F494802
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1568 | 720 | 3136 | 430 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_1260219|Ga0436365_1260219_567_1952 |
| Length | 461 |
| Sequence | MTPAARLSAAIEVIDTIEAQRSPAAQALKEWGTSHRFAGSGDRAAIAGLVWDVLRRRASSAWVMDDDAPRSRVLGMLKVERGLDAEAIAALCDGGRFAPGPLTEAEHGALATRSPADAPAPIAGDYPEWLDPYLAKVFGEDRAAEAAAMASRAPLDLRVNTLKAKREKVLASLKHLGAHETPWSPMGLRIELGADAKNPGVHAEEDFIKGLVEVQDEGSQLAALFSAAKPGEQVIDLCAGAGGKTLALAAMMQGKGRLIATDHDKRQLVPIHQRLSRAGVHNAEVRTPKGEAETLSDIKASADLVLIDAPCTGTGTWRRNPDAKWRMRPGALEIRVKDQIEVLDRAAAMVKPGGRIAYITCSVLPEENSEQVRAFVARHPAFAIASPGETVGVLWDKADAFAEAALRLPEGWLMTPRRTGTDGFFVAILRRTSRSAPQTTLIVSRGTSPSPARRRGQAGAN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 9 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 10 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 11 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 12 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 18 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 89 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 90 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 91 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 93 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 94 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 95 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 96 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 100 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 101 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 102 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 103 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 109 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 112 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 113 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 114 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 146 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 147 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 148 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 149 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 150 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 151 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 152 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 231 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 232 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 233 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 234 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 238 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 242 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 243 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 244 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 245 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 246 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 247 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 248 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 249 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 250 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 251 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 252 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 253 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 254 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 255 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 256 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 257 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 258 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 259 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 260 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 261 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 262 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 263 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 264 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 265 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 266 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 267 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 268 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 269 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 270 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 271 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 272 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 273 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 274 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 275 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 276 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 277 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 278 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 279 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 280 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 281 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 282 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 283 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 284 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 285 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 286 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 287 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 288 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 289 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 290 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 291 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 292 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 293 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 294 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 295 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 296 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 297 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 298 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 299 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 300 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 301 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 302 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 303 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 304 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 305 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 306 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 307 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 308 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 309 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 310 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 311 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 312 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 313 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 314 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 315 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 316 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 317 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 318 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 319 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 320 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 384 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 386 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 387 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 388 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 389 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 390 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 391 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 392 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 394 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 395 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 396 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 397 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 398 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 399 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 400 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 401 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 402 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 403 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 404 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 405 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 406 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 407 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 408 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 409 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 410 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 440 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 441 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 442 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 443 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 444 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 445 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 446 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 451 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 454 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 455 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 459 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 460 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 461 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 462 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 463 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 464 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 465 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 466 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 467 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 468 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 469 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 470 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 471 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 472 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 473 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 474 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 475 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 476 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 477 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 478 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 479 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 480 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 481 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 482 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 483 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 484 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 485 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 486 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 487 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 488 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 489 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 490 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 491 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 492 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 493 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 494 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 495 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 496 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 497 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 498 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 499 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 500 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 501 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 502 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 503 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 504 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 505 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 506 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 507 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 508 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 509 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 510 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 511 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 512 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 513 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 514 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 515 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 516 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 517 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 518 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 519 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 520 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 521 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 522 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 523 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 524 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 525 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 526 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 527 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 528 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 529 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 530 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 531 | 2791355199 | |||
| 532 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 533 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 534 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 535 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 536 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 537 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 538 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 539 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 540 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 541 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 542 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 543 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 544 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 545 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 546 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 547 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 548 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 549 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 550 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 551 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 552 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 553 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 554 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 555 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 556 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 557 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 558 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 559 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 560 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 561 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 562 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 563 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 564 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 565 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 566 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 567 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 568 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 569 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 570 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 571 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 572 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 573 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 574 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 575 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 576 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 577 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 578 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 579 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 580 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 581 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 582 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 583 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 584 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 585 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 586 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 587 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 588 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 589 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 590 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 591 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 592 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 593 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 594 | 2904699407 | |||
| 595 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 596 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 597 | 2906610324 | |||
| 598 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 599 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 600 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 601 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 602 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 603 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 604 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 605 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 606 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 607 | 2922368715 | |||
| 608 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 609 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 610 | 2922425934 | |||
| 611 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 612 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 613 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 614 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 615 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 616 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 617 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 618 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 619 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 620 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 621 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 622 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 623 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 624 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 625 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 626 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 627 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 628 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 629 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 630 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 631 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 632 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 633 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 634 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 635 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 636 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 637 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 638 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 639 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 640 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 641 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 642 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 643 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 644 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 645 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 646 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 647 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 648 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 649 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 650 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 651 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 652 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 653 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 654 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 655 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 656 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 657 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 658 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 659 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 660 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 661 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 662 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 663 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 664 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 665 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 666 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 667 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 668 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 669 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 670 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 671 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 672 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 673 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 674 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 675 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 676 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 677 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 678 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 679 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 680 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 681 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 682 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 683 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 684 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 685 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 686 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 687 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 688 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 689 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 690 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 691 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 692 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 693 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 694 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 695 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 696 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 697 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 698 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 699 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 700 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 701 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 702 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 703 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 704 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 705 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 706 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 707 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 708 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 709 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 710 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 711 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 712 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 713 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 714 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 715 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 716 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 717 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 718 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 719 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 720 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.92 |
| Metatranscriptomes | 0.06 |
| Isolates | 14.01 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.48 |
| Nodule | 11.42 |
| Rhizoplane | 6.06 |
| Rhizosphere | 66.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436365_1260219 | 3300039437 | Bacteria | 4209 |
| 2 | 2214745197 | 2209111006 | Bacteria | 17059 |
| 3 | ARcpr5oldR_c000160 | 3300000041 | Bacteria | 11755 |
| 4 | ARSoilYngRDRAFT_c00063 | 3300000042 | Bacteria | 17542 |
| 5 | ARcpr5yngRDRAFT_c000034 | 3300000043 | Bacteria | 21574 |
| 6 | ARSoilOldRDRAFT_c000147 | 3300000044 | Bacteria | 11995 |
| 7 | JGI24737J22298_10000521 | 3300001990 | Bacteria | 13498 |
| 8 | JGI24750J21931_1000637 | 3300002070 | Bacteria | 5248 |
| 9 | JGI24035J26624_1000503 | 3300002126 | Bacteria | 3639 |
| 10 | JGI24742J22300_10001833 | 3300002244 | Bacteria | 3386 |
| 11 | JGI24751J29686_10009828 | 3300002459 | Bacteria | 1971 |
| 12 | JGI25406J46586_10000047 | 3300003203 | Bacteria | 54770 |
| 13 | JGI25153J46596_10000740 | 3300003215 | Bacteria | 20002 |
| 14 | JGI25153J46596_10003653 | 3300003215 | Bacteria | 8519 |
| 15 | JGI25160J50197_1001080 | 3300003354 | Bacteria | 13978 |
| 16 | Ga0055531_10003612 | 3300003794 | Bacteria | 9778 |
| 17 | Ga0065165_1025653 | 3300005262 | Bacteria | 1955 |
| 18 | Ga0065712_10001661 | 3300005290 | Bacteria | 8971 |
| 19 | Ga0065715_10004531 | 3300005293 | Bacteria | 5629 |
| 20 | Ga0065715_10090446 | 3300005293 | Bacteria | 6991 |
| 21 | Ga0070658_10059686 | 3300005327 | Bacteria | 3106 |
| 22 | Ga0070658_10098944 | 3300005327 | Bacteria | 2410 |
| 23 | Ga0070676_10000905 | 3300005328 | Bacteria | 14682 |
| 24 | Ga0070683_100022201 | 3300005329 | Bacteria | 5669 |
| 25 | Ga0070683_100089578 | 3300005329 | Bacteria | 2887 |
| 26 | Ga0070690_100002135 | 3300005330 | Bacteria | 10564 |
| 27 | Ga0070690_100004750 | 3300005330 | Bacteria | 7581 |
| 28 | Ga0070670_100077822 | 3300005331 | Bacteria | 2849 |
| 29 | Ga0070670_100096468 | 3300005331 | Bacteria | 2544 |
| 30 | Ga0070677_10006219 | 3300005333 | Bacteria | 3964 |
| 31 | Ga0068869_100008696 | 3300005334 | Bacteria | 6558 |
| 32 | Ga0068869_100028213 | 3300005334 | Bacteria | 3921 |
| 33 | Ga0070666_10005333 | 3300005335 | Bacteria | 7881 |
| 34 | Ga0070666_10007448 | 3300005335 | Bacteria | 6748 |
| 35 | Ga0070680_100011041 | 3300005336 | Bacteria | 6980 |
| 36 | Ga0070680_100018350 | 3300005336 | Bacteria | 5526 |
| 37 | Ga0070680_100162923 | 3300005336 | Bacteria | 1874 |
| 38 | Ga0070682_100002763 | 3300005337 | Bacteria | 9720 |
| 39 | Ga0070682_100028035 | 3300005337 | Bacteria | 3385 |
| 40 | Ga0070682_100032890 | 3300005337 | Bacteria | 3147 |
| 41 | Ga0068868_100009579 | 3300005338 | Bacteria | 6982 |
| 42 | Ga0068868_100018639 | 3300005338 | Bacteria | 5193 |
| 43 | Ga0068868_100031028 | 3300005338 | Bacteria | 4102 |
| 44 | Ga0068868_100276285 | 3300005338 | Bacteria | 1420 |
| 45 | Ga0070660_100000985 | 3300005339 | Bacteria | 19067 |
| 46 | Ga0070660_100026110 | 3300005339 | Bacteria | 4347 |
| 47 | Ga0070660_100035104 | 3300005339 | Bacteria | 3794 |
| 48 | Ga0070660_100049723 | 3300005339 | Bacteria | 3224 |
| 49 | Ga0070689_100010818 | 3300005340 | Bacteria | 6520 |
| 50 | Ga0070689_100049462 | 3300005340 | Bacteria | 3246 |
| 51 | Ga0070689_100067341 | 3300005340 | Bacteria | 2791 |
| 52 | Ga0070689_100092019 | 3300005340 | Bacteria | 2392 |
| 53 | Ga0070689_100109297 | 3300005340 | Bacteria | 2198 |
| 54 | Ga0070691_10000060 | 3300005341 | Bacteria | 30257 |
| 55 | Ga0070687_100001608 | 3300005343 | Bacteria | 8043 |
| 56 | Ga0070687_100087956 | 3300005343 | Bacteria | 1712 |
| 57 | Ga0070661_100024705 | 3300005344 | Bacteria | 4311 |
| 58 | Ga0070661_100141724 | 3300005344 | Bacteria | 1812 |
| 59 | Ga0070692_10002122 | 3300005345 | Bacteria | 7584 |
| 60 | Ga0070692_10019414 | 3300005345 | Bacteria | 3280 |
| 61 | Ga0070668_100004462 | 3300005347 | Bacteria | 10383 |
| 62 | Ga0070668_100020450 | 3300005347 | Bacteria | 4995 |
| 63 | Ga0070669_100001173 | 3300005353 | Bacteria | 19124 |
| 64 | Ga0070675_100008084 | 3300005354 | Bacteria | 8154 |
| 65 | Ga0070675_100025493 | 3300005354 | Bacteria | 4739 |
| 66 | Ga0070675_100073782 | 3300005354 | Bacteria | 2833 |
| 67 | Ga0070671_100000349 | 3300005355 | Bacteria | 31741 |
| 68 | Ga0070671_100098641 | 3300005355 | Bacteria | 2451 |
| 69 | Ga0070671_100201469 | 3300005355 | Bacteria | 1688 |
| 70 | Ga0070674_100013947 | 3300005356 | Bacteria | 4983 |
| 71 | Ga0070674_100032577 | 3300005356 | Bacteria | 3462 |
| 72 | Ga0070674_100047762 | 3300005356 | Bacteria | 2935 |
| 73 | Ga0070674_100064813 | 3300005356 | Bacteria | 2562 |
| 74 | Ga0070673_100007101 | 3300005364 | Bacteria | 7355 |
| 75 | Ga0070673_100055829 | 3300005364 | Bacteria | 3113 |
| 76 | Ga0070673_100153399 | 3300005364 | Bacteria | 1953 |
| 77 | Ga0070688_100000475 | 3300005365 | Bacteria | 20349 |
| 78 | Ga0070688_100005391 | 3300005365 | Bacteria | 6731 |
| 79 | Ga0070688_100013195 | 3300005365 | Bacteria | 4653 |
| 80 | Ga0070659_100006503 | 3300005366 | Bacteria | 8436 |
| 81 | Ga0070667_100000810 | 3300005367 | Bacteria | 29225 |
| 82 | Ga0070667_100009653 | 3300005367 | Bacteria | 8006 |
| 83 | Ga0070667_100015010 | 3300005367 | Bacteria | 6400 |
| 84 | Ga0070667_100148326 | 3300005367 | Bacteria | 2058 |
| 85 | Ga0070703_10007949 | 3300005406 | Bacteria | 2983 |
| 86 | Ga0070709_10011165 | 3300005434 | Bacteria | 4996 |
| 87 | Ga0070709_10021489 | 3300005434 | Bacteria | 3759 |
| 88 | Ga0070709_10029765 | 3300005434 | Bacteria | 3270 |
| 89 | Ga0070709_10068774 | 3300005434 | Bacteria | 2279 |
| 90 | Ga0070714_100048569 | 3300005435 | Bacteria | 3610 |
| 91 | Ga0070714_100051098 | 3300005435 | Bacteria | 3524 |
| 92 | Ga0070714_100102147 | 3300005435 | Bacteria | 2527 |
| 93 | Ga0070714_100111893 | 3300005435 | Bacteria | 2419 |
| 94 | Ga0070714_100257729 | 3300005435 | Bacteria | 1614 |
| 95 | Ga0070713_100012585 | 3300005436 | Bacteria | 6213 |
| 96 | Ga0070713_100028354 | 3300005436 | Bacteria | 4421 |
| 97 | Ga0070713_100029886 | 3300005436 | Bacteria | 4321 |
| 98 | Ga0070713_100046807 | 3300005436 | Bacteria | 3551 |
| 99 | Ga0070710_10001849 | 3300005437 | Bacteria | 9973 |
| 100 | Ga0070710_10127488 | 3300005437 | Bacteria | 1548 |
| 101 | Ga0070701_10005299 | 3300005438 | Bacteria | 5311 |
| 102 | Ga0070701_10009325 | 3300005438 | Bacteria | 4295 |
| 103 | Ga0070711_100020708 | 3300005439 | Bacteria | 4242 |
| 104 | Ga0070711_100063443 | 3300005439 | Bacteria | 2579 |
| 105 | Ga0070705_100015365 | 3300005440 | Bacteria | 3957 |
| 106 | Ga0070700_100000664 | 3300005441 | Bacteria | 17024 |
| 107 | Ga0070700_100032022 | 3300005441 | Bacteria | 3157 |
| 108 | Ga0070700_100070960 | 3300005441 | Bacteria | 2222 |
| 109 | Ga0070700_100116164 | 3300005441 | Bacteria | 1786 |
| 110 | Ga0070694_100005788 | 3300005444 | Bacteria | 7498 |
| 111 | Ga0070663_100003715 | 3300005455 | Bacteria | 8849 |
| 112 | Ga0070663_100025035 | 3300005455 | Bacteria | 4025 |
| 113 | Ga0070663_100034160 | 3300005455 | Bacteria | 3520 |
| 114 | Ga0070663_100105892 | 3300005455 | Bacteria | 2106 |
| 115 | Ga0070678_100003479 | 3300005456 | Bacteria | 8774 |
| 116 | Ga0070678_100033155 | 3300005456 | Bacteria | 3582 |
| 117 | Ga0070678_100038499 | 3300005456 | Bacteria | 3367 |
| 118 | Ga0070678_100046523 | 3300005456 | Bacteria | 3111 |
| 119 | Ga0070662_100005798 | 3300005457 | Bacteria | 7916 |
| 120 | Ga0070662_100007680 | 3300005457 | Bacteria | 6996 |
| 121 | Ga0070662_100086845 | 3300005457 | Bacteria | 2340 |
| 122 | Ga0070681_10015477 | 3300005458 | Bacteria | 7595 |
| 123 | Ga0070681_10021129 | 3300005458 | Bacteria | 6522 |
| 124 | Ga0070681_10040444 | 3300005458 | Bacteria | 4671 |
| 125 | Ga0070681_10115998 | 3300005458 | Bacteria | 2615 |
| 126 | Ga0070681_10258209 | 3300005458 | Bacteria | 1654 |
| 127 | Ga0068867_100002762 | 3300005459 | Bacteria | 12366 |
| 128 | Ga0068867_100110168 | 3300005459 | Bacteria | 2114 |
| 129 | Ga0068867_100118206 | 3300005459 | Bacteria | 2045 |
| 130 | Ga0070685_10004766 | 3300005466 | Bacteria | 6867 |
| 131 | Ga0070685_10009588 | 3300005466 | Bacteria | 5007 |
| 132 | Ga0070679_100015288 | 3300005530 | Bacteria | 7374 |
| 133 | Ga0070679_100029125 | 3300005530 | Bacteria | 5446 |
| 134 | Ga0070679_100050504 | 3300005530 | Bacteria | 4143 |
| 135 | Ga0070679_100062725 | 3300005530 | Bacteria | 3705 |
| 136 | Ga0070679_100141517 | 3300005530 | Bacteria | 2385 |
| 137 | Ga0070679_100148690 | 3300005530 | Bacteria | 2320 |
| 138 | Ga0070679_100161968 | 3300005530 | Bacteria | 2211 |
| 139 | Ga0070679_100188559 | 3300005530 | Bacteria | 2032 |
| 140 | Ga0070684_100000464 | 3300005535 | Bacteria | 27749 |
| 141 | Ga0070684_100010906 | 3300005535 | Bacteria | 7221 |
| 142 | Ga0070684_100012560 | 3300005535 | Bacteria | 6794 |
| 143 | Ga0070684_100026872 | 3300005535 | Bacteria | 4852 |
| 144 | Ga0070697_100086517 | 3300005536 | Bacteria | 2586 |
| 145 | Ga0068853_100003829 | 3300005539 | Bacteria | 11523 |
| 146 | Ga0068853_100025347 | 3300005539 | Bacteria | 4976 |
| 147 | Ga0068853_100073806 | 3300005539 | Bacteria | 2975 |
| 148 | Ga0068853_100095505 | 3300005539 | Bacteria | 2621 |
| 149 | Ga0070672_100145150 | 3300005543 | Bacteria | 1960 |
| 150 | Ga0070672_100148853 | 3300005543 | Bacteria | 1936 |
| 151 | Ga0070686_100001439 | 3300005544 | Bacteria | 13446 |
| 152 | Ga0070686_100016485 | 3300005544 | Bacteria | 4300 |
| 153 | Ga0070686_100044137 | 3300005544 | Bacteria | 2800 |
| 154 | Ga0070686_100048141 | 3300005544 | Bacteria | 2700 |
| 155 | Ga0070686_100063471 | 3300005544 | Bacteria | 2393 |
| 156 | Ga0070695_100001320 | 3300005545 | Bacteria | 13725 |
| 157 | Ga0070695_100001619 | 3300005545 | Bacteria | 12621 |
| 158 | Ga0070695_100008441 | 3300005545 | Bacteria | 6112 |
| 159 | Ga0070696_100011085 | 3300005546 | Bacteria | 6033 |
| 160 | Ga0070693_100000266 | 3300005547 | Bacteria | 24669 |
| 161 | Ga0070665_100083382 | 3300005548 | Bacteria | 3201 |
| 162 | Ga0070665_100104524 | 3300005548 | Bacteria | 2834 |
| 163 | Ga0070665_100147673 | 3300005548 | Bacteria | 2354 |
| 164 | Ga0070665_100221489 | 3300005548 | Bacteria | 1892 |
| 165 | Ga0070704_100001701 | 3300005549 | Bacteria | 11987 |
| 166 | Ga0070704_100002112 | 3300005549 | Bacteria | 11059 |
| 167 | Ga0068855_100034429 | 3300005563 | Bacteria | 6041 |
| 168 | Ga0068855_100034770 | 3300005563 | Bacteria | 6006 |
| 169 | Ga0068855_100059531 | 3300005563 | Bacteria | 4468 |
| 170 | Ga0068855_100160757 | 3300005563 | Bacteria | 2549 |
| 171 | Ga0068855_100208295 | 3300005563 | Bacteria | 2199 |
| 172 | Ga0068855_100209137 | 3300005563 | Bacteria | 2193 |
| 173 | Ga0068855_100277971 | 3300005563 | Bacteria | 1860 |
| 174 | Ga0070664_100012689 | 3300005564 | Bacteria | 6860 |
| 175 | Ga0070664_100155908 | 3300005564 | Bacteria | 2018 |
| 176 | Ga0068857_100006833 | 3300005577 | Bacteria | 9820 |
| 177 | Ga0068857_100049167 | 3300005577 | Bacteria | 3742 |
| 178 | Ga0068854_100005898 | 3300005578 | Bacteria | 7758 |
| 179 | Ga0068854_100024241 | 3300005578 | Bacteria | 4152 |
| 180 | Ga0068856_100000020 | 3300005614 | Bacteria | 146775 |
| 181 | Ga0068856_100149477 | 3300005614 | Bacteria | 2344 |
| 182 | Ga0070702_100004216 | 3300005615 | Bacteria | 6541 |
| 183 | Ga0068852_100005120 | 3300005616 | Bacteria | 9342 |
| 184 | Ga0068852_100007306 | 3300005616 | Bacteria | 8056 |
| 185 | Ga0068852_100015569 | 3300005616 | Bacteria | 5905 |
| 186 | Ga0068852_100015717 | 3300005616 | Bacteria | 5882 |
| 187 | Ga0068852_100042670 | 3300005616 | Bacteria | 3841 |
| 188 | Ga0068852_100081153 | 3300005616 | Bacteria | 2878 |
| 189 | Ga0068859_100013817 | 3300005617 | Bacteria | 8096 |
| 190 | Ga0068859_100037907 | 3300005617 | Bacteria | 4837 |
| 191 | Ga0068859_100046985 | 3300005617 | Bacteria | 4336 |
| 192 | Ga0068859_100077641 | 3300005617 | Bacteria | 3361 |
| 193 | Ga0068864_100019484 | 3300005618 | Bacteria | 5673 |
| 194 | Ga0068864_100046630 | 3300005618 | Bacteria | 3719 |
| 195 | Ga0068864_100129170 | 3300005618 | Bacteria | 2268 |
| 196 | Ga0068864_100262673 | 3300005618 | Bacteria | 1606 |
| 197 | Ga0068866_10000694 | 3300005718 | Bacteria | 15306 |
| 198 | Ga0068866_10029627 | 3300005718 | Bacteria | 2619 |
| 199 | Ga0068861_100013181 | 3300005719 | Bacteria | 5783 |
| 200 | Ga0068861_100023990 | 3300005719 | Bacteria | 4406 |
| 201 | Ga0068861_100110233 | 3300005719 | Bacteria | 2204 |
| 202 | Ga0068870_10009104 | 3300005840 | Bacteria | 4499 |
| 203 | Ga0068863_100001201 | 3300005841 | Bacteria | 25868 |
| 204 | Ga0068863_100007995 | 3300005841 | Bacteria | 10337 |
| 205 | Ga0068863_100076014 | 3300005841 | Bacteria | 3177 |
| 206 | Ga0068858_100016234 | 3300005842 | Bacteria | 6995 |
| 207 | Ga0068858_100023790 | 3300005842 | Bacteria | 5708 |
| 208 | Ga0068858_100051014 | 3300005842 | Bacteria | 3828 |
| 209 | Ga0068858_100067510 | 3300005842 | Bacteria | 3313 |
| 210 | Ga0068860_100001359 | 3300005843 | Bacteria | 26585 |
| 211 | Ga0068860_100001708 | 3300005843 | Bacteria | 23464 |
| 212 | Ga0068860_100024209 | 3300005843 | Bacteria | 5870 |
| 213 | Ga0068860_100081370 | 3300005843 | Bacteria | 3080 |
| 214 | Ga0068860_100132560 | 3300005843 | Bacteria | 2392 |
| 215 | Ga0068862_100005931 | 3300005844 | Bacteria | 10175 |
| 216 | Ga0068862_100042098 | 3300005844 | Bacteria | 3889 |
| 217 | Ga0068862_100058981 | 3300005844 | Bacteria | 3294 |
| 218 | Ga0081455_10000009 | 3300005937 | Bacteria | 249885 |
| 219 | Ga0081455_10006680 | 3300005937 | Bacteria | 12325 |
| 220 | Ga0081455_10030306 | 3300005937 | Bacteria | 4916 |
| 221 | Ga0081455_10096354 | 3300005937 | Bacteria | 2386 |
| 222 | Ga0081540_1000143 | 3300005983 | Bacteria | 74581 |
| 223 | Ga0081540_1002154 | 3300005983 | Bacteria | 16364 |
| 224 | Ga0081540_1002625 | 3300005983 | Bacteria | 14612 |
| 225 | Ga0081540_1003015 | 3300005983 | Bacteria | 13484 |
| 226 | Ga0081540_1005422 | 3300005983 | Bacteria | 9519 |
| 227 | Ga0081540_1006906 | 3300005983 | Bacteria | 8187 |
| 228 | Ga0081540_1011009 | 3300005983 | Bacteria | 6074 |
| 229 | Ga0081540_1016111 | 3300005983 | Bacteria | 4699 |
| 230 | Ga0081540_1023632 | 3300005983 | Bacteria | 3589 |
| 231 | Ga0081540_1028760 | 3300005983 | Bacteria | 3113 |
| 232 | Ga0081539_10000140 | 3300005985 | Bacteria | 166746 |
| 233 | Ga0081539_10002339 | 3300005985 | Bacteria | 27248 |
| 234 | Ga0081539_10018773 | 3300005985 | Bacteria | 4774 |
| 235 | Ga0070717_10001862 | 3300006028 | Bacteria | 14744 |
| 236 | Ga0070717_10045194 | 3300006028 | Bacteria | 3600 |
| 237 | Ga0075365_10041177 | 3300006038 | Bacteria | 3017 |
| 238 | Ga0075365_10127397 | 3300006038 | Bacteria | 1760 |
| 239 | Ga0075368_10014162 | 3300006042 | Bacteria | 2941 |
| 240 | Ga0075363_100004915 | 3300006048 | Bacteria | 5910 |
| 241 | Ga0075363_100046915 | 3300006048 | Bacteria | 2293 |
| 242 | Ga0075364_10024537 | 3300006051 | Bacteria | 3830 |
| 243 | Ga0070715_10003038 | 3300006163 | Bacteria | 5257 |
| 244 | Ga0070715_10012125 | 3300006163 | Bacteria | 3125 |
| 245 | Ga0070715_10065946 | 3300006163 | Bacteria | 1604 |
| 246 | Ga0070716_100003599 | 3300006173 | Bacteria | 7323 |
| 247 | Ga0070712_100004909 | 3300006175 | Bacteria | 8269 |
| 248 | Ga0070712_100027618 | 3300006175 | Bacteria | 3790 |
| 249 | Ga0070712_100029025 | 3300006175 | Bacteria | 3706 |
| 250 | Ga0070712_100048375 | 3300006175 | Bacteria | 2947 |
| 251 | Ga0070712_100061706 | 3300006175 | Bacteria | 2649 |
| 252 | Ga0070712_100220162 | 3300006175 | Bacteria | 1502 |
| 253 | Ga0075362_10003689 | 3300006177 | Bacteria | 5406 |
| 254 | Ga0075362_10025532 | 3300006177 | Bacteria | 2517 |
| 255 | Ga0075362_10036285 | 3300006177 | Bacteria | 2156 |
| 256 | Ga0075367_10005474 | 3300006178 | Bacteria | 6311 |
| 257 | Ga0075367_10018220 | 3300006178 | Bacteria | 3870 |
| 258 | Ga0075367_10026576 | 3300006178 | Bacteria | 3285 |
| 259 | Ga0075369_10045777 | 3300006186 | Bacteria | 1882 |
| 260 | Ga0075366_10059614 | 3300006195 | Bacteria | 2267 |
| 261 | Ga0097621_100001359 | 3300006237 | Bacteria | 16830 |
| 262 | Ga0097621_100085119 | 3300006237 | Bacteria | 2636 |
| 263 | Ga0075370_10047579 | 3300006353 | Bacteria | 2429 |
| 264 | Ga0075370_10075879 | 3300006353 | Bacteria | 1927 |
| 265 | Ga0075370_10103009 | 3300006353 | Bacteria | 1653 |
| 266 | Ga0068871_100003508 | 3300006358 | Bacteria | 10795 |
| 267 | Ga0068871_100081780 | 3300006358 | Bacteria | 2677 |
| 268 | Ga0075430_100000244 | 3300006846 | Bacteria | 37691 |
| 269 | Ga0075434_100026091 | 3300006871 | Bacteria | 5722 |
| 270 | Ga0075434_100097339 | 3300006871 | Bacteria | 2947 |
| 271 | Ga0068865_100001830 | 3300006881 | Bacteria | 12495 |
| 272 | Ga0068865_100025798 | 3300006881 | Bacteria | 3870 |
| 273 | Ga0068865_100079400 | 3300006881 | Bacteria | 2350 |
| 274 | Ga0075436_100004211 | 3300006914 | Bacteria | 9869 |
| 275 | Ga0075436_100031832 | 3300006914 | Bacteria | 3634 |
| 276 | Ga0097620_100013818 | 3300006931 | Bacteria | 8096 |
| 277 | Ga0097620_100037906 | 3300006931 | Bacteria | 4837 |
| 278 | Ga0097620_100046986 | 3300006931 | Bacteria | 4336 |
| 279 | Ga0097620_100077644 | 3300006931 | Bacteria | 3361 |
| 280 | Ga0099824_1007930 | 3300006942 | Bacteria | 13807 |
| 281 | Ga0099824_1015115 | 3300006942 | Bacteria | 7438 |
| 282 | Ga0075435_100013273 | 3300007076 | Bacteria | 6121 |
| 283 | Ga0075435_100191542 | 3300007076 | Bacteria | 1731 |
| 284 | Ga0099795_10025171 | 3300007788 | Bacteria | 1993 |
| 285 | Ga0105250_10045953 | 3300009092 | Bacteria | 1751 |
| 286 | Ga0105240_10017915 | 3300009093 | Bacteria | 9527 |
| 287 | Ga0105240_10038025 | 3300009093 | Bacteria | 6178 |
| 288 | Ga0105240_10045568 | 3300009093 | Bacteria | 5562 |
| 289 | Ga0105240_10047264 | 3300009093 | Bacteria | 5446 |
| 290 | Ga0105240_10073684 | 3300009093 | Bacteria | 4216 |
| 291 | Ga0105240_10173056 | 3300009093 | Bacteria | 2555 |
| 292 | Ga0105240_10275619 | 3300009093 | Bacteria | 1935 |
| 293 | Ga0111539_10000173 | 3300009094 | Bacteria | 74781 |
| 294 | Ga0111539_10018558 | 3300009094 | Bacteria | 8616 |
| 295 | Ga0111539_10078446 | 3300009094 | Bacteria | 3885 |
| 296 | Ga0111539_10084268 | 3300009094 | Bacteria | 3738 |
| 297 | Ga0111539_10087823 | 3300009094 | Bacteria | 3653 |
| 298 | Ga0111539_10186184 | 3300009094 | Bacteria | 2424 |
| 299 | Ga0105245_10003312 | 3300009098 | Bacteria | 14462 |
| 300 | Ga0105245_10021446 | 3300009098 | Bacteria | 5668 |
| 301 | Ga0105245_10106651 | 3300009098 | Bacteria | 2600 |
| 302 | Ga0105247_10024725 | 3300009101 | Bacteria | 3621 |
| 303 | Ga0105247_10026306 | 3300009101 | Bacteria | 3512 |
| 304 | Ga0114129_10187696 | 3300009147 | Bacteria | 2809 |
| 305 | Ga0114129_10354797 | 3300009147 | Bacteria | 1942 |
| 306 | Ga0105243_10011575 | 3300009148 | Bacteria | 6675 |
| 307 | Ga0105243_10130437 | 3300009148 | Bacteria | 2132 |
| 308 | Ga0105241_10009656 | 3300009174 | Bacteria | 7091 |
| 309 | Ga0105241_10126238 | 3300009174 | Bacteria | 2066 |
| 310 | Ga0105242_10000399 | 3300009176 | Bacteria | 34466 |
| 311 | Ga0105242_10033580 | 3300009176 | Bacteria | 4109 |
| 312 | Ga0105242_10163493 | 3300009176 | Unclassified | 1950 |
| 313 | Ga0105248_10013945 | 3300009177 | Bacteria | 8843 |
| 314 | Ga0105248_10032551 | 3300009177 | Bacteria | 5827 |
| 315 | Ga0105248_10235723 | 3300009177 | Bacteria | 2060 |
| 316 | Ga0105248_10241572 | 3300009177 | Bacteria | 2033 |
| 317 | Ga0105248_10283693 | 3300009177 | Bacteria | 1864 |
| 318 | Ga0105237_10034867 | 3300009545 | Bacteria | 5092 |
| 319 | Ga0105237_10062673 | 3300009545 | Bacteria | 3718 |
| 320 | Ga0105237_10184625 | 3300009545 | Bacteria | 2086 |
| 321 | Ga0105237_10386896 | 3300009545 | Bacteria | 1404 |
| 322 | Ga0105238_10008599 | 3300009551 | Bacteria | 10215 |
| 323 | Ga0105238_10018493 | 3300009551 | Bacteria | 7090 |
| 324 | Ga0105238_10072194 | 3300009551 | Bacteria | 3448 |
| 325 | Ga0105238_10082718 | 3300009551 | Bacteria | 3200 |
| 326 | Ga0105238_10145210 | 3300009551 | Bacteria | 2349 |
| 327 | Ga0105249_10029823 | 3300009553 | Bacteria | 4928 |
| 328 | Ga0105239_10067902 | 3300010375 | Bacteria | 3917 |
| 329 | Ga0105239_10080663 | 3300010375 | Bacteria | 3580 |
| 330 | Ga0105239_10082676 | 3300010375 | Bacteria | 3537 |
| 331 | Ga0105239_10108616 | 3300010375 | Bacteria | 3074 |
| 332 | Ga0105239_10201369 | 3300010375 | Bacteria | 2230 |
| 333 | Ga0105239_10279979 | 3300010375 | Bacteria | 1877 |
| 334 | Ga0105246_10000033 | 3300011119 | Bacteria | 50575 |
| 335 | Ga0105246_10023862 | 3300011119 | Bacteria | 3964 |
| 336 | Ga0157373_10005894 | 3300013100 | Bacteria | 9167 |
| 337 | Ga0157371_10031668 | 3300013102 | Bacteria | 3811 |
| 338 | Ga0157370_10128904 | 3300013104 | Bacteria | 2360 |
| 339 | Ga0157370_10186971 | 3300013104 | Bacteria | 1923 |
| 340 | Ga0157369_10010862 | 3300013105 | Bacteria | 10373 |
| 341 | Ga0157369_10088464 | 3300013105 | Bacteria | 3306 |
| 342 | Ga0157369_10097519 | 3300013105 | Bacteria | 3136 |
| 343 | Ga0157374_10018913 | 3300013296 | Bacteria | 6090 |
| 344 | Ga0157374_10087148 | 3300013296 | Bacteria | 2971 |
| 345 | Ga0157378_10009284 | 3300013297 | Bacteria | 8568 |
| 346 | Ga0157378_10057957 | 3300013297 | Bacteria | 3454 |
| 347 | Ga0157378_10073594 | 3300013297 | Bacteria | 3072 |
| 348 | Ga0163162_10007926 | 3300013306 | Bacteria | 10355 |
| 349 | Ga0163162_10049822 | 3300013306 | Bacteria | 4199 |
| 350 | Ga0163162_10126869 | 3300013306 | Bacteria | 2658 |
| 351 | Ga0163162_10312021 | 3300013306 | Bacteria | 1705 |
| 352 | Ga0157372_10001162 | 3300013307 | Bacteria | 28497 |
| 353 | Ga0157372_10067851 | 3300013307 | Bacteria | 4009 |
| 354 | Ga0157372_10154780 | 3300013307 | Bacteria | 2647 |
| 355 | Ga0157375_10018904 | 3300013308 | Bacteria | 6255 |
| 356 | Ga0157375_10021748 | 3300013308 | Bacteria | 5889 |
| 357 | Ga0157375_10033246 | 3300013308 | Bacteria | 4898 |
| 358 | Ga0157375_10141304 | 3300013308 | Bacteria | 2535 |
| 359 | Ga0157375_10321881 | 3300013308 | Bacteria | 1711 |
| 360 | Ga0163163_10001787 | 3300014325 | Bacteria | 18120 |
| 361 | Ga0163163_10060072 | 3300014325 | Bacteria | 3763 |
| 362 | Ga0163163_10098726 | 3300014325 | Bacteria | 2941 |
| 363 | Ga0163163_10152441 | 3300014325 | Bacteria | 2355 |
| 364 | Ga0157380_10064729 | 3300014326 | Bacteria | 2936 |
| 365 | Ga0157377_10000740 | 3300014745 | Bacteria | 13498 |
| 366 | Ga0157377_10024449 | 3300014745 | Bacteria | 3211 |
| 367 | Ga0157379_10003378 | 3300014968 | Bacteria | 13509 |
| 368 | Ga0157379_10097715 | 3300014968 | Bacteria | 2636 |
| 369 | Ga0157376_10005599 | 3300014969 | Bacteria | 8786 |
| 370 | Ga0157376_10229775 | 3300014969 | Bacteria | 1723 |
| 371 | Ga0163161_10008117 | 3300017792 | Bacteria | 7261 |
| 372 | Ga0163161_10008394 | 3300017792 | Bacteria | 7148 |
| 373 | Ga0206356_10558017 | 3300020070 | Bacteria | 1731 |
| 374 | Ga0214544_1000002 | 3300021320 | Bacteria | 753857 |
| 375 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 376 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 377 | Ga0214543_1000001 | 3300021327 | Bacteria | 776921 |
| 378 | Ga0213872_10023205 | 3300021361 | Bacteria | 2855 |
| 379 | Ga0213876_10009439 | 3300021384 | Bacteria | 5251 |
| 380 | Ga0213876_10056797 | 3300021384 | Bacteria | 2066 |
| 381 | Ga0213875_10000007 | 3300021388 | Bacteria | 562717 |
| 382 | Ga0209677_102829 | 3300025253 | Bacteria | 6135 |
| 383 | Ga0209148_1000428 | 3300025254 | Bacteria | 46613 |
| 384 | Ga0209233_1000804 | 3300025261 | Bacteria | 14031 |
| 385 | Ga0209233_1006202 | 3300025261 | Bacteria | 3874 |
| 386 | Ga0209233_1008608 | 3300025261 | Bacteria | 3145 |
| 387 | Ga0207666_1000006 | 3300025271 | Bacteria | 51882 |
| 388 | Ga0207666_1001276 | 3300025271 | Bacteria | 2975 |
| 389 | Ga0209455_1002286 | 3300025272 | Bacteria | 7540 |
| 390 | Ga0207673_1000712 | 3300025290 | Bacteria | 3559 |
| 391 | Ga0209564_1001578 | 3300025295 | Bacteria | 22285 |
| 392 | Ga0209564_1003479 | 3300025295 | Bacteria | 10734 |
| 393 | Ga0209564_1026529 | 3300025295 | Bacteria | 1910 |
| 394 | Ga0209758_1000140 | 3300025297 | Bacteria | 174267 |
| 395 | Ga0209758_1000321 | 3300025297 | Bacteria | 92591 |
| 396 | Ga0209758_1001092 | 3300025297 | Bacteria | 35145 |
| 397 | Ga0209758_1001514 | 3300025297 | Bacteria | 26963 |
| 398 | Ga0209758_1001968 | 3300025297 | Bacteria | 22196 |
| 399 | Ga0209758_1002659 | 3300025297 | Bacteria | 17684 |
| 400 | Ga0209758_1003492 | 3300025297 | Bacteria | 14221 |
| 401 | Ga0209758_1008964 | 3300025297 | Bacteria | 6338 |
| 402 | Ga0209758_1017349 | 3300025297 | Bacteria | 3592 |
| 403 | Ga0209256_1005434 | 3300025299 | Bacteria | 7340 |
| 404 | Ga0207426_1000278 | 3300025302 | Bacteria | 105775 |
| 405 | Ga0207426_1000378 | 3300025302 | Bacteria | 76958 |
| 406 | Ga0207426_1002170 | 3300025302 | Bacteria | 13286 |
| 407 | Ga0207426_1018412 | 3300025302 | Bacteria | 2460 |
| 408 | Ga0207426_1023520 | 3300025302 | Bacteria | 2101 |
| 409 | Ga0209257_1000522 | 3300025304 | Bacteria | 66723 |
| 410 | Ga0207697_10000009 | 3300025315 | Bacteria | 67526 |
| 411 | Ga0207697_10004408 | 3300025315 | Bacteria | 6729 |
| 412 | Ga0207656_10012199 | 3300025321 | Bacteria | 3262 |
| 413 | Ga0207653_10036515 | 3300025885 | Bacteria | 1601 |
| 414 | Ga0207682_10000301 | 3300025893 | Bacteria | 22279 |
| 415 | Ga0207692_10000849 | 3300025898 | Bacteria | 10974 |
| 416 | Ga0207692_10006397 | 3300025898 | Bacteria | 4775 |
| 417 | Ga0207692_10017678 | 3300025898 | Bacteria | 3184 |
| 418 | Ga0207692_10034555 | 3300025898 | Bacteria | 2448 |
| 419 | Ga0207642_10043027 | 3300025899 | Bacteria | 1989 |
| 420 | Ga0207710_10018364 | 3300025900 | Bacteria | 2974 |
| 421 | Ga0207688_10000012 | 3300025901 | Bacteria | 60353 |
| 422 | Ga0207688_10000263 | 3300025901 | Bacteria | 23901 |
| 423 | Ga0207688_10041797 | 3300025901 | Bacteria | 2551 |
| 424 | Ga0207680_10007512 | 3300025903 | Bacteria | 5322 |
| 425 | Ga0207680_10020383 | 3300025903 | Bacteria | 3567 |
| 426 | Ga0207680_10029543 | 3300025903 | Bacteria | 3081 |
| 427 | Ga0207647_10002921 | 3300025904 | Bacteria | 12870 |
| 428 | Ga0207647_10006251 | 3300025904 | Bacteria | 8674 |
| 429 | Ga0207647_10033866 | 3300025904 | Bacteria | 3267 |
| 430 | Ga0207685_10004719 | 3300025905 | Bacteria | 3504 |
| 431 | Ga0207699_10007610 | 3300025906 | Bacteria | 5303 |
| 432 | Ga0207699_10017739 | 3300025906 | Bacteria | 3756 |
| 433 | Ga0207699_10025811 | 3300025906 | Bacteria | 3231 |
| 434 | Ga0207645_10000124 | 3300025907 | Bacteria | 58746 |
| 435 | Ga0207645_10022280 | 3300025907 | Bacteria | 4123 |
| 436 | Ga0207645_10056703 | 3300025907 | Bacteria | 2501 |
| 437 | Ga0207645_10086454 | 3300025907 | Bacteria | 2015 |
| 438 | Ga0207643_10000046 | 3300025908 | Bacteria | 80736 |
| 439 | Ga0207643_10000889 | 3300025908 | Bacteria | 18002 |
| 440 | Ga0207705_10075165 | 3300025909 | Bacteria | 2453 |
| 441 | Ga0207705_10115555 | 3300025909 | Bacteria | 1986 |
| 442 | Ga0207684_10003987 | 3300025910 | Bacteria | 14129 |
| 443 | Ga0207684_10133715 | 3300025910 | Bacteria | 2129 |
| 444 | Ga0207654_10004889 | 3300025911 | Bacteria | 6780 |
| 445 | Ga0207654_10015528 | 3300025911 | Bacteria | 3953 |
| 446 | Ga0207707_10009522 | 3300025912 | Bacteria | 8427 |
| 447 | Ga0207707_10011411 | 3300025912 | Bacteria | 7738 |
| 448 | Ga0207707_10024737 | 3300025912 | Bacteria | 5253 |
| 449 | Ga0207707_10027011 | 3300025912 | Bacteria | 5017 |
| 450 | Ga0207707_10033774 | 3300025912 | Bacteria | 4477 |
| 451 | Ga0207707_10059952 | 3300025912 | Bacteria | 3311 |
| 452 | Ga0207707_10294682 | 3300025912 | Bacteria | 1403 |
| 453 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 454 | Ga0207695_10008039 | 3300025913 | Bacteria | 13279 |
| 455 | Ga0207695_10081943 | 3300025913 | Bacteria | 3264 |
| 456 | Ga0207695_10120229 | 3300025913 | Bacteria | 2596 |
| 457 | Ga0207671_10007118 | 3300025914 | Bacteria | 9772 |
| 458 | Ga0207671_10044503 | 3300025914 | Bacteria | 3283 |
| 459 | Ga0207671_10120545 | 3300025914 | Bacteria | 2005 |
| 460 | Ga0207693_10001080 | 3300025915 | Bacteria | 24461 |
| 461 | Ga0207693_10001875 | 3300025915 | Bacteria | 18415 |
| 462 | Ga0207693_10007332 | 3300025915 | Bacteria | 9072 |
| 463 | Ga0207693_10018304 | 3300025915 | Bacteria | 5582 |
| 464 | Ga0207693_10050341 | 3300025915 | Bacteria | 3272 |
| 465 | Ga0207693_10055325 | 3300025915 | Bacteria | 3113 |
| 466 | Ga0207693_10174151 | 3300025915 | Bacteria | 1694 |
| 467 | Ga0207663_10000347 | 3300025916 | Bacteria | 20128 |
| 468 | Ga0207663_10010022 | 3300025916 | Bacteria | 5022 |
| 469 | Ga0207663_10021116 | 3300025916 | Bacteria | 3701 |
| 470 | Ga0207663_10143834 | 3300025916 | Bacteria | 1665 |
| 471 | Ga0207660_10071085 | 3300025917 | Bacteria | 2531 |
| 472 | Ga0207660_10109729 | 3300025917 | Bacteria | 2074 |
| 473 | Ga0207660_10133279 | 3300025917 | Bacteria | 1893 |
| 474 | Ga0207660_10160578 | 3300025917 | Bacteria | 1733 |
| 475 | Ga0207662_10000154 | 3300025918 | Bacteria | 32501 |
| 476 | Ga0207662_10000222 | 3300025918 | Bacteria | 26332 |
| 477 | Ga0207662_10032507 | 3300025918 | Bacteria | 3038 |
| 478 | Ga0207662_10144063 | 3300025918 | Bacteria | 1511 |
| 479 | Ga0207657_10000162 | 3300025919 | Bacteria | 68121 |
| 480 | Ga0207657_10030200 | 3300025919 | Bacteria | 4922 |
| 481 | Ga0207657_10060302 | 3300025919 | Bacteria | 3256 |
| 482 | Ga0207657_10071568 | 3300025919 | Bacteria | 2936 |
| 483 | Ga0207657_10152882 | 3300025919 | Bacteria | 1879 |
| 484 | Ga0207649_10000798 | 3300025920 | Bacteria | 20284 |
| 485 | Ga0207652_10021470 | 3300025921 | Bacteria | 5329 |
| 486 | Ga0207652_10045919 | 3300025921 | Bacteria | 3725 |
| 487 | Ga0207652_10117589 | 3300025921 | Bacteria | 2362 |
| 488 | Ga0207652_10122151 | 3300025921 | Bacteria | 2318 |
| 489 | Ga0207652_10308076 | 3300025921 | Bacteria | 1429 |
| 490 | Ga0207681_10007488 | 3300025923 | Bacteria | 6687 |
| 491 | Ga0207681_10094623 | 3300025923 | Bacteria | 2141 |
| 492 | Ga0207694_10018170 | 3300025924 | Bacteria | 5317 |
| 493 | Ga0207694_10048738 | 3300025924 | Bacteria | 3278 |
| 494 | Ga0207650_10054665 | 3300025925 | Bacteria | 2963 |
| 495 | Ga0207659_10000762 | 3300025926 | Bacteria | 19116 |
| 496 | Ga0207659_10140306 | 3300025926 | Bacteria | 1875 |
| 497 | Ga0207659_10199744 | 3300025926 | Bacteria | 1596 |
| 498 | Ga0207687_10008325 | 3300025927 | Bacteria | 6787 |
| 499 | Ga0207687_10023134 | 3300025927 | Bacteria | 4140 |
| 500 | Ga0207687_10131080 | 3300025927 | Bacteria | 1890 |
| 501 | Ga0207700_10000290 | 3300025928 | Bacteria | 29736 |
| 502 | Ga0207700_10078975 | 3300025928 | Bacteria | 2561 |
| 503 | Ga0207700_10082443 | 3300025928 | Bacteria | 2515 |
| 504 | Ga0207700_10102014 | 3300025928 | Bacteria | 2290 |
| 505 | Ga0207700_10178814 | 3300025928 | Bacteria | 1775 |
| 506 | Ga0207664_10010393 | 3300025929 | Bacteria | 6574 |
| 507 | Ga0207664_10011397 | 3300025929 | Bacteria | 6318 |
| 508 | Ga0207664_10029434 | 3300025929 | Bacteria | 4183 |
| 509 | Ga0207664_10096420 | 3300025929 | Bacteria | 2434 |
| 510 | Ga0207664_10097259 | 3300025929 | Bacteria | 2425 |
| 511 | Ga0207644_10024576 | 3300025931 | Bacteria | 4137 |
| 512 | Ga0207644_10056409 | 3300025931 | Bacteria | 2835 |
| 513 | Ga0207690_10006396 | 3300025932 | Bacteria | 6981 |
| 514 | Ga0207690_10100607 | 3300025932 | Bacteria | 2063 |
| 515 | Ga0207706_10000929 | 3300025933 | Bacteria | 30046 |
| 516 | Ga0207706_10020484 | 3300025933 | Bacteria | 5944 |
| 517 | Ga0207706_10155385 | 3300025933 | Bacteria | 2012 |
| 518 | Ga0207686_10084159 | 3300025934 | Bacteria | 2083 |
| 519 | Ga0207686_10090123 | 3300025934 | Bacteria | 2023 |
| 520 | Ga0207709_10000256 | 3300025935 | Bacteria | 63853 |
| 521 | Ga0207709_10106054 | 3300025935 | Bacteria | 1869 |
| 522 | Ga0207670_10003293 | 3300025936 | Bacteria | 8558 |
| 523 | Ga0207670_10010584 | 3300025936 | Bacteria | 5320 |
| 524 | Ga0207670_10020290 | 3300025936 | Bacteria | 4081 |
| 525 | Ga0207670_10066843 | 3300025936 | Bacteria | 2471 |
| 526 | Ga0207669_10001769 | 3300025937 | Bacteria | 9164 |
| 527 | Ga0207669_10045983 | 3300025937 | Bacteria | 2576 |
| 528 | Ga0207669_10051306 | 3300025937 | Bacteria | 2471 |
| 529 | Ga0207669_10078648 | 3300025937 | Bacteria | 2102 |
| 530 | Ga0207669_10096367 | 3300025937 | Bacteria | 1942 |
| 531 | Ga0207669_10109797 | 3300025937 | Bacteria | 1845 |
| 532 | Ga0207704_10021960 | 3300025938 | Bacteria | 3410 |
| 533 | Ga0207704_10037137 | 3300025938 | Bacteria | 2811 |
| 534 | Ga0207665_10000719 | 3300025939 | Bacteria | 22485 |
| 535 | Ga0207665_10043622 | 3300025939 | Bacteria | 2999 |
| 536 | Ga0207665_10105306 | 3300025939 | Bacteria | 1975 |
| 537 | Ga0207691_10006340 | 3300025940 | Bacteria | 11426 |
| 538 | Ga0207691_10006425 | 3300025940 | Bacteria | 11355 |
| 539 | Ga0207691_10015435 | 3300025940 | Bacteria | 7265 |
| 540 | Ga0207691_10118759 | 3300025940 | Bacteria | 2346 |
| 541 | Ga0207711_10036622 | 3300025941 | Bacteria | 4164 |
| 542 | Ga0207711_10053917 | 3300025941 | Bacteria | 3449 |
| 543 | Ga0207711_10182249 | 3300025941 | Bacteria | 1910 |
| 544 | Ga0207689_10000109 | 3300025942 | Bacteria | 67941 |
| 545 | Ga0207689_10031109 | 3300025942 | Bacteria | 4446 |
| 546 | Ga0207689_10051147 | 3300025942 | Bacteria | 3406 |
| 547 | Ga0207689_10052656 | 3300025942 | Bacteria | 3353 |
| 548 | Ga0207661_10001655 | 3300025944 | Bacteria | 15191 |
| 549 | Ga0207661_10006709 | 3300025944 | Bacteria | 8143 |
| 550 | Ga0207661_10093766 | 3300025944 | Bacteria | 2506 |
| 551 | Ga0207661_10096435 | 3300025944 | Bacteria | 2474 |
| 552 | Ga0207661_10115604 | 3300025944 | Bacteria | 2276 |
| 553 | Ga0207661_10148070 | 3300025944 | Bacteria | 2027 |
| 554 | Ga0207679_10000763 | 3300025945 | Bacteria | 21224 |
| 555 | Ga0207679_10027676 | 3300025945 | Bacteria | 3924 |
| 556 | Ga0207679_10039187 | 3300025945 | Bacteria | 3382 |
| 557 | Ga0207679_10210571 | 3300025945 | Bacteria | 1630 |
| 558 | Ga0207667_10021843 | 3300025949 | Bacteria | 7083 |
| 559 | Ga0207667_10034067 | 3300025949 | Bacteria | 5471 |
| 560 | Ga0207667_10109822 | 3300025949 | Bacteria | 2845 |
| 561 | Ga0207667_10119538 | 3300025949 | Bacteria | 2715 |
| 562 | Ga0207667_10123233 | 3300025949 | Bacteria | 2671 |
| 563 | Ga0207667_10164754 | 3300025949 | Bacteria | 2279 |
| 564 | Ga0207667_10170068 | 3300025949 | Bacteria | 2240 |
| 565 | Ga0207651_10000900 | 3300025960 | Bacteria | 13066 |
| 566 | Ga0207651_10004250 | 3300025960 | Bacteria | 7184 |
| 567 | Ga0207651_10130307 | 3300025960 | Bacteria | 1924 |
| 568 | Ga0207712_10010883 | 3300025961 | Bacteria | 5790 |
| 569 | Ga0207712_10022037 | 3300025961 | Bacteria | 4190 |
| 570 | Ga0207712_10030069 | 3300025961 | Bacteria | 3650 |
| 571 | Ga0207712_10040854 | 3300025961 | Bacteria | 3186 |
| 572 | Ga0207668_10015835 | 3300025972 | Bacteria | 4694 |
| 573 | Ga0207668_10030283 | 3300025972 | Bacteria | 3555 |
| 574 | Ga0207640_10004377 | 3300025981 | Bacteria | 7650 |
| 575 | Ga0207658_10018594 | 3300025986 | Bacteria | 4802 |
| 576 | Ga0207658_10034145 | 3300025986 | Bacteria | 3633 |
| 577 | Ga0207677_10007601 | 3300026023 | Bacteria | 6012 |
| 578 | Ga0207677_10010239 | 3300026023 | Bacteria | 5300 |
| 579 | Ga0207677_10011127 | 3300026023 | Bacteria | 5117 |
| 580 | Ga0207703_10012561 | 3300026035 | Bacteria | 6602 |
| 581 | Ga0207703_10013883 | 3300026035 | Bacteria | 6279 |
| 582 | Ga0207703_10028301 | 3300026035 | Bacteria | 4417 |
| 583 | Ga0207703_10060311 | 3300026035 | Bacteria | 3102 |
| 584 | Ga0207639_10039190 | 3300026041 | Bacteria | 3529 |
| 585 | Ga0207639_10053845 | 3300026041 | Bacteria | 3072 |
| 586 | Ga0207639_10195327 | 3300026041 | Bacteria | 1731 |
| 587 | Ga0207678_10004447 | 3300026067 | Bacteria | 12606 |
| 588 | Ga0207678_10006545 | 3300026067 | Bacteria | 10328 |
| 589 | Ga0207678_10008261 | 3300026067 | Bacteria | 9171 |
| 590 | Ga0207678_10029694 | 3300026067 | Bacteria | 4773 |
| 591 | Ga0207678_10034437 | 3300026067 | Bacteria | 4411 |
| 592 | Ga0207678_10056317 | 3300026067 | Bacteria | 3384 |
| 593 | Ga0207708_10000098 | 3300026075 | Bacteria | 67005 |
| 594 | Ga0207708_10002092 | 3300026075 | Bacteria | 14690 |
| 595 | Ga0207708_10006322 | 3300026075 | Bacteria | 8779 |
| 596 | Ga0207708_10012533 | 3300026075 | Bacteria | 6321 |
| 597 | Ga0207708_10109972 | 3300026075 | Bacteria | 2138 |
| 598 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 599 | Ga0207702_10002142 | 3300026078 | Bacteria | 18978 |
| 600 | Ga0207702_10114296 | 3300026078 | Bacteria | 2405 |
| 601 | Ga0207702_10115998 | 3300026078 | Bacteria | 2389 |
| 602 | Ga0207641_10038224 | 3300026088 | Bacteria | 4011 |
| 603 | Ga0207641_10135346 | 3300026088 | Bacteria | 2217 |
| 604 | Ga0207641_10150619 | 3300026088 | Bacteria | 2106 |
| 605 | Ga0207648_10001639 | 3300026089 | Bacteria | 24530 |
| 606 | Ga0207648_10002003 | 3300026089 | Bacteria | 22234 |
| 607 | Ga0207648_10010667 | 3300026089 | Bacteria | 8687 |
| 608 | Ga0207648_10059959 | 3300026089 | Bacteria | 3318 |
| 609 | Ga0207676_10017955 | 3300026095 | Bacteria | 5133 |
| 610 | Ga0207676_10031583 | 3300026095 | Bacteria | 3983 |
| 611 | Ga0207676_10095444 | 3300026095 | Bacteria | 2452 |
| 612 | Ga0207674_10000420 | 3300026116 | Bacteria | 55287 |
| 613 | Ga0207674_10003611 | 3300026116 | Bacteria | 18863 |
| 614 | Ga0207674_10033144 | 3300026116 | Bacteria | 5409 |
| 615 | Ga0207674_10044894 | 3300026116 | Bacteria | 4550 |
| 616 | Ga0207675_100002543 | 3300026118 | Bacteria | 18056 |
| 617 | Ga0207675_100008008 | 3300026118 | Bacteria | 9959 |
| 618 | Ga0207675_100124538 | 3300026118 | Bacteria | 2441 |
| 619 | Ga0207675_100196290 | 3300026118 | Bacteria | 1937 |
| 620 | Ga0207683_10000004 | 3300026121 | Bacteria | 188086 |
| 621 | Ga0207683_10001293 | 3300026121 | Bacteria | 22621 |
| 622 | Ga0207683_10015556 | 3300026121 | Bacteria | 6478 |
| 623 | Ga0207683_10020374 | 3300026121 | Bacteria | 5672 |
| 624 | Ga0207683_10035723 | 3300026121 | Bacteria | 4323 |
| 625 | Ga0207698_10004120 | 3300026142 | Bacteria | 8830 |
| 626 | Ga0207698_10017188 | 3300026142 | Bacteria | 4900 |
| 627 | Ga0209389_1000032 | 3300027296 | Bacteria | 134064 |
| 628 | Ga0209389_1000995 | 3300027296 | Bacteria | 18828 |
| 629 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 630 | Ga0209589_1000211 | 3300027357 | Bacteria | 69316 |
| 631 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 632 | Ga0209489_100006 | 3300027361 | Bacteria | 475698 |
| 633 | Ga0209489_111765 | 3300027361 | Bacteria | 8620 |
| 634 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 635 | Ga0209700_100005 | 3300027363 | Bacteria | 573969 |
| 636 | Ga0209966_1001208 | 3300027695 | Bacteria | 4603 |
| 637 | Ga0209998_10002107 | 3300027717 | Bacteria | 4636 |
| 638 | Ga0209998_10003369 | 3300027717 | Bacteria | 3507 |
| 639 | Ga0209974_10009223 | 3300027876 | Bacteria | 3349 |
| 640 | Ga0207428_10000303 | 3300027907 | Bacteria | 65124 |
| 641 | Ga0207428_10019216 | 3300027907 | Bacteria | 5826 |
| 642 | Ga0268266_10044379 | 3300028379 | Bacteria | 3800 |
| 643 | Ga0268266_10047490 | 3300028379 | Bacteria | 3678 |
| 644 | Ga0268266_10056381 | 3300028379 | Bacteria | 3380 |
| 645 | Ga0268265_10012335 | 3300028380 | Bacteria | 5790 |
| 646 | Ga0268264_10000149 | 3300028381 | Bacteria | 163972 |
| 647 | Ga0268264_10073523 | 3300028381 | Bacteria | 2902 |
| 648 | Ga0268264_10102135 | 3300028381 | Bacteria | 2495 |
| 649 | Ga0268264_10198647 | 3300028381 | Bacteria | 1833 |
| 650 | Ga0268264_10226639 | 3300028381 | Bacteria | 1723 |
| 651 | Ga0265337_1000539 | 3300028556 | Bacteria | 20178 |
| 652 | Ga0265334_10045848 | 3300028573 | Bacteria | 1692 |
| 653 | Ga0265318_10012129 | 3300028577 | Bacteria | 3679 |
| 654 | Ga0265336_10013212 | 3300028666 | Bacteria | 2756 |
| 655 | Ga0307517_10000249 | 3300028786 | Bacteria | 91911 |
| 656 | Ga0307515_10050561 | 3300028794 | Bacteria | 6221 |
| 657 | Ga0265338_10000665 | 3300028800 | Bacteria | 59449 |
| 658 | Ga0265338_10010360 | 3300028800 | Bacteria | 10945 |
| 659 | Ga0265338_10085175 | 3300028800 | Bacteria | 2635 |
| 660 | Ga0265330_10012435 | 3300031235 | Bacteria | 3979 |
| 661 | Ga0265332_10001409 | 3300031238 | Bacteria | 13560 |
| 662 | Ga0265320_10011080 | 3300031240 | Bacteria | 5323 |
| 663 | Ga0265325_10000603 | 3300031241 | Bacteria | 26174 |
| 664 | Ga0265325_10008234 | 3300031241 | Bacteria | 6166 |
| 665 | Ga0265325_10055536 | 3300031241 | Bacteria | 2024 |
| 666 | Ga0265340_10011380 | 3300031247 | Bacteria | 4727 |
| 667 | Ga0265340_10011777 | 3300031247 | Bacteria | 4640 |
| 668 | Ga0265340_10023020 | 3300031247 | Bacteria | 3179 |
| 669 | Ga0265339_10000465 | 3300031249 | Bacteria | 31657 |
| 670 | Ga0265339_10016860 | 3300031249 | Bacteria | 4341 |
| 671 | Ga0265339_10036117 | 3300031249 | Bacteria | 2767 |
| 672 | Ga0265339_10048704 | 3300031249 | Bacteria | 2323 |
| 673 | Ga0265339_10086086 | 3300031249 | Bacteria | 1654 |
| 674 | Ga0265331_10025769 | 3300031250 | Bacteria | 2965 |
| 675 | Ga0265331_10029591 | 3300031250 | Bacteria | 2731 |
| 676 | Ga0307509_10004311 | 3300031507 | Bacteria | 20669 |
| 677 | Ga0307408_100024489 | 3300031548 | Bacteria | 4123 |
| 678 | Ga0265313_10000006 | 3300031595 | Bacteria | 183184 |
| 679 | Ga0265313_10010630 | 3300031595 | Bacteria | 5796 |
| 680 | Ga0307508_10000018 | 3300031616 | Bacteria | 202701 |
| 681 | Ga0307508_10109943 | 3300031616 | Bacteria | 2355 |
| 682 | Ga0265314_10002127 | 3300031711 | Bacteria | 20778 |
| 683 | Ga0265314_10019317 | 3300031711 | Bacteria | 5282 |
| 684 | Ga0265342_10001132 | 3300031712 | Bacteria | 25514 |
| 685 | Ga0265342_10002171 | 3300031712 | Bacteria | 17254 |
| 686 | Ga0265342_10094300 | 3300031712 | Bacteria | 1713 |
| 687 | Ga0316576_10157855 | 3300031727 | Bacteria | 1710 |
| 688 | Ga0307516_10011365 | 3300031730 | Bacteria | 9683 |
| 689 | Ga0307516_10153301 | 3300031730 | Bacteria | 2062 |
| 690 | Ga0307410_10176024 | 3300031852 | Bacteria | 1616 |
| 691 | Ga0307412_10058553 | 3300031911 | Bacteria | 2578 |
| 692 | Ga0307412_10135882 | 3300031911 | Bacteria | 1794 |
| 693 | Ga0307416_100142142 | 3300032002 | Bacteria | 2184 |
| 694 | Ga0307411_10187957 | 3300032005 | Bacteria | 1574 |
| 695 | Ga0307507_10022838 | 3300033179 | Bacteria | 6892 |
| 696 | Ga0307510_10013733 | 3300033180 | Bacteria | 9600 |
| 697 | Ga0307510_10033134 | 3300033180 | Bacteria | 5807 |
| 698 | Ga0307510_10048914 | 3300033180 | Bacteria | 4504 |
| 699 | Ga0315911_1000006 | 3300033442 | Bacteria | 414563 |
| 700 | Ga0316215_1003036 | 3300033544 | Bacteria | 1594 |
| 701 | Ga0373958_0001300 | 3300034819 | Bacteria | 3339 |
| 702 | Ga0373938_0000022 | 3300034957 | Bacteria | 20030 |
| 703 | Ga0373929_0000472 | 3300035085 | Bacteria | 7704 |
| 704 | Ga0373934_0005378 | 3300035086 | Bacteria | 4741 |
| 705 | Ga0373940_0000137 | 3300035088 | Bacteria | 9375 |
| 706 | Ga0373949_0000261 | 3300035090 | Bacteria | 19624 |
| 707 | Ga0373951_0002760 | 3300035091 | Bacteria | 4393 |
| 708 | Ga0373952_0003517 | 3300035092 | Bacteria | 2825 |
| 709 | Ga0373932_0002247 | 3300035112 | Bacteria | 4945 |
| 710 | Ga0373939_0000463 | 3300035114 | Bacteria | 10276 |
| 711 | Ga0373939_0003813 | 3300035114 | Bacteria | 3553 |
| 712 | Ga0373941_0000221 | 3300035115 | Bacteria | 10967 |
| 713 | Ga0373941_0000589 | 3300035115 | Bacteria | 7345 |
| 714 | Ga0373945_0015340 | 3300035116 | Bacteria | 2576 |
| 715 | Ga0373953_0040881 | 3300035117 | Bacteria | 1843 |
| 716 | Ga0373954_0003471 | 3300035118 | Bacteria | 6687 |
| 717 | Ga0373954_0054642 | 3300035118 | Bacteria | 1878 |
| 718 | Ga0373956_0002490 | 3300035119 | Bacteria | 7496 |
| 719 | Ga0373956_0024869 | 3300035119 | Bacteria | 2585 |
| 720 | Ga0373957_0009403 | 3300035120 | Bacteria | 3198 |
| 721 | Ga0373960_0000800 | 3300035121 | Bacteria | 6614 |
| 722 | Ga0373960_0002104 | 3300035121 | Bacteria | 4482 |
| 723 | Ga0373943_0000061 | 3300035170 | Bacteria | 37449 |
| 724 | Ga0373943_0022381 | 3300035170 | Bacteria | 2928 |
| 725 | Ga0373946_0025537 | 3300035171 | Bacteria | 2324 |
| 726 | Ga0373955_0013625 | 3300035172 | Bacteria | 3938 |
| 727 | Ga0373955_0020458 | 3300035172 | Bacteria | 3327 |
| 728 | Ga0373942_0006530 | 3300035207 | Bacteria | 2695 |
| 729 | Ga0373961_0005825 | 3300035241 | Bacteria | 2960 |
| 730 | Ga0373961_0008356 | 3300035241 | Bacteria | 2517 |
| 731 | Ga0373962_0003673 | 3300035242 | Bacteria | 3691 |
| 732 | Ga0373962_0013120 | 3300035242 | Bacteria | 2094 |
| 733 | Ga0373924_0008696 | 3300035410 | Bacteria | 3701 |
| 734 | Ga0373924_0011814 | 3300035410 | Bacteria | 3250 |
| 735 | Ga0373931_0000750 | 3300035691 | Bacteria | 13546 |
| 736 | Ga0373935_0001116 | 3300035692 | Bacteria | 14637 |
| 737 | Ga0373935_0015189 | 3300035692 | Bacteria | 4651 |
| 738 | Ga0373935_0068802 | 3300035692 | Bacteria | 2279 |
| 739 | Ga0373935_0105033 | 3300035692 | Bacteria | 1867 |
| 740 | Ga0373927_0000275 | 3300035695 | Bacteria | 40382 |
| 741 | Ga0373927_0001437 | 3300035695 | Bacteria | 17974 |
| 742 | Ga0373927_0004277 | 3300035695 | Bacteria | 10020 |
| 743 | Ga0373927_0020807 | 3300035695 | Bacteria | 4300 |
| 744 | Ga0373927_0053127 | 3300035695 | Bacteria | 2620 |
| 745 | Ga0373927_0059425 | 3300035695 | Bacteria | 2472 |
| 746 | Ga0373933_0001880 | 3300035724 | Bacteria | 12123 |
| 747 | Ga0373933_0003392 | 3300035724 | Bacteria | 8881 |
| 748 | Ga0373933_0053271 | 3300035724 | Bacteria | 2423 |
| 749 | Ga0373933_0081011 | 3300035724 | Bacteria | 1991 |
| 750 | Ga0373947_0000187 | 3300035725 | Bacteria | 34086 |
| 751 | Ga0373947_0003173 | 3300035725 | Bacteria | 9781 |
| 752 | Ga0373947_0028877 | 3300035725 | Bacteria | 3253 |
| 753 | Ga0373947_0084669 | 3300035725 | Bacteria | 1968 |
| 754 | Ga0373937_0016414 | 3300036401 | Bacteria | 6577 |
| 755 | Ga0373937_0020656 | 3300036401 | Bacteria | 5905 |
| 756 | Ga0373937_0065794 | 3300036401 | Bacteria | 3337 |
| 757 | Ga0373925_0000791 | 3300037068 | Bacteria | 29167 |
| 758 | Ga0373925_0006458 | 3300037068 | Bacteria | 8624 |
| 759 | Ga0373925_0021188 | 3300037068 | Bacteria | 4736 |
| 760 | Ga0373925_0075820 | 3300037068 | Bacteria | 2549 |
| 761 | Ga0373925_0083593 | 3300037068 | Bacteria | 2432 |
| 762 | Ga0373925_0133663 | 3300037068 | Bacteria | 1936 |
| 763 | Ga0373925_0145606 | 3300037068 | Bacteria | 1857 |
| 764 | Ga0395899_0007661 | 3300037312 | Bacteria | 8324 |
| 765 | Ga0395899_0048874 | 3300037312 | Bacteria | 3146 |
| 766 | Ga0395900_0002820 | 3300037418 | Bacteria | 18968 |
| 767 | Ga0395900_0132770 | 3300037418 | Bacteria | 2551 |
| 768 | Ga0395900_0183877 | 3300037418 | Bacteria | 2122 |
| 769 | Ga0395900_0224298 | 3300037418 | Bacteria | 1893 |
| 770 | Ga0395900_0504171 | 3300037418 | Bacteria | 1160 |
| 771 | Ga0395898_0035823 | 3300037466 | Bacteria | 4932 |
| 772 | Ga0395898_0037214 | 3300037466 | Bacteria | 4829 |
| 773 | Ga0395898_0114923 | 3300037466 | Bacteria | 2579 |
| 774 | Ga0395898_0116527 | 3300037466 | Bacteria | 2560 |
| 775 | Ga0395898_0256323 | 3300037466 | Bacteria | 1668 |
| 776 | Ga0395905_0013848 | 3300037471 | Bacteria | 7715 |
| 777 | Ga0436364_0009242 | 3300037853 | Bacteria | 1668 |
| 778 | Ga0436364_0565423 | 3300037853 | Bacteria | 13235 |
| 779 | Ga0436364_1381345 | 3300037853 | Bacteria | 2017 |
| 780 | Ga0395901_0073052 | 3300038443 | Bacteria | 3577 |
| 781 | Ga0395901_0102522 | 3300038443 | Bacteria | 3003 |
| 782 | Ga0395901_0206396 | 3300038443 | Bacteria | 2058 |
| 783 | Ga0395901_0217750 | 3300038443 | Bacteria | 1996 |
| 784 | Ga0395901_0281687 | 3300038443 | Bacteria | 1727 |
| 785 | Ga0436365_0244105 | 3300039437 | Bacteria | 7287 |
| 786 | Ga0436365_0552397 | 3300039437 | Bacteria | 18046 |
| 787 | Ga0436365_0712843 | 3300039437 | Bacteria | 3690 |
| 788 | Ga0436361_0476110 | 3300039447 | Bacteria | 14479 |
| 789 | Ga0436363_0312479 | 3300039450 | Bacteria | 6730 |
| 790 | Ga0436363_1211778 | 3300039450 | Bacteria | 5063 |
| 791 | Ga0466972_0000160 | 3300044658 | Bacteria | 54154 |
| 792 | Ga0466972_0041245 | 3300044658 | Bacteria | 2248 |
| 793 | Ga0453683_0000499 | 3300044673 | Bacteria | 44878 |
| 794 | Ga0466965_0068895 | 3300044683 | Bacteria | 1777 |
| 795 | Ga0466966_0000669 | 3300044684 | Bacteria | 21779 |
| 796 | Ga0466961_0000208 | 3300044693 | Bacteria | 39439 |
| 797 | Ga0466961_0049061 | 3300044693 | Bacteria | 2699 |
| 798 | Ga0466963_0051971 | 3300044694 | Bacteria | 2718 |
| 799 | Ga0466957_0304793 | 3300044842 | Bacteria | 1071 |
| 800 | Ga0466960_0004027 | 3300044901 | Bacteria | 5712 |
| 801 | Ga0466959_0000832 | 3300045049 | Bacteria | 18217 |
| 802 | Ga0466959_0065541 | 3300045049 | Bacteria | 2636 |
| 803 | Ga0466967_0007808 | 3300045976 | Bacteria | 7773 |
| 804 | Ga0495592_0002109 | 3300046454 | Bacteria | 14021 |
| 805 | Ga0495592_0010077 | 3300046454 | Bacteria | 7118 |
| 806 | Ga0495603_0001086 | 3300046455 | Bacteria | 15788 |
| 807 | Ga0495603_0005459 | 3300046455 | Bacteria | 7590 |
| 808 | Ga0495603_0012614 | 3300046455 | Bacteria | 5113 |
| 809 | Ga0495603_0025716 | 3300046455 | Bacteria | 3559 |
| 810 | Ga0495629_0000329 | 3300046459 | Bacteria | 40545 |
| 811 | Ga0495629_0000726 | 3300046459 | Bacteria | 26748 |
| 812 | Ga0495629_0008557 | 3300046459 | Bacteria | 7535 |
| 813 | Ga0495629_0073225 | 3300046459 | Bacteria | 2392 |
| 814 | Ga0495629_0145998 | 3300046459 | Bacteria | 1645 |
| 815 | Ga0495638_0078657 | 3300046460 | Bacteria | 2006 |
| 816 | Ga0495641_0000747 | 3300046461 | Bacteria | 27535 |
| 817 | Ga0495641_0009078 | 3300046461 | Bacteria | 5957 |
| 818 | Ga0495651_0000528 | 3300046462 | Bacteria | 29605 |
| 819 | Ga0495651_0001234 | 3300046462 | Bacteria | 19776 |
| 820 | Ga0495653_0000358 | 3300046463 | Bacteria | 36893 |
| 821 | Ga0495653_0024434 | 3300046463 | Bacteria | 4870 |
| 822 | Ga0495653_0120003 | 3300046463 | Bacteria | 1875 |
| 823 | Ga0495582_0000416 | 3300046473 | Bacteria | 23251 |
| 824 | Ga0495582_0018577 | 3300046473 | Bacteria | 3801 |
| 825 | Ga0495582_0039151 | 3300046473 | Bacteria | 2610 |
| 826 | Ga0495605_0058321 | 3300046474 | Bacteria | 1856 |
| 827 | Ga0495605_0077055 | 3300046474 | Bacteria | 1565 |
| 828 | Ga0495639_0000165 | 3300046475 | Bacteria | 34551 |
| 829 | Ga0495639_0042460 | 3300046475 | Bacteria | 2051 |
| 830 | Ga0495662_0000066 | 3300046476 | Bacteria | 36870 |
| 831 | Ga0495662_0007797 | 3300046476 | Bacteria | 5271 |
| 832 | Ga0495662_0055096 | 3300046476 | Bacteria | 1921 |
| 833 | Ga0495664_0000510 | 3300046477 | Bacteria | 19398 |
| 834 | Ga0495664_0003203 | 3300046477 | Bacteria | 8886 |
| 835 | Ga0495664_0025954 | 3300046477 | Bacteria | 3411 |
| 836 | Ga0495585_0050021 | 3300046492 | Bacteria | 2319 |
| 837 | Ga0495594_0000441 | 3300046499 | Bacteria | 20981 |
| 838 | Ga0495594_0104469 | 3300046499 | Bacteria | 1595 |
| 839 | Ga0495607_0055693 | 3300046501 | Bacteria | 2274 |
| 840 | Ga0495606_0001663 | 3300046507 | Bacteria | 28893 |
| 841 | Ga0495606_0045553 | 3300046507 | Bacteria | 2905 |
| 842 | Ga0495608_0002274 | 3300046511 | Bacteria | 13858 |
| 843 | Ga0495608_0002377 | 3300046511 | Bacteria | 13537 |
| 844 | Ga0495608_0025275 | 3300046511 | Bacteria | 4054 |
| 845 | Ga0495608_0041729 | 3300046511 | Bacteria | 3069 |
| 846 | Ga0495618_0002751 | 3300046514 | Bacteria | 11183 |
| 847 | Ga0495618_0020274 | 3300046514 | Bacteria | 4093 |
| 848 | Ga0495620_0049417 | 3300046515 | Bacteria | 1800 |
| 849 | Ga0495628_0019406 | 3300046516 | Bacteria | 5622 |
| 850 | Ga0495628_0020389 | 3300046516 | Bacteria | 5469 |
| 851 | Ga0495628_0022251 | 3300046516 | Bacteria | 5209 |
| 852 | Ga0495628_0146998 | 3300046516 | Bacteria | 1796 |
| 853 | Ga0495630_0008582 | 3300046517 | Bacteria | 7332 |
| 854 | Ga0495631_0019145 | 3300046518 | Bacteria | 3213 |
| 855 | Ga0495642_0056699 | 3300046528 | Bacteria | 1619 |
| 856 | Ga0495652_0002427 | 3300046529 | Bacteria | 19218 |
| 857 | Ga0495652_0005186 | 3300046529 | Bacteria | 12313 |
| 858 | Ga0495652_0020974 | 3300046529 | Bacteria | 5807 |
| 859 | Ga0495652_0066937 | 3300046529 | Bacteria | 3012 |
| 860 | Ga0495665_0000802 | 3300046531 | Bacteria | 16451 |
| 861 | Ga0495665_0001233 | 3300046531 | Bacteria | 13656 |
| 862 | Ga0495640_0003534 | 3300046533 | Bacteria | 12566 |
| 863 | Ga0495640_0009403 | 3300046533 | Bacteria | 7612 |
| 864 | Ga0495640_0027787 | 3300046533 | Bacteria | 4077 |
| 865 | Ga0495640_0065735 | 3300046533 | Bacteria | 2448 |
| 866 | Ga0495586_0014173 | 3300046535 | Bacteria | 4237 |
| 867 | Ga0495586_0099032 | 3300046535 | Bacteria | 1617 |
| 868 | Ga0495587_0001337 | 3300046536 | Bacteria | 16369 |
| 869 | Ga0495587_0024608 | 3300046536 | Bacteria | 3688 |
| 870 | Ga0495587_0030214 | 3300046536 | Bacteria | 3286 |
| 871 | Ga0495609_0071603 | 3300046538 | Bacteria | 1523 |
| 872 | Ga0495645_0008975 | 3300046543 | Bacteria | 6983 |
| 873 | Ga0495645_0034306 | 3300046543 | Bacteria | 3702 |
| 874 | Ga0495645_0050362 | 3300046543 | Bacteria | 3032 |
| 875 | Ga0495645_0112011 | 3300046543 | Bacteria | 1930 |
| 876 | Ga0495622_0004915 | 3300046557 | Bacteria | 6190 |
| 877 | Ga0495622_0019370 | 3300046557 | Bacteria | 3168 |
| 878 | Ga0495622_0032366 | 3300046557 | Bacteria | 2442 |
| 879 | Ga0495667_0002234 | 3300046559 | Bacteria | 12951 |
| 880 | Ga0495667_0060233 | 3300046559 | Bacteria | 2490 |
| 881 | Ga0495634_0002191 | 3300046642 | Bacteria | 16415 |
| 882 | Ga0495634_0002979 | 3300046642 | Bacteria | 13815 |
| 883 | Ga0495634_0015120 | 3300046642 | Bacteria | 5547 |
| 884 | Ga0495625_0048927 | 3300046660 | Bacteria | 3041 |
| 885 | Ga0495625_0086437 | 3300046660 | Bacteria | 2175 |
| 886 | Ga0495635_0000527 | 3300046663 | Bacteria | 24259 |
| 887 | Ga0495635_0001696 | 3300046663 | Bacteria | 14837 |
| 888 | Ga0495635_0002022 | 3300046663 | Bacteria | 13767 |
| 889 | Ga0495635_0031514 | 3300046663 | Bacteria | 3680 |
| 890 | Ga0495635_0088227 | 3300046663 | Bacteria | 2122 |
| 891 | Ga0495635_0138618 | 3300046663 | Bacteria | 1657 |
| 892 | Ga0495659_0044852 | 3300046664 | Bacteria | 1591 |
| 893 | Ga0495588_0055784 | 3300046674 | Bacteria | 2039 |
| 894 | Ga0495657_0001550 | 3300046675 | Bacteria | 19763 |
| 895 | Ga0495657_0007232 | 3300046675 | Bacteria | 8604 |
| 896 | Ga0495657_0053087 | 3300046675 | Bacteria | 2714 |
| 897 | Ga0495599_0002310 | 3300046678 | Bacteria | 11080 |
| 898 | Ga0495599_0013701 | 3300046678 | Bacteria | 5012 |
| 899 | Ga0495599_0097191 | 3300046678 | Bacteria | 1836 |
| 900 | Ga0495599_0133702 | 3300046678 | Bacteria | 1540 |
| 901 | Ga0495623_0003518 | 3300046679 | Bacteria | 10364 |
| 902 | Ga0495646_0017484 | 3300046680 | Bacteria | 4549 |
| 903 | Ga0495646_0022612 | 3300046680 | Bacteria | 3965 |
| 904 | Ga0495646_0044539 | 3300046680 | Bacteria | 2713 |
| 905 | Ga0495646_0057438 | 3300046680 | Bacteria | 2329 |
| 906 | Ga0495646_0067909 | 3300046680 | Bacteria | 2106 |
| 907 | Ga0495646_0101890 | 3300046680 | Bacteria | 1645 |
| 908 | Ga0495647_0001835 | 3300046681 | Bacteria | 6580 |
| 909 | Ga0495647_0002668 | 3300046681 | Bacteria | 5665 |
| 910 | Ga0495647_0004959 | 3300046681 | Bacteria | 4358 |
| 911 | Ga0495658_0004889 | 3300046683 | Bacteria | 6576 |
| 912 | Ga0495658_0027133 | 3300046683 | Bacteria | 3078 |
| 913 | Ga0495658_0109867 | 3300046683 | Bacteria | 1657 |
| 914 | Ga0495613_0002281 | 3300046689 | Bacteria | 14509 |
| 915 | Ga0495613_0003015 | 3300046689 | Bacteria | 12608 |
| 916 | Ga0495613_0016014 | 3300046689 | Bacteria | 5582 |
| 917 | Ga0495624_0005449 | 3300046690 | Bacteria | 9169 |
| 918 | Ga0495624_0006912 | 3300046690 | Bacteria | 8002 |
| 919 | Ga0495624_0030168 | 3300046690 | Bacteria | 3533 |
| 920 | Ga0495624_0055194 | 3300046690 | Bacteria | 2503 |
| 921 | Ga0495670_0044264 | 3300046691 | Bacteria | 2222 |
| 922 | Ga0495589_0040148 | 3300046794 | Bacteria | 2338 |
| 923 | Ga0495600_0001526 | 3300046809 | Bacteria | 12864 |
| 924 | Ga0495600_0001732 | 3300046809 | Bacteria | 12197 |
| 925 | Ga0495600_0034421 | 3300046809 | Bacteria | 3288 |
| 926 | Ga0495600_0079095 | 3300046809 | Bacteria | 2147 |
| 927 | Ga0495581_0000530 | 3300047315 | Bacteria | 19591 |
| 928 | Ga0495581_0014680 | 3300047315 | Bacteria | 4543 |
| 929 | Ga0495604_0002815 | 3300047317 | Bacteria | 13967 |
| 930 | Ga0495604_0165071 | 3300047317 | Bacteria | 1562 |
| 931 | Ga0495674_0000138 | 3300047319 | Bacteria | 55916 |
| 932 | Ga0495674_0001486 | 3300047319 | Bacteria | 22968 |
| 933 | Ga0495674_0069326 | 3300047319 | Bacteria | 3049 |
| 934 | Ga0495674_0090443 | 3300047319 | Bacteria | 2615 |
| 935 | Ga0495674_0119459 | 3300047319 | Bacteria | 2228 |
| 936 | Ga0495674_0273753 | 3300047319 | Bacteria | 1385 |
| 937 | Ga0495672_0019216 | 3300047320 | Bacteria | 4512 |
| 938 | Ga0495672_0034108 | 3300047320 | Bacteria | 3147 |
| 939 | Ga0495672_0046474 | 3300047320 | Bacteria | 2589 |
| 940 | Ga0495676_0045353 | 3300047321 | Bacteria | 3579 |
| 941 | Ga0495676_0095528 | 3300047321 | Bacteria | 2211 |
| 942 | Ga0495680_0011728 | 3300047322 | Bacteria | 7741 |
| 943 | Ga0495680_0061251 | 3300047322 | Bacteria | 2896 |
| 944 | Ga0495680_0085190 | 3300047322 | Bacteria | 2380 |
| 945 | Ga0495680_0130739 | 3300047322 | Bacteria | 1845 |
| 946 | Ga0495683_0027742 | 3300047323 | Bacteria | 2895 |
| 947 | Ga0495687_014951 | 3300047443 | Bacteria | 3967 |
| 948 | Ga0495675_0012926 | 3300047444 | Bacteria | 5261 |
| 949 | Ga0495675_0017016 | 3300047444 | Bacteria | 4603 |
| 950 | Ga0495675_0087339 | 3300047444 | Bacteria | 1959 |
| 951 | Ga0495684_0001215 | 3300047471 | Bacteria | 20690 |
| 952 | Ga0495684_0019302 | 3300047471 | Bacteria | 5246 |
| 953 | Ga0495684_0027385 | 3300047471 | Bacteria | 4376 |
| 954 | Ga0495684_0032837 | 3300047471 | Bacteria | 3987 |
| 955 | Ga0495684_0114104 | 3300047471 | Bacteria | 2037 |
| 956 | Ga0495686_0193125 | 3300047472 | Bacteria | 1172 |
| 957 | Ga0495593_0000345 | 3300047673 | Bacteria | 25682 |
| 958 | Ga0495602_0012463 | 3300048088 | Bacteria | 8737 |
| 959 | Ga0495602_0053861 | 3300048088 | Bacteria | 3558 |
| 960 | Ga0495614_0023407 | 3300048089 | Bacteria | 2665 |
| 961 | Ga0495615_0013853 | 3300048090 | Bacteria | 1693 |
| 962 | Ga0495615_0022097 | 3300048090 | Bacteria | 1443 |
| 963 | Ga0496100_0007042 | 3300048903 | Bacteria | 6170 |
| 964 | Ga0496100_0054311 | 3300048903 | Bacteria | 2612 |
| 965 | Ga0496100_0061728 | 3300048903 | Bacteria | 2470 |
| 966 | Ga0496101_0001619 | 3300048904 | Bacteria | 13525 |
| 967 | Ga0496101_0004213 | 3300048904 | Bacteria | 9009 |
| 968 | Ga0496101_0068477 | 3300048904 | Bacteria | 2595 |
| 969 | Ga0496101_0138739 | 3300048904 | Bacteria | 1852 |
| 970 | Ga0496101_0221241 | 3300048904 | Bacteria | 1469 |
| 971 | Ga0496102_0006904 | 3300048905 | Bacteria | 9684 |
| 972 | Ga0496102_0023343 | 3300048905 | Bacteria | 5492 |
| 973 | Ga0496103_0003429 | 3300048906 | Bacteria | 9692 |
| 974 | Ga0496103_0062407 | 3300048906 | Bacteria | 2319 |
| 975 | Ga0496103_0072235 | 3300048906 | Bacteria | 2161 |
| 976 | Ga0496104_0006123 | 3300048907 | Bacteria | 10560 |
| 977 | Ga0496104_0009040 | 3300048907 | Bacteria | 8859 |
| 978 | Ga0496104_0067046 | 3300048907 | Bacteria | 3409 |
| 979 | Ga0496104_0068763 | 3300048907 | Bacteria | 3365 |
| 980 | Ga0496104_0149939 | 3300048907 | Bacteria | 2239 |
| 981 | Ga0496105_0004225 | 3300048908 | Bacteria | 10790 |
| 982 | Ga0496105_0035275 | 3300048908 | Bacteria | 4116 |
| 983 | Ga0496105_0036082 | 3300048908 | Bacteria | 4071 |
| 984 | Ga0496105_0039020 | 3300048908 | Bacteria | 3913 |
| 985 | Ga0496105_0046279 | 3300048908 | Bacteria | 3591 |
| 986 | Ga0496106_0000587 | 3300048909 | Bacteria | 25963 |
| 987 | Ga0496106_0004983 | 3300048909 | Bacteria | 9830 |
| 988 | Ga0496106_0012623 | 3300048909 | Bacteria | 6241 |
| 989 | Ga0496106_0018998 | 3300048909 | Bacteria | 5093 |
| 990 | Ga0496106_0059119 | 3300048909 | Bacteria | 2903 |
| 991 | Ga0496106_0113223 | 3300048909 | Bacteria | 2114 |
| 992 | Ga0496107_0002981 | 3300048910 | Bacteria | 11211 |
| 993 | Ga0496107_0008057 | 3300048910 | Bacteria | 7275 |
| 994 | Ga0496107_0037062 | 3300048910 | Bacteria | 3499 |
| 995 | Ga0496108_0000517 | 3300048911 | Bacteria | 30206 |
| 996 | Ga0496108_0005354 | 3300048911 | Bacteria | 10373 |
| 997 | Ga0496108_0008243 | 3300048911 | Bacteria | 8457 |
| 998 | Ga0496108_0014716 | 3300048911 | Bacteria | 6385 |
| 999 | Ga0496108_0021192 | 3300048911 | Bacteria | 5341 |
| 1000 | Ga0496108_0024182 | 3300048911 | Bacteria | 5001 |
| 1001 | Ga0496108_0056517 | 3300048911 | Bacteria | 3297 |
| 1002 | Ga0496109_0001287 | 3300048912 | Bacteria | 20815 |
| 1003 | Ga0496109_0001899 | 3300048912 | Bacteria | 17343 |
| 1004 | Ga0496109_0003767 | 3300048912 | Bacteria | 12667 |
| 1005 | Ga0496109_0015266 | 3300048912 | Bacteria | 6687 |
| 1006 | Ga0496109_0022363 | 3300048912 | Bacteria | 5600 |
| 1007 | Ga0496109_0033944 | 3300048912 | Bacteria | 4592 |
| 1008 | Ga0496109_0042157 | 3300048912 | Bacteria | 4133 |
| 1009 | Ga0496109_0049200 | 3300048912 | Bacteria | 3837 |
| 1010 | Ga0496109_0080204 | 3300048912 | Bacteria | 3007 |
| 1011 | Ga0496109_0134155 | 3300048912 | Bacteria | 2312 |
| 1012 | Ga0496109_0168887 | 3300048912 | Bacteria | 2052 |
| 1013 | Ga0496109_0275439 | 3300048912 | Bacteria | 1585 |
| 1014 | Ga0496109_0318284 | 3300048912 | Bacteria | 1468 |
| 1015 | Ga0496110_0001638 | 3300048913 | Bacteria | 16435 |
| 1016 | Ga0496110_0018515 | 3300048913 | Bacteria | 5840 |
| 1017 | Ga0496110_0035267 | 3300048913 | Bacteria | 4339 |
| 1018 | Ga0496110_0051151 | 3300048913 | Bacteria | 3630 |
| 1019 | Ga0496110_0114130 | 3300048913 | Bacteria | 2430 |
| 1020 | Ga0496110_0139915 | 3300048913 | Bacteria | 2188 |
| 1021 | Ga0496110_0165008 | 3300048913 | Bacteria | 2008 |
| 1022 | Ga0496110_0257807 | 3300048913 | Bacteria | 1587 |
| 1023 | Ga0496110_0398155 | 3300048913 | Bacteria | 1255 |
| 1024 | Ga0496111_0001713 | 3300048914 | Bacteria | 12814 |
| 1025 | Ga0496111_0003286 | 3300048914 | Bacteria | 9989 |
| 1026 | Ga0496111_0105893 | 3300048914 | Bacteria | 2070 |
| 1027 | Ga0496111_0108437 | 3300048914 | Bacteria | 2044 |
| 1028 | Ga0496111_0123339 | 3300048914 | Bacteria | 1914 |
| 1029 | Ga0496112_0000004 | 3300048915 | Bacteria | 553294 |
| 1030 | Ga0496112_0004435 | 3300048915 | Bacteria | 11889 |
| 1031 | Ga0496112_0017567 | 3300048915 | Bacteria | 6724 |
| 1032 | Ga0496112_0022393 | 3300048915 | Bacteria | 6023 |
| 1033 | Ga0496112_0033460 | 3300048915 | Bacteria | 4997 |
| 1034 | Ga0496112_0034589 | 3300048915 | Bacteria | 4917 |
| 1035 | Ga0496112_0037988 | 3300048915 | Bacteria | 4701 |
| 1036 | Ga0496112_0048275 | 3300048915 | Bacteria | 4174 |
| 1037 | Ga0496112_0058807 | 3300048915 | Bacteria | 3786 |
| 1038 | Ga0496112_0060042 | 3300048915 | Bacteria | 3746 |
| 1039 | Ga0496112_0176529 | 3300048915 | Bacteria | 2101 |
| 1040 | Ga0496113_0002800 | 3300048916 | Bacteria | 10265 |
| 1041 | Ga0496113_0006800 | 3300048916 | Bacteria | 7289 |
| 1042 | Ga0496113_0014818 | 3300048916 | Bacteria | 5334 |
| 1043 | Ga0496113_0033117 | 3300048916 | Bacteria | 3760 |
| 1044 | Ga0496113_0060308 | 3300048916 | Bacteria | 2859 |
| 1045 | Ga0496114_0008606 | 3300048917 | Bacteria | 8086 |
| 1046 | Ga0496114_0011846 | 3300048917 | Bacteria | 6977 |
| 1047 | Ga0496114_0039109 | 3300048917 | Bacteria | 3925 |
| 1048 | Ga0496114_0083373 | 3300048917 | Bacteria | 2705 |
| 1049 | Ga0496114_0378579 | 3300048917 | Bacteria | 1253 |
| 1050 | Ga0496115_0002504 | 3300048918 | Bacteria | 13204 |
| 1051 | Ga0496115_0006400 | 3300048918 | Bacteria | 8627 |
| 1052 | Ga0496115_0021895 | 3300048918 | Bacteria | 4943 |
| 1053 | Ga0496115_0053770 | 3300048918 | Bacteria | 3232 |
| 1054 | Ga0496115_0061200 | 3300048918 | Bacteria | 3035 |
| 1055 | Ga0496115_0271458 | 3300048918 | Bacteria | 1393 |
| 1056 | Ga0496116_0028721 | 3300048919 | Bacteria | 4023 |
| 1057 | Ga0496117_0071071 | 3300048920 | Bacteria | 2334 |
| 1058 | Ga0496118_0039892 | 3300048921 | Bacteria | 3741 |
| 1059 | Ga0496119_0016774 | 3300048922 | Bacteria | 5548 |
| 1060 | Ga0496119_0048622 | 3300048922 | Bacteria | 2629 |
| 1061 | Ga0496120_0041707 | 3300048923 | Bacteria | 2686 |
| 1062 | Ga0496120_0065797 | 3300048923 | Bacteria | 2007 |
| 1063 | Ga0496121_0000458 | 3300048924 | Bacteria | 80207 |
| 1064 | Ga0496121_0001749 | 3300048924 | Bacteria | 35439 |
| 1065 | Ga0496121_0002564 | 3300048924 | Bacteria | 27512 |
| 1066 | Ga0496121_0004375 | 3300048924 | Bacteria | 19087 |
| 1067 | Ga0496121_0009926 | 3300048924 | Bacteria | 10838 |
| 1068 | Ga0496121_0017689 | 3300048924 | Bacteria | 7256 |
| 1069 | Ga0496121_0044385 | 3300048924 | Bacteria | 3835 |
| 1070 | Ga0496121_0070359 | 3300048924 | Bacteria | 2819 |
| 1071 | Ga0496121_0074115 | 3300048924 | Bacteria | 2724 |
| 1072 | Ga0496121_0132223 | 3300048924 | Bacteria | 1865 |
| 1073 | Ga0496121_0197402 | 3300048924 | Bacteria | 1437 |
| 1074 | Ga0496122_0017860 | 3300048925 | Bacteria | 6593 |
| 1075 | Ga0496122_0058303 | 3300048925 | Bacteria | 2860 |
| 1076 | Ga0496123_0088166 | 3300048926 | Bacteria | 1854 |
| 1077 | Ga0496124_0010603 | 3300048927 | Bacteria | 9314 |
| 1078 | Ga0496125_0000951 | 3300048928 | Bacteria | 45511 |
| 1079 | Ga0496125_0001462 | 3300048928 | Bacteria | 34212 |
| 1080 | Ga0496125_0002254 | 3300048928 | Bacteria | 25623 |
| 1081 | Ga0496125_0095051 | 3300048928 | Bacteria | 2218 |
| 1082 | Ga0496126_0018663 | 3300048929 | Bacteria | 6864 |
| 1083 | Ga0496126_0025235 | 3300048929 | Bacteria | 5722 |
| 1084 | Ga0496126_0040762 | 3300048929 | Bacteria | 4303 |
| 1085 | Ga0496126_0046444 | 3300048929 | Bacteria | 3983 |
| 1086 | Ga0496126_0098652 | 3300048929 | Bacteria | 2559 |
| 1087 | Ga0496126_0100548 | 3300048929 | Bacteria | 2530 |
| 1088 | Ga0496126_0120639 | 3300048929 | Bacteria | 2274 |
| 1089 | Ga0496126_0171016 | 3300048929 | Bacteria | 1851 |
| 1090 | Ga0501031_0004867 | 3300049568 | Bacteria | 8730 |
| 1091 | Ga0501031_0029474 | 3300049568 | Bacteria | 3579 |
| 1092 | Ga0501031_0036678 | 3300049568 | Bacteria | 3198 |
| 1093 | Ga0501031_0055369 | 3300049568 | Bacteria | 2584 |
| 1094 | Ga0501032_0001822 | 3300049569 | Bacteria | 16845 |
| 1095 | Ga0501032_0006705 | 3300049569 | Bacteria | 8452 |
| 1096 | Ga0501032_0061313 | 3300049569 | Bacteria | 2521 |
| 1097 | Ga0501032_0071711 | 3300049569 | Bacteria | 2308 |
| 1098 | Ga0501033_0000827 | 3300049570 | Bacteria | 28243 |
| 1099 | Ga0501033_0001583 | 3300049570 | Bacteria | 20018 |
| 1100 | Ga0501033_0014098 | 3300049570 | Bacteria | 6078 |
| 1101 | Ga0501033_0016530 | 3300049570 | Bacteria | 5585 |
| 1102 | Ga0501033_0137995 | 3300049570 | Bacteria | 1764 |
| 1103 | Ga0501034_0000032 | 3300049571 | Bacteria | 243763 |
| 1104 | Ga0501034_0002449 | 3300049571 | Bacteria | 22384 |
| 1105 | Ga0501034_0063969 | 3300049571 | Bacteria | 3693 |
| 1106 | Ga0501034_0077338 | 3300049571 | Bacteria | 3333 |
| 1107 | Ga0501034_0125024 | 3300049571 | Bacteria | 2557 |
| 1108 | Ga0501034_0126594 | 3300049571 | Bacteria | 2539 |
| 1109 | Ga0501034_0161501 | 3300049571 | Bacteria | 2211 |
| 1110 | Ga0501034_0348099 | 3300049571 | Bacteria | 1410 |
| 1111 | Ga0501036_0000149 | 3300049572 | Bacteria | 45598 |
| 1112 | Ga0501036_0000674 | 3300049572 | Bacteria | 25113 |
| 1113 | Ga0501036_0004945 | 3300049572 | Bacteria | 10773 |
| 1114 | Ga0501036_0037467 | 3300049572 | Bacteria | 4102 |
| 1115 | Ga0501036_0051485 | 3300049572 | Bacteria | 3486 |
| 1116 | Ga0501036_0063926 | 3300049572 | Bacteria | 3115 |
| 1117 | Ga0501036_0164909 | 3300049572 | Bacteria | 1868 |
| 1118 | Ga0501037_0000153 | 3300049573 | Bacteria | 64239 |
| 1119 | Ga0501037_0000888 | 3300049573 | Bacteria | 22320 |
| 1120 | Ga0501037_0007710 | 3300049573 | Bacteria | 7879 |
| 1121 | Ga0501037_0017413 | 3300049573 | Bacteria | 5291 |
| 1122 | Ga0501037_0023391 | 3300049573 | Bacteria | 4569 |
| 1123 | Ga0501037_0025967 | 3300049573 | Bacteria | 4327 |
| 1124 | Ga0501037_0051032 | 3300049573 | Bacteria | 3025 |
| 1125 | Ga0501037_0116080 | 3300049573 | Bacteria | 1926 |
| 1126 | Ga0501038_0000138 | 3300049574 | Bacteria | 62493 |
| 1127 | Ga0501038_0001121 | 3300049574 | Bacteria | 24319 |
| 1128 | Ga0501038_0009574 | 3300049574 | Bacteria | 8887 |
| 1129 | Ga0501038_0032799 | 3300049574 | Bacteria | 4578 |
| 1130 | Ga0501038_0044769 | 3300049574 | Bacteria | 3843 |
| 1131 | Ga0501038_0086561 | 3300049574 | Bacteria | 2632 |
| 1132 | Ga0501038_0125019 | 3300049574 | Bacteria | 2117 |
| 1133 | Ga0501039_0000842 | 3300049575 | Bacteria | 22166 |
| 1134 | Ga0501039_0003466 | 3300049575 | Bacteria | 11782 |
| 1135 | Ga0501039_0151491 | 3300049575 | Bacteria | 1822 |
| 1136 | Ga0501039_0158354 | 3300049575 | Bacteria | 1779 |
| 1137 | Ga0501042_0001932 | 3300049578 | Bacteria | 12476 |
| 1138 | Ga0501042_0075397 | 3300049578 | Bacteria | 2414 |
| 1139 | Ga0501043_0006630 | 3300049579 | Bacteria | 9261 |
| 1140 | Ga0501043_0008464 | 3300049579 | Bacteria | 8098 |
| 1141 | Ga0501043_0018007 | 3300049579 | Bacteria | 5540 |
| 1142 | Ga0501043_0019806 | 3300049579 | Bacteria | 5283 |
| 1143 | Ga0501043_0045301 | 3300049579 | Bacteria | 3459 |
| 1144 | Ga0501043_0094042 | 3300049579 | Bacteria | 2356 |
| 1145 | Ga0501043_0098002 | 3300049579 | Bacteria | 2304 |
| 1146 | Ga0501043_0158632 | 3300049579 | Bacteria | 1768 |
| 1147 | Ga0501046_0021327 | 3300049580 | Bacteria | 5347 |
| 1148 | Ga0501046_0029266 | 3300049580 | Bacteria | 4478 |
| 1149 | Ga0501046_0062318 | 3300049580 | Bacteria | 2914 |
| 1150 | Ga0501046_0079255 | 3300049580 | Bacteria | 2539 |
| 1151 | Ga0501046_0177177 | 3300049580 | Bacteria | 1596 |
| 1152 | Ga0501047_0000010 | 3300049581 | Bacteria | 429357 |
| 1153 | Ga0501047_0001785 | 3300049581 | Bacteria | 20809 |
| 1154 | Ga0501047_0004062 | 3300049581 | Bacteria | 13761 |
| 1155 | Ga0501047_0012519 | 3300049581 | Bacteria | 8035 |
| 1156 | Ga0501047_0048611 | 3300049581 | Bacteria | 4096 |
| 1157 | Ga0501047_0119186 | 3300049581 | Bacteria | 2521 |
| 1158 | Ga0501047_0127100 | 3300049581 | Bacteria | 2429 |
| 1159 | Ga0501047_0141576 | 3300049581 | Bacteria | 2283 |
| 1160 | Ga0501047_0201508 | 3300049581 | Bacteria | 1851 |
| 1161 | Ga0501047_0250797 | 3300049581 | Bacteria | 1618 |
| 1162 | Ga0501048_0000396 | 3300049582 | Bacteria | 30302 |
| 1163 | Ga0501048_0000653 | 3300049582 | Bacteria | 24953 |
| 1164 | Ga0501067_0019432 | 3300049583 | Bacteria | 3761 |
| 1165 | Ga0501067_0037938 | 3300049583 | Bacteria | 2676 |
| 1166 | Ga0501067_0085856 | 3300049583 | Bacteria | 1746 |
| 1167 | Ga0501068_0004084 | 3300049584 | Bacteria | 7922 |
| 1168 | Ga0501068_0020465 | 3300049584 | Bacteria | 3854 |
| 1169 | Ga0501068_0024884 | 3300049584 | Bacteria | 3518 |
| 1170 | Ga0501068_0031994 | 3300049584 | Bacteria | 3126 |
| 1171 | Ga0501068_0052257 | 3300049584 | Bacteria | 2472 |
| 1172 | Ga0501068_0083832 | 3300049584 | Bacteria | 1960 |
| 1173 | Ga0501069_0005888 | 3300049585 | Bacteria | 6388 |
| 1174 | Ga0501070_0002230 | 3300049586 | Bacteria | 17026 |
| 1175 | Ga0501070_0029990 | 3300049586 | Bacteria | 4557 |
| 1176 | Ga0501070_0031212 | 3300049586 | Bacteria | 4463 |
| 1177 | Ga0501070_0038371 | 3300049586 | Bacteria | 3996 |
| 1178 | Ga0501070_0041037 | 3300049586 | Bacteria | 3856 |
| 1179 | Ga0501070_0060813 | 3300049586 | Bacteria | 3130 |
| 1180 | Ga0501070_0086286 | 3300049586 | Bacteria | 2598 |
| 1181 | Ga0501071_0026342 | 3300049587 | Bacteria | 4080 |
| 1182 | Ga0501072_0001051 | 3300049588 | Bacteria | 20459 |
| 1183 | Ga0501072_0002565 | 3300049588 | Bacteria | 13617 |
| 1184 | Ga0501072_0066504 | 3300049588 | Bacteria | 2843 |
| 1185 | Ga0501072_0149988 | 3300049588 | Bacteria | 1859 |
| 1186 | Ga0501073_0000221 | 3300049589 | Bacteria | 37338 |
| 1187 | Ga0501073_0030234 | 3300049589 | Bacteria | 3868 |
| 1188 | Ga0501073_0035819 | 3300049589 | Bacteria | 3526 |
| 1189 | Ga0501073_0050655 | 3300049589 | Bacteria | 2910 |
| 1190 | Ga0501073_0050877 | 3300049589 | Bacteria | 2902 |
| 1191 | Ga0501073_0060342 | 3300049589 | Bacteria | 2647 |
| 1192 | Ga0501073_0082683 | 3300049589 | Bacteria | 2234 |
| 1193 | Ga0501073_0173309 | 3300049589 | Bacteria | 1493 |
| 1194 | Ga0501074_0015795 | 3300049590 | Bacteria | 5489 |
| 1195 | Ga0501074_0018904 | 3300049590 | Bacteria | 5004 |
| 1196 | Ga0501074_0054256 | 3300049590 | Bacteria | 2890 |
| 1197 | Ga0501076_0126782 | 3300049592 | Bacteria | 2069 |
| 1198 | Ga0501077_0046592 | 3300049593 | Bacteria | 2754 |
| 1199 | Ga0501079_0050115 | 3300049741 | Bacteria | 3223 |
| 1200 | Ga0501080_0003063 | 3300049742 | Bacteria | 14759 |
| 1201 | Ga0501080_0011359 | 3300049742 | Bacteria | 8154 |
| 1202 | Ga0501080_0026159 | 3300049742 | Bacteria | 5420 |
| 1203 | Ga0501080_0067483 | 3300049742 | Bacteria | 3326 |
| 1204 | Ga0501080_0071767 | 3300049742 | Bacteria | 3221 |
| 1205 | Ga0501080_0092246 | 3300049742 | Bacteria | 2813 |
| 1206 | Ga0501080_0452977 | 3300049742 | Bacteria | 1150 |
| 1207 | Ga0501083_0001423 | 3300049744 | Bacteria | 16322 |
| 1208 | Ga0501083_0008402 | 3300049744 | Bacteria | 7299 |
| 1209 | Ga0501083_0025847 | 3300049744 | Bacteria | 4064 |
| 1210 | Ga0501083_0035733 | 3300049744 | Bacteria | 3393 |
| 1211 | Ga0501083_0089514 | 3300049744 | Bacteria | 2033 |
| 1212 | Ga0501035_0001426 | 3300049822 | Bacteria | 24484 |
| 1213 | Ga0501035_0004322 | 3300049822 | Bacteria | 13496 |
| 1214 | Ga0501035_0007645 | 3300049822 | Bacteria | 10098 |
| 1215 | Ga0501035_0012953 | 3300049822 | Bacteria | 7697 |
| 1216 | Ga0501035_0045651 | 3300049822 | Bacteria | 3941 |
| 1217 | Ga0501035_0059092 | 3300049822 | Bacteria | 3414 |
| 1218 | Ga0501035_0065875 | 3300049822 | Bacteria | 3215 |
| 1219 | Ga0501035_0145794 | 3300049822 | Bacteria | 2056 |
| 1220 | Ga0501035_0163108 | 3300049822 | Bacteria | 1928 |
| 1221 | Ga0501035_0208445 | 3300049822 | Bacteria | 1673 |
| 1222 | Ga0501044_0000369 | 3300049823 | Bacteria | 56363 |
| 1223 | Ga0501044_0013258 | 3300049823 | Bacteria | 8923 |
| 1224 | Ga0501044_0013456 | 3300049823 | Bacteria | 8849 |
| 1225 | Ga0501044_0018430 | 3300049823 | Bacteria | 7479 |
| 1226 | Ga0501044_0075210 | 3300049823 | Bacteria | 3429 |
| 1227 | Ga0501044_0136215 | 3300049823 | Bacteria | 2447 |
| 1228 | Ga0501045_0064688 | 3300049824 | Bacteria | 2685 |
| 1229 | Ga0501045_0081311 | 3300049824 | Bacteria | 2389 |
| 1230 | Ga0501045_0092737 | 3300049824 | Bacteria | 2234 |
| 1231 | nmdc:mga03n38_6896_c1 | 3300050490 | Bacteria | 3985 |
| 1232 | nmdc:mga00v17_9599_c1 | 3300050491 | Bacteria | 5244 |
| 1233 | nmdc:mga0yw44_1008_c1 | 3300050492 | Bacteria | 10779 |
| 1234 | nmdc:mga0yw44_27628_c1 | 3300050492 | Bacteria | 3253 |
| 1235 | nmdc:mga0yw44_4407_c1 | 3300050492 | Bacteria | 6449 |
| 1236 | nmdc:mga0yw44_7568_c1 | 3300050492 | Bacteria | 5352 |
| 1237 | nmdc:mga0k408_41747_c1 | 3300050493 | Bacteria | 2641 |
| 1238 | nmdc:mga0k408_71478_c1 | 3300050493 | Bacteria | 2025 |
| 1239 | nmdc:mga06z11_23196_c1 | 3300050494 | Bacteria | 2911 |
| 1240 | nmdc:mga06z11_5654_c1 | 3300050494 | Bacteria | 5036 |
| 1241 | nmdc:mga04h51_53107_c1 | 3300050495 | Bacteria | 1366 |
| 1242 | nmdc:mga07m45_1367_c1 | 3300050496 | Bacteria | 11128 |
| 1243 | nmdc:mga08y16_172_c1 | 3300050511 | Bacteria | 56716 |
| 1244 | nmdc:mga08y16_55900_c1 | 3300050511 | Bacteria | 4124 |
| 1245 | nmdc:mga0n895_24014_c1 | 3300050512 | Bacteria | 5739 |
| 1246 | nmdc:mga0rr50_180782_c1 | 3300050513 | Bacteria | 1724 |
| 1247 | nmdc:mga08x19_4_c2 | 3300050514 | Bacteria | 202063 |
| 1248 | nmdc:mga08x19_89926_c1 | 3300050514 | Bacteria | 2025 |
| 1249 | nmdc:mga0sz30_8294_c1 | 3300050516 | Bacteria | 3919 |
| 1250 | Ga0495601_0002574 | 3300053077 | Bacteria | 10312 |
| 1251 | Ga0495601_0015114 | 3300053077 | Bacteria | 4662 |
| 1252 | Ga0495601_0036761 | 3300053077 | Bacteria | 3060 |
| 1253 | Ga0495601_0047852 | 3300053077 | Bacteria | 2693 |
| 1254 | Ga0495601_0054332 | 3300053077 | Bacteria | 2534 |
| 1255 | Ga0495612_0004857 | 3300053078 | Bacteria | 5566 |
| 1256 | Ga0495612_0085424 | 3300053078 | Bacteria | 1330 |
| 1257 | Ga0500610_0142077 | 3300053079 | Bacteria | 1211 |
| 1258 | Ga0500635_0027246 | 3300053080 | Bacteria | 1815 |
| 1259 | Ga0495655_0001288 | 3300053083 | Bacteria | 3860 |
| 1260 | Ga0495595_0025302 | 3300053084 | Bacteria | 2629 |
| 1261 | Ga0495595_0100767 | 3300053084 | Bacteria | 1394 |
| 1262 | Ga0495619_0000609 | 3300053085 | Bacteria | 23652 |
| 1263 | Ga0495619_0000757 | 3300053085 | Bacteria | 21079 |
| 1264 | Ga0495619_0000799 | 3300053085 | Bacteria | 20602 |
| 1265 | Ga0495619_0001114 | 3300053085 | Bacteria | 17646 |
| 1266 | Ga0495619_0026157 | 3300053085 | Bacteria | 3753 |
| 1267 | Ga0495619_0048425 | 3300053085 | Bacteria | 2800 |
| 1268 | Ga0500643_000032 | 3300053087 | Bacteria | 200350 |
| 1269 | Ga0500644_0000786 | 3300053088 | Bacteria | 10824 |
| 1270 | Ga0500647_0023164 | 3300053091 | Bacteria | 2911 |
| 1271 | Ga0500583_0048761 | 3300053092 | Bacteria | 1956 |
| 1272 | Ga0500651_0027621 | 3300053093 | Bacteria | 3569 |
| 1273 | Ga0500566_0000006 | 3300053094 | Bacteria | 153632 |
| 1274 | Ga0500566_0002123 | 3300053094 | Bacteria | 11677 |
| 1275 | Ga0500566_0011398 | 3300053094 | Bacteria | 5236 |
| 1276 | Ga0500566_0017517 | 3300053094 | Bacteria | 4210 |
| 1277 | Ga0500640_003111 | 3300053095 | Bacteria | 5688 |
| 1278 | Ga0500641_0011598 | 3300053096 | Bacteria | 3201 |
| 1279 | Ga0500650_0000167 | 3300053098 | Bacteria | 16961 |
| 1280 | Ga0500555_002027 | 3300053103 | Bacteria | 5966 |
| 1281 | Ga0500556_0000030 | 3300053104 | Bacteria | 165098 |
| 1282 | Ga0500557_000004 | 3300053105 | Bacteria | 202318 |
| 1283 | Ga0500572_000870 | 3300053111 | Bacteria | 9372 |
| 1284 | Ga0500572_001481 | 3300053111 | Bacteria | 6343 |
| 1285 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 1286 | Ga0500595_000306 | 3300053119 | Bacteria | 32239 |
| 1287 | Ga0500595_001964 | 3300053119 | Bacteria | 10563 |
| 1288 | Ga0500595_002618 | 3300053119 | Bacteria | 8762 |
| 1289 | Ga0500595_006167 | 3300053119 | Bacteria | 5129 |
| 1290 | Ga0500595_007411 | 3300053119 | Bacteria | 4553 |
| 1291 | Ga0500595_009208 | 3300053119 | Bacteria | 3996 |
| 1292 | Ga0500595_030128 | 3300053119 | Bacteria | 1832 |
| 1293 | Ga0500595_033571 | 3300053119 | Bacteria | 1702 |
| 1294 | Ga0500595_038239 | 3300053119 | Bacteria | 1560 |
| 1295 | Ga0500608_010820 | 3300053122 | Bacteria | 3933 |
| 1296 | Ga0500608_066101 | 3300053122 | Bacteria | 1724 |
| 1297 | Ga0500614_000745 | 3300053123 | Bacteria | 8292 |
| 1298 | Ga0500642_0000080 | 3300053130 | Bacteria | 52024 |
| 1299 | Ga0500642_0000302 | 3300053130 | Bacteria | 17637 |
| 1300 | Ga0500652_000003 | 3300053131 | Bacteria | 221528 |
| 1301 | Ga0500652_001787 | 3300053131 | Bacteria | 6519 |
| 1302 | Ga0500652_007383 | 3300053131 | Bacteria | 3597 |
| 1303 | Ga0500655_011446 | 3300053133 | Bacteria | 1608 |
| 1304 | Ga0500559_0000714 | 3300053136 | Bacteria | 21826 |
| 1305 | Ga0500559_0002857 | 3300053136 | Bacteria | 8726 |
| 1306 | Ga0500559_0004788 | 3300053136 | Bacteria | 6337 |
| 1307 | Ga0500568_0000001 | 3300053139 | Bacteria | 988705 |
| 1308 | Ga0500568_0000978 | 3300053139 | Bacteria | 19672 |
| 1309 | Ga0500568_0012491 | 3300053139 | Bacteria | 3903 |
| 1310 | Ga0500577_0000263 | 3300053142 | Bacteria | 13754 |
| 1311 | Ga0500586_001063 | 3300053145 | Bacteria | 5668 |
| 1312 | Ga0500590_082201 | 3300053148 | Bacteria | 1580 |
| 1313 | Ga0500603_000163 | 3300053150 | Bacteria | 16654 |
| 1314 | Ga0500603_000339 | 3300053150 | Bacteria | 12234 |
| 1315 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1316 | Ga0500616_0000252 | 3300053153 | Bacteria | 83060 |
| 1317 | Ga0500616_0000696 | 3300053153 | Bacteria | 39234 |
| 1318 | Ga0500616_0004537 | 3300053153 | Bacteria | 9843 |
| 1319 | Ga0500616_0012792 | 3300053153 | Bacteria | 4899 |
| 1320 | Ga0500616_0016773 | 3300053153 | Bacteria | 4163 |
| 1321 | Ga0500622_0003870 | 3300053156 | Bacteria | 9716 |
| 1322 | Ga0500630_000788 | 3300053159 | Bacteria | 14585 |
| 1323 | Ga0500633_0016195 | 3300053160 | Bacteria | 2158 |
| 1324 | Ga0500638_084353 | 3300053162 | Bacteria | 1505 |
| 1325 | Ga0500639_000765 | 3300053163 | Bacteria | 16347 |
| 1326 | Ga0500636_0000066 | 3300053177 | Bacteria | 51367 |
| 1327 | Ga0500636_0013143 | 3300053177 | Bacteria | 4858 |
| 1328 | Ga0500636_0015097 | 3300053177 | Bacteria | 4546 |
| 1329 | Ga0500636_0036362 | 3300053177 | Bacteria | 2915 |
| 1330 | Ga0500637_0003078 | 3300053178 | Bacteria | 7601 |
| 1331 | Ga0500637_0009851 | 3300053178 | Bacteria | 4886 |
| 1332 | Ga0500637_0074348 | 3300053178 | Bacteria | 1958 |
| 1333 | Ga0500625_043521 | 3300053729 | Bacteria | 2104 |
| 1334 | Ga0500645_000385 | 3300053730 | Bacteria | 30984 |
| 1335 | Ga0500596_004638 | 3300053735 | Bacteria | 2503 |
| 1336 | Ga0500596_005269 | 3300053735 | Bacteria | 2296 |
| 1337 | Ga0500596_005521 | 3300053735 | Bacteria | 2213 |
| 1338 | Ga0500599_001124 | 3300053736 | Bacteria | 3028 |
| 1339 | Ga0501084_0011449 | 3300054114 | Bacteria | 7345 |
| 1340 | Ga0501084_0170783 | 3300054114 | Bacteria | 1835 |
| 1341 | Ga0501084_0250095 | 3300054114 | Bacteria | 1496 |
| 1342 | Ga0501082_0000183 | 3300060353 | Bacteria | 54241 |
| 1343 | Ga0501082_0016777 | 3300060353 | Bacteria | 6306 |
| 1344 | Ga0501082_0094903 | 3300060353 | Bacteria | 2578 |
| 1345 | 2507508360 | 2507262055 | Bacteria | 8048963 |
| 1346 | 2508542435 | 2508501009 | Bacteria | 7784016 |
| 1347 | 2508691802 | 2508501042 | Bacteria | 8719808 |
| 1348 | 2509150486 | 2508501128 | Bacteria | 8613869 |
| 1349 | 2511399885 | 2511231028 | Bacteria | 8046582 |
| 1350 | 2513625090 | 2513237092 | Bacteria | 8341956 |
| 1351 | 2513645612 | 2513237095 | Bacteria | 8976980 |
| 1352 | 2513657925 | 2513237096 | Bacteria | 8722461 |
| 1353 | 2513674458 | 2513237098 | Bacteria | 9902361 |
| 1354 | 2513692809 | 2513237101 | Bacteria | 7952346 |
| 1355 | 2513706618 | 2513237102 | Bacteria | 7703324 |
| 1356 | 2513722595 | 2513237104 | Bacteria | 10034502 |
| 1357 | 2513855623 | 2513237137 | Bacteria | 9558895 |
| 1358 | 2513872985 | 2513237139 | Bacteria | 8737671 |
| 1359 | 2513894740 | 2513237141 | Bacteria | 8496279 |
| 1360 | 2513919982 | 2513237145 | Bacteria | 8979722 |
| 1361 | 2514013752 | 2513237161 | Bacteria | 8871253 |
| 1362 | 2515627138 | 2515154112 | Bacteria | 8294334 |
| 1363 | 2517102835 | 2517093001 | Bacteria | 9002274 |
| 1364 | 2517892163 | 2517572143 | Bacteria | 9484767 |
| 1365 | 2524437565 | 2524023205 | Bacteria | 8918781 |
| 1366 | 2524465733 | 2524023210 | Bacteria | 9029266 |
| 1367 | 2524534263 | 2524023228 | Bacteria | 10118060 |
| 1368 | 2528853872 | 2528768022 | Bacteria | 10457665 |
| 1369 | 2603859667 | 2602042107 | Bacteria | 6226103 |
| 1370 | 2617347156 | 2617270735 | Bacteria | 9163226 |
| 1371 | 2617375537 | 2617270741 | Bacteria | 8201522 |
| 1372 | 2644288843 | 2643221651 | Bacteria | 4798932 |
| 1373 | 2671120582 | 2667528175 | Bacteria | 7532676 |
| 1374 | 2723844833 | 2721755755 | Bacteria | 8322773 |
| 1375 | 2728753143 | 2728368998 | Bacteria | 8720350 |
| 1376 | 2745079652 | 2744054633 | Bacteria | 8678936 |
| 1377 | 2793065480 | 2791355196 | Bacteria | 7323613 |
| 1378 | 2793068759 | 2791355197 | Bacteria | 8420563 |
| 1379 | 2793082294 | |||
| 1380 | 2805915115 | 2802429603 | Bacteria | 8777136 |
| 1381 | 2818238658 | 2816332527 | Bacteria | 8933356 |
| 1382 | 2824604110 | 2824600985 | Bacteria | 8488197 |
| 1383 | 2824610379 | 2824609381 | Bacteria | 8672835 |
| 1384 | 2824617953 | 2824617872 | Bacteria | 8814715 |
| 1385 | 2824626621 | 2824626560 | Bacteria | 8813858 |
| 1386 | 2824638638 | 2824635225 | Bacteria | 8785348 |
| 1387 | 2824646106 | 2824644064 | Bacteria | 8743947 |
| 1388 | 2824668631 | 2824661429 | Bacteria | 9877870 |
| 1389 | 2824672497 | 2824671348 | Bacteria | 8369588 |
| 1390 | 2824685881 | 2824679649 | Bacteria | 8248951 |
| 1391 | 2824688947 | 2824687955 | Bacteria | 8360029 |
| 1392 | 2824716292 | 2824714736 | Bacteria | 8717648 |
| 1393 | 2824746576 | 2824746037 | Bacteria | 7911610 |
| 1394 | 2824759517 | 2824753945 | Bacteria | 9787441 |
| 1395 | 2824771732 | 2824763712 | Bacteria | 9792355 |
| 1396 | 2824775416 | 2824773399 | Bacteria | 8360218 |
| 1397 | 2838123513 | 2838122688 | Bacteria | 8803140 |
| 1398 | 2841947711 | 2841941048 | Bacteria | 8688029 |
| 1399 | 2841949615 | 2841949485 | Bacteria | 8680857 |
| 1400 | 2841964204 | 2841957949 | Bacteria | 8652217 |
| 1401 | 2841971878 | 2841966195 | Bacteria | 8673214 |
| 1402 | 2841974779 | 2841974524 | Bacteria | 8931498 |
| 1403 | 2841983663 | 2841983080 | Bacteria | 8395090 |
| 1404 | 2842040027 | 2842038055 | Bacteria | 8002051 |
| 1405 | 2842047028 | 2842045827 | Bacteria | 8006841 |
| 1406 | 2844319277 | 2844315083 | Bacteria | 8138177 |
| 1407 | 2847936438 | 2847930680 | Bacteria | 9342022 |
| 1408 | 2847946787 | 2847939898 | Bacteria | 8606328 |
| 1409 | 2849079100 | 2849076700 | Bacteria | 7039503 |
| 1410 | 2857516649 | 2857509624 | Bacteria | 7472071 |
| 1411 | 2857528935 | 2857524615 | Bacteria | 6615449 |
| 1412 | 2874598273 | 2874590934 | Bacteria | 8299676 |
| 1413 | 2874605455 | 2874604998 | Bacteria | 7834745 |
| 1414 | 2874619525 | 2874612657 | Bacteria | 8252029 |
| 1415 | 2874627580 | 2874620515 | Bacteria | 8290088 |
| 1416 | 2874632087 | 2874628541 | Bacteria | 8630250 |
| 1417 | 2874652671 | 2874645413 | Bacteria | 8214782 |
| 1418 | 2876764755 | 2876761206 | Bacteria | 10111113 |
| 1419 | 2876778249 | 2876771140 | Bacteria | 8287509 |
| 1420 | 2876814391 | 2876808645 | Bacteria | 8824342 |
| 1421 | 2876825882 | 2876818435 | Bacteria | 8274608 |
| 1422 | 2879082043 | 2879074833 | Bacteria | 8279565 |
| 1423 | 2879090220 | 2879083081 | Bacteria | 8587928 |
| 1424 | 2879104898 | 2879099564 | Bacteria | 10442239 |
| 1425 | 2879115768 | 2879110137 | Bacteria | 8907982 |
| 1426 | 2879135190 | 2879127579 | Bacteria | 8294491 |
| 1427 | 2879145451 | 2879142872 | Bacteria | 8267021 |
| 1428 | 2881368621 | 2881364244 | Bacteria | 7710352 |
| 1429 | 2881673292 | 2881665667 | Bacteria | 8175609 |
| 1430 | 2885373551 | 2885366525 | Bacteria | 8326213 |
| 1431 | 2885382740 | 2885374607 | Bacteria | 8927485 |
| 1432 | 2888384294 | 2888378607 | Bacteria | 9652610 |
| 1433 | 2888393592 | 2888388044 | Bacteria | 7304136 |
| 1434 | 2888424754 | 2888419890 | Bacteria | 7857137 |
| 1435 | 2889039539 | 2889033259 | Bacteria | 9099371 |
| 1436 | 2893070393 | 2893066018 | Bacteria | 6158120 |
| 1437 | 2903731117 | 2903727486 | Bacteria | 8281579 |
| 1438 | 2903754908 | 2903748898 | Bacteria | 9972761 |
| 1439 | 2903771783 | 2903768456 | Bacteria | 9749579 |
| 1440 | 2904673100 | 2904666416 | Bacteria | 8226587 |
| 1441 | 2904694762 | 2904690495 | Bacteria | 9412302 |
| 1442 | 2904702306 | |||
| 1443 | 2904714905 | 2904711408 | Bacteria | 9771557 |
| 1444 | 2906607374 | 2906602504 | Bacteria | 8295279 |
| 1445 | 2906617290 | |||
| 1446 | 2906631141 | 2906626472 | Bacteria | 8826946 |
| 1447 | 2906643315 | 2906635258 | Bacteria | 8601019 |
| 1448 | 2906645151 | 2906643746 | Bacteria | 8722424 |
| 1449 | 2906662555 | 2906660503 | Bacteria | 8595048 |
| 1450 | 2908742441 | 2908739725 | Bacteria | 8628932 |
| 1451 | 2908760084 | 2908756301 | Bacteria | 8864324 |
| 1452 | 2908780398 | 2908775508 | Bacteria | 8092255 |
| 1453 | 2919076335 | 2919073203 | Bacteria | 6531949 |
| 1454 | 2922365585 | 2922361189 | Bacteria | 7436256 |
| 1455 | 2922374651 | |||
| 1456 | 2922391203 | 2922386360 | Bacteria | 7017218 |
| 1457 | 2922400578 | 2922393267 | Bacteria | 8285685 |
| 1458 | 2922430534 | |||
| 1459 | 2929621745 | 2929615660 | Bacteria | 9193770 |
| 1460 | 2929629948 | 2929624759 | Bacteria | 9339455 |
| 1461 | 2932788597 | 2932784394 | Bacteria | 9704911 |
| 1462 | 2932798131 | 2932794094 | Bacteria | 7915132 |
| 1463 | 2932807013 | 2932801729 | Bacteria | 7987968 |
| 1464 | 2932817181 | 2932809354 | Bacteria | 9135765 |
| 1465 | 2932825230 | 2932818245 | Bacteria | 9955613 |
| 1466 | 2932830246 | 2932828146 | Bacteria | 9745859 |
| 1467 | 2933583979 | 2933577622 | Bacteria | 9116884 |
| 1468 | 2935609152 | 2935608549 | Bacteria | 8203142 |
| 1469 | 2935622528 | 2935616580 | Bacteria | 9032984 |
| 1470 | 2935631308 | 2935630451 | Bacteria | 8169952 |
| 1471 | 2935642133 | 2935638405 | Bacteria | 10015038 |
| 1472 | 2935651048 | 2935648319 | Bacteria | 8801166 |
| 1473 | 2935659229 | 2935656913 | Bacteria | 8965014 |
| 1474 | 2935672483 | 2935665750 | Bacteria | 9571747 |
| 1475 | 2935676053 | 2935675223 | Bacteria | 9928132 |
| 1476 | 2935686044 | 2935684952 | Bacteria | 9590419 |
| 1477 | 2935697711 | 2935694250 | Bacteria | 9291695 |
| 1478 | 2935705884 | 2935703347 | Bacteria | 10242284 |
| 1479 | 2935714596 | 2935713505 | Bacteria | 9608509 |
| 1480 | 2935725215 | 2935722832 | Bacteria | 9608746 |
| 1481 | 2935732425 | 2935732158 | Bacteria | 9706831 |
| 1482 | 2935741804 | 2935741537 | Bacteria | 9707219 |
| 1483 | 2935752009 | 2935750917 | Bacteria | 9590372 |
| 1484 | 2935765266 | 2935760218 | Bacteria | 9817913 |
| 1485 | 2935771829 | 2935769743 | Bacteria | 7878163 |
| 1486 | 2935778731 | 2935777560 | Bacteria | 8077691 |
| 1487 | 2935788880 | 2935785616 | Bacteria | 7962367 |
| 1488 | 2935795320 | 2935793552 | Bacteria | 8012592 |
| 1489 | 2935802881 | 2935801545 | Bacteria | 9301974 |
| 1490 | 2935813287 | 2935810662 | Bacteria | 9401221 |
| 1491 | 2935822312 | 2935819856 | Bacteria | 8261050 |
| 1492 | 2935830300 | 2935827899 | Bacteria | 10038562 |
| 1493 | 2935838197 | 2935837841 | Bacteria | 9454360 |
| 1494 | 2935847894 | 2935847175 | Bacteria | 8228321 |
| 1495 | 2935860777 | 2935855204 | Bacteria | 9035059 |
| 1496 | 2935872250 | 2935864058 | Bacteria | 9784707 |
| 1497 | 2935878695 | 2935873716 | Bacteria | 9632195 |
| 1498 | 2935886863 | 2935883170 | Bacteria | 7964738 |
| 1499 | 2935908887 | 2935908558 | Bacteria | 8568796 |
| 1500 | 2935919606 | 2935916978 | Bacteria | 9113783 |
| 1501 | 2935926539 | 2935926038 | Bacteria | 8601059 |
| 1502 | 2935934989 | 2935934488 | Bacteria | 8602579 |
| 1503 | 2935943439 | 2935942939 | Bacteria | 8599779 |
| 1504 | 2935951877 | 2935951376 | Bacteria | 8602333 |
| 1505 | 2935960636 | 2935959822 | Bacteria | 7869783 |
| 1506 | 2935968002 | 2935967501 | Bacteria | 8603075 |
| 1507 | 2935978631 | 2935975950 | Bacteria | 8347125 |
| 1508 | 2935987511 | 2935984226 | Bacteria | 8302647 |
| 1509 | 2935994909 | 2935992306 | Bacteria | 9802711 |
| 1510 | 2936003552 | 2936002035 | Bacteria | 9362176 |
| 1511 | 2936013644 | 2936011229 | Bacteria | 8801034 |
| 1512 | 2936022229 | 2936019824 | Bacteria | 8804134 |
| 1513 | 2936030675 | 2936028420 | Bacteria | 8965941 |
| 1514 | 2936042236 | 2936037263 | Bacteria | 9446081 |
| 1515 | 2936048488 | 2936046547 | Bacteria | 8903709 |
| 1516 | 2936058702 | 2936055302 | Bacteria | 8785755 |
| 1517 | 2940557188 | 2940556831 | Bacteria | 9590747 |
| 1518 | 2941510049 | 2941507105 | Bacteria | 8166816 |
| 1519 | 2941518864 | 2941515067 | Bacteria | 8166720 |
| 1520 | 2941525448 | 2941523033 | Bacteria | 8169134 |
| 1521 | 2941533033 | 2941531003 | Bacteria | 7653939 |
| 1522 | 2941539136 | 2941538514 | Bacteria | 9402094 |
| 1523 | 3005480446 | 3005474847 | Bacteria | 9259049 |
| 1524 | 3005484539 | 3005483717 | Bacteria | 7877331 |
| 1525 | 3005510542 | 3005506211 | Bacteria | 6943378 |
| 1526 | 3005587822 | 3005587118 | Bacteria | 7794411 |
| 1527 | 3005599459 | 3005594810 | Bacteria | 8716512 |
| 1528 | 3005715119 | 3005710791 | Bacteria | 7622528 |
| 1529 | 3005722519 | 3005718088 | Bacteria | 8283608 |
| 1530 | 8006931345 | 8006926726 | Bacteria | 6749210 |
| 1531 | 8006940438 | 8006933436 | Bacteria | 10410654 |
| 1532 | 8006967078 | 8006964411 | Bacteria | 8966052 |
| 1533 | 8006980127 | 8006973647 | Bacteria | 10679141 |
| 1534 | 8006988037 | 8006984368 | Bacteria | 9651211 |
| 1535 | 8006995763 | 8006994254 | Bacteria | 8309700 |
| 1536 | 8016522062 | 8016511872 | Bacteria | 9921665 |
| 1537 | 8016529399 | 8016522445 | Bacteria | 8156687 |
| 1538 | 8016534609 | 8016530956 | Bacteria | 8155261 |
| 1539 | 8016547833 | 8016539877 | Bacteria | 8155419 |
| 1540 | 8016554304 | 8016548790 | Bacteria | 8155074 |
| 1541 | 8016562679 | 8016557553 | Bacteria | 8154380 |
| 1542 | 8016572955 | 8016566248 | Bacteria | 8158151 |
| 1543 | 8016600460 | 8016595262 | Bacteria | 8149947 |
| 1544 | 8016610283 | 8016603502 | Bacteria | 8731218 |
| 1545 | 8016614649 | 8016613128 | Bacteria | 8794220 |
| 1546 | 8016626345 | 8016622563 | Bacteria | 7999408 |
| 1547 | 8016640087 | 8016630954 | Bacteria | 9217207 |
| 1548 | 8017063605 | 8017057580 | Bacteria | 10023680 |
| 1549 | 8019534375 | 8019530166 | Bacteria | 8155624 |
| 1550 | 8019545087 | 8019538911 | Bacteria | 7872763 |
| 1551 | 8019553434 | 8019547302 | Bacteria | 7996444 |
| 1552 | 8019556341 | 8019555841 | Bacteria | 9642137 |
| 1553 | 8019568971 | 8019565922 | Bacteria | 9639779 |
| 1554 | 8019582929 | 8019576017 | Bacteria | 10049540 |
| 1555 | 8019590726 | 8019586578 | Bacteria | 10212056 |
| 1556 | 8019600623 | 8019597564 | Bacteria | 10041141 |
| 1557 | 8019617922 | 8019608314 | Bacteria | 10042931 |
| 1558 | 8019628426 | 8019619141 | Bacteria | 9218857 |
| 1559 | 8019645523 | 8019638758 | Bacteria | 9062356 |
| 1560 | 8019658762 | 8019648815 | Bacteria | 10014479 |
| 1561 | 8019662086 | 8019659431 | Bacteria | 8577854 |
| 1562 | 8019671605 | 8019668869 | Bacteria | 8791617 |
| 1563 | 8019690301 | 8019687851 | Bacteria | 8712826 |
| 1564 | 8055746089 | 8055742211 | Bacteria | 9226248 |
| 1565 | 8056673620 | 8056673599 | Bacteria | 7871253 |
| 1566 | 8056687384 | 8056681323 | Bacteria | 8472857 |
| 1567 | 8056691291 | 8056689827 | Bacteria | 6712655 |
| 1568 | 8056968249 | 8056967851 | Bacteria | 9038162 |
| 1569 | Ga0436365_1260219 | |||
| 1570 | 2214745197 | |||
| 1571 | ARcpr5oldR_c000160 | |||
| 1572 | ARSoilYngRDRAFT_c00063 | |||
| 1573 | ARcpr5yngRDRAFT_c000034 | |||
| 1574 | ARSoilOldRDRAFT_c000147 | |||
| 1575 | JGI24737J22298_10000521 | |||
| 1576 | JGI24750J21931_1000637 | |||
| 1577 | JGI24035J26624_1000503 | |||
| 1578 | JGI24742J22300_10001833 | |||
| 1579 | JGI24751J29686_10009828 | |||
| 1580 | JGI25406J46586_10000047 | |||
| 1581 | JGI25153J46596_10000740 | |||
| 1582 | JGI25153J46596_10003653 | |||
| 1583 | JGI25160J50197_1001080 | |||
| 1584 | Ga0055531_10003612 | |||
| 1585 | Ga0065165_1025653 | |||
| 1586 | Ga0065712_10001661 | |||
| 1587 | Ga0065715_10004531 | |||
| 1588 | Ga0065715_10090446 | |||
| 1589 | Ga0070658_10059686 | |||
| 1590 | Ga0070658_10098944 | |||
| 1591 | Ga0070676_10000905 | |||
| 1592 | Ga0070683_100022201 | |||
| 1593 | Ga0070683_100089578 | |||
| 1594 | Ga0070690_100002135 | |||
| 1595 | Ga0070690_100004750 | |||
| 1596 | Ga0070670_100077822 | |||
| 1597 | Ga0070670_100096468 | |||
| 1598 | Ga0070677_10006219 | |||
| 1599 | Ga0068869_100008696 | |||
| 1600 | Ga0068869_100028213 | |||
| 1601 | Ga0070666_10005333 | |||
| 1602 | Ga0070666_10007448 | |||
| 1603 | Ga0070680_100011041 | |||
| 1604 | Ga0070680_100018350 | |||
| 1605 | Ga0070680_100162923 | |||
| 1606 | Ga0070682_100002763 | |||
| 1607 | Ga0070682_100028035 | |||
| 1608 | Ga0070682_100032890 | |||
| 1609 | Ga0068868_100009579 | |||
| 1610 | Ga0068868_100018639 | |||
| 1611 | Ga0068868_100031028 | |||
| 1612 | Ga0068868_100276285 | |||
| 1613 | Ga0070660_100000985 | |||
| 1614 | Ga0070660_100026110 | |||
| 1615 | Ga0070660_100035104 | |||
| 1616 | Ga0070660_100049723 | |||
| 1617 | Ga0070689_100010818 | |||
| 1618 | Ga0070689_100049462 | |||
| 1619 | Ga0070689_100067341 | |||
| 1620 | Ga0070689_100092019 | |||
| 1621 | Ga0070689_100109297 | |||
| 1622 | Ga0070691_10000060 | |||
| 1623 | Ga0070687_100001608 | |||
| 1624 | Ga0070687_100087956 | |||
| 1625 | Ga0070661_100024705 | |||
| 1626 | Ga0070661_100141724 | |||
| 1627 | Ga0070692_10002122 | |||
| 1628 | Ga0070692_10019414 | |||
| 1629 | Ga0070668_100004462 | |||
| 1630 | Ga0070668_100020450 | |||
| 1631 | Ga0070669_100001173 | |||
| 1632 | Ga0070675_100008084 | |||
| 1633 | Ga0070675_100025493 | |||
| 1634 | Ga0070675_100073782 | |||
| 1635 | Ga0070671_100000349 | |||
| 1636 | Ga0070671_100098641 | |||
| 1637 | Ga0070671_100201469 | |||
| 1638 | Ga0070674_100013947 | |||
| 1639 | Ga0070674_100032577 | |||
| 1640 | Ga0070674_100047762 | |||
| 1641 | Ga0070674_100064813 | |||
| 1642 | Ga0070673_100007101 | |||
| 1643 | Ga0070673_100055829 | |||
| 1644 | Ga0070673_100153399 | |||
| 1645 | Ga0070688_100000475 | |||
| 1646 | Ga0070688_100005391 | |||
| 1647 | Ga0070688_100013195 | |||
| 1648 | Ga0070659_100006503 | |||
| 1649 | Ga0070667_100000810 | |||
| 1650 | Ga0070667_100009653 | |||
| 1651 | Ga0070667_100015010 | |||
| 1652 | Ga0070667_100148326 | |||
| 1653 | Ga0070703_10007949 | |||
| 1654 | Ga0070709_10011165 | |||
| 1655 | Ga0070709_10021489 | |||
| 1656 | Ga0070709_10029765 | |||
| 1657 | Ga0070709_10068774 | |||
| 1658 | Ga0070714_100048569 | |||
| 1659 | Ga0070714_100051098 | |||
| 1660 | Ga0070714_100102147 | |||
| 1661 | Ga0070714_100111893 | |||
| 1662 | Ga0070714_100257729 | |||
| 1663 | Ga0070713_100012585 | |||
| 1664 | Ga0070713_100028354 | |||
| 1665 | Ga0070713_100029886 | |||
| 1666 | Ga0070713_100046807 | |||
| 1667 | Ga0070710_10001849 | |||
| 1668 | Ga0070710_10127488 | |||
| 1669 | Ga0070701_10005299 | |||
| 1670 | Ga0070701_10009325 | |||
| 1671 | Ga0070711_100020708 | |||
| 1672 | Ga0070711_100063443 | |||
| 1673 | Ga0070705_100015365 | |||
| 1674 | Ga0070700_100000664 | |||
| 1675 | Ga0070700_100032022 | |||
| 1676 | Ga0070700_100070960 | |||
| 1677 | Ga0070700_100116164 | |||
| 1678 | Ga0070694_100005788 | |||
| 1679 | Ga0070663_100003715 | |||
| 1680 | Ga0070663_100025035 | |||
| 1681 | Ga0070663_100034160 | |||
| 1682 | Ga0070663_100105892 | |||
| 1683 | Ga0070678_100003479 | |||
| 1684 | Ga0070678_100033155 | |||
| 1685 | Ga0070678_100038499 | |||
| 1686 | Ga0070678_100046523 | |||
| 1687 | Ga0070662_100005798 | |||
| 1688 | Ga0070662_100007680 | |||
| 1689 | Ga0070662_100086845 | |||
| 1690 | Ga0070681_10015477 | |||
| 1691 | Ga0070681_10021129 | |||
| 1692 | Ga0070681_10040444 | |||
| 1693 | Ga0070681_10115998 | |||
| 1694 | Ga0070681_10258209 | |||
| 1695 | Ga0068867_100002762 | |||
| 1696 | Ga0068867_100110168 | |||
| 1697 | Ga0068867_100118206 | |||
| 1698 | Ga0070685_10004766 | |||
| 1699 | Ga0070685_10009588 | |||
| 1700 | Ga0070679_100015288 | |||
| 1701 | Ga0070679_100029125 | |||
| 1702 | Ga0070679_100050504 | |||
| 1703 | Ga0070679_100062725 | |||
| 1704 | Ga0070679_100141517 | |||
| 1705 | Ga0070679_100148690 | |||
| 1706 | Ga0070679_100161968 | |||
| 1707 | Ga0070679_100188559 | |||
| 1708 | Ga0070684_100000464 | |||
| 1709 | Ga0070684_100010906 | |||
| 1710 | Ga0070684_100012560 | |||
| 1711 | Ga0070684_100026872 | |||
| 1712 | Ga0070697_100086517 | |||
| 1713 | Ga0068853_100003829 | |||
| 1714 | Ga0068853_100025347 | |||
| 1715 | Ga0068853_100073806 | |||
| 1716 | Ga0068853_100095505 | |||
| 1717 | Ga0070672_100145150 | |||
| 1718 | Ga0070672_100148853 | |||
| 1719 | Ga0070686_100001439 | |||
| 1720 | Ga0070686_100016485 | |||
| 1721 | Ga0070686_100044137 | |||
| 1722 | Ga0070686_100048141 | |||
| 1723 | Ga0070686_100063471 | |||
| 1724 | Ga0070695_100001320 | |||
| 1725 | Ga0070695_100001619 | |||
| 1726 | Ga0070695_100008441 | |||
| 1727 | Ga0070696_100011085 | |||
| 1728 | Ga0070693_100000266 | |||
| 1729 | Ga0070665_100083382 | |||
| 1730 | Ga0070665_100104524 | |||
| 1731 | Ga0070665_100147673 | |||
| 1732 | Ga0070665_100221489 | |||
| 1733 | Ga0070704_100001701 | |||
| 1734 | Ga0070704_100002112 | |||
| 1735 | Ga0068855_100034429 | |||
| 1736 | Ga0068855_100034770 | |||
| 1737 | Ga0068855_100059531 | |||
| 1738 | Ga0068855_100160757 | |||
| 1739 | Ga0068855_100208295 | |||
| 1740 | Ga0068855_100209137 | |||
| 1741 | Ga0068855_100277971 | |||
| 1742 | Ga0070664_100012689 | |||
| 1743 | Ga0070664_100155908 | |||
| 1744 | Ga0068857_100006833 | |||
| 1745 | Ga0068857_100049167 | |||
| 1746 | Ga0068854_100005898 | |||
| 1747 | Ga0068854_100024241 | |||
| 1748 | Ga0068856_100000020 | |||
| 1749 | Ga0068856_100149477 | |||
| 1750 | Ga0070702_100004216 | |||
| 1751 | Ga0068852_100005120 | |||
| 1752 | Ga0068852_100007306 | |||
| 1753 | Ga0068852_100015569 | |||
| 1754 | Ga0068852_100015717 | |||
| 1755 | Ga0068852_100042670 | |||
| 1756 | Ga0068852_100081153 | |||
| 1757 | Ga0068859_100013817 | |||
| 1758 | Ga0068859_100037907 | |||
| 1759 | Ga0068859_100046985 | |||
| 1760 | Ga0068859_100077641 | |||
| 1761 | Ga0068864_100019484 | |||
| 1762 | Ga0068864_100046630 | |||
| 1763 | Ga0068864_100129170 | |||
| 1764 | Ga0068864_100262673 | |||
| 1765 | Ga0068866_10000694 | |||
| 1766 | Ga0068866_10029627 | |||
| 1767 | Ga0068861_100013181 | |||
| 1768 | Ga0068861_100023990 | |||
| 1769 | Ga0068861_100110233 | |||
| 1770 | Ga0068870_10009104 | |||
| 1771 | Ga0068863_100001201 | |||
| 1772 | Ga0068863_100007995 | |||
| 1773 | Ga0068863_100076014 | |||
| 1774 | Ga0068858_100016234 | |||
| 1775 | Ga0068858_100023790 | |||
| 1776 | Ga0068858_100051014 | |||
| 1777 | Ga0068858_100067510 | |||
| 1778 | Ga0068860_100001359 | |||
| 1779 | Ga0068860_100001708 | |||
| 1780 | Ga0068860_100024209 | |||
| 1781 | Ga0068860_100081370 | |||
| 1782 | Ga0068860_100132560 | |||
| 1783 | Ga0068862_100005931 | |||
| 1784 | Ga0068862_100042098 | |||
| 1785 | Ga0068862_100058981 | |||
| 1786 | Ga0081455_10000009 | |||
| 1787 | Ga0081455_10006680 | |||
| 1788 | Ga0081455_10030306 | |||
| 1789 | Ga0081455_10096354 | |||
| 1790 | Ga0081540_1000143 | |||
| 1791 | Ga0081540_1002154 | |||
| 1792 | Ga0081540_1002625 | |||
| 1793 | Ga0081540_1003015 | |||
| 1794 | Ga0081540_1005422 | |||
| 1795 | Ga0081540_1006906 | |||
| 1796 | Ga0081540_1011009 | |||
| 1797 | Ga0081540_1016111 | |||
| 1798 | Ga0081540_1023632 | |||
| 1799 | Ga0081540_1028760 | |||
| 1800 | Ga0081539_10000140 | |||
| 1801 | Ga0081539_10002339 | |||
| 1802 | Ga0081539_10018773 | |||
| 1803 | Ga0070717_10001862 | |||
| 1804 | Ga0070717_10045194 | |||
| 1805 | Ga0075365_10041177 | |||
| 1806 | Ga0075365_10127397 | |||
| 1807 | Ga0075368_10014162 | |||
| 1808 | Ga0075363_100004915 | |||
| 1809 | Ga0075363_100046915 | |||
| 1810 | Ga0075364_10024537 | |||
| 1811 | Ga0070715_10003038 | |||
| 1812 | Ga0070715_10012125 | |||
| 1813 | Ga0070715_10065946 | |||
| 1814 | Ga0070716_100003599 | |||
| 1815 | Ga0070712_100004909 | |||
| 1816 | Ga0070712_100027618 | |||
| 1817 | Ga0070712_100029025 | |||
| 1818 | Ga0070712_100048375 | |||
| 1819 | Ga0070712_100061706 | |||
| 1820 | Ga0070712_100220162 | |||
| 1821 | Ga0075362_10003689 | |||
| 1822 | Ga0075362_10025532 | |||
| 1823 | Ga0075362_10036285 | |||
| 1824 | Ga0075367_10005474 | |||
| 1825 | Ga0075367_10018220 | |||
| 1826 | Ga0075367_10026576 | |||
| 1827 | Ga0075369_10045777 | |||
| 1828 | Ga0075366_10059614 | |||
| 1829 | Ga0097621_100001359 | |||
| 1830 | Ga0097621_100085119 | |||
| 1831 | Ga0075370_10047579 | |||
| 1832 | Ga0075370_10075879 | |||
| 1833 | Ga0075370_10103009 | |||
| 1834 | Ga0068871_100003508 | |||
| 1835 | Ga0068871_100081780 | |||
| 1836 | Ga0075430_100000244 | |||
| 1837 | Ga0075434_100026091 | |||
| 1838 | Ga0075434_100097339 | |||
| 1839 | Ga0068865_100001830 | |||
| 1840 | Ga0068865_100025798 | |||
| 1841 | Ga0068865_100079400 | |||
| 1842 | Ga0075436_100004211 | |||
| 1843 | Ga0075436_100031832 | |||
| 1844 | Ga0097620_100013818 | |||
| 1845 | Ga0097620_100037906 | |||
| 1846 | Ga0097620_100046986 | |||
| 1847 | Ga0097620_100077644 | |||
| 1848 | Ga0099824_1007930 | |||
| 1849 | Ga0099824_1015115 | |||
| 1850 | Ga0075435_100013273 | |||
| 1851 | Ga0075435_100191542 | |||
| 1852 | Ga0099795_10025171 | |||
| 1853 | Ga0105250_10045953 | |||
| 1854 | Ga0105240_10017915 | |||
| 1855 | Ga0105240_10038025 | |||
| 1856 | Ga0105240_10045568 | |||
| 1857 | Ga0105240_10047264 | |||
| 1858 | Ga0105240_10073684 | |||
| 1859 | Ga0105240_10173056 | |||
| 1860 | Ga0105240_10275619 | |||
| 1861 | Ga0111539_10000173 | |||
| 1862 | Ga0111539_10018558 | |||
| 1863 | Ga0111539_10078446 | |||
| 1864 | Ga0111539_10084268 | |||
| 1865 | Ga0111539_10087823 | |||
| 1866 | Ga0111539_10186184 | |||
| 1867 | Ga0105245_10003312 | |||
| 1868 | Ga0105245_10021446 | |||
| 1869 | Ga0105245_10106651 | |||
| 1870 | Ga0105247_10024725 | |||
| 1871 | Ga0105247_10026306 | |||
| 1872 | Ga0114129_10187696 | |||
| 1873 | Ga0114129_10354797 | |||
| 1874 | Ga0105243_10011575 | |||
| 1875 | Ga0105243_10130437 | |||
| 1876 | Ga0105241_10009656 | |||
| 1877 | Ga0105241_10126238 | |||
| 1878 | Ga0105242_10000399 | |||
| 1879 | Ga0105242_10033580 | |||
| 1880 | Ga0105242_10163493 | |||
| 1881 | Ga0105248_10013945 | |||
| 1882 | Ga0105248_10032551 | |||
| 1883 | Ga0105248_10235723 | |||
| 1884 | Ga0105248_10241572 | |||
| 1885 | Ga0105248_10283693 | |||
| 1886 | Ga0105237_10034867 | |||
| 1887 | Ga0105237_10062673 | |||
| 1888 | Ga0105237_10184625 | |||
| 1889 | Ga0105237_10386896 | |||
| 1890 | Ga0105238_10008599 | |||
| 1891 | Ga0105238_10018493 | |||
| 1892 | Ga0105238_10072194 | |||
| 1893 | Ga0105238_10082718 | |||
| 1894 | Ga0105238_10145210 | |||
| 1895 | Ga0105249_10029823 | |||
| 1896 | Ga0105239_10067902 | |||
| 1897 | Ga0105239_10080663 | |||
| 1898 | Ga0105239_10082676 | |||
| 1899 | Ga0105239_10108616 | |||
| 1900 | Ga0105239_10201369 | |||
| 1901 | Ga0105239_10279979 | |||
| 1902 | Ga0105246_10000033 | |||
| 1903 | Ga0105246_10023862 | |||
| 1904 | Ga0157373_10005894 | |||
| 1905 | Ga0157371_10031668 | |||
| 1906 | Ga0157370_10128904 | |||
| 1907 | Ga0157370_10186971 | |||
| 1908 | Ga0157369_10010862 | |||
| 1909 | Ga0157369_10088464 | |||
| 1910 | Ga0157369_10097519 | |||
| 1911 | Ga0157374_10018913 | |||
| 1912 | Ga0157374_10087148 | |||
| 1913 | Ga0157378_10009284 | |||
| 1914 | Ga0157378_10057957 | |||
| 1915 | Ga0157378_10073594 | |||
| 1916 | Ga0163162_10007926 | |||
| 1917 | Ga0163162_10049822 | |||
| 1918 | Ga0163162_10126869 | |||
| 1919 | Ga0163162_10312021 | |||
| 1920 | Ga0157372_10001162 | |||
| 1921 | Ga0157372_10067851 | |||
| 1922 | Ga0157372_10154780 | |||
| 1923 | Ga0157375_10018904 | |||
| 1924 | Ga0157375_10021748 | |||
| 1925 | Ga0157375_10033246 | |||
| 1926 | Ga0157375_10141304 | |||
| 1927 | Ga0157375_10321881 | |||
| 1928 | Ga0163163_10001787 | |||
| 1929 | Ga0163163_10060072 | |||
| 1930 | Ga0163163_10098726 | |||
| 1931 | Ga0163163_10152441 | |||
| 1932 | Ga0157380_10064729 | |||
| 1933 | Ga0157377_10000740 | |||
| 1934 | Ga0157377_10024449 | |||
| 1935 | Ga0157379_10003378 | |||
| 1936 | Ga0157379_10097715 | |||
| 1937 | Ga0157376_10005599 | |||
| 1938 | Ga0157376_10229775 | |||
| 1939 | Ga0163161_10008117 | |||
| 1940 | Ga0163161_10008394 | |||
| 1941 | Ga0206356_10558017 | |||
| 1942 | Ga0214544_1000002 | |||
| 1943 | Ga0214542_1000001 | |||
| 1944 | Ga0214545_1000001 | |||
| 1945 | Ga0214543_1000001 | |||
| 1946 | Ga0213872_10023205 | |||
| 1947 | Ga0213876_10009439 | |||
| 1948 | Ga0213876_10056797 | |||
| 1949 | Ga0213875_10000007 | |||
| 1950 | Ga0209677_102829 | |||
| 1951 | Ga0209148_1000428 | |||
| 1952 | Ga0209233_1000804 | |||
| 1953 | Ga0209233_1006202 | |||
| 1954 | Ga0209233_1008608 | |||
| 1955 | Ga0207666_1000006 | |||
| 1956 | Ga0207666_1001276 | |||
| 1957 | Ga0209455_1002286 | |||
| 1958 | Ga0207673_1000712 | |||
| 1959 | Ga0209564_1001578 | |||
| 1960 | Ga0209564_1003479 | |||
| 1961 | Ga0209564_1026529 | |||
| 1962 | Ga0209758_1000140 | |||
| 1963 | Ga0209758_1000321 | |||
| 1964 | Ga0209758_1001092 | |||
| 1965 | Ga0209758_1001514 | |||
| 1966 | Ga0209758_1001968 | |||
| 1967 | Ga0209758_1002659 | |||
| 1968 | Ga0209758_1003492 | |||
| 1969 | Ga0209758_1008964 | |||
| 1970 | Ga0209758_1017349 | |||
| 1971 | Ga0209256_1005434 | |||
| 1972 | Ga0207426_1000278 | |||
| 1973 | Ga0207426_1000378 | |||
| 1974 | Ga0207426_1002170 | |||
| 1975 | Ga0207426_1018412 | |||
| 1976 | Ga0207426_1023520 | |||
| 1977 | Ga0209257_1000522 | |||
| 1978 | Ga0207697_10000009 | |||
| 1979 | Ga0207697_10004408 | |||
| 1980 | Ga0207656_10012199 | |||
| 1981 | Ga0207653_10036515 | |||
| 1982 | Ga0207682_10000301 | |||
| 1983 | Ga0207692_10000849 | |||
| 1984 | Ga0207692_10006397 | |||
| 1985 | Ga0207692_10017678 | |||
| 1986 | Ga0207692_10034555 | |||
| 1987 | Ga0207642_10043027 | |||
| 1988 | Ga0207710_10018364 | |||
| 1989 | Ga0207688_10000012 | |||
| 1990 | Ga0207688_10000263 | |||
| 1991 | Ga0207688_10041797 | |||
| 1992 | Ga0207680_10007512 | |||
| 1993 | Ga0207680_10020383 | |||
| 1994 | Ga0207680_10029543 | |||
| 1995 | Ga0207647_10002921 | |||
| 1996 | Ga0207647_10006251 | |||
| 1997 | Ga0207647_10033866 | |||
| 1998 | Ga0207685_10004719 | |||
| 1999 | Ga0207699_10007610 | |||
| 2000 | Ga0207699_10017739 | |||
| 2001 | Ga0207699_10025811 | |||
| 2002 | Ga0207645_10000124 | |||
| 2003 | Ga0207645_10022280 | |||
| 2004 | Ga0207645_10056703 | |||
| 2005 | Ga0207645_10086454 | |||
| 2006 | Ga0207643_10000046 | |||
| 2007 | Ga0207643_10000889 | |||
| 2008 | Ga0207705_10075165 | |||
| 2009 | Ga0207705_10115555 | |||
| 2010 | Ga0207684_10003987 | |||
| 2011 | Ga0207684_10133715 | |||
| 2012 | Ga0207654_10004889 | |||
| 2013 | Ga0207654_10015528 | |||
| 2014 | Ga0207707_10009522 | |||
| 2015 | Ga0207707_10011411 | |||
| 2016 | Ga0207707_10024737 | |||
| 2017 | Ga0207707_10027011 | |||
| 2018 | Ga0207707_10033774 | |||
| 2019 | Ga0207707_10059952 | |||
| 2020 | Ga0207707_10294682 | |||
| 2021 | Ga0207695_10000008 | |||
| 2022 | Ga0207695_10008039 | |||
| 2023 | Ga0207695_10081943 | |||
| 2024 | Ga0207695_10120229 | |||
| 2025 | Ga0207671_10007118 | |||
| 2026 | Ga0207671_10044503 | |||
| 2027 | Ga0207671_10120545 | |||
| 2028 | Ga0207693_10001080 | |||
| 2029 | Ga0207693_10001875 | |||
| 2030 | Ga0207693_10007332 | |||
| 2031 | Ga0207693_10018304 | |||
| 2032 | Ga0207693_10050341 | |||
| 2033 | Ga0207693_10055325 | |||
| 2034 | Ga0207693_10174151 | |||
| 2035 | Ga0207663_10000347 | |||
| 2036 | Ga0207663_10010022 | |||
| 2037 | Ga0207663_10021116 | |||
| 2038 | Ga0207663_10143834 | |||
| 2039 | Ga0207660_10071085 | |||
| 2040 | Ga0207660_10109729 | |||
| 2041 | Ga0207660_10133279 | |||
| 2042 | Ga0207660_10160578 | |||
| 2043 | Ga0207662_10000154 | |||
| 2044 | Ga0207662_10000222 | |||
| 2045 | Ga0207662_10032507 | |||
| 2046 | Ga0207662_10144063 | |||
| 2047 | Ga0207657_10000162 | |||
| 2048 | Ga0207657_10030200 | |||
| 2049 | Ga0207657_10060302 | |||
| 2050 | Ga0207657_10071568 | |||
| 2051 | Ga0207657_10152882 | |||
| 2052 | Ga0207649_10000798 | |||
| 2053 | Ga0207652_10021470 | |||
| 2054 | Ga0207652_10045919 | |||
| 2055 | Ga0207652_10117589 | |||
| 2056 | Ga0207652_10122151 | |||
| 2057 | Ga0207652_10308076 | |||
| 2058 | Ga0207681_10007488 | |||
| 2059 | Ga0207681_10094623 | |||
| 2060 | Ga0207694_10018170 | |||
| 2061 | Ga0207694_10048738 | |||
| 2062 | Ga0207650_10054665 | |||
| 2063 | Ga0207659_10000762 | |||
| 2064 | Ga0207659_10140306 | |||
| 2065 | Ga0207659_10199744 | |||
| 2066 | Ga0207687_10008325 | |||
| 2067 | Ga0207687_10023134 | |||
| 2068 | Ga0207687_10131080 | |||
| 2069 | Ga0207700_10000290 | |||
| 2070 | Ga0207700_10078975 | |||
| 2071 | Ga0207700_10082443 | |||
| 2072 | Ga0207700_10102014 | |||
| 2073 | Ga0207700_10178814 | |||
| 2074 | Ga0207664_10010393 | |||
| 2075 | Ga0207664_10011397 | |||
| 2076 | Ga0207664_10029434 | |||
| 2077 | Ga0207664_10096420 | |||
| 2078 | Ga0207664_10097259 | |||
| 2079 | Ga0207644_10024576 | |||
| 2080 | Ga0207644_10056409 | |||
| 2081 | Ga0207690_10006396 | |||
| 2082 | Ga0207690_10100607 | |||
| 2083 | Ga0207706_10000929 | |||
| 2084 | Ga0207706_10020484 | |||
| 2085 | Ga0207706_10155385 | |||
| 2086 | Ga0207686_10084159 | |||
| 2087 | Ga0207686_10090123 | |||
| 2088 | Ga0207709_10000256 | |||
| 2089 | Ga0207709_10106054 | |||
| 2090 | Ga0207670_10003293 | |||
| 2091 | Ga0207670_10010584 | |||
| 2092 | Ga0207670_10020290 | |||
| 2093 | Ga0207670_10066843 | |||
| 2094 | Ga0207669_10001769 | |||
| 2095 | Ga0207669_10045983 | |||
| 2096 | Ga0207669_10051306 | |||
| 2097 | Ga0207669_10078648 | |||
| 2098 | Ga0207669_10096367 | |||
| 2099 | Ga0207669_10109797 | |||
| 2100 | Ga0207704_10021960 | |||
| 2101 | Ga0207704_10037137 | |||
| 2102 | Ga0207665_10000719 | |||
| 2103 | Ga0207665_10043622 | |||
| 2104 | Ga0207665_10105306 | |||
| 2105 | Ga0207691_10006340 | |||
| 2106 | Ga0207691_10006425 | |||
| 2107 | Ga0207691_10015435 | |||
| 2108 | Ga0207691_10118759 | |||
| 2109 | Ga0207711_10036622 | |||
| 2110 | Ga0207711_10053917 | |||
| 2111 | Ga0207711_10182249 | |||
| 2112 | Ga0207689_10000109 | |||
| 2113 | Ga0207689_10031109 | |||
| 2114 | Ga0207689_10051147 | |||
| 2115 | Ga0207689_10052656 | |||
| 2116 | Ga0207661_10001655 | |||
| 2117 | Ga0207661_10006709 | |||
| 2118 | Ga0207661_10093766 | |||
| 2119 | Ga0207661_10096435 | |||
| 2120 | Ga0207661_10115604 | |||
| 2121 | Ga0207661_10148070 | |||
| 2122 | Ga0207679_10000763 | |||
| 2123 | Ga0207679_10027676 | |||
| 2124 | Ga0207679_10039187 | |||
| 2125 | Ga0207679_10210571 | |||
| 2126 | Ga0207667_10021843 | |||
| 2127 | Ga0207667_10034067 | |||
| 2128 | Ga0207667_10109822 | |||
| 2129 | Ga0207667_10119538 | |||
| 2130 | Ga0207667_10123233 | |||
| 2131 | Ga0207667_10164754 | |||
| 2132 | Ga0207667_10170068 | |||
| 2133 | Ga0207651_10000900 | |||
| 2134 | Ga0207651_10004250 | |||
| 2135 | Ga0207651_10130307 | |||
| 2136 | Ga0207712_10010883 | |||
| 2137 | Ga0207712_10022037 | |||
| 2138 | Ga0207712_10030069 | |||
| 2139 | Ga0207712_10040854 | |||
| 2140 | Ga0207668_10015835 | |||
| 2141 | Ga0207668_10030283 | |||
| 2142 | Ga0207640_10004377 | |||
| 2143 | Ga0207658_10018594 | |||
| 2144 | Ga0207658_10034145 | |||
| 2145 | Ga0207677_10007601 | |||
| 2146 | Ga0207677_10010239 | |||
| 2147 | Ga0207677_10011127 | |||
| 2148 | Ga0207703_10012561 | |||
| 2149 | Ga0207703_10013883 | |||
| 2150 | Ga0207703_10028301 | |||
| 2151 | Ga0207703_10060311 | |||
| 2152 | Ga0207639_10039190 | |||
| 2153 | Ga0207639_10053845 | |||
| 2154 | Ga0207639_10195327 | |||
| 2155 | Ga0207678_10004447 | |||
| 2156 | Ga0207678_10006545 | |||
| 2157 | Ga0207678_10008261 | |||
| 2158 | Ga0207678_10029694 | |||
| 2159 | Ga0207678_10034437 | |||
| 2160 | Ga0207678_10056317 | |||
| 2161 | Ga0207708_10000098 | |||
| 2162 | Ga0207708_10002092 | |||
| 2163 | Ga0207708_10006322 | |||
| 2164 | Ga0207708_10012533 | |||
| 2165 | Ga0207708_10109972 | |||
| 2166 | Ga0207702_10000002 | |||
| 2167 | Ga0207702_10002142 | |||
| 2168 | Ga0207702_10114296 | |||
| 2169 | Ga0207702_10115998 | |||
| 2170 | Ga0207641_10038224 | |||
| 2171 | Ga0207641_10135346 | |||
| 2172 | Ga0207641_10150619 | |||
| 2173 | Ga0207648_10001639 | |||
| 2174 | Ga0207648_10002003 | |||
| 2175 | Ga0207648_10010667 | |||
| 2176 | Ga0207648_10059959 | |||
| 2177 | Ga0207676_10017955 | |||
| 2178 | Ga0207676_10031583 | |||
| 2179 | Ga0207676_10095444 | |||
| 2180 | Ga0207674_10000420 | |||
| 2181 | Ga0207674_10003611 | |||
| 2182 | Ga0207674_10033144 | |||
| 2183 | Ga0207674_10044894 | |||
| 2184 | Ga0207675_100002543 | |||
| 2185 | Ga0207675_100008008 | |||
| 2186 | Ga0207675_100124538 | |||
| 2187 | Ga0207675_100196290 | |||
| 2188 | Ga0207683_10000004 | |||
| 2189 | Ga0207683_10001293 | |||
| 2190 | Ga0207683_10015556 | |||
| 2191 | Ga0207683_10020374 | |||
| 2192 | Ga0207683_10035723 | |||
| 2193 | Ga0207698_10004120 | |||
| 2194 | Ga0207698_10017188 | |||
| 2195 | Ga0209389_1000032 | |||
| 2196 | Ga0209389_1000995 | |||
| 2197 | Ga0209589_1000001 | |||
| 2198 | Ga0209589_1000211 | |||
| 2199 | Ga0209489_100001 | |||
| 2200 | Ga0209489_100006 | |||
| 2201 | Ga0209489_111765 | |||
| 2202 | Ga0209700_100001 | |||
| 2203 | Ga0209700_100005 | |||
| 2204 | Ga0209966_1001208 | |||
| 2205 | Ga0209998_10002107 | |||
| 2206 | Ga0209998_10003369 | |||
| 2207 | Ga0209974_10009223 | |||
| 2208 | Ga0207428_10000303 | |||
| 2209 | Ga0207428_10019216 | |||
| 2210 | Ga0268266_10044379 | |||
| 2211 | Ga0268266_10047490 | |||
| 2212 | Ga0268266_10056381 | |||
| 2213 | Ga0268265_10012335 | |||
| 2214 | Ga0268264_10000149 | |||
| 2215 | Ga0268264_10073523 | |||
| 2216 | Ga0268264_10102135 | |||
| 2217 | Ga0268264_10198647 | |||
| 2218 | Ga0268264_10226639 | |||
| 2219 | Ga0265337_1000539 | |||
| 2220 | Ga0265334_10045848 | |||
| 2221 | Ga0265318_10012129 | |||
| 2222 | Ga0265336_10013212 | |||
| 2223 | Ga0307517_10000249 | |||
| 2224 | Ga0307515_10050561 | |||
| 2225 | Ga0265338_10000665 | |||
| 2226 | Ga0265338_10010360 | |||
| 2227 | Ga0265338_10085175 | |||
| 2228 | Ga0265330_10012435 | |||
| 2229 | Ga0265332_10001409 | |||
| 2230 | Ga0265320_10011080 | |||
| 2231 | Ga0265325_10000603 | |||
| 2232 | Ga0265325_10008234 | |||
| 2233 | Ga0265325_10055536 | |||
| 2234 | Ga0265340_10011380 | |||
| 2235 | Ga0265340_10011777 | |||
| 2236 | Ga0265340_10023020 | |||
| 2237 | Ga0265339_10000465 | |||
| 2238 | Ga0265339_10016860 | |||
| 2239 | Ga0265339_10036117 | |||
| 2240 | Ga0265339_10048704 | |||
| 2241 | Ga0265339_10086086 | |||
| 2242 | Ga0265331_10025769 | |||
| 2243 | Ga0265331_10029591 | |||
| 2244 | Ga0307509_10004311 | |||
| 2245 | Ga0307408_100024489 | |||
| 2246 | Ga0265313_10000006 | |||
| 2247 | Ga0265313_10010630 | |||
| 2248 | Ga0307508_10000018 | |||
| 2249 | Ga0307508_10109943 | |||
| 2250 | Ga0265314_10002127 | |||
| 2251 | Ga0265314_10019317 | |||
| 2252 | Ga0265342_10001132 | |||
| 2253 | Ga0265342_10002171 | |||
| 2254 | Ga0265342_10094300 | |||
| 2255 | Ga0316576_10157855 | |||
| 2256 | Ga0307516_10011365 | |||
| 2257 | Ga0307516_10153301 | |||
| 2258 | Ga0307410_10176024 | |||
| 2259 | Ga0307412_10058553 | |||
| 2260 | Ga0307412_10135882 | |||
| 2261 | Ga0307416_100142142 | |||
| 2262 | Ga0307411_10187957 | |||
| 2263 | Ga0307507_10022838 | |||
| 2264 | Ga0307510_10013733 | |||
| 2265 | Ga0307510_10033134 | |||
| 2266 | Ga0307510_10048914 | |||
| 2267 | Ga0315911_1000006 | |||
| 2268 | Ga0316215_1003036 | |||
| 2269 | Ga0373958_0001300 | |||
| 2270 | Ga0373938_0000022 | |||
| 2271 | Ga0373929_0000472 | |||
| 2272 | Ga0373934_0005378 | |||
| 2273 | Ga0373940_0000137 | |||
| 2274 | Ga0373949_0000261 | |||
| 2275 | Ga0373951_0002760 | |||
| 2276 | Ga0373952_0003517 | |||
| 2277 | Ga0373932_0002247 | |||
| 2278 | Ga0373939_0000463 | |||
| 2279 | Ga0373939_0003813 | |||
| 2280 | Ga0373941_0000221 | |||
| 2281 | Ga0373941_0000589 | |||
| 2282 | Ga0373945_0015340 | |||
| 2283 | Ga0373953_0040881 | |||
| 2284 | Ga0373954_0003471 | |||
| 2285 | Ga0373954_0054642 | |||
| 2286 | Ga0373956_0002490 | |||
| 2287 | Ga0373956_0024869 | |||
| 2288 | Ga0373957_0009403 | |||
| 2289 | Ga0373960_0000800 | |||
| 2290 | Ga0373960_0002104 | |||
| 2291 | Ga0373943_0000061 | |||
| 2292 | Ga0373943_0022381 | |||
| 2293 | Ga0373946_0025537 | |||
| 2294 | Ga0373955_0013625 | |||
| 2295 | Ga0373955_0020458 | |||
| 2296 | Ga0373942_0006530 | |||
| 2297 | Ga0373961_0005825 | |||
| 2298 | Ga0373961_0008356 | |||
| 2299 | Ga0373962_0003673 | |||
| 2300 | Ga0373962_0013120 | |||
| 2301 | Ga0373924_0008696 | |||
| 2302 | Ga0373924_0011814 | |||
| 2303 | Ga0373931_0000750 | |||
| 2304 | Ga0373935_0001116 | |||
| 2305 | Ga0373935_0015189 | |||
| 2306 | Ga0373935_0068802 | |||
| 2307 | Ga0373935_0105033 | |||
| 2308 | Ga0373927_0000275 | |||
| 2309 | Ga0373927_0001437 | |||
| 2310 | Ga0373927_0004277 | |||
| 2311 | Ga0373927_0020807 | |||
| 2312 | Ga0373927_0053127 | |||
| 2313 | Ga0373927_0059425 | |||
| 2314 | Ga0373933_0001880 | |||
| 2315 | Ga0373933_0003392 | |||
| 2316 | Ga0373933_0053271 | |||
| 2317 | Ga0373933_0081011 | |||
| 2318 | Ga0373947_0000187 | |||
| 2319 | Ga0373947_0003173 | |||
| 2320 | Ga0373947_0028877 | |||
| 2321 | Ga0373947_0084669 | |||
| 2322 | Ga0373937_0016414 | |||
| 2323 | Ga0373937_0020656 | |||
| 2324 | Ga0373937_0065794 | |||
| 2325 | Ga0373925_0000791 | |||
| 2326 | Ga0373925_0006458 | |||
| 2327 | Ga0373925_0021188 | |||
| 2328 | Ga0373925_0075820 | |||
| 2329 | Ga0373925_0083593 | |||
| 2330 | Ga0373925_0133663 | |||
| 2331 | Ga0373925_0145606 | |||
| 2332 | Ga0395899_0007661 | |||
| 2333 | Ga0395899_0048874 | |||
| 2334 | Ga0395900_0002820 | |||
| 2335 | Ga0395900_0132770 | |||
| 2336 | Ga0395900_0183877 | |||
| 2337 | Ga0395900_0224298 | |||
| 2338 | Ga0395900_0504171 | |||
| 2339 | Ga0395898_0035823 | |||
| 2340 | Ga0395898_0037214 | |||
| 2341 | Ga0395898_0114923 | |||
| 2342 | Ga0395898_0116527 | |||
| 2343 | Ga0395898_0256323 | |||
| 2344 | Ga0395905_0013848 | |||
| 2345 | Ga0436364_0009242 | |||
| 2346 | Ga0436364_0565423 | |||
| 2347 | Ga0436364_1381345 | |||
| 2348 | Ga0395901_0073052 | |||
| 2349 | Ga0395901_0102522 | |||
| 2350 | Ga0395901_0206396 | |||
| 2351 | Ga0395901_0217750 | |||
| 2352 | Ga0395901_0281687 | |||
| 2353 | Ga0436365_0244105 | |||
| 2354 | Ga0436365_0552397 | |||
| 2355 | Ga0436365_0712843 | |||
| 2356 | Ga0436361_0476110 | |||
| 2357 | Ga0436363_0312479 | |||
| 2358 | Ga0436363_1211778 | |||
| 2359 | Ga0466972_0000160 | |||
| 2360 | Ga0466972_0041245 | |||
| 2361 | Ga0453683_0000499 | |||
| 2362 | Ga0466965_0068895 | |||
| 2363 | Ga0466966_0000669 | |||
| 2364 | Ga0466961_0000208 | |||
| 2365 | Ga0466961_0049061 | |||
| 2366 | Ga0466963_0051971 | |||
| 2367 | Ga0466957_0304793 | |||
| 2368 | Ga0466960_0004027 | |||
| 2369 | Ga0466959_0000832 | |||
| 2370 | Ga0466959_0065541 | |||
| 2371 | Ga0466967_0007808 | |||
| 2372 | Ga0495592_0002109 | |||
| 2373 | Ga0495592_0010077 | |||
| 2374 | Ga0495603_0001086 | |||
| 2375 | Ga0495603_0005459 | |||
| 2376 | Ga0495603_0012614 | |||
| 2377 | Ga0495603_0025716 | |||
| 2378 | Ga0495629_0000329 | |||
| 2379 | Ga0495629_0000726 | |||
| 2380 | Ga0495629_0008557 | |||
| 2381 | Ga0495629_0073225 | |||
| 2382 | Ga0495629_0145998 | |||
| 2383 | Ga0495638_0078657 | |||
| 2384 | Ga0495641_0000747 | |||
| 2385 | Ga0495641_0009078 | |||
| 2386 | Ga0495651_0000528 | |||
| 2387 | Ga0495651_0001234 | |||
| 2388 | Ga0495653_0000358 | |||
| 2389 | Ga0495653_0024434 | |||
| 2390 | Ga0495653_0120003 | |||
| 2391 | Ga0495582_0000416 | |||
| 2392 | Ga0495582_0018577 | |||
| 2393 | Ga0495582_0039151 | |||
| 2394 | Ga0495605_0058321 | |||
| 2395 | Ga0495605_0077055 | |||
| 2396 | Ga0495639_0000165 | |||
| 2397 | Ga0495639_0042460 | |||
| 2398 | Ga0495662_0000066 | |||
| 2399 | Ga0495662_0007797 | |||
| 2400 | Ga0495662_0055096 | |||
| 2401 | Ga0495664_0000510 | |||
| 2402 | Ga0495664_0003203 | |||
| 2403 | Ga0495664_0025954 | |||
| 2404 | Ga0495585_0050021 | |||
| 2405 | Ga0495594_0000441 | |||
| 2406 | Ga0495594_0104469 | |||
| 2407 | Ga0495607_0055693 | |||
| 2408 | Ga0495606_0001663 | |||
| 2409 | Ga0495606_0045553 | |||
| 2410 | Ga0495608_0002274 | |||
| 2411 | Ga0495608_0002377 | |||
| 2412 | Ga0495608_0025275 | |||
| 2413 | Ga0495608_0041729 | |||
| 2414 | Ga0495618_0002751 | |||
| 2415 | Ga0495618_0020274 | |||
| 2416 | Ga0495620_0049417 | |||
| 2417 | Ga0495628_0019406 | |||
| 2418 | Ga0495628_0020389 | |||
| 2419 | Ga0495628_0022251 | |||
| 2420 | Ga0495628_0146998 | |||
| 2421 | Ga0495630_0008582 | |||
| 2422 | Ga0495631_0019145 | |||
| 2423 | Ga0495642_0056699 | |||
| 2424 | Ga0495652_0002427 | |||
| 2425 | Ga0495652_0005186 | |||
| 2426 | Ga0495652_0020974 | |||
| 2427 | Ga0495652_0066937 | |||
| 2428 | Ga0495665_0000802 | |||
| 2429 | Ga0495665_0001233 | |||
| 2430 | Ga0495640_0003534 | |||
| 2431 | Ga0495640_0009403 | |||
| 2432 | Ga0495640_0027787 | |||
| 2433 | Ga0495640_0065735 | |||
| 2434 | Ga0495586_0014173 | |||
| 2435 | Ga0495586_0099032 | |||
| 2436 | Ga0495587_0001337 | |||
| 2437 | Ga0495587_0024608 | |||
| 2438 | Ga0495587_0030214 | |||
| 2439 | Ga0495609_0071603 | |||
| 2440 | Ga0495645_0008975 | |||
| 2441 | Ga0495645_0034306 | |||
| 2442 | Ga0495645_0050362 | |||
| 2443 | Ga0495645_0112011 | |||
| 2444 | Ga0495622_0004915 | |||
| 2445 | Ga0495622_0019370 | |||
| 2446 | Ga0495622_0032366 | |||
| 2447 | Ga0495667_0002234 | |||
| 2448 | Ga0495667_0060233 | |||
| 2449 | Ga0495634_0002191 | |||
| 2450 | Ga0495634_0002979 | |||
| 2451 | Ga0495634_0015120 | |||
| 2452 | Ga0495625_0048927 | |||
| 2453 | Ga0495625_0086437 | |||
| 2454 | Ga0495635_0000527 | |||
| 2455 | Ga0495635_0001696 | |||
| 2456 | Ga0495635_0002022 | |||
| 2457 | Ga0495635_0031514 | |||
| 2458 | Ga0495635_0088227 | |||
| 2459 | Ga0495635_0138618 | |||
| 2460 | Ga0495659_0044852 | |||
| 2461 | Ga0495588_0055784 | |||
| 2462 | Ga0495657_0001550 | |||
| 2463 | Ga0495657_0007232 | |||
| 2464 | Ga0495657_0053087 | |||
| 2465 | Ga0495599_0002310 | |||
| 2466 | Ga0495599_0013701 | |||
| 2467 | Ga0495599_0097191 | |||
| 2468 | Ga0495599_0133702 | |||
| 2469 | Ga0495623_0003518 | |||
| 2470 | Ga0495646_0017484 | |||
| 2471 | Ga0495646_0022612 | |||
| 2472 | Ga0495646_0044539 | |||
| 2473 | Ga0495646_0057438 | |||
| 2474 | Ga0495646_0067909 | |||
| 2475 | Ga0495646_0101890 | |||
| 2476 | Ga0495647_0001835 | |||
| 2477 | Ga0495647_0002668 | |||
| 2478 | Ga0495647_0004959 | |||
| 2479 | Ga0495658_0004889 | |||
| 2480 | Ga0495658_0027133 | |||
| 2481 | Ga0495658_0109867 | |||
| 2482 | Ga0495613_0002281 | |||
| 2483 | Ga0495613_0003015 | |||
| 2484 | Ga0495613_0016014 | |||
| 2485 | Ga0495624_0005449 | |||
| 2486 | Ga0495624_0006912 | |||
| 2487 | Ga0495624_0030168 | |||
| 2488 | Ga0495624_0055194 | |||
| 2489 | Ga0495670_0044264 | |||
| 2490 | Ga0495589_0040148 | |||
| 2491 | Ga0495600_0001526 | |||
| 2492 | Ga0495600_0001732 | |||
| 2493 | Ga0495600_0034421 | |||
| 2494 | Ga0495600_0079095 | |||
| 2495 | Ga0495581_0000530 | |||
| 2496 | Ga0495581_0014680 | |||
| 2497 | Ga0495604_0002815 | |||
| 2498 | Ga0495604_0165071 | |||
| 2499 | Ga0495674_0000138 | |||
| 2500 | Ga0495674_0001486 | |||
| 2501 | Ga0495674_0069326 | |||
| 2502 | Ga0495674_0090443 | |||
| 2503 | Ga0495674_0119459 | |||
| 2504 | Ga0495674_0273753 | |||
| 2505 | Ga0495672_0019216 | |||
| 2506 | Ga0495672_0034108 | |||
| 2507 | Ga0495672_0046474 | |||
| 2508 | Ga0495676_0045353 | |||
| 2509 | Ga0495676_0095528 | |||
| 2510 | Ga0495680_0011728 | |||
| 2511 | Ga0495680_0061251 | |||
| 2512 | Ga0495680_0085190 | |||
| 2513 | Ga0495680_0130739 | |||
| 2514 | Ga0495683_0027742 | |||
| 2515 | Ga0495687_014951 | |||
| 2516 | Ga0495675_0012926 | |||
| 2517 | Ga0495675_0017016 | |||
| 2518 | Ga0495675_0087339 | |||
| 2519 | Ga0495684_0001215 | |||
| 2520 | Ga0495684_0019302 | |||
| 2521 | Ga0495684_0027385 | |||
| 2522 | Ga0495684_0032837 | |||
| 2523 | Ga0495684_0114104 | |||
| 2524 | Ga0495686_0193125 | |||
| 2525 | Ga0495593_0000345 | |||
| 2526 | Ga0495602_0012463 | |||
| 2527 | Ga0495602_0053861 | |||
| 2528 | Ga0495614_0023407 | |||
| 2529 | Ga0495615_0013853 | |||
| 2530 | Ga0495615_0022097 | |||
| 2531 | Ga0496100_0007042 | |||
| 2532 | Ga0496100_0054311 | |||
| 2533 | Ga0496100_0061728 | |||
| 2534 | Ga0496101_0001619 | |||
| 2535 | Ga0496101_0004213 | |||
| 2536 | Ga0496101_0068477 | |||
| 2537 | Ga0496101_0138739 | |||
| 2538 | Ga0496101_0221241 | |||
| 2539 | Ga0496102_0006904 | |||
| 2540 | Ga0496102_0023343 | |||
| 2541 | Ga0496103_0003429 | |||
| 2542 | Ga0496103_0062407 | |||
| 2543 | Ga0496103_0072235 | |||
| 2544 | Ga0496104_0006123 | |||
| 2545 | Ga0496104_0009040 | |||
| 2546 | Ga0496104_0067046 | |||
| 2547 | Ga0496104_0068763 | |||
| 2548 | Ga0496104_0149939 | |||
| 2549 | Ga0496105_0004225 | |||
| 2550 | Ga0496105_0035275 | |||
| 2551 | Ga0496105_0036082 | |||
| 2552 | Ga0496105_0039020 | |||
| 2553 | Ga0496105_0046279 | |||
| 2554 | Ga0496106_0000587 | |||
| 2555 | Ga0496106_0004983 | |||
| 2556 | Ga0496106_0012623 | |||
| 2557 | Ga0496106_0018998 | |||
| 2558 | Ga0496106_0059119 | |||
| 2559 | Ga0496106_0113223 | |||
| 2560 | Ga0496107_0002981 | |||
| 2561 | Ga0496107_0008057 | |||
| 2562 | Ga0496107_0037062 | |||
| 2563 | Ga0496108_0000517 | |||
| 2564 | Ga0496108_0005354 | |||
| 2565 | Ga0496108_0008243 | |||
| 2566 | Ga0496108_0014716 | |||
| 2567 | Ga0496108_0021192 | |||
| 2568 | Ga0496108_0024182 | |||
| 2569 | Ga0496108_0056517 | |||
| 2570 | Ga0496109_0001287 | |||
| 2571 | Ga0496109_0001899 | |||
| 2572 | Ga0496109_0003767 | |||
| 2573 | Ga0496109_0015266 | |||
| 2574 | Ga0496109_0022363 | |||
| 2575 | Ga0496109_0033944 | |||
| 2576 | Ga0496109_0042157 | |||
| 2577 | Ga0496109_0049200 | |||
| 2578 | Ga0496109_0080204 | |||
| 2579 | Ga0496109_0134155 | |||
| 2580 | Ga0496109_0168887 | |||
| 2581 | Ga0496109_0275439 | |||
| 2582 | Ga0496109_0318284 | |||
| 2583 | Ga0496110_0001638 | |||
| 2584 | Ga0496110_0018515 | |||
| 2585 | Ga0496110_0035267 | |||
| 2586 | Ga0496110_0051151 | |||
| 2587 | Ga0496110_0114130 | |||
| 2588 | Ga0496110_0139915 | |||
| 2589 | Ga0496110_0165008 | |||
| 2590 | Ga0496110_0257807 | |||
| 2591 | Ga0496110_0398155 | |||
| 2592 | Ga0496111_0001713 | |||
| 2593 | Ga0496111_0003286 | |||
| 2594 | Ga0496111_0105893 | |||
| 2595 | Ga0496111_0108437 | |||
| 2596 | Ga0496111_0123339 | |||
| 2597 | Ga0496112_0000004 | |||
| 2598 | Ga0496112_0004435 | |||
| 2599 | Ga0496112_0017567 | |||
| 2600 | Ga0496112_0022393 | |||
| 2601 | Ga0496112_0033460 | |||
| 2602 | Ga0496112_0034589 | |||
| 2603 | Ga0496112_0037988 | |||
| 2604 | Ga0496112_0048275 | |||
| 2605 | Ga0496112_0058807 | |||
| 2606 | Ga0496112_0060042 | |||
| 2607 | Ga0496112_0176529 | |||
| 2608 | Ga0496113_0002800 | |||
| 2609 | Ga0496113_0006800 | |||
| 2610 | Ga0496113_0014818 | |||
| 2611 | Ga0496113_0033117 | |||
| 2612 | Ga0496113_0060308 | |||
| 2613 | Ga0496114_0008606 | |||
| 2614 | Ga0496114_0011846 | |||
| 2615 | Ga0496114_0039109 | |||
| 2616 | Ga0496114_0083373 | |||
| 2617 | Ga0496114_0378579 | |||
| 2618 | Ga0496115_0002504 | |||
| 2619 | Ga0496115_0006400 | |||
| 2620 | Ga0496115_0021895 | |||
| 2621 | Ga0496115_0053770 | |||
| 2622 | Ga0496115_0061200 | |||
| 2623 | Ga0496115_0271458 | |||
| 2624 | Ga0496116_0028721 | |||
| 2625 | Ga0496117_0071071 | |||
| 2626 | Ga0496118_0039892 | |||
| 2627 | Ga0496119_0016774 | |||
| 2628 | Ga0496119_0048622 | |||
| 2629 | Ga0496120_0041707 | |||
| 2630 | Ga0496120_0065797 | |||
| 2631 | Ga0496121_0000458 | |||
| 2632 | Ga0496121_0001749 | |||
| 2633 | Ga0496121_0002564 | |||
| 2634 | Ga0496121_0004375 | |||
| 2635 | Ga0496121_0009926 | |||
| 2636 | Ga0496121_0017689 | |||
| 2637 | Ga0496121_0044385 | |||
| 2638 | Ga0496121_0070359 | |||
| 2639 | Ga0496121_0074115 | |||
| 2640 | Ga0496121_0132223 | |||
| 2641 | Ga0496121_0197402 | |||
| 2642 | Ga0496122_0017860 | |||
| 2643 | Ga0496122_0058303 | |||
| 2644 | Ga0496123_0088166 | |||
| 2645 | Ga0496124_0010603 | |||
| 2646 | Ga0496125_0000951 | |||
| 2647 | Ga0496125_0001462 | |||
| 2648 | Ga0496125_0002254 | |||
| 2649 | Ga0496125_0095051 | |||
| 2650 | Ga0496126_0018663 | |||
| 2651 | Ga0496126_0025235 | |||
| 2652 | Ga0496126_0040762 | |||
| 2653 | Ga0496126_0046444 | |||
| 2654 | Ga0496126_0098652 | |||
| 2655 | Ga0496126_0100548 | |||
| 2656 | Ga0496126_0120639 | |||
| 2657 | Ga0496126_0171016 | |||
| 2658 | Ga0501031_0004867 | |||
| 2659 | Ga0501031_0029474 | |||
| 2660 | Ga0501031_0036678 | |||
| 2661 | Ga0501031_0055369 | |||
| 2662 | Ga0501032_0001822 | |||
| 2663 | Ga0501032_0006705 | |||
| 2664 | Ga0501032_0061313 | |||
| 2665 | Ga0501032_0071711 | |||
| 2666 | Ga0501033_0000827 | |||
| 2667 | Ga0501033_0001583 | |||
| 2668 | Ga0501033_0014098 | |||
| 2669 | Ga0501033_0016530 | |||
| 2670 | Ga0501033_0137995 | |||
| 2671 | Ga0501034_0000032 | |||
| 2672 | Ga0501034_0002449 | |||
| 2673 | Ga0501034_0063969 | |||
| 2674 | Ga0501034_0077338 | |||
| 2675 | Ga0501034_0125024 | |||
| 2676 | Ga0501034_0126594 | |||
| 2677 | Ga0501034_0161501 | |||
| 2678 | Ga0501034_0348099 | |||
| 2679 | Ga0501036_0000149 | |||
| 2680 | Ga0501036_0000674 | |||
| 2681 | Ga0501036_0004945 | |||
| 2682 | Ga0501036_0037467 | |||
| 2683 | Ga0501036_0051485 | |||
| 2684 | Ga0501036_0063926 | |||
| 2685 | Ga0501036_0164909 | |||
| 2686 | Ga0501037_0000153 | |||
| 2687 | Ga0501037_0000888 | |||
| 2688 | Ga0501037_0007710 | |||
| 2689 | Ga0501037_0017413 | |||
| 2690 | Ga0501037_0023391 | |||
| 2691 | Ga0501037_0025967 | |||
| 2692 | Ga0501037_0051032 | |||
| 2693 | Ga0501037_0116080 | |||
| 2694 | Ga0501038_0000138 | |||
| 2695 | Ga0501038_0001121 | |||
| 2696 | Ga0501038_0009574 | |||
| 2697 | Ga0501038_0032799 | |||
| 2698 | Ga0501038_0044769 | |||
| 2699 | Ga0501038_0086561 | |||
| 2700 | Ga0501038_0125019 | |||
| 2701 | Ga0501039_0000842 | |||
| 2702 | Ga0501039_0003466 | |||
| 2703 | Ga0501039_0151491 | |||
| 2704 | Ga0501039_0158354 | |||
| 2705 | Ga0501042_0001932 | |||
| 2706 | Ga0501042_0075397 | |||
| 2707 | Ga0501043_0006630 | |||
| 2708 | Ga0501043_0008464 | |||
| 2709 | Ga0501043_0018007 | |||
| 2710 | Ga0501043_0019806 | |||
| 2711 | Ga0501043_0045301 | |||
| 2712 | Ga0501043_0094042 | |||
| 2713 | Ga0501043_0098002 | |||
| 2714 | Ga0501043_0158632 | |||
| 2715 | Ga0501046_0021327 | |||
| 2716 | Ga0501046_0029266 | |||
| 2717 | Ga0501046_0062318 | |||
| 2718 | Ga0501046_0079255 | |||
| 2719 | Ga0501046_0177177 | |||
| 2720 | Ga0501047_0000010 | |||
| 2721 | Ga0501047_0001785 | |||
| 2722 | Ga0501047_0004062 | |||
| 2723 | Ga0501047_0012519 | |||
| 2724 | Ga0501047_0048611 | |||
| 2725 | Ga0501047_0119186 | |||
| 2726 | Ga0501047_0127100 | |||
| 2727 | Ga0501047_0141576 | |||
| 2728 | Ga0501047_0201508 | |||
| 2729 | Ga0501047_0250797 | |||
| 2730 | Ga0501048_0000396 | |||
| 2731 | Ga0501048_0000653 | |||
| 2732 | Ga0501067_0019432 | |||
| 2733 | Ga0501067_0037938 | |||
| 2734 | Ga0501067_0085856 | |||
| 2735 | Ga0501068_0004084 | |||
| 2736 | Ga0501068_0020465 | |||
| 2737 | Ga0501068_0024884 | |||
| 2738 | Ga0501068_0031994 | |||
| 2739 | Ga0501068_0052257 | |||
| 2740 | Ga0501068_0083832 | |||
| 2741 | Ga0501069_0005888 | |||
| 2742 | Ga0501070_0002230 | |||
| 2743 | Ga0501070_0029990 | |||
| 2744 | Ga0501070_0031212 | |||
| 2745 | Ga0501070_0038371 | |||
| 2746 | Ga0501070_0041037 | |||
| 2747 | Ga0501070_0060813 | |||
| 2748 | Ga0501070_0086286 | |||
| 2749 | Ga0501071_0026342 | |||
| 2750 | Ga0501072_0001051 | |||
| 2751 | Ga0501072_0002565 | |||
| 2752 | Ga0501072_0066504 | |||
| 2753 | Ga0501072_0149988 | |||
| 2754 | Ga0501073_0000221 | |||
| 2755 | Ga0501073_0030234 | |||
| 2756 | Ga0501073_0035819 | |||
| 2757 | Ga0501073_0050655 | |||
| 2758 | Ga0501073_0050877 | |||
| 2759 | Ga0501073_0060342 | |||
| 2760 | Ga0501073_0082683 | |||
| 2761 | Ga0501073_0173309 | |||
| 2762 | Ga0501074_0015795 | |||
| 2763 | Ga0501074_0018904 | |||
| 2764 | Ga0501074_0054256 | |||
| 2765 | Ga0501076_0126782 | |||
| 2766 | Ga0501077_0046592 | |||
| 2767 | Ga0501079_0050115 | |||
| 2768 | Ga0501080_0003063 | |||
| 2769 | Ga0501080_0011359 | |||
| 2770 | Ga0501080_0026159 | |||
| 2771 | Ga0501080_0067483 | |||
| 2772 | Ga0501080_0071767 | |||
| 2773 | Ga0501080_0092246 | |||
| 2774 | Ga0501080_0452977 | |||
| 2775 | Ga0501083_0001423 | |||
| 2776 | Ga0501083_0008402 | |||
| 2777 | Ga0501083_0025847 | |||
| 2778 | Ga0501083_0035733 | |||
| 2779 | Ga0501083_0089514 | |||
| 2780 | Ga0501035_0001426 | |||
| 2781 | Ga0501035_0004322 | |||
| 2782 | Ga0501035_0007645 | |||
| 2783 | Ga0501035_0012953 | |||
| 2784 | Ga0501035_0045651 | |||
| 2785 | Ga0501035_0059092 | |||
| 2786 | Ga0501035_0065875 | |||
| 2787 | Ga0501035_0145794 | |||
| 2788 | Ga0501035_0163108 | |||
| 2789 | Ga0501035_0208445 | |||
| 2790 | Ga0501044_0000369 | |||
| 2791 | Ga0501044_0013258 | |||
| 2792 | Ga0501044_0013456 | |||
| 2793 | Ga0501044_0018430 | |||
| 2794 | Ga0501044_0075210 | |||
| 2795 | Ga0501044_0136215 | |||
| 2796 | Ga0501045_0064688 | |||
| 2797 | Ga0501045_0081311 | |||
| 2798 | Ga0501045_0092737 | |||
| 2799 | nmdc:mga03n38_6896_c1 | |||
| 2800 | nmdc:mga00v17_9599_c1 | |||
| 2801 | nmdc:mga0yw44_1008_c1 | |||
| 2802 | nmdc:mga0yw44_27628_c1 | |||
| 2803 | nmdc:mga0yw44_4407_c1 | |||
| 2804 | nmdc:mga0yw44_7568_c1 | |||
| 2805 | nmdc:mga0k408_41747_c1 | |||
| 2806 | nmdc:mga0k408_71478_c1 | |||
| 2807 | nmdc:mga06z11_23196_c1 | |||
| 2808 | nmdc:mga06z11_5654_c1 | |||
| 2809 | nmdc:mga04h51_53107_c1 | |||
| 2810 | nmdc:mga07m45_1367_c1 | |||
| 2811 | nmdc:mga08y16_172_c1 | |||
| 2812 | nmdc:mga08y16_55900_c1 | |||
| 2813 | nmdc:mga0n895_24014_c1 | |||
| 2814 | nmdc:mga0rr50_180782_c1 | |||
| 2815 | nmdc:mga08x19_4_c2 | |||
| 2816 | nmdc:mga08x19_89926_c1 | |||
| 2817 | nmdc:mga0sz30_8294_c1 | |||
| 2818 | Ga0495601_0002574 | |||
| 2819 | Ga0495601_0015114 | |||
| 2820 | Ga0495601_0036761 | |||
| 2821 | Ga0495601_0047852 | |||
| 2822 | Ga0495601_0054332 | |||
| 2823 | Ga0495612_0004857 | |||
| 2824 | Ga0495612_0085424 | |||
| 2825 | Ga0500610_0142077 | |||
| 2826 | Ga0500635_0027246 | |||
| 2827 | Ga0495655_0001288 | |||
| 2828 | Ga0495595_0025302 | |||
| 2829 | Ga0495595_0100767 | |||
| 2830 | Ga0495619_0000609 | |||
| 2831 | Ga0495619_0000757 | |||
| 2832 | Ga0495619_0000799 | |||
| 2833 | Ga0495619_0001114 | |||
| 2834 | Ga0495619_0026157 | |||
| 2835 | Ga0495619_0048425 | |||
| 2836 | Ga0500643_000032 | |||
| 2837 | Ga0500644_0000786 | |||
| 2838 | Ga0500647_0023164 | |||
| 2839 | Ga0500583_0048761 | |||
| 2840 | Ga0500651_0027621 | |||
| 2841 | Ga0500566_0000006 | |||
| 2842 | Ga0500566_0002123 | |||
| 2843 | Ga0500566_0011398 | |||
| 2844 | Ga0500566_0017517 | |||
| 2845 | Ga0500640_003111 | |||
| 2846 | Ga0500641_0011598 | |||
| 2847 | Ga0500650_0000167 | |||
| 2848 | Ga0500555_002027 | |||
| 2849 | Ga0500556_0000030 | |||
| 2850 | Ga0500557_000004 | |||
| 2851 | Ga0500572_000870 | |||
| 2852 | Ga0500572_001481 | |||
| 2853 | Ga0500595_000002 | |||
| 2854 | Ga0500595_000306 | |||
| 2855 | Ga0500595_001964 | |||
| 2856 | Ga0500595_002618 | |||
| 2857 | Ga0500595_006167 | |||
| 2858 | Ga0500595_007411 | |||
| 2859 | Ga0500595_009208 | |||
| 2860 | Ga0500595_030128 | |||
| 2861 | Ga0500595_033571 | |||
| 2862 | Ga0500595_038239 | |||
| 2863 | Ga0500608_010820 | |||
| 2864 | Ga0500608_066101 | |||
| 2865 | Ga0500614_000745 | |||
| 2866 | Ga0500642_0000080 | |||
| 2867 | Ga0500642_0000302 | |||
| 2868 | Ga0500652_000003 | |||
| 2869 | Ga0500652_001787 | |||
| 2870 | Ga0500652_007383 | |||
| 2871 | Ga0500655_011446 | |||
| 2872 | Ga0500559_0000714 | |||
| 2873 | Ga0500559_0002857 | |||
| 2874 | Ga0500559_0004788 | |||
| 2875 | Ga0500568_0000001 | |||
| 2876 | Ga0500568_0000978 | |||
| 2877 | Ga0500568_0012491 | |||
| 2878 | Ga0500577_0000263 | |||
| 2879 | Ga0500586_001063 | |||
| 2880 | Ga0500590_082201 | |||
| 2881 | Ga0500603_000163 | |||
| 2882 | Ga0500603_000339 | |||
| 2883 | Ga0500616_0000002 | |||
| 2884 | Ga0500616_0000252 | |||
| 2885 | Ga0500616_0000696 | |||
| 2886 | Ga0500616_0004537 | |||
| 2887 | Ga0500616_0012792 | |||
| 2888 | Ga0500616_0016773 | |||
| 2889 | Ga0500622_0003870 | |||
| 2890 | Ga0500630_000788 | |||
| 2891 | Ga0500633_0016195 | |||
| 2892 | Ga0500638_084353 | |||
| 2893 | Ga0500639_000765 | |||
| 2894 | Ga0500636_0000066 | |||
| 2895 | Ga0500636_0013143 | |||
| 2896 | Ga0500636_0015097 | |||
| 2897 | Ga0500636_0036362 | |||
| 2898 | Ga0500637_0003078 | |||
| 2899 | Ga0500637_0009851 | |||
| 2900 | Ga0500637_0074348 | |||
| 2901 | Ga0500625_043521 | |||
| 2902 | Ga0500645_000385 | |||
| 2903 | Ga0500596_004638 | |||
| 2904 | Ga0500596_005269 | |||
| 2905 | Ga0500596_005521 | |||
| 2906 | Ga0500599_001124 | |||
| 2907 | Ga0501084_0011449 | |||
| 2908 | Ga0501084_0170783 | |||
| 2909 | Ga0501084_0250095 | |||
| 2910 | Ga0501082_0000183 | |||
| 2911 | Ga0501082_0016777 | |||
| 2912 | Ga0501082_0094903 | |||
| 2913 | 2507508360 | |||
| 2914 | 2508542435 | |||
| 2915 | 2508691802 | |||
| 2916 | 2509150486 | |||
| 2917 | 2511399885 | |||
| 2918 | 2513625090 | |||
| 2919 | 2513645612 | |||
| 2920 | 2513657925 | |||
| 2921 | 2513674458 | |||
| 2922 | 2513692809 | |||
| 2923 | 2513706618 | |||
| 2924 | 2513722595 | |||
| 2925 | 2513855623 | |||
| 2926 | 2513872985 | |||
| 2927 | 2513894740 | |||
| 2928 | 2513919982 | |||
| 2929 | 2514013752 | |||
| 2930 | 2515627138 | |||
| 2931 | 2517102835 | |||
| 2932 | 2517892163 | |||
| 2933 | 2524437565 | |||
| 2934 | 2524465733 | |||
| 2935 | 2524534263 | |||
| 2936 | 2528853872 | |||
| 2937 | 2603859667 | |||
| 2938 | 2617347156 | |||
| 2939 | 2617375537 | |||
| 2940 | 2644288843 | |||
| 2941 | 2671120582 | |||
| 2942 | 2723844833 | |||
| 2943 | 2728753143 | |||
| 2944 | 2745079652 | |||
| 2945 | 2793065480 | |||
| 2946 | 2793068759 | |||
| 2947 | 2793082294 | |||
| 2948 | 2805915115 | |||
| 2949 | 2818238658 | |||
| 2950 | 2824604110 | |||
| 2951 | 2824610379 | |||
| 2952 | 2824617953 | |||
| 2953 | 2824626621 | |||
| 2954 | 2824638638 | |||
| 2955 | 2824646106 | |||
| 2956 | 2824668631 | |||
| 2957 | 2824672497 | |||
| 2958 | 2824685881 | |||
| 2959 | 2824688947 | |||
| 2960 | 2824716292 | |||
| 2961 | 2824746576 | |||
| 2962 | 2824759517 | |||
| 2963 | 2824771732 | |||
| 2964 | 2824775416 | |||
| 2965 | 2838123513 | |||
| 2966 | 2841947711 | |||
| 2967 | 2841949615 | |||
| 2968 | 2841964204 | |||
| 2969 | 2841971878 | |||
| 2970 | 2841974779 | |||
| 2971 | 2841983663 | |||
| 2972 | 2842040027 | |||
| 2973 | 2842047028 | |||
| 2974 | 2844319277 | |||
| 2975 | 2847936438 | |||
| 2976 | 2847946787 | |||
| 2977 | 2849079100 | |||
| 2978 | 2857516649 | |||
| 2979 | 2857528935 | |||
| 2980 | 2874598273 | |||
| 2981 | 2874605455 | |||
| 2982 | 2874619525 | |||
| 2983 | 2874627580 | |||
| 2984 | 2874632087 | |||
| 2985 | 2874652671 | |||
| 2986 | 2876764755 | |||
| 2987 | 2876778249 | |||
| 2988 | 2876814391 | |||
| 2989 | 2876825882 | |||
| 2990 | 2879082043 | |||
| 2991 | 2879090220 | |||
| 2992 | 2879104898 | |||
| 2993 | 2879115768 | |||
| 2994 | 2879135190 | |||
| 2995 | 2879145451 | |||
| 2996 | 2881368621 | |||
| 2997 | 2881673292 | |||
| 2998 | 2885373551 | |||
| 2999 | 2885382740 | |||
| 3000 | 2888384294 | |||
| 3001 | 2888393592 | |||
| 3002 | 2888424754 | |||
| 3003 | 2889039539 | |||
| 3004 | 2893070393 | |||
| 3005 | 2903731117 | |||
| 3006 | 2903754908 | |||
| 3007 | 2903771783 | |||
| 3008 | 2904673100 | |||
| 3009 | 2904694762 | |||
| 3010 | 2904702306 | |||
| 3011 | 2904714905 | |||
| 3012 | 2906607374 | |||
| 3013 | 2906617290 | |||
| 3014 | 2906631141 | |||
| 3015 | 2906643315 | |||
| 3016 | 2906645151 | |||
| 3017 | 2906662555 | |||
| 3018 | 2908742441 | |||
| 3019 | 2908760084 | |||
| 3020 | 2908780398 | |||
| 3021 | 2919076335 | |||
| 3022 | 2922365585 | |||
| 3023 | 2922374651 | |||
| 3024 | 2922391203 | |||
| 3025 | 2922400578 | |||
| 3026 | 2922430534 | |||
| 3027 | 2929621745 | |||
| 3028 | 2929629948 | |||
| 3029 | 2932788597 | |||
| 3030 | 2932798131 | |||
| 3031 | 2932807013 | |||
| 3032 | 2932817181 | |||
| 3033 | 2932825230 | |||
| 3034 | 2932830246 | |||
| 3035 | 2933583979 | |||
| 3036 | 2935609152 | |||
| 3037 | 2935622528 | |||
| 3038 | 2935631308 | |||
| 3039 | 2935642133 | |||
| 3040 | 2935651048 | |||
| 3041 | 2935659229 | |||
| 3042 | 2935672483 | |||
| 3043 | 2935676053 | |||
| 3044 | 2935686044 | |||
| 3045 | 2935697711 | |||
| 3046 | 2935705884 | |||
| 3047 | 2935714596 | |||
| 3048 | 2935725215 | |||
| 3049 | 2935732425 | |||
| 3050 | 2935741804 | |||
| 3051 | 2935752009 | |||
| 3052 | 2935765266 | |||
| 3053 | 2935771829 | |||
| 3054 | 2935778731 | |||
| 3055 | 2935788880 | |||
| 3056 | 2935795320 | |||
| 3057 | 2935802881 | |||
| 3058 | 2935813287 | |||
| 3059 | 2935822312 | |||
| 3060 | 2935830300 | |||
| 3061 | 2935838197 | |||
| 3062 | 2935847894 | |||
| 3063 | 2935860777 | |||
| 3064 | 2935872250 | |||
| 3065 | 2935878695 | |||
| 3066 | 2935886863 | |||
| 3067 | 2935908887 | |||
| 3068 | 2935919606 | |||
| 3069 | 2935926539 | |||
| 3070 | 2935934989 | |||
| 3071 | 2935943439 | |||
| 3072 | 2935951877 | |||
| 3073 | 2935960636 | |||
| 3074 | 2935968002 | |||
| 3075 | 2935978631 | |||
| 3076 | 2935987511 | |||
| 3077 | 2935994909 | |||
| 3078 | 2936003552 | |||
| 3079 | 2936013644 | |||
| 3080 | 2936022229 | |||
| 3081 | 2936030675 | |||
| 3082 | 2936042236 | |||
| 3083 | 2936048488 | |||
| 3084 | 2936058702 | |||
| 3085 | 2940557188 | |||
| 3086 | 2941510049 | |||
| 3087 | 2941518864 | |||
| 3088 | 2941525448 | |||
| 3089 | 2941533033 | |||
| 3090 | 2941539136 | |||
| 3091 | 3005480446 | |||
| 3092 | 3005484539 | |||
| 3093 | 3005510542 | |||
| 3094 | 3005587822 | |||
| 3095 | 3005599459 | |||
| 3096 | 3005715119 | |||
| 3097 | 3005722519 | |||
| 3098 | 8006931345 | |||
| 3099 | 8006940438 | |||
| 3100 | 8006967078 | |||
| 3101 | 8006980127 | |||
| 3102 | 8006988037 | |||
| 3103 | 8006995763 | |||
| 3104 | 8016522062 | |||
| 3105 | 8016529399 | |||
| 3106 | 8016534609 | |||
| 3107 | 8016547833 | |||
| 3108 | 8016554304 | |||
| 3109 | 8016562679 | |||
| 3110 | 8016572955 | |||
| 3111 | 8016600460 | |||
| 3112 | 8016610283 | |||
| 3113 | 8016614649 | |||
| 3114 | 8016626345 | |||
| 3115 | 8016640087 | |||
| 3116 | 8017063605 | |||
| 3117 | 8019534375 | |||
| 3118 | 8019545087 | |||
| 3119 | 8019553434 | |||
| 3120 | 8019556341 | |||
| 3121 | 8019568971 | |||
| 3122 | 8019582929 | |||
| 3123 | 8019590726 | |||
| 3124 | 8019600623 | |||
| 3125 | 8019617922 | |||
| 3126 | 8019628426 | |||
| 3127 | 8019645523 | |||
| 3128 | 8019658762 | |||
| 3129 | 8019662086 | |||
| 3130 | 8019671605 | |||
| 3131 | 8019690301 | |||
| 3132 | 8055746089 | |||
| 3133 | 8056673620 | |||
| 3134 | 8056687384 | |||
| 3135 | 8056691291 | |||
| 3136 | 8056968249 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2frx-assembly2.cif.gz_B | crystal structure of yebu, a m5c rna methyltransferase from e.coli | 0.8806 | 126 | 433 |
| 7r6k-assembly1.cif.gz_q | state e2 nucleolar 60s ribosomal intermediate - model for noc2/noc3 region | 0.876 | 155 | 309 |
| 3a4t-assembly1.cif.gz_A | crystal structure of atrm4 from m.jannaschii with sinefungin | 0.8666 | 154 | 431 |
| 3a4t-assembly1.cif.gz_A | crystal structure of atrm4 from m.jannaschii with sinefungin | 0.8571 | 154 | 431 |
| 3m4x-assembly1.cif.gz_A | structure of a ribosomal methyltransferase | 0.8539 | 126 | 433 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B7ZXR6_266_358_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9516 | 215 | 285 | 3.40.50.150 |
| af_Q8I5B4_187_375_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9213 | 219 | 431 | 3.40.50.150 |
| 1sqfA04 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9144 | 215 | 431 | 3.40.50.150 |
| af_Q8I5B4_187_375_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9073 | 219 | 431 | 3.40.50.150 |
| 1sqfA04 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9056 | 215 | 431 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537L2G6-F1-model_v4 | RsmB/NOP family class I SAM-dependent RNA methyltransferase | 0.9905 | 1 | 432 |
GO:0001510
GO:0003723 GO:0008173 |
| AF-A0A537L2G6-F1-model_v4 | RsmB/NOP family class I SAM-dependent RNA methyltransferase | 0.9883 | 1 | 432 |
GO:0001510
GO:0003723 GO:0008173 |
| AF-A0A527VW72-F1-model_v4 | RsmB/NOP family class I SAM-dependent RNA methyltransferase | 0.9705 | 135 | 364 |
GO:0001510
GO:0003723 GO:0008173 |
| AF-A0A3S1VKP8-F1-model_v4 | deleted | 0.9644 | 1 | 228 |
|
| AF-A0A356W3W8-F1-model_v4 | MFS transporter | 0.9643 | 1 | 303 |
GO:0001510
GO:0003723 GO:0008173 |