bacteria 9902361
1354 2513692809 2513237101 Bacteria 7952346
1355 2513706618 2513237102 Bacteria 7703324
1356 2513722595 2513237104 Bacteria 10034502
1357 2513855623 2513237137 Bacteria 9558895
1358 2513872985 2513237139 Bacteria 8737671
1359 2513894740 2513237141 Bacteria 8496279
1360 2513919982 2513237145 Bacteria 8979722
1361 2514013752 2513237161 Bacteria 8871253
1362 2515627138 2515154112 Bacteria 8294334
1363 2517102835 2517093001 Bacteria 9002274
1364 2517892163 2517572143 Bacteria 9484767
1365 2524437565 2524023205 Bacteria 8918781
1366 2524465733 2524023210 Bacteria 9029266
1367 2524534263 2524023228 Bacteria 10118060
1368 2528853872 2528768022 Bacteria 10457665
1369 2603859667 2602042107 Bacteria 6226103
1370 2617347156 2617270735 Bacteria 9163226
1371 2617375537 2617270741 Bacteria 8201522
1372 2644288843 2643221651 Bacteria 4798932
1373 2671120582 2667528175 Bacteria 7532676
1374 2723844833 2721755755 Bacteria 8322773
1375 2728753143 2728368998 Bacteria 8720350
1376 2745079652 2744054633 Bacteria 8678936
1377 2793065480 2791355196 Bacteria 7323613
1378 2793068759 2791355197 Bacteria 8420563
1379 2793082294
1380 2805915115 2802429603 Bacteria 8777136
1381 2818238658 2816332527 Bacteria 8933356
1382 2824604110 2824600985 Bacteria 8488197
1383 2824610379 2824609381 Bacteria 8672835
1384 2824617953 2824617872 Bacteria 8814715
1385 2824626621 2824626560 Bacteria 8813858
1386 2824638638 2824635225 Bacteria 8785348
1387 2824646106 2824644064 Bacteria 8743947
1388 2824668631 2824661429 Bacteria 9877870
1389 2824672497 2824671348 Bacteria 8369588
1390 2824685881 2824679649 Bacteria 8248951
1391 2824688947 2824687955 Bacteria 8360029
1392 2824716292 2824714736 Bacteria 8717648
1393 2824746576 2824746037 Bacteria 7911610
1394 2824759517 2824753945 Bacteria 9787441
1395 2824771732 2824763712 Bacteria 9792355
1396 2824775416 2824773399 Bacteria 8360218
1397 2838123513 2838122688 Bacteria 8803140
1398 2841947711 2841941048 Bacteria 8688029
1399 2841949615 2841949485 Bacteria 8680857
1400 2841964204 2841957949 Bacteria 8652217
1401 2841971878 2841966195 Bacteria 8673214
1402 2841974779 2841974524 Bacteria 8931498
1403 2841983663 2841983080 Bacteria 8395090
1404 2842040027 2842038055 Bacteria 8002051
1405 2842047028 2842045827 Bacteria 8006841
1406 2844319277 2844315083 Bacteria 8138177
1407 2847936438 2847930680 Bacteria 9342022
1408 2847946787 2847939898 Bacteria 8606328
1409 2849079100 2849076700 Bacteria 7039503
1410 2857516649 2857509624 Bacteria 7472071
1411 2857528935 2857524615 Bacteria 6615449
1412 2874598273 2874590934 Bacteria 8299676
1413 2874605455 2874604998 Bacteria 7834745
1414 2874619525 2874612657 Bacteria 8252029
1415 2874627580 2874620515 Bacteria 8290088
1416 2874632087 2874628541 Bacteria 8630250
1417 2874652671 2874645413 Bacteria 8214782
1418 2876764755 2876761206 Bacteria 10111113
1419 2876778249 2876771140 Bacteria 8287509
1420 2876814391 2876808645 Bacteria 8824342
1421 2876825882 2876818435 Bacteria 8274608
1422 2879082043 2879074833 Bacteria 8279565
1423 2879090220 2879083081 Bacteria 8587928
1424 2879104898 2879099564 Bacteria 10442239
1425 2879115768 2879110137 Bacteria 8907982
1426 2879135190 2879127579 Bacteria 8294491
1427 2879145451 2879142872 Bacteria 8267021
1428 2881368621 2881364244 Bacteria 7710352
1429 2881673292 2881665667 Bacteria 8175609
1430 2885373551 2885366525 Bacteria 8326213
1431 2885382740 2885374607 Bacteria 8927485
1432 2888384294 2888378607 Bacteria 9652610
1433 2888393592 2888388044 Bacteria 7304136
1434 2888424754 2888419890 Bacteria 7857137
1435 2889039539 2889033259 Bacteria 9099371
1436 2893070393 2893066018 Bacteria 6158120
1437 2903731117 2903727486 Bacteria 8281579
1438 2903754908 2903748898 Bacteria 9972761
1439 2903771783 2903768456 Bacteria 9749579
1440 2904673100 2904666416 Bacteria 8226587
1441 2904694762 2904690495 Bacteria 9412302
1442 2904702306
1443 2904714905 2904711408 Bacteria 9771557
1444 2906607374 2906602504 Bacteria 8295279
1445 2906617290
1446 2906631141 2906626472 Bacteria 8826946
1447 2906643315 2906635258 Bacteria 8601019
1448 2906645151 2906643746 Bacteria 8722424
1449 2906662555 2906660503 Bacteria 8595048
1450 2908742441 2908739725 Bacteria 8628932
1451 2908760084 2908756301 Bacteria 8864324
1452 2908780398 2908775508 Bacteria 8092255
1453 2919076335 2919073203 Bacteria 6531949
1454 2922365585 2922361189 Bacteria 7436256
1455 2922374651
1456 2922391203 2922386360 Bacteria 7017218
1457 2922400578 2922393267 Bacteria 8285685
1458 2922430534
1459 2929621745 2929615660 Bacteria 9193770
1460 2929629948 2929624759 Bacteria 9339455
1461 2932788597 2932784394 Bacteria 9704911
1462 2932798131 2932794094 Bacteria 7915132
1463 2932807013 2932801729 Bacteria 7987968
1464 2932817181 2932809354 Bacteria 9135765
1465 2932825230 2932818245 Bacteria 9955613
1466 2932830246 2932828146 Bacteria 9745859
1467 2933583979 2933577622 Bacteria 9116884
1468 2935609152 2935608549 Bacteria 8203142
1469 2935622528 2935616580 Bacteria 9032984
1470 2935631308 2935630451 Bacteria 8169952
1471 2935642133 2935638405 Bacteria 10015038
1472 2935651048 2935648319 Bacteria 8801166
1473 2935659229 2935656913 Bacteria 8965014
1474 2935672483 2935665750 Bacteria 9571747
1475 2935676053 2935675223 Bacteria 9928132
1476 2935686044 2935684952 Bacteria 9590419
1477 2935697711 2935694250 Bacteria 9291695
1478 2935705884 2935703347 Bacteria 10242284
1479 2935714596 2935713505 Bacteria 9608509
1480 2935725215 2935722832 Bacteria 9608746
1481 2935732425 2935732158 Bacteria 9706831
1482 2935741804 2935741537 Bacteria 9707219
1483 2935752009 2935750917 Bacteria 9590372
1484 2935765266 2935760218 Bacteria 9817913
1485 2935771829 2935769743 Bacteria 7878163
1486 2935778731 2935777560 Bacteria 8077691
1487 2935788880 2935785616 Bacteria 7962367
1488 2935795320 2935793552 Bacteria 8012592
1489 2935802881 2935801545 Bacteria 9301974
1490 2935813287 2935810662 Bacteria 9401221
1491 2935822312 2935819856 Bacteria 8261050
1492 2935830300 2935827899 Bacteria 10038562
1493 2935838197 2935837841 Bacteria 9454360
1494 2935847894 2935847175 Bacteria 8228321
1495 2935860777 2935855204 Bacteria 9035059
1496 2935872250 2935864058 Bacteria 9784707
1497 2935878695 2935873716 Bacteria 9632195
1498 2935886863 2935883170 Bacteria 7964738
1499 2935908887 2935908558 Bacteria 8568796
1500 2935919606 2935916978 Bacteria 9113783
1501 2935926539 2935926038 Bacteria 8601059
1502 2935934989 2935934488 Bacteria 8602579
1503 2935943439 2935942939 Bacteria 8599779
1504 2935951877 2935951376 Bacteria 8602333
1505 2935960636 2935959822 Bacteria 7869783
1506 2935968002 2935967501 Bacteria 8603075
1507 2935978631 2935975950 Bacteria 8347125
1508 2935987511 2935984226 Bacteria 8302647
1509 2935994909 2935992306 Bacteria 9802711
1510 2936003552 2936002035 Bacteria 9362176
1511 2936013644 2936011229 Bacteria 8801034
1512 2936022229 2936019824 Bacteria 8804134
1513 2936030675 2936028420 Bacteria 8965941
1514 2936042236 2936037263 Bacteria 9446081
1515 2936048488 2936046547 Bacteria 8903709
1516 2936058702 2936055302 Bacteria 8785755
1517 2940557188 2940556831 Bacteria 9590747
1518 2941510049 2941507105 Bacteria 8166816
1519 2941518864 2941515067 Bacteria 8166720
1520 2941525448 2941523033 Bacteria 8169134
1521 2941533033 2941531003 Bacteria 7653939
1522 2941539136 2941538514 Bacteria 9402094
1523 3005480446 3005474847 Bacteria 9259049
1524 3005484539 3005483717 Bacteria 7877331
1525 3005510542 3005506211 Bacteria 6943378
1526 3005587822 3005587118 Bacteria 7794411
1527 3005599459 3005594810 Bacteria 8716512
1528 3005715119 3005710791 Bacteria 7622528
1529 3005722519 3005718088 Bacteria 8283608
1530 8006931345 8006926726 Bacteria 6749210
1531 8006940438 8006933436 Bacteria 10410654
1532 8006967078 8006964411 Bacteria 8966052
1533 8006980127 8006973647 Bacteria 10679141
1534 8006988037 8006984368 Bacteria 9651211
1535 8006995763 8006994254 Bacteria 8309700
1536 8016522062 8016511872 Bacteria 9921665
1537 8016529399 8016522445 Bacteria 8156687
1538 8016534609 8016530956 Bacteria 8155261
1539 8016547833 8016539877 Bacteria 8155419
1540 8016554304 8016548790 Bacteria 8155074
1541 8016562679 8016557553 Bacteria 8154380
1542 8016572955 8016566248 Bacteria 8158151
1543 8016600460 8016595262 Bacteria 8149947
1544 8016610283 8016603502 Bacteria 8731218
1545 8016614649 8016613128 Bacteria 8794220
1546 8016626345 8016622563 Bacteria 7999408
1547 8016640087 8016630954 Bacteria 9217207
1548 8017063605 8017057580 Bacteria 10023680
1549 8019534375 8019530166 Bacteria 8155624
1550 8019545087 8019538911 Bacteria 7872763
1551 8019553434 8019547302 Bacteria 7996444
1552 8019556341 8019555841 Bacteria 9642137
1553 8019568971 8019565922 Bacteria 9639779
1554 8019582929 8019576017 Bacteria 10049540
1555 8019590726 8019586578 Bacteria 10212056
1556 8019600623 8019597564 Bacteria 10041141
1557 8019617922 8019608314 Bacteria 10042931
1558 8019628426 8019619141 Bacteria 9218857
1559 8019645523 8019638758 Bacteria 9062356
1560 8019658762 8019648815 Bacteria 10014479
1561 8019662086 8019659431 Bacteria 8577854
1562 8019671605 8019668869 Bacteria 8791617
1563 8019690301 8019687851 Bacteria 8712826
1564 8055746089 8055742211 Bacteria 9226248
1565 8056673620 8056673599 Bacteria 7871253
1566 8056687384 8056681323 Bacteria 8472857
1567 8056691291 8056689827 Bacteria 6712655
1568 8056968249 8056967851 Bacteria 9038162
1569 Ga0436365_1260219
1570 2214745197
1571 ARcpr5oldR_c000160
1572 ARSoilYngRDRAFT_c00063
1573 ARcpr5yngRDRAFT_c000034
1574 ARSoilOldRDRAFT_c000147
1575 JGI24737J22298_10000521
1576 JGI24750J21931_1000637
1577 JGI24035J26624_1000503
1578 JGI24742J22300_10001833
1579 JGI24751J29686_10009828
1580 JGI25406J46586_10000047
1581 JGI25153J46596_10000740
1582 JGI25153J46596_10003653
1583 JGI25160J50197_1001080
1584 Ga0055531_10003612
1585 Ga0065165_1025653
1586 Ga0065712_10001661
1587 Ga0065715_10004531
1588 Ga0065715_10090446
1589 Ga0070658_10059686
1590 Ga0070658_10098944
1591 Ga0070676_10000905
1592 Ga0070683_100022201
1593 Ga0070683_100089578
1594 Ga0070690_100002135
1595 Ga0070690_100004750
1596 Ga0070670_100077822
1597 Ga0070670_100096468
1598 Ga0070677_10006219
1599 Ga0068869_100008696
1600 Ga0068869_100028213
1601 Ga0070666_10005333
1602 Ga0070666_10007448
1603 Ga0070680_100011041
1604 Ga0070680_100018350
1605 Ga0070680_100162923
1606 Ga0070682_100002763
1607 Ga0070682_100028035
1608 Ga0070682_100032890
1609 Ga0068868_100009579
1610 Ga0068868_100018639
1611 Ga0068868_100031028
1612 Ga0068868_100276285
1613 Ga0070660_100000985
1614 Ga0070660_100026110
1615 Ga0070660_100035104
1616 Ga0070660_100049723
1617 Ga0070689_100010818
1618 Ga0070689_100049462
1619 Ga0070689_100067341
1620 Ga0070689_100092019
1621 Ga0070689_100109297
1622 Ga0070691_10000060
1623 Ga0070687_100001608
1624 Ga0070687_100087956
1625 Ga0070661_100024705
1626 Ga0070661_100141724
1627 Ga0070692_10002122
1628 Ga0070692_10019414
1629 Ga0070668_100004462
1630 Ga0070668_100020450
1631 Ga0070669_100001173
1632 Ga0070675_100008084
1633 Ga0070675_100025493
1634 Ga0070675_100073782
1635 Ga0070671_100000349
1636 Ga0070671_100098641
1637 Ga0070671_100201469
1638 Ga0070674_100013947
1639 Ga0070674_100032577
1640 Ga0070674_100047762
1641 Ga0070674_100064813
1642 Ga0070673_100007101
1643 Ga0070673_100055829
1644 Ga0070673_100153399
1645 Ga0070688_100000475
1646 Ga0070688_100005391
1647 Ga0070688_100013195
1648 Ga0070659_100006503
1649 Ga0070667_100000810
1650 Ga0070667_100009653
1651 Ga0070667_100015010
1652 Ga0070667_100148326
1653 Ga0070703_10007949
1654 Ga0070709_10011165
1655 Ga0070709_10021489
1656 Ga0070709_10029765
1657 Ga0070709_10068774
1658 Ga0070714_100048569
1659 Ga0070714_100051098
1660 Ga0070714_100102147
1661 Ga0070714_100111893
1662 Ga0070714_100257729
1663 Ga0070713_100012585
1664 Ga0070713_100028354
1665 Ga0070713_100029886
1666 Ga0070713_100046807
1667 Ga0070710_10001849
1668 Ga0070710_10127488
1669 Ga0070701_10005299
1670 Ga0070701_10009325
1671 Ga0070711_100020708
1672 Ga0070711_100063443
1673 Ga0070705_100015365
1674 Ga0070700_100000664
1675 Ga0070700_100032022
1676 Ga0070700_100070960
1677 Ga0070700_100116164
1678 Ga0070694_100005788
1679 Ga0070663_100003715
1680 Ga0070663_100025035
1681 Ga0070663_100034160
1682 Ga0070663_100105892
1683 Ga0070678_100003479
1684 Ga0070678_100033155
1685 Ga0070678_100038499
1686 Ga0070678_100046523
1687 Ga0070662_100005798
1688 Ga0070662_100007680
1689 Ga0070662_100086845
1690 Ga0070681_10015477
1691 Ga0070681_10021129
1692 Ga0070681_10040444
1693 Ga0070681_10115998
1694 Ga0070681_10258209
1695 Ga0068867_100002762
1696 Ga0068867_100110168
1697 Ga0068867_100118206
1698 Ga0070685_10004766
1699 Ga0070685_10009588
1700 Ga0070679_100015288
1701 Ga0070679_100029125
1702 Ga0070679_100050504
1703 Ga0070679_100062725
1704 Ga0070679_100141517
1705 Ga0070679_100148690
1706 Ga0070679_100161968
1707 Ga0070679_100188559
1708 Ga0070684_100000464
1709 Ga0070684_100010906
1710 Ga0070684_100012560
1711 Ga0070684_100026872
1712 Ga0070697_100086517
1713 Ga0068853_100003829
1714 Ga0068853_100025347
1715 Ga0068853_100073806
1716 Ga0068853_100095505
1717 Ga0070672_100145150
1718 Ga0070672_100148853
1719 Ga0070686_100001439
1720 Ga0070686_100016485
1721 Ga0070686_100044137
1722 Ga0070686_100048141
1723 Ga0070686_100063471
1724 Ga0070695_100001320
1725 Ga0070695_100001619
1726 Ga0070695_100008441
1727 Ga0070696_100011085
1728 Ga0070693_100000266
1729 Ga0070665_100083382
1730 Ga0070665_100104524
1731 Ga0070665_100147673
1732 Ga0070665_100221489
1733 Ga0070704_100001701
1734 Ga0070704_100002112
1735 Ga0068855_100034429
1736 Ga0068855_100034770
1737 Ga0068855_100059531
1738 Ga0068855_100160757
1739 Ga0068855_100208295
1740 Ga0068855_100209137
1741 Ga0068855_100277971
1742 Ga0070664_100012689
1743 Ga0070664_100155908
1744 Ga0068857_100006833
1745 Ga0068857_100049167
1746 Ga0068854_100005898
1747 Ga0068854_100024241
1748 Ga0068856_100000020
1749 Ga0068856_100149477
1750 Ga0070702_100004216
1751 Ga0068852_100005120
1752 Ga0068852_100007306
1753 Ga0068852_100015569
1754 Ga0068852_100015717
1755 Ga0068852_100042670
1756 Ga0068852_100081153
1757 Ga0068859_100013817
1758 Ga0068859_100037907
1759 Ga0068859_100046985
1760 Ga0068859_100077641
1761 Ga0068864_100019484
1762 Ga0068864_100046630
1763 Ga0068864_100129170
1764 Ga0068864_100262673
1765 Ga0068866_10000694
1766 Ga0068866_10029627
1767 Ga0068861_100013181
1768 Ga0068861_100023990
1769 Ga0068861_100110233
1770 Ga0068870_10009104
1771 Ga0068863_100001201
1772 Ga0068863_100007995
1773 Ga0068863_100076014
1774 Ga0068858_100016234
1775 Ga0068858_100023790
1776 Ga0068858_100051014
1777 Ga0068858_100067510
1778 Ga0068860_100001359
1779 Ga0068860_100001708
1780 Ga0068860_100024209
1781 Ga0068860_100081370
1782 Ga0068860_100132560
1783 Ga0068862_100005931
1784 Ga0068862_100042098
1785 Ga0068862_100058981
1786 Ga0081455_10000009
1787 Ga0081455_10006680
1788 Ga0081455_10030306
1789 Ga0081455_10096354
1790 Ga0081540_1000143
1791 Ga0081540_1002154
1792 Ga0081540_1002625
1793 Ga0081540_1003015
1794 Ga0081540_1005422
1795 Ga0081540_1006906
1796 Ga0081540_1011009
1797 Ga0081540_1016111
1798 Ga0081540_1023632
1799 Ga0081540_1028760
1800 Ga0081539_10000140
1801 Ga0081539_10002339
1802 Ga0081539_10018773
1803 Ga0070717_10001862
1804 Ga0070717_10045194
1805 Ga0075365_10041177
1806 Ga0075365_10127397
1807 Ga0075368_10014162
1808 Ga0075363_100004915
1809 Ga0075363_100046915
1810 Ga0075364_10024537
1811 Ga0070715_10003038
1812 Ga0070715_10012125
1813 Ga0070715_10065946
1814 Ga0070716_100003599
1815 Ga0070712_100004909
1816 Ga0070712_100027618
1817 Ga0070712_100029025
1818 Ga0070712_100048375
1819 Ga0070712_100061706
1820 Ga0070712_100220162
1821 Ga0075362_10003689
1822 Ga0075362_10025532
1823 Ga0075362_10036285
1824 Ga0075367_10005474
1825 Ga0075367_10018220
1826 Ga0075367_10026576
1827 Ga0075369_10045777
1828 Ga0075366_10059614
1829 Ga0097621_100001359
1830 Ga0097621_100085119
1831 Ga0075370_10047579
1832 Ga0075370_10075879
1833 Ga0075370_10103009
1834 Ga0068871_100003508
1835 Ga0068871_100081780
1836 Ga0075430_100000244
1837 Ga0075434_100026091
1838 Ga0075434_100097339
1839 Ga0068865_100001830
1840 Ga0068865_100025798
1841 Ga0068865_100079400
1842 Ga0075436_100004211
1843 Ga0075436_100031832
1844 Ga0097620_100013818
1845 Ga0097620_100037906
1846 Ga0097620_100046986
1847 Ga0097620_100077644
1848 Ga0099824_1007930
1849 Ga0099824_1015115
1850 Ga0075435_100013273
1851 Ga0075435_100191542
1852 Ga0099795_10025171
1853 Ga0105250_10045953
1854 Ga0105240_10017915
1855 Ga0105240_10038025
1856 Ga0105240_10045568
1857 Ga0105240_10047264
1858 Ga0105240_10073684
1859 Ga0105240_10173056
1860 Ga0105240_10275619
1861 Ga0111539_10000173
1862 Ga0111539_10018558
1863 Ga0111539_10078446
1864 Ga0111539_10084268
1865 Ga0111539_10087823
1866 Ga0111539_10186184
1867 Ga0105245_10003312
1868 Ga0105245_10021446
1869 Ga0105245_10106651
1870 Ga0105247_10024725
1871 Ga0105247_10026306
1872 Ga0114129_10187696
1873 Ga0114129_10354797
1874 Ga0105243_10011575
1875 Ga0105243_10130437
1876 Ga0105241_10009656
1877 Ga0105241_10126238
1878 Ga0105242_10000399
1879 Ga0105242_10033580
1880 Ga0105242_10163493
1881 Ga0105248_10013945
1882 Ga0105248_10032551
1883 Ga0105248_10235723
1884 Ga0105248_10241572
1885 Ga0105248_10283693
1886 Ga0105237_10034867
1887 Ga0105237_10062673
1888 Ga0105237_10184625
1889 Ga0105237_10386896
1890 Ga0105238_10008599
1891 Ga0105238_10018493
1892 Ga0105238_10072194
1893 Ga0105238_10082718
1894 Ga0105238_10145210
1895 Ga0105249_10029823
1896 Ga0105239_10067902
1897 Ga0105239_10080663
1898 Ga0105239_10082676
1899 Ga0105239_10108616
1900 Ga0105239_10201369
1901 Ga0105239_10279979
1902 Ga0105246_10000033
1903 Ga0105246_10023862
1904 Ga0157373_10005894
1905 Ga0157371_10031668
1906 Ga0157370_10128904
1907 Ga0157370_10186971
1908 Ga0157369_10010862
1909 Ga0157369_10088464
1910 Ga0157369_10097519
1911 Ga0157374_10018913
1912 Ga0157374_10087148
1913 Ga0157378_10009284
1914 Ga0157378_10057957
1915 Ga0157378_10073594
1916 Ga0163162_10007926
1917 Ga0163162_10049822
1918 Ga0163162_10126869
1919 Ga0163162_10312021
1920 Ga0157372_10001162
1921 Ga0157372_10067851
1922 Ga0157372_10154780
1923 Ga0157375_10018904
1924 Ga0157375_10021748
1925 Ga0157375_10033246
1926 Ga0157375_10141304
1927 Ga0157375_10321881
1928 Ga0163163_10001787
1929 Ga0163163_10060072
1930 Ga0163163_10098726
1931 Ga0163163_10152441
1932 Ga0157380_10064729
1933 Ga0157377_10000740
1934 Ga0157377_10024449
1935 Ga0157379_10003378
1936 Ga0157379_10097715
1937 Ga0157376_10005599
1938 Ga0157376_10229775
1939 Ga0163161_10008117
1940 Ga0163161_10008394
1941 Ga0206356_10558017
1942 Ga0214544_1000002
1943 Ga0214542_1000001
1944 Ga0214545_1000001
1945 Ga0214543_1000001
1946 Ga0213872_10023205
1947 Ga0213876_10009439
1948 Ga0213876_10056797
1949 Ga0213875_10000007
1950 Ga0209677_102829
1951 Ga0209148_1000428
1952 Ga0209233_1000804
1953 Ga0209233_1006202
1954 Ga0209233_1008608
1955 Ga0207666_1000006
1956 Ga0207666_1001276
1957 Ga0209455_1002286
1958 Ga0207673_1000712
1959 Ga0209564_1001578
1960 Ga0209564_1003479
1961 Ga0209564_1026529
1962 Ga0209758_1000140
1963 Ga0209758_1000321
1964 Ga0209758_1001092
1965 Ga0209758_1001514
1966 Ga0209758_1001968
1967 Ga0209758_1002659
1968 Ga0209758_1003492
1969 Ga0209758_1008964
1970 Ga0209758_1017349
1971 Ga0209256_1005434
1972 Ga0207426_1000278
1973 Ga0207426_1000378
1974 Ga0207426_1002170
1975 Ga0207426_1018412
1976 Ga0207426_1023520
1977 Ga0209257_1000522
1978 Ga0207697_10000009
1979 Ga0207697_10004408
1980 Ga0207656_10012199
1981 Ga0207653_10036515
1982 Ga0207682_10000301
1983 Ga0207692_10000849
1984 Ga0207692_10006397
1985 Ga0207692_10017678
1986 Ga0207692_10034555
1987 Ga0207642_10043027
1988 Ga0207710_10018364
1989 Ga0207688_10000012
1990 Ga0207688_10000263
1991 Ga0207688_10041797
1992 Ga0207680_10007512
1993 Ga0207680_10020383
1994 Ga0207680_10029543
1995 Ga0207647_10002921
1996 Ga0207647_10006251
1997 Ga0207647_10033866
1998 Ga0207685_10004719
1999 Ga0207699_10007610
2000 Ga0207699_10017739
2001 Ga0207699_10025811
2002 Ga0207645_10000124
2003 Ga0207645_10022280
2004 Ga0207645_10056703
2005 Ga0207645_10086454
2006 Ga0207643_10000046
2007 Ga0207643_10000889
2008 Ga0207705_10075165
2009 Ga0207705_10115555
2010 Ga0207684_10003987
2011 Ga0207684_10133715
2012 Ga0207654_10004889
2013 Ga0207654_10015528
2014 Ga0207707_10009522
2015 Ga0207707_10011411
2016 Ga0207707_10024737
2017 Ga0207707_10027011
2018 Ga0207707_10033774
2019 Ga0207707_10059952
2020 Ga0207707_10294682
2021 Ga0207695_10000008
2022 Ga0207695_10008039
2023 Ga0207695_10081943
2024 Ga0207695_10120229
2025 Ga0207671_10007118
2026 Ga0207671_10044503
2027 Ga0207671_10120545
2028 Ga0207693_10001080
2029 Ga0207693_10001875
2030 Ga0207693_10007332
2031 Ga0207693_10018304
2032 Ga0207693_10050341
2033 Ga0207693_10055325
2034 Ga0207693_10174151
2035 Ga0207663_10000347
2036 Ga0207663_10010022
2037 Ga0207663_10021116
2038 Ga0207663_10143834
2039 Ga0207660_10071085
2040 Ga0207660_10109729
2041 Ga0207660_10133279
2042 Ga0207660_10160578
2043 Ga0207662_10000154
2044 Ga0207662_10000222
2045 Ga0207662_10032507
2046 Ga0207662_10144063
2047 Ga0207657_10000162
2048 Ga0207657_10030200
2049 Ga0207657_10060302
2050 Ga0207657_10071568
2051 Ga0207657_10152882
2052 Ga0207649_10000798
2053 Ga0207652_10021470
2054 Ga0207652_10045919
2055 Ga0207652_10117589
2056 Ga0207652_10122151
2057 Ga0207652_10308076
2058 Ga0207681_10007488
2059 Ga0207681_10094623
2060 Ga0207694_10018170
2061 Ga0207694_10048738
2062 Ga0207650_10054665
2063 Ga0207659_10000762
2064 Ga0207659_10140306
2065 Ga0207659_10199744
2066 Ga0207687_10008325
2067 Ga0207687_10023134
2068 Ga0207687_10131080
2069 Ga0207700_10000290
2070 Ga0207700_10078975
2071 Ga0207700_10082443
2072 Ga0207700_10102014
2073 Ga0207700_10178814
2074 Ga0207664_10010393
2075 Ga0207664_10011397
2076 Ga0207664_10029434
2077 Ga0207664_10096420
2078 Ga0207664_10097259
2079 Ga0207644_10024576
2080 Ga0207644_10056409
2081 Ga0207690_10006396
2082 Ga0207690_10100607
2083 Ga0207706_10000929
2084 Ga0207706_10020484
2085 Ga0207706_10155385
2086 Ga0207686_10084159
2087 Ga0207686_10090123
2088 Ga0207709_10000256
2089 Ga0207709_10106054
2090 Ga0207670_10003293
2091 Ga0207670_10010584
2092 Ga0207670_10020290
2093 Ga0207670_10066843
2094 Ga0207669_10001769
2095 Ga0207669_10045983
2096 Ga0207669_10051306
2097 Ga0207669_10078648
2098 Ga0207669_10096367
2099 Ga0207669_10109797
2100 Ga0207704_10021960
2101 Ga0207704_10037137
2102 Ga0207665_10000719
2103 Ga0207665_10043622
2104 Ga0207665_10105306
2105 Ga0207691_10006340
2106 Ga0207691_10006425
2107 Ga0207691_10015435
2108 Ga0207691_10118759
2109 Ga0207711_10036622
2110 Ga0207711_10053917
2111 Ga0207711_10182249
2112 Ga0207689_10000109
2113 Ga0207689_10031109
2114 Ga0207689_10051147
2115 Ga0207689_10052656
2116 Ga0207661_10001655
2117 Ga0207661_10006709
2118 Ga0207661_10093766
2119 Ga0207661_10096435
2120 Ga0207661_10115604
2121 Ga0207661_10148070
2122 Ga0207679_10000763
2123 Ga0207679_10027676
2124 Ga0207679_10039187
2125 Ga0207679_10210571
2126 Ga0207667_10021843
2127 Ga0207667_10034067
2128 Ga0207667_10109822
2129 Ga0207667_10119538
2130 Ga0207667_10123233
2131 Ga0207667_10164754
2132 Ga0207667_10170068
2133 Ga0207651_10000900
2134 Ga0207651_10004250
2135 Ga0207651_10130307
2136 Ga0207712_10010883
2137 Ga0207712_10022037
2138 Ga0207712_10030069
2139 Ga0207712_10040854
2140 Ga0207668_10015835
2141 Ga0207668_10030283
2142 Ga0207640_10004377
2143 Ga0207658_10018594
2144 Ga0207658_10034145
2145 Ga0207677_10007601
2146 Ga0207677_10010239
2147 Ga0207677_10011127
2148 Ga0207703_10012561
2149 Ga0207703_10013883
2150 Ga0207703_10028301
2151 Ga0207703_10060311
2152 Ga0207639_10039190
2153 Ga0207639_10053845
2154 Ga0207639_10195327
2155 Ga0207678_10004447
2156 Ga0207678_10006545
2157 Ga0207678_10008261
2158 Ga0207678_10029694
2159 Ga0207678_10034437
2160 Ga0207678_10056317
2161 Ga0207708_10000098
2162 Ga0207708_10002092
2163 Ga0207708_10006322
2164 Ga0207708_10012533
2165 Ga0207708_10109972
2166 Ga0207702_10000002
2167 Ga0207702_10002142
2168 Ga0207702_10114296
2169 Ga0207702_10115998
2170 Ga0207641_10038224
2171 Ga0207641_10135346
2172 Ga0207641_10150619
2173 Ga0207648_10001639
2174 Ga0207648_10002003
2175 Ga0207648_10010667
2176 Ga0207648_10059959
2177 Ga0207676_10017955
2178 Ga0207676_10031583
2179 Ga0207676_10095444
2180 Ga0207674_10000420
2181 Ga0207674_10003611
2182 Ga0207674_10033144
2183 Ga0207674_10044894
2184 Ga0207675_100002543
2185 Ga0207675_100008008
2186 Ga0207675_100124538
2187 Ga0207675_100196290
2188 Ga0207683_10000004
2189 Ga0207683_10001293
2190 Ga0207683_10015556
2191 Ga0207683_10020374
2192 Ga0207683_10035723
2193 Ga0207698_10004120
2194 Ga0207698_10017188
2195 Ga0209389_1000032
2196 Ga0209389_1000995
2197 Ga0209589_1000001
2198 Ga0209589_1000211
2199 Ga0209489_100001
2200 Ga0209489_100006
2201 Ga0209489_111765
2202 Ga0209700_100001
2203 Ga0209700_100005
2204 Ga0209966_1001208
2205 Ga0209998_10002107
2206 Ga0209998_10003369
2207 Ga0209974_10009223
2208 Ga0207428_10000303
2209 Ga0207428_10019216
2210 Ga0268266_10044379
2211 Ga0268266_10047490
2212 Ga0268266_10056381
2213 Ga0268265_10012335
2214 Ga0268264_10000149
2215 Ga0268264_10073523
2216 Ga0268264_10102135
2217 Ga0268264_10198647
2218 Ga0268264_10226639
2219 Ga0265337_1000539
2220 Ga0265334_10045848
2221 Ga0265318_10012129
2222 Ga0265336_10013212
2223 Ga0307517_10000249
2224 Ga0307515_10050561
2225 Ga0265338_10000665
2226 Ga0265338_10010360
2227 Ga0265338_10085175
2228 Ga0265330_10012435
2229 Ga0265332_10001409
2230 Ga0265320_10011080
2231 Ga0265325_10000603
2232 Ga0265325_10008234
2233 Ga0265325_10055536
2234 Ga0265340_10011380
2235 Ga0265340_10011777
2236 Ga0265340_10023020
2237 Ga0265339_10000465
2238 Ga0265339_10016860
2239 Ga0265339_10036117
2240 Ga0265339_10048704
2241 Ga0265339_10086086
2242 Ga0265331_10025769
2243 Ga0265331_10029591
2244 Ga0307509_10004311
2245 Ga0307408_100024489
2246 Ga0265313_10000006
2247 Ga0265313_10010630
2248 Ga0307508_10000018
2249 Ga0307508_10109943
2250 Ga0265314_10002127
2251 Ga0265314_10019317
2252 Ga0265342_10001132
2253 Ga0265342_10002171
2254 Ga0265342_10094300
2255 Ga0316576_10157855
2256 Ga0307516_10011365
2257 Ga0307516_10153301
2258 Ga0307410_10176024
2259 Ga0307412_10058553
2260 Ga0307412_10135882
2261 Ga0307416_100142142
2262 Ga0307411_10187957
2263 Ga0307507_10022838
2264 Ga0307510_10013733
2265 Ga0307510_10033134
2266 Ga0307510_10048914
2267 Ga0315911_1000006
2268 Ga0316215_1003036
2269 Ga0373958_0001300
2270 Ga0373938_0000022
2271 Ga0373929_0000472
2272 Ga0373934_0005378
2273 Ga0373940_0000137
2274 Ga0373949_0000261
2275 Ga0373951_0002760
2276 Ga0373952_0003517
2277 Ga0373932_0002247
2278 Ga0373939_0000463
2279 Ga0373939_0003813
2280 Ga0373941_0000221
2281 Ga0373941_0000589
2282 Ga0373945_0015340
2283 Ga0373953_0040881
2284 Ga0373954_0003471
2285 Ga0373954_0054642
2286 Ga0373956_0002490
2287 Ga0373956_0024869
2288 Ga0373957_0009403
2289 Ga0373960_0000800
2290 Ga0373960_0002104
2291 Ga0373943_0000061
2292 Ga0373943_0022381
2293 Ga0373946_0025537
2294 Ga0373955_0013625
2295 Ga0373955_0020458
2296 Ga0373942_0006530
2297 Ga0373961_0005825
2298 Ga0373961_0008356
2299 Ga0373962_0003673
2300 Ga0373962_0013120
2301 Ga0373924_0008696
2302 Ga0373924_0011814
2303 Ga0373931_0000750
2304 Ga0373935_0001116
2305 Ga0373935_0015189
2306 Ga0373935_0068802
2307 Ga0373935_0105033
2308 Ga0373927_0000275
2309 Ga0373927_0001437
2310 Ga0373927_0004277
2311 Ga0373927_0020807
2312 Ga0373927_0053127
2313 Ga0373927_0059425
2314 Ga0373933_0001880
2315 Ga0373933_0003392
2316 Ga0373933_0053271
2317 Ga0373933_0081011
2318 Ga0373947_0000187
2319 Ga0373947_0003173
2320 Ga0373947_0028877
2321 Ga0373947_0084669
2322 Ga0373937_0016414
2323 Ga0373937_0020656
2324 Ga0373937_0065794
2325 Ga0373925_0000791
2326 Ga0373925_0006458
2327 Ga0373925_0021188
2328 Ga0373925_0075820
2329 Ga0373925_0083593
2330 Ga0373925_0133663
2331 Ga0373925_0145606
2332 Ga0395899_0007661
2333 Ga0395899_0048874
2334 Ga0395900_0002820
2335 Ga0395900_0132770
2336 Ga0395900_0183877
2337 Ga0395900_0224298
2338 Ga0395900_0504171
2339 Ga0395898_0035823
2340 Ga0395898_0037214
2341 Ga0395898_0114923
2342 Ga0395898_0116527
2343 Ga0395898_0256323
2344 Ga0395905_0013848
2345 Ga0436364_0009242
2346 Ga0436364_0565423
2347 Ga0436364_1381345
2348 Ga0395901_0073052
2349 Ga0395901_0102522
2350 Ga0395901_0206396
2351 Ga0395901_0217750
2352 Ga0395901_0281687
2353 Ga0436365_0244105
2354 Ga0436365_0552397
2355 Ga0436365_0712843
2356 Ga0436361_0476110
2357 Ga0436363_0312479
2358 Ga0436363_1211778
2359 Ga0466972_0000160
2360 Ga0466972_0041245
2361 Ga0453683_0000499
2362 Ga0466965_0068895
2363 Ga0466966_0000669
2364 Ga0466961_0000208
2365 Ga0466961_0049061
2366 Ga0466963_0051971
2367 Ga0466957_0304793
2368 Ga0466960_0004027
2369 Ga0466959_0000832
2370 Ga0466959_0065541
2371 Ga0466967_0007808
2372 Ga0495592_0002109
2373 Ga0495592_0010077
2374 Ga0495603_0001086
2375 Ga0495603_0005459
2376 Ga0495603_0012614
2377 Ga0495603_0025716
2378 Ga0495629_0000329
2379 Ga0495629_0000726
2380 Ga0495629_0008557
2381 Ga0495629_0073225
2382 Ga0495629_0145998
2383 Ga0495638_0078657
2384 Ga0495641_0000747
2385 Ga0495641_0009078
2386 Ga0495651_0000528
2387 Ga0495651_0001234
2388 Ga0495653_0000358
2389 Ga0495653_0024434
2390 Ga0495653_0120003
2391 Ga0495582_0000416
2392 Ga0495582_0018577
2393 Ga0495582_0039151
2394 Ga0495605_0058321
2395 Ga0495605_0077055
2396 Ga0495639_0000165
2397 Ga0495639_0042460
2398 Ga0495662_0000066
2399 Ga0495662_0007797
2400 Ga0495662_0055096
2401 Ga0495664_0000510
2402 Ga0495664_0003203
2403 Ga0495664_0025954
2404 Ga0495585_0050021
2405 Ga0495594_0000441
2406 Ga0495594_0104469
2407 Ga0495607_0055693
2408 Ga0495606_0001663
2409 Ga0495606_0045553
2410 Ga0495608_0002274
2411 Ga0495608_0002377
2412 Ga0495608_0025275
2413 Ga0495608_0041729
2414 Ga0495618_0002751
2415 Ga0495618_0020274
2416 Ga0495620_0049417
2417 Ga0495628_0019406
2418 Ga0495628_0020389
2419 Ga0495628_0022251
2420 Ga0495628_0146998
2421 Ga0495630_0008582
2422 Ga0495631_0019145
2423 Ga0495642_0056699
2424 Ga0495652_0002427
2425 Ga0495652_0005186
2426 Ga0495652_0020974
2427 Ga0495652_0066937
2428 Ga0495665_0000802
2429 Ga0495665_0001233
2430 Ga0495640_0003534
2431 Ga0495640_0009403
2432 Ga0495640_0027787
2433 Ga0495640_0065735
2434 Ga0495586_0014173
2435 Ga0495586_0099032
2436 Ga0495587_0001337
2437 Ga0495587_0024608
2438 Ga0495587_0030214
2439 Ga0495609_0071603
2440 Ga0495645_0008975
2441 Ga0495645_0034306
2442 Ga0495645_0050362
2443 Ga0495645_0112011
2444 Ga0495622_0004915
2445 Ga0495622_0019370
2446 Ga0495622_0032366
2447 Ga0495667_0002234
2448 Ga0495667_0060233
2449 Ga0495634_0002191
2450 Ga0495634_0002979
2451 Ga0495634_0015120
2452 Ga0495625_0048927
2453 Ga0495625_0086437
2454 Ga0495635_0000527
2455 Ga0495635_0001696
2456 Ga0495635_0002022
2457 Ga0495635_0031514
2458 Ga0495635_0088227
2459 Ga0495635_0138618
2460 Ga0495659_0044852
2461 Ga0495588_0055784
2462 Ga0495657_0001550
2463 Ga0495657_0007232
2464 Ga0495657_0053087
2465 Ga0495599_0002310
2466 Ga0495599_0013701
2467 Ga0495599_0097191
2468 Ga0495599_0133702
2469 Ga0495623_0003518
2470 Ga0495646_0017484
2471 Ga0495646_0022612
2472 Ga0495646_0044539
2473 Ga0495646_0057438
2474 Ga0495646_0067909
2475 Ga0495646_0101890
2476 Ga0495647_0001835
2477 Ga0495647_0002668
2478 Ga0495647_0004959
2479 Ga0495658_0004889
2480 Ga0495658_0027133
2481 Ga0495658_0109867
2482 Ga0495613_0002281
2483 Ga0495613_0003015
2484 Ga0495613_0016014
2485 Ga0495624_0005449
2486 Ga0495624_0006912
2487 Ga0495624_0030168
2488 Ga0495624_0055194
2489 Ga0495670_0044264
2490 Ga0495589_0040148
2491 Ga0495600_0001526
2492 Ga0495600_0001732
2493 Ga0495600_0034421
2494 Ga0495600_0079095
2495 Ga0495581_0000530
2496 Ga0495581_0014680
2497 Ga0495604_0002815
2498 Ga0495604_0165071
2499 Ga0495674_0000138
2500 Ga0495674_0001486
2501 Ga0495674_0069326
2502 Ga0495674_0090443
2503 Ga0495674_0119459
2504 Ga0495674_0273753
2505 Ga0495672_0019216
2506 Ga0495672_0034108
2507 Ga0495672_0046474
2508 Ga0495676_0045353
2509 Ga0495676_0095528
2510 Ga0495680_0011728
2511 Ga0495680_0061251
2512 Ga0495680_0085190
2513 Ga0495680_0130739
2514 Ga0495683_0027742
2515 Ga0495687_014951
2516 Ga0495675_0012926
2517 Ga0495675_0017016
2518 Ga0495675_0087339
2519 Ga0495684_0001215
2520 Ga0495684_0019302
2521 Ga0495684_0027385
2522 Ga0495684_0032837
2523 Ga0495684_0114104
2524 Ga0495686_0193125
2525 Ga0495593_0000345
2526 Ga0495602_0012463
2527 Ga0495602_0053861
2528 Ga0495614_0023407
2529 Ga0495615_0013853
2530 Ga0495615_0022097
2531 Ga0496100_0007042
2532 Ga0496100_0054311
2533 Ga0496100_0061728
2534 Ga0496101_0001619
2535 Ga0496101_0004213
2536 Ga0496101_0068477
2537 Ga0496101_0138739
2538 Ga0496101_0221241
2539 Ga0496102_0006904
2540 Ga0496102_0023343
2541 Ga0496103_0003429
2542 Ga0496103_0062407
2543 Ga0496103_0072235
2544 Ga0496104_0006123
2545 Ga0496104_0009040
2546 Ga0496104_0067046
2547 Ga0496104_0068763
2548 Ga0496104_0149939
2549 Ga0496105_0004225
2550 Ga0496105_0035275
2551 Ga0496105_0036082
2552 Ga0496105_0039020
2553 Ga0496105_0046279
2554 Ga0496106_0000587
2555 Ga0496106_0004983
2556 Ga0496106_0012623
2557 Ga0496106_0018998
2558 Ga0496106_0059119
2559 Ga0496106_0113223
2560 Ga0496107_0002981
2561 Ga0496107_0008057
2562 Ga0496107_0037062
2563 Ga0496108_0000517
2564 Ga0496108_0005354
2565 Ga0496108_0008243
2566 Ga0496108_0014716
2567 Ga0496108_0021192
2568 Ga0496108_0024182
2569 Ga0496108_0056517
2570 Ga0496109_0001287
2571 Ga0496109_0001899
2572 Ga0496109_0003767
2573 Ga0496109_0015266
2574 Ga0496109_0022363
2575 Ga0496109_0033944
2576 Ga0496109_0042157
2577 Ga0496109_0049200
2578 Ga0496109_0080204
2579 Ga0496109_0134155
2580 Ga0496109_0168887
2581 Ga0496109_0275439
2582 Ga0496109_0318284
2583 Ga0496110_0001638
2584 Ga0496110_0018515
2585 Ga0496110_0035267
2586 Ga0496110_0051151
2587 Ga0496110_0114130
2588 Ga0496110_0139915
2589 Ga0496110_0165008
2590 Ga0496110_0257807
2591 Ga0496110_0398155
2592 Ga0496111_0001713
2593 Ga0496111_0003286
2594 Ga0496111_0105893
2595 Ga0496111_0108437
2596 Ga0496111_0123339
2597 Ga0496112_0000004
2598 Ga0496112_0004435
2599 Ga0496112_0017567
2600 Ga0496112_0022393
2601 Ga0496112_0033460
2602 Ga0496112_0034589
2603 Ga0496112_0037988
2604 Ga0496112_0048275
2605 Ga0496112_0058807
2606 Ga0496112_0060042
2607 Ga0496112_0176529
2608 Ga0496113_0002800
2609 Ga0496113_0006800
2610 Ga0496113_0014818
2611 Ga0496113_0033117
2612 Ga0496113_0060308
2613 Ga0496114_0008606
2614 Ga0496114_0011846
2615 Ga0496114_0039109
2616 Ga0496114_0083373
2617 Ga0496114_0378579
2618 Ga0496115_0002504
2619 Ga0496115_0006400
2620 Ga0496115_0021895
2621 Ga0496115_0053770
2622 Ga0496115_0061200
2623 Ga0496115_0271458
2624 Ga0496116_0028721
2625 Ga0496117_0071071
2626 Ga0496118_0039892
2627 Ga0496119_0016774
2628 Ga0496119_0048622
2629 Ga0496120_0041707
2630 Ga0496120_0065797
2631 Ga0496121_0000458
2632 Ga0496121_0001749
2633 Ga0496121_0002564
2634 Ga0496121_0004375
2635 Ga0496121_0009926
2636 Ga0496121_0017689
2637 Ga0496121_0044385
2638 Ga0496121_0070359
2639 Ga0496121_0074115
2640 Ga0496121_0132223
2641 Ga0496121_0197402
2642 Ga0496122_0017860
2643 Ga0496122_0058303
2644 Ga0496123_0088166
2645 Ga0496124_0010603
2646 Ga0496125_0000951
2647 Ga0496125_0001462
2648 Ga0496125_0002254
2649 Ga0496125_0095051
2650 Ga0496126_0018663
2651 Ga0496126_0025235
2652 Ga0496126_0040762
2653 Ga0496126_0046444
2654 Ga0496126_0098652
2655 Ga0496126_0100548
2656 Ga0496126_0120639
2657 Ga0496126_0171016
2658 Ga0501031_0004867
2659 Ga0501031_0029474
2660 Ga0501031_0036678
2661 Ga0501031_0055369
2662 Ga0501032_0001822
2663 Ga0501032_0006705
2664 Ga0501032_0061313
2665 Ga0501032_0071711
2666 Ga0501033_0000827
2667 Ga0501033_0001583
2668 Ga0501033_0014098
2669 Ga0501033_0016530
2670 Ga0501033_0137995
2671 Ga0501034_0000032
2672 Ga0501034_0002449
2673 Ga0501034_0063969
2674 Ga0501034_0077338
2675 Ga0501034_0125024
2676 Ga0501034_0126594
2677 Ga0501034_0161501
2678 Ga0501034_0348099
2679 Ga0501036_0000149
2680 Ga0501036_0000674
2681 Ga0501036_0004945
2682 Ga0501036_0037467
2683 Ga0501036_0051485
2684 Ga0501036_0063926
2685 Ga0501036_0164909
2686 Ga0501037_0000153
2687 Ga0501037_0000888
2688 Ga0501037_0007710
2689 Ga0501037_0017413
2690 Ga0501037_0023391
2691 Ga0501037_0025967
2692 Ga0501037_0051032
2693 Ga0501037_0116080
2694 Ga0501038_0000138
2695 Ga0501038_0001121
2696 Ga0501038_0009574
2697 Ga0501038_0032799
2698 Ga0501038_0044769
2699 Ga0501038_0086561
2700 Ga0501038_0125019
2701 Ga0501039_0000842
2702 Ga0501039_0003466
2703 Ga0501039_0151491
2704 Ga0501039_0158354
2705 Ga0501042_0001932
2706 Ga0501042_0075397
2707 Ga0501043_0006630
2708 Ga0501043_0008464
2709 Ga0501043_0018007
2710 Ga0501043_0019806
2711 Ga0501043_0045301
2712 Ga0501043_0094042
2713 Ga0501043_0098002
2714 Ga0501043_0158632
2715 Ga0501046_0021327
2716 Ga0501046_0029266
2717 Ga0501046_0062318
2718 Ga0501046_0079255
2719 Ga0501046_0177177
2720 Ga0501047_0000010
2721 Ga0501047_0001785
2722 Ga0501047_0004062
2723 Ga0501047_0012519
2724 Ga0501047_0048611
2725 Ga0501047_0119186
2726 Ga0501047_0127100
2727 Ga0501047_0141576
2728 Ga0501047_0201508
2729 Ga0501047_0250797
2730 Ga0501048_0000396
2731 Ga0501048_0000653
2732 Ga0501067_0019432
2733 Ga0501067_0037938
2734 Ga0501067_0085856
2735 Ga0501068_0004084
2736 Ga0501068_0020465
2737 Ga0501068_0024884
2738 Ga0501068_0031994
2739 Ga0501068_0052257
2740 Ga0501068_0083832
2741 Ga0501069_0005888
2742 Ga0501070_0002230
2743 Ga0501070_0029990
2744 Ga0501070_0031212
2745 Ga0501070_0038371
2746 Ga0501070_0041037
2747 Ga0501070_0060813
2748 Ga0501070_0086286
2749 Ga0501071_0026342
2750 Ga0501072_0001051
2751 Ga0501072_0002565
2752 Ga0501072_0066504
2753 Ga0501072_0149988
2754 Ga0501073_0000221
2755 Ga0501073_0030234
2756 Ga0501073_0035819
2757 Ga0501073_0050655
2758 Ga0501073_0050877
2759 Ga0501073_0060342
2760 Ga0501073_0082683
2761 Ga0501073_0173309
2762 Ga0501074_0015795
2763 Ga0501074_0018904
2764 Ga0501074_0054256
2765 Ga0501076_0126782
2766 Ga0501077_0046592
2767 Ga0501079_0050115
2768 Ga0501080_0003063
2769 Ga0501080_0011359
2770 Ga0501080_0026159
2771 Ga0501080_0067483
2772 Ga0501080_0071767
2773 Ga0501080_0092246
2774 Ga0501080_0452977
2775 Ga0501083_0001423
2776 Ga0501083_0008402
2777 Ga0501083_0025847
2778 Ga0501083_0035733
2779 Ga0501083_0089514
2780 Ga0501035_0001426
2781 Ga0501035_0004322
2782 Ga0501035_0007645
2783 Ga0501035_0012953
2784 Ga0501035_0045651
2785 Ga0501035_0059092
2786 Ga0501035_0065875
2787 Ga0501035_0145794
2788 Ga0501035_0163108
2789 Ga0501035_0208445
2790 Ga0501044_0000369
2791 Ga0501044_0013258
2792 Ga0501044_0013456
2793 Ga0501044_0018430
2794 Ga0501044_0075210
2795 Ga0501044_0136215
2796 Ga0501045_0064688
2797 Ga0501045_0081311
2798 Ga0501045_0092737
2799 nmdc:mga03n38_6896_c1
2800 nmdc:mga00v17_9599_c1
2801 nmdc:mga0yw44_1008_c1
2802 nmdc:mga0yw44_27628_c1
2803 nmdc:mga0yw44_4407_c1
2804 nmdc:mga0yw44_7568_c1
2805 nmdc:mga0k408_41747_c1
2806 nmdc:mga0k408_71478_c1
2807 nmdc:mga06z11_23196_c1
2808 nmdc:mga06z11_5654_c1
2809 nmdc:mga04h51_53107_c1
2810 nmdc:mga07m45_1367_c1
2811 nmdc:mga08y16_172_c1
2812 nmdc:mga08y16_55900_c1
2813 nmdc:mga0n895_24014_c1
2814 nmdc:mga0rr50_180782_c1
2815 nmdc:mga08x19_4_c2
2816 nmdc:mga08x19_89926_c1
2817 nmdc:mga0sz30_8294_c1
2818 Ga0495601_0002574
2819 Ga0495601_0015114
2820 Ga0495601_0036761
2821 Ga0495601_0047852
2822 Ga0495601_0054332
2823 Ga0495612_0004857
2824 Ga0495612_0085424
2825 Ga0500610_0142077
2826 Ga0500635_0027246
2827 Ga0495655_0001288
2828 Ga0495595_0025302
2829 Ga0495595_0100767
2830 Ga0495619_0000609
2831 Ga0495619_0000757
2832 Ga0495619_0000799
2833 Ga0495619_0001114
2834 Ga0495619_0026157
2835 Ga0495619_0048425
2836 Ga0500643_000032
2837 Ga0500644_0000786
2838 Ga0500647_0023164
2839 Ga0500583_0048761
2840 Ga0500651_0027621
2841 Ga0500566_0000006
2842 Ga0500566_0002123
2843 Ga0500566_0011398
2844 Ga0500566_0017517
2845 Ga0500640_003111
2846 Ga0500641_0011598
2847 Ga0500650_0000167
2848 Ga0500555_002027
2849 Ga0500556_0000030
2850 Ga0500557_000004
2851 Ga0500572_000870
2852 Ga0500572_001481
2853 Ga0500595_000002
2854 Ga0500595_000306
2855 Ga0500595_001964
2856 Ga0500595_002618
2857 Ga0500595_006167
2858 Ga0500595_007411
2859 Ga0500595_009208
2860 Ga0500595_030128
2861 Ga0500595_033571
2862 Ga0500595_038239
2863 Ga0500608_010820
2864 Ga0500608_066101
2865 Ga0500614_000745
2866 Ga0500642_0000080
2867 Ga0500642_0000302
2868 Ga0500652_000003
2869 Ga0500652_001787
2870 Ga0500652_007383
2871 Ga0500655_011446
2872 Ga0500559_0000714
2873 Ga0500559_0002857
2874 Ga0500559_0004788
2875 Ga0500568_0000001
2876 Ga0500568_0000978
2877 Ga0500568_0012491
2878 Ga0500577_0000263
2879 Ga0500586_001063
2880 Ga0500590_082201
2881 Ga0500603_000163
2882 Ga0500603_000339
2883 Ga0500616_0000002
2884 Ga0500616_0000252
2885 Ga0500616_0000696
2886 Ga0500616_0004537
2887 Ga0500616_0012792
2888 Ga0500616_0016773
2889 Ga0500622_0003870
2890 Ga0500630_000788
2891 Ga0500633_0016195
2892 Ga0500638_084353
2893 Ga0500639_000765
2894 Ga0500636_0000066
2895 Ga0500636_0013143
2896 Ga0500636_0015097
2897 Ga0500636_0036362
2898 Ga0500637_0003078
2899 Ga0500637_0009851
2900 Ga0500637_0074348
2901 Ga0500625_043521
2902 Ga0500645_000385
2903 Ga0500596_004638
2904 Ga0500596_005269
2905 Ga0500596_005521
2906 Ga0500599_001124
2907 Ga0501084_0011449
2908 Ga0501084_0170783
2909 Ga0501084_0250095
2910 Ga0501082_0000183
2911 Ga0501082_0016777
2912 Ga0501082_0094903
2913 2507508360
2914 2508542435
2915 2508691802
2916 2509150486
2917 2511399885
2918 2513625090
2919 2513645612
2920 2513657925
2921 2513674458
2922 2513692809
2923 2513706618
2924 2513722595
2925 2513855623
2926 2513872985
2927 2513894740
2928 2513919982
2929 2514013752
2930 2515627138
2931 2517102835
2932 2517892163
2933 2524437565
2934 2524465733
2935 2524534263
2936 2528853872
2937 2603859667
2938 2617347156
2939 2617375537
2940 2644288843
2941 2671120582
2942 2723844833
2943 2728753143
2944 2745079652
2945 2793065480
2946 2793068759
2947 2793082294
2948 2805915115
2949 2818238658
2950 2824604110
2951 2824610379
2952 2824617953
2953 2824626621
2954 2824638638
2955 2824646106
2956 2824668631
2957 2824672497
2958 2824685881
2959 2824688947
2960 2824716292
2961 2824746576
2962 2824759517
2963 2824771732
2964 2824775416
2965 2838123513
2966 2841947711
2967 2841949615
2968 2841964204
2969 2841971878
2970 2841974779
2971 2841983663
2972 2842040027
2973 2842047028
2974 2844319277
2975 2847936438
2976 2847946787
2977 2849079100
2978 2857516649
2979 2857528935
2980 2874598273
2981 2874605455
2982 2874619525
2983 2874627580
2984 2874632087
2985 2874652671
2986 2876764755
2987 2876778249
2988 2876814391
2989 2876825882
2990 2879082043
2991 2879090220
2992 2879104898
2993 2879115768
2994 2879135190
2995 2879145451
2996 2881368621
2997 2881673292
2998 2885373551
2999 2885382740
3000 2888384294
3001 2888393592
3002 2888424754
3003 2889039539
3004 2893070393
3005 2903731117
3006 2903754908
3007 2903771783
3008 2904673100
3009 2904694762
3010 2904702306
3011 2904714905
3012 2906607374
3013 2906617290
3014 2906631141
3015 2906643315
3016 2906645151
3017 2906662555
3018 2908742441
3019 2908760084
3020 2908780398
3021 2919076335
3022 2922365585
3023 2922374651
3024 2922391203
3025 2922400578
3026 2922430534
3027 2929621745
3028 2929629948
3029 2932788597
3030 2932798131
3031 2932807013
3032 2932817181
3033 2932825230
3034 2932830246
3035 2933583979
3036 2935609152
3037 2935622528
3038 2935631308
3039 2935642133
3040 2935651048
3041 2935659229
3042 2935672483
3043 2935676053
3044 2935686044
3045 2935697711
3046 2935705884
3047 2935714596
3048 2935725215
3049 2935732425
3050 2935741804
3051 2935752009
3052 2935765266
3053 2935771829
3054 2935778731
3055 2935788880
3056 2935795320
3057 2935802881
3058 2935813287
3059 2935822312
3060 2935830300
3061 2935838197
3062 2935847894
3063 2935860777
3064 2935872250
3065 2935878695
3066 2935886863
3067 2935908887
3068 2935919606
3069 2935926539
3070 2935934989
3071 2935943439
3072 2935951877
3073 2935960636
3074 2935968002
3075 2935978631
3076 2935987511
3077 2935994909
3078 2936003552
3079 2936013644
3080 2936022229
3081 2936030675
3082 2936042236
3083 2936048488
3084 2936058702
3085 2940557188
3086 2941510049
3087 2941518864
3088 2941525448
3089 2941533033
3090 2941539136
3091 3005480446
3092 3005484539
3093 3005510542
3094 3005587822
3095 3005599459
3096 3005715119
3097 3005722519
3098 8006931345
3099 8006940438
3100 8006967078
3101 8006980127
3102 8006988037
3103 8006995763
3104 8016522062
3105 8016529399
3106 8016534609
3107 8016547833
3108 8016554304
3109 8016562679
3110 8016572955
3111 8016600460
3112 8016610283
3113 8016614649
3114 8016626345
3115 8016640087
3116 8017063605
3117 8019534375
3118 8019545087
3119 8019553434
3120 8019556341
3121 8019568971
3122 8019582929
3123 8019590726
3124 8019600623
3125 8019617922
3126 8019628426
3127 8019645523
3128 8019658762
3129 8019662086
3130 8019671605
3131 8019690301
3132 8055746089
3133 8056673620
3134 8056687384
3135 8056691291
3136 8056968249

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

219

312

0.93

PF22458

RsmF-B_ferredox

Methyltr_RsmF/B-like, ferredoxin-like domain

126

197

0.93

PF01189

Methyltr_RsmB-F

16S rRNA methyltransferase RsmB/F

223

430

0.87

PF01728

FtsJ

FtsJ-like methyltransferase

213

373

0.84

PF13847

Methyltransf_31

Methyltransferase domain

228

403

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2frx-assembly2.cif.gz_B crystal structure of yebu, a m5c rna methyltransferase from e.coli 0.8806 126 433
7r6k-assembly1.cif.gz_q state e2 nucleolar 60s ribosomal intermediate - model for noc2/noc3 region 0.876 155 309
3a4t-assembly1.cif.gz_A crystal structure of atrm4 from m.jannaschii with sinefungin 0.8666 154 431
3a4t-assembly1.cif.gz_A crystal structure of atrm4 from m.jannaschii with sinefungin 0.8571 154 431
3m4x-assembly1.cif.gz_A structure of a ribosomal methyltransferase 0.8539 126 433
ID Description Score Start End Superfamily
af_B7ZXR6_266_358_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9516 215 285 3.40.50.150
af_Q8I5B4_187_375_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9213 219 431 3.40.50.150
1sqfA04 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9144 215 431 3.40.50.150
af_Q8I5B4_187_375_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9073 219 431 3.40.50.150
1sqfA04 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9056 215 431 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A537L2G6-F1-model_v4 RsmB/NOP family class I SAM-dependent RNA methyltransferase 0.9905 1 432 GO:0001510
GO:0003723
GO:0008173
AF-A0A537L2G6-F1-model_v4 RsmB/NOP family class I SAM-dependent RNA methyltransferase 0.9883 1 432 GO:0001510
GO:0003723
GO:0008173
AF-A0A527VW72-F1-model_v4 RsmB/NOP family class I SAM-dependent RNA methyltransferase 0.9705 135 364 GO:0001510
GO:0003723
GO:0008173
AF-A0A3S1VKP8-F1-model_v4 deleted 0.9644 1 228
AF-A0A356W3W8-F1-model_v4 MFS transporter 0.9643 1 303 GO:0001510
GO:0003723
GO:0008173

Map