F494832
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1572 | 923 | 1094 | 224 |
Family's Representative Sequence
| Representative Sequence | 3300039438|Ga0436360_0879069|Ga0436360_0879069_1439_2203 |
| Length | 254 |
| Sequence | MHLKDFSSPLWVGFIQQPQYTLDGITMRILLVEDDMDLQRLLKKALSEAGYVVDTAADGEEGHFLGDTEPYDAVVLDLGLPKMDGVTVLEKWRAAGRTMPVLILTARDRWSDKVAGFDAGADDYLAKPFYTEELLARLRALLRRAAGLATADIEVGKLRIDTRASRVTFDGNPVKLTSQEYRLLSYLAHHRGKVVSRTELVEHLYDQDFDRDSNTIEVFIGRLRKKLDAGLIQTVRGLGYSLEDPKLGGTAAEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 3 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 4 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 5 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 6 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 7 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 8 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 9 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 10 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 11 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 12 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 13 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 14 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 15 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 16 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 17 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 18 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 19 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 20 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 21 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 22 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 23 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 24 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 25 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 26 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 27 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 28 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 29 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 30 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 31 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 32 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 33 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 34 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 35 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 36 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 37 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 38 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 39 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 40 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 41 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 42 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 43 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 44 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 45 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 46 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 47 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 48 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 49 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 50 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 51 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 52 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 53 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 54 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 55 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 56 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 57 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 58 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 59 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 60 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 61 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 62 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 63 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 64 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 65 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 66 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 67 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 68 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 69 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 70 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 71 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 72 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 73 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 74 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 75 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 76 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 77 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 78 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 79 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 80 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 81 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 82 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 83 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 84 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 85 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 86 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 87 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 88 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 89 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 90 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 91 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 92 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 93 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 94 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 95 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 96 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 97 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 98 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 99 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 100 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 101 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 102 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 103 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 104 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 105 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 106 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 107 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 108 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 109 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 110 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 111 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 112 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 113 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 114 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 115 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 116 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 117 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 118 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 119 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 120 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 121 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 122 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 123 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 124 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 125 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 126 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 127 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 128 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 129 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 130 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 131 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 132 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 133 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 134 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 135 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 136 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 137 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 138 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 139 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 140 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 141 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 142 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 143 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 144 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 145 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 146 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 147 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 148 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 149 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 150 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 151 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 152 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 153 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 154 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 155 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 156 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 157 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 158 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 159 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 160 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 161 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 162 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 163 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 164 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 165 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 166 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 167 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 168 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 169 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 170 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 171 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 172 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 173 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 174 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 175 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 176 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 177 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 178 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 179 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 180 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 181 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 182 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 183 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 184 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 185 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 186 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 187 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 188 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 189 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 190 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 191 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 192 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 193 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 194 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 195 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 196 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 197 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 198 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 199 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 200 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 201 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 202 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 203 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 204 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 205 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 206 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 207 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 208 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 209 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 210 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 211 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 212 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 213 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 214 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 215 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 216 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 217 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 218 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 219 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 220 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 221 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 222 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 223 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 224 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 225 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 226 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 227 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 228 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 229 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 230 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 231 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 232 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 233 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 234 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 235 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 236 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 237 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 238 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 239 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 240 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 241 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 242 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 243 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 244 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 245 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 246 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 247 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 248 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 249 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 250 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 251 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 252 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 253 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 254 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 255 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 256 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 257 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 258 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 259 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 260 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 261 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 262 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 263 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 264 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 265 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 266 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 267 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 268 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 269 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 270 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 271 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 272 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 273 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 274 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 275 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 276 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 277 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 278 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 279 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 280 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 281 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 282 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 283 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 284 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 285 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 286 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 287 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 288 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 289 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 290 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 291 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 292 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 293 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 294 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 295 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 296 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 297 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 298 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 299 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 300 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 301 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 302 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 303 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 304 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 305 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 306 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 307 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 308 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 309 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 310 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 311 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 312 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 313 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 314 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 315 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 316 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 317 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 318 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 319 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 320 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 321 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 322 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 323 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 324 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 325 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 326 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 327 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 328 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 329 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 330 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 331 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 332 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 333 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 334 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 335 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 336 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 337 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 338 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 339 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 340 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 341 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 342 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 343 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 344 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 345 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 346 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 347 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 348 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 349 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 350 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 351 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 352 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 353 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 354 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 355 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 356 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 357 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 358 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 359 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 360 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 361 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 362 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 363 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 364 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 365 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 366 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 367 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 368 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 369 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 370 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 371 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 372 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 373 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 374 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 375 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 376 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 377 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 378 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 379 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 380 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 381 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 382 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 383 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 384 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 385 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 386 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 387 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 388 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 389 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 390 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 391 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 392 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 393 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 394 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 395 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 396 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 397 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 398 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 399 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 400 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 401 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 402 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 403 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 404 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 405 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 406 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 407 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 408 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 409 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 410 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 411 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 412 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 413 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 414 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 415 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 416 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 417 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 418 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 419 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 420 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 421 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 422 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 423 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 424 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 425 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 426 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 427 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 428 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 429 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 430 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 431 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 432 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 433 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 434 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 435 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 436 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 437 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 438 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 439 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 440 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 441 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 442 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 443 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 444 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 445 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 446 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 447 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 448 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 449 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 450 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 451 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 452 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 453 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 454 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 455 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 456 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 457 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 458 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 459 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 460 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 461 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 462 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 463 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 464 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 465 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 466 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 467 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 468 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 469 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 470 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 471 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 472 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 473 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 474 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 475 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 476 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 477 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 478 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 479 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 480 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 481 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 482 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 483 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 484 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 485 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 486 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 487 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 488 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 489 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 490 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 491 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 492 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 493 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 494 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 495 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 496 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 497 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 498 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 499 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 500 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 501 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 502 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 503 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 504 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 505 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 506 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 507 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 508 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 509 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 510 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 511 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 512 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 513 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 514 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 515 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 516 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 517 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 518 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 519 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 520 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 521 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 522 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 523 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 524 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 525 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 526 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 527 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 528 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 529 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 530 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 531 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 532 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 533 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 534 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 535 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 536 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 537 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 538 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 539 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 540 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 541 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 542 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 543 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 544 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 545 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 546 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 547 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 548 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 549 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 550 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 551 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 552 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 553 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 554 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 555 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 556 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 557 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 558 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 559 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 560 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 561 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 562 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 563 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 564 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 565 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 566 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 567 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 568 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 569 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 570 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 571 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 572 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 573 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 574 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 575 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 576 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 577 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 578 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 579 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 580 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 581 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 582 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 583 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 584 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 585 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 586 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 587 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 588 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 589 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 590 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 591 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 592 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 593 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 594 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 595 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 596 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 597 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 598 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 599 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 600 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 601 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 602 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 603 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 604 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 605 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 606 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 607 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 608 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 609 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 610 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 611 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 612 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 613 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 614 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 615 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 616 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 617 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 618 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 619 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 620 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 621 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 622 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 623 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 624 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 625 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 626 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 627 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 628 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 629 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 630 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 631 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 632 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 633 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 634 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 635 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 636 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 637 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 638 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 639 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 640 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 641 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 642 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 643 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 644 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 645 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 646 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 647 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 648 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 649 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 650 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 651 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 652 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 653 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 654 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 655 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 656 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 657 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 658 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 659 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 660 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 661 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 662 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 663 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 664 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 665 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 666 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 667 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 668 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 669 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 670 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 671 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 672 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 673 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 674 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 675 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 676 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 677 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 678 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 679 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 680 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 681 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 682 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 683 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 684 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 685 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 686 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 687 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 688 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 689 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 690 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 691 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 692 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 693 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 694 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 695 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 696 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 697 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 698 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 699 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 700 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 701 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 702 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 703 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 704 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 705 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 706 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 707 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 708 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 709 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 710 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 711 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 712 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 713 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 714 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 715 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 716 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 717 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 718 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 719 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 720 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 721 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 722 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 723 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 724 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 725 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 726 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 727 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 728 | 3300041497 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT | Metatranscriptome | Unclassified |
| 729 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 730 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 731 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 732 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 733 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 734 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 735 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 736 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 737 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 738 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 739 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 740 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 741 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 742 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 743 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 744 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 745 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 746 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 747 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 748 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 749 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 750 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 751 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 752 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 753 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 754 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 755 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 756 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 757 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 758 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 759 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 760 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 761 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 762 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 763 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 764 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 765 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 766 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 767 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 768 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 769 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 770 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 771 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 772 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 773 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 774 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 775 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 776 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 777 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 778 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 779 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 780 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 781 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 782 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 783 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 784 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 785 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 786 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 787 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 788 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 789 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 790 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 791 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 792 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 793 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 794 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 795 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 796 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 797 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 798 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 799 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 800 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 801 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 802 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 803 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 804 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 805 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 806 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 807 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 808 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 809 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 810 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 811 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 812 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 813 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 814 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 815 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 816 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 817 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 818 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 819 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 820 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 821 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 822 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 823 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 824 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 825 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 826 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 827 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 828 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 829 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 830 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 831 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 832 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 833 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 834 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 835 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 836 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 837 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 838 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 839 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 840 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 841 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 842 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 843 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 844 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 845 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 846 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 847 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 848 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 849 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 850 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 851 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 852 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 853 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 854 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 855 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 856 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 857 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 858 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 859 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 860 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 861 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 862 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 863 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 864 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 865 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 866 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 867 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 868 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 869 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 870 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 871 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 872 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 873 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 874 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 875 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 876 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 877 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 878 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 879 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 880 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 881 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 882 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 883 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 884 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 885 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 886 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 887 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 888 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 889 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 890 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 891 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 892 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 893 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 894 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 895 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 896 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 897 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 898 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 899 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 900 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 901 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 902 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 903 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 904 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 905 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 906 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 907 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 908 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 909 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 910 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 911 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 912 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 913 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 914 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 915 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 916 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 917 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 918 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 919 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 920 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 921 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 922 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 923 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 69.34 |
| Metatranscriptomes | 0.25 |
| Isolates | 30.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.1 |
| Nodule | 25.38 |
| Rhizoplane | 1.27 |
| Rhizosphere | 52.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1001068 | 3300001915 | Bacteria | 8189 |
| 2 | JGI24740J21852_10001706 | 3300001979 | Bacteria | 10085 |
| 3 | JGI24740J21852_10011169 | 3300001979 | Bacteria | 3428 |
| 4 | JGI24739J22299_10014633 | 3300001989 | Bacteria | 2851 |
| 5 | JGI24737J22298_10010599 | 3300001990 | Bacteria | 3038 |
| 6 | JGI24737J22298_10018602 | 3300001990 | Bacteria | 2228 |
| 7 | JGI25155J39150_1000089 | 3300002704 | Bacteria | 51946 |
| 8 | JGI25156J39149_1000147 | 3300002705 | Bacteria | 51946 |
| 9 | JGI25162J39368_1000243 | 3300002737 | Bacteria | 54503 |
| 10 | JGI25162J39368_1000372 | 3300002737 | Bacteria | 38119 |
| 11 | JGI25154J39366_1000160 | 3300002738 | Bacteria | 51946 |
| 12 | JGI25158J39367_1000293 | 3300002739 | Bacteria | 11361 |
| 13 | JGI25158J39367_1001028 | 3300002739 | Bacteria | 5095 |
| 14 | JGI25157J39369_1000190 | 3300002741 | Bacteria | 51946 |
| 15 | JGI25152J39213_1003430 | 3300002773 | Bacteria | 5419 |
| 16 | JGI25152J39213_1004848 | 3300002773 | Bacteria | 4112 |
| 17 | JGI25152J39213_1006337 | 3300002773 | Bacteria | 3248 |
| 18 | JGI25152J39213_1006342 | 3300002773 | Bacteria | 3247 |
| 19 | JGI25152J39213_1006896 | 3300002773 | Bacteria | 3006 |
| 20 | JGI25150J39212_1000031 | 3300002774 | Bacteria | 100456 |
| 21 | JGI25159J45721_1000001 | 3300002987 | Bacteria | 303489 |
| 22 | JGI25159J45721_1000264 | 3300002987 | Bacteria | 24458 |
| 23 | JGI25151J46595_10000062 | 3300003187 | Bacteria | 146687 |
| 24 | JGI25151J46595_10003599 | 3300003187 | Bacteria | 8487 |
| 25 | JGI25151J46595_10004214 | 3300003187 | Bacteria | 7650 |
| 26 | JGI25151J46595_10014854 | 3300003187 | Bacteria | 3456 |
| 27 | JGI25151J46595_10036908 | 3300003187 | Bacteria | 1838 |
| 28 | JGI25165J46597_1000017 | 3300003214 | Bacteria | 377013 |
| 29 | JGI25165J46597_1000318 | 3300003214 | Bacteria | 57977 |
| 30 | JGI25165J46597_1000413 | 3300003214 | Bacteria | 44960 |
| 31 | JGI25165J46597_1004436 | 3300003214 | Bacteria | 3013 |
| 32 | JGI25153J46596_10000021 | 3300003215 | Bacteria | 252651 |
| 33 | JGI25153J46596_10000755 | 3300003215 | Bacteria | 19791 |
| 34 | JGI25153J46596_10002646 | 3300003215 | Bacteria | 10240 |
| 35 | JGI25153J46596_10006186 | 3300003215 | Bacteria | 6124 |
| 36 | JGI25153J46596_10034305 | 3300003215 | Bacteria | 1661 |
| 37 | JGI25153J46596_10034323 | 3300003215 | Bacteria | 1660 |
| 38 | rootH1_10006292 | 3300003316 | Bacteria | 6778 |
| 39 | JGI25160J50197_1000002 | 3300003354 | Bacteria | 561707 |
| 40 | JGI25160J50197_1000855 | 3300003354 | Bacteria | 16156 |
| 41 | JGI25160J50197_1001062 | 3300003354 | Bacteria | 14110 |
| 42 | JGI25160J50197_1013067 | 3300003354 | Bacteria | 2848 |
| 43 | JGI25161J50226_1000338 | 3300003374 | Bacteria | 25195 |
| 44 | JGI25161J50226_1000742 | 3300003374 | Bacteria | 12536 |
| 45 | JGI25161J50226_1001156 | 3300003374 | Bacteria | 8773 |
| 46 | Ga0055525_1000070 | 3300003759 | Bacteria | 183047 |
| 47 | Ga0055542_1000102 | 3300003762 | Bacteria | 115614 |
| 48 | Ga0055529_1000136 | 3300003763 | Bacteria | 104102 |
| 49 | Ga0055526_1000042 | 3300003771 | Bacteria | 124886 |
| 50 | Ga0055526_1000805 | 3300003771 | Bacteria | 23389 |
| 51 | Ga0055526_1005449 | 3300003771 | Bacteria | 7317 |
| 52 | Ga0055526_1010411 | 3300003771 | Bacteria | 4328 |
| 53 | Ga0055526_1019686 | 3300003771 | Bacteria | 2446 |
| 54 | Ga0055526_1020429 | 3300003771 | Bacteria | 2357 |
| 55 | Ga0055526_1030080 | 3300003771 | Bacteria | 1593 |
| 56 | Ga0055524_1000650 | 3300003775 | Bacteria | 24635 |
| 57 | Ga0055524_1006021 | 3300003775 | Bacteria | 5324 |
| 58 | Ga0055524_1011277 | 3300003775 | Bacteria | 3507 |
| 59 | Ga0055524_1012192 | 3300003775 | Bacteria | 3314 |
| 60 | Ga0055524_1017549 | 3300003775 | Bacteria | 2522 |
| 61 | Ga0055524_1022121 | 3300003775 | Bacteria | 2086 |
| 62 | Ga0055524_1024531 | 3300003775 | Bacteria | 1910 |
| 63 | Ga0055536_1000427 | 3300003781 | Bacteria | 30054 |
| 64 | Ga0055528_1000607 | 3300003790 | Bacteria | 26876 |
| 65 | Ga0055528_1000798 | 3300003790 | Bacteria | 21827 |
| 66 | Ga0055528_1005643 | 3300003790 | Bacteria | 5778 |
| 67 | Ga0055528_1013886 | 3300003790 | Bacteria | 3021 |
| 68 | Ga0055528_1030911 | 3300003790 | Bacteria | 1407 |
| 69 | Ga0055530_10004975 | 3300003791 | Bacteria | 6570 |
| 70 | Ga0055540_1000380 | 3300003792 | Bacteria | 37153 |
| 71 | Ga0055540_1010288 | 3300003792 | Bacteria | 3125 |
| 72 | Ga0055540_1013681 | 3300003792 | Bacteria | 2463 |
| 73 | Ga0055540_1033501 | 3300003792 | Bacteria | 1163 |
| 74 | Ga0055531_10029444 | 3300003794 | Bacteria | 1869 |
| 75 | Ga0058692_1013229 | 3300003856 | Bacteria | 1928 |
| 76 | Ga0055543_1000115 | 3300004625 | Bacteria | 68252 |
| 77 | Ga0055543_1000137 | 3300004625 | Bacteria | 60651 |
| 78 | Ga0055543_1003775 | 3300004625 | Bacteria | 4323 |
| 79 | Ga0065165_1000004 | 3300005262 | Bacteria | 377081 |
| 80 | Ga0065165_1003706 | 3300005262 | Bacteria | 10353 |
| 81 | Ga0065165_1045465 | 3300005262 | Bacteria | 1279 |
| 82 | Ga0070658_10010959 | 3300005327 | Bacteria | 7266 |
| 83 | Ga0070658_10053726 | 3300005327 | Bacteria | 3270 |
| 84 | Ga0070658_10075769 | 3300005327 | Bacteria | 2760 |
| 85 | Ga0070676_10005044 | 3300005328 | Bacteria | 6995 |
| 86 | Ga0070690_100400562 | 3300005330 | Bacteria | 1008 |
| 87 | Ga0070670_100091084 | 3300005331 | Bacteria | 2621 |
| 88 | Ga0070670_100098407 | 3300005331 | Bacteria | 2517 |
| 89 | Ga0070670_100169119 | 3300005331 | Bacteria | 1896 |
| 90 | Ga0068869_100003248 | 3300005334 | Bacteria | 9934 |
| 91 | Ga0070666_10005936 | 3300005335 | Bacteria | 7498 |
| 92 | Ga0070666_10008438 | 3300005335 | Bacteria | 6398 |
| 93 | Ga0070680_100000100 | 3300005336 | Bacteria | 49540 |
| 94 | Ga0070680_100096703 | 3300005336 | Bacteria | 2448 |
| 95 | Ga0068868_100156958 | 3300005338 | Bacteria | 1877 |
| 96 | Ga0068868_100468459 | 3300005338 | Bacteria | 1098 |
| 97 | Ga0070660_100004214 | 3300005339 | Bacteria | 9925 |
| 98 | Ga0070660_100017038 | 3300005339 | Bacteria | 5289 |
| 99 | Ga0070660_100058836 | 3300005339 | Bacteria | 2979 |
| 100 | Ga0070660_100579161 | 3300005339 | Bacteria | 937 |
| 101 | Ga0070689_100219546 | 3300005340 | Bacteria | 1559 |
| 102 | Ga0070691_10001507 | 3300005341 | Bacteria | 10004 |
| 103 | Ga0070691_10002680 | 3300005341 | Bacteria | 7928 |
| 104 | Ga0070691_10281054 | 3300005341 | Bacteria | 903 |
| 105 | Ga0070661_100000160 | 3300005344 | Bacteria | 55287 |
| 106 | Ga0070661_100010954 | 3300005344 | Bacteria | 6319 |
| 107 | Ga0070661_100034466 | 3300005344 | Bacteria | 3670 |
| 108 | Ga0070661_100302359 | 3300005344 | Bacteria | 1246 |
| 109 | Ga0070668_100053738 | 3300005347 | Bacteria | 3106 |
| 110 | Ga0070668_100146586 | 3300005347 | Bacteria | 1906 |
| 111 | Ga0070675_100274295 | 3300005354 | Bacteria | 1481 |
| 112 | Ga0070674_100101869 | 3300005356 | Bacteria | 2094 |
| 113 | Ga0070673_100031659 | 3300005364 | Bacteria | 3973 |
| 114 | Ga0070688_100203110 | 3300005365 | Bacteria | 1388 |
| 115 | Ga0070659_100028368 | 3300005366 | Bacteria | 4322 |
| 116 | Ga0070659_100095870 | 3300005366 | Bacteria | 2383 |
| 117 | Ga0070667_100122040 | 3300005367 | Bacteria | 2267 |
| 118 | Ga0070709_10001001 | 3300005434 | Bacteria | 15591 |
| 119 | Ga0070709_10493890 | 3300005434 | Bacteria | 929 |
| 120 | Ga0070714_100012979 | 3300005435 | Bacteria | 6663 |
| 121 | Ga0070714_100022269 | 3300005435 | Bacteria | 5194 |
| 122 | Ga0070714_100865222 | 3300005435 | Bacteria | 877 |
| 123 | Ga0070713_100000262 | 3300005436 | Bacteria | 34628 |
| 124 | Ga0070713_100061009 | 3300005436 | Bacteria | 3154 |
| 125 | Ga0070710_10334401 | 3300005437 | Bacteria | 998 |
| 126 | Ga0070711_100197511 | 3300005439 | Bacteria | 1550 |
| 127 | Ga0070711_100635050 | 3300005439 | Bacteria | 894 |
| 128 | Ga0070711_100902852 | 3300005439 | Bacteria | 754 |
| 129 | Ga0070705_100119002 | 3300005440 | Bacteria | 1702 |
| 130 | Ga0070705_100324345 | 3300005440 | Bacteria | 1113 |
| 131 | Ga0070678_100000139 | 3300005456 | Bacteria | 29667 |
| 132 | Ga0070678_100262262 | 3300005456 | Bacteria | 1454 |
| 133 | Ga0070678_100837028 | 3300005456 | Bacteria | 838 |
| 134 | Ga0070662_100276456 | 3300005457 | Bacteria | 1358 |
| 135 | Ga0070681_10000003 | 3300005458 | Bacteria | 252785 |
| 136 | Ga0070681_10040066 | 3300005458 | Bacteria | 4697 |
| 137 | Ga0070681_10075303 | 3300005458 | Bacteria | 3335 |
| 138 | Ga0070681_10082403 | 3300005458 | Bacteria | 3172 |
| 139 | Ga0068867_100018286 | 3300005459 | Bacteria | 4981 |
| 140 | Ga0068867_100100775 | 3300005459 | Bacteria | 2205 |
| 141 | Ga0068867_100114855 | 3300005459 | Bacteria | 2073 |
| 142 | Ga0068867_100412646 | 3300005459 | Bacteria | 1142 |
| 143 | Ga0070685_10338153 | 3300005466 | Bacteria | 1026 |
| 144 | Ga0070707_100742212 | 3300005468 | Bacteria | 945 |
| 145 | Ga0070679_100001255 | 3300005530 | Bacteria | 22375 |
| 146 | Ga0070679_100015724 | 3300005530 | Bacteria | 7277 |
| 147 | Ga0070679_100163594 | 3300005530 | Bacteria | 2199 |
| 148 | Ga0070679_100353154 | 3300005530 | Bacteria | 1418 |
| 149 | Ga0070684_100245317 | 3300005535 | Bacteria | 1637 |
| 150 | Ga0070697_100625443 | 3300005536 | Bacteria | 947 |
| 151 | Ga0068853_100029148 | 3300005539 | Bacteria | 4650 |
| 152 | Ga0068853_100063732 | 3300005539 | Bacteria | 3193 |
| 153 | Ga0068853_100147644 | 3300005539 | Bacteria | 2114 |
| 154 | Ga0068853_100203524 | 3300005539 | Bacteria | 1802 |
| 155 | Ga0070672_100054920 | 3300005543 | Bacteria | 3119 |
| 156 | Ga0070686_100642102 | 3300005544 | Bacteria | 841 |
| 157 | Ga0070693_100081219 | 3300005547 | Bacteria | 1933 |
| 158 | Ga0070693_100187440 | 3300005547 | Bacteria | 1336 |
| 159 | Ga0070665_100001553 | 3300005548 | Bacteria | 26522 |
| 160 | Ga0070665_100181852 | 3300005548 | Bacteria | 2104 |
| 161 | Ga0070665_100316226 | 3300005548 | Bacteria | 1565 |
| 162 | Ga0070665_101068319 | 3300005548 | Bacteria | 819 |
| 163 | Ga0068855_100000374 | 3300005563 | Bacteria | 55329 |
| 164 | Ga0068855_100025478 | 3300005563 | Bacteria | 7076 |
| 165 | Ga0068855_100031230 | 3300005563 | Bacteria | 6361 |
| 166 | Ga0068855_100066217 | 3300005563 | Bacteria | 4212 |
| 167 | Ga0068855_100113925 | 3300005563 | Bacteria | 3101 |
| 168 | Ga0068855_100716604 | 3300005563 | Bacteria | 1069 |
| 169 | Ga0070664_100248465 | 3300005564 | Bacteria | 1598 |
| 170 | Ga0068857_100001171 | 3300005577 | Bacteria | 20458 |
| 171 | Ga0068857_100066779 | 3300005577 | Bacteria | 3201 |
| 172 | Ga0068854_100037323 | 3300005578 | Bacteria | 3410 |
| 173 | Ga0068856_100003455 | 3300005614 | Bacteria | 15973 |
| 174 | Ga0068856_100003973 | 3300005614 | Bacteria | 14814 |
| 175 | Ga0068852_100005263 | 3300005616 | Bacteria | 9233 |
| 176 | Ga0068852_100036960 | 3300005616 | Bacteria | 4092 |
| 177 | Ga0068861_100038208 | 3300005719 | Bacteria | 3573 |
| 178 | Ga0068861_100078905 | 3300005719 | Bacteria | 2572 |
| 179 | Ga0068851_10253758 | 3300005834 | Bacteria | 998 |
| 180 | Ga0068863_100171572 | 3300005841 | Bacteria | 2080 |
| 181 | Ga0068858_100017646 | 3300005842 | Bacteria | 6690 |
| 182 | Ga0068858_100122719 | 3300005842 | Bacteria | 2431 |
| 183 | Ga0068858_100404699 | 3300005842 | Bacteria | 1311 |
| 184 | Ga0068860_100152944 | 3300005843 | Bacteria | 2222 |
| 185 | Ga0068860_100190810 | 3300005843 | Bacteria | 1983 |
| 186 | Ga0068862_100046983 | 3300005844 | Bacteria | 3683 |
| 187 | Ga0068862_100267796 | 3300005844 | Bacteria | 1561 |
| 188 | Ga0068862_100281608 | 3300005844 | Bacteria | 1524 |
| 189 | Ga0075365_10075176 | 3300006038 | Bacteria | 2279 |
| 190 | Ga0075368_10227118 | 3300006042 | Bacteria | 794 |
| 191 | Ga0075363_100153505 | 3300006048 | Bacteria | 1301 |
| 192 | Ga0075364_10032539 | 3300006051 | Bacteria | 3353 |
| 193 | Ga0070716_100007829 | 3300006173 | Bacteria | 5281 |
| 194 | Ga0070712_100000171 | 3300006175 | Bacteria | 35631 |
| 195 | Ga0070712_100008256 | 3300006175 | Bacteria | 6542 |
| 196 | Ga0075362_10070603 | 3300006177 | Bacteria | 1594 |
| 197 | Ga0075367_10023622 | 3300006178 | Bacteria | 3462 |
| 198 | Ga0075367_10127194 | 3300006178 | Bacteria | 1573 |
| 199 | Ga0075367_10184832 | 3300006178 | Bacteria | 1300 |
| 200 | Ga0075367_10204975 | 3300006178 | Bacteria | 1232 |
| 201 | Ga0075366_10012273 | 3300006195 | Bacteria | 4858 |
| 202 | Ga0075366_10050728 | 3300006195 | Bacteria | 2464 |
| 203 | Ga0097621_100073785 | 3300006237 | Bacteria | 2825 |
| 204 | Ga0097621_100577839 | 3300006237 | Bacteria | 1025 |
| 205 | Ga0075370_10112041 | 3300006353 | Bacteria | 1585 |
| 206 | Ga0075370_10113838 | 3300006353 | Bacteria | 1572 |
| 207 | Ga0068871_100026285 | 3300006358 | Bacteria | 4541 |
| 208 | Ga0068871_100165022 | 3300006358 | Bacteria | 1896 |
| 209 | Ga0075431_100012097 | 3300006847 | Bacteria | 8707 |
| 210 | Ga0075434_100029143 | 3300006871 | Bacteria | 5429 |
| 211 | Ga0075429_100723170 | 3300006880 | Bacteria | 872 |
| 212 | Ga0075436_100001738 | 3300006914 | Bacteria | 14913 |
| 213 | Ga0075436_100055208 | 3300006914 | Bacteria | 2743 |
| 214 | Ga0079104_1001952 | 3300006946 | Bacteria | 12226 |
| 215 | Ga0079104_1006397 | 3300006946 | Bacteria | 4466 |
| 216 | Ga0075435_100119646 | 3300007076 | Bacteria | 2197 |
| 217 | Ga0105250_10027216 | 3300009092 | Bacteria | 2304 |
| 218 | Ga0105240_10000027 | 3300009093 | Bacteria | 348486 |
| 219 | Ga0105240_10002036 | 3300009093 | Bacteria | 33289 |
| 220 | Ga0105240_10002102 | 3300009093 | Bacteria | 32589 |
| 221 | Ga0105240_10410921 | 3300009093 | Bacteria | 1522 |
| 222 | Ga0105240_10434757 | 3300009093 | Bacteria | 1472 |
| 223 | Ga0105240_10488377 | 3300009093 | Bacteria | 1371 |
| 224 | Ga0105245_10030128 | 3300009098 | Bacteria | 4797 |
| 225 | Ga0105245_10072143 | 3300009098 | Bacteria | 3136 |
| 226 | Ga0105245_10162320 | 3300009098 | Bacteria | 2121 |
| 227 | Ga0105245_10952398 | 3300009098 | Bacteria | 901 |
| 228 | Ga0105247_10080264 | 3300009101 | Bacteria | 2054 |
| 229 | Ga0105247_10102920 | 3300009101 | Bacteria | 1828 |
| 230 | Ga0105247_10417463 | 3300009101 | Bacteria | 960 |
| 231 | Ga0114129_10031485 | 3300009147 | Bacteria | 7498 |
| 232 | Ga0105243_10000367 | 3300009148 | Bacteria | 48386 |
| 233 | Ga0105243_10007689 | 3300009148 | Bacteria | 8283 |
| 234 | Ga0105241_10010758 | 3300009174 | Bacteria | 6715 |
| 235 | Ga0105241_10044755 | 3300009174 | Bacteria | 3355 |
| 236 | Ga0105241_10051327 | 3300009174 | Bacteria | 3145 |
| 237 | Ga0105241_10077387 | 3300009174 | Bacteria | 2596 |
| 238 | Ga0105241_10078979 | 3300009174 | Bacteria | 2572 |
| 239 | Ga0105241_10782045 | 3300009174 | Bacteria | 878 |
| 240 | Ga0105242_10012664 | 3300009176 | Bacteria | 6495 |
| 241 | Ga0105242_10043250 | 3300009176 | Bacteria | 3644 |
| 242 | Ga0105242_10048929 | 3300009176 | Bacteria | 3438 |
| 243 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 244 | Ga0105248_10060975 | 3300009177 | Bacteria | 4234 |
| 245 | Ga0105248_10091837 | 3300009177 | Bacteria | 3419 |
| 246 | Ga0105248_10539530 | 3300009177 | Bacteria | 1316 |
| 247 | Ga0105237_10056896 | 3300009545 | Bacteria | 3913 |
| 248 | Ga0105237_10139538 | 3300009545 | Bacteria | 2418 |
| 249 | Ga0105237_10162691 | 3300009545 | Bacteria | 2230 |
| 250 | Ga0105237_10175205 | 3300009545 | Bacteria | 2145 |
| 251 | Ga0105237_10315632 | 3300009545 | Bacteria | 1566 |
| 252 | Ga0105237_10320520 | 3300009545 | Bacteria | 1553 |
| 253 | Ga0105238_10007661 | 3300009551 | Bacteria | 10805 |
| 254 | Ga0105238_10009150 | 3300009551 | Bacteria | 9916 |
| 255 | Ga0105238_10019021 | 3300009551 | Bacteria | 6995 |
| 256 | Ga0105238_10051343 | 3300009551 | Bacteria | 4148 |
| 257 | Ga0105249_10219821 | 3300009553 | Bacteria | 1869 |
| 258 | Ga0123341_1000006 | 3300009765 | Bacteria | 149197 |
| 259 | Ga0123342_1004514 | 3300009766 | Bacteria | 21146 |
| 260 | Ga0105239_10047501 | 3300010375 | Bacteria | 4704 |
| 261 | Ga0105246_10089264 | 3300011119 | Bacteria | 2217 |
| 262 | Ga0105246_10186534 | 3300011119 | Bacteria | 1602 |
| 263 | Ga0157373_10029739 | 3300013100 | Bacteria | 3933 |
| 264 | Ga0157373_10037466 | 3300013100 | Bacteria | 3476 |
| 265 | Ga0157373_10071232 | 3300013100 | Bacteria | 2456 |
| 266 | Ga0157373_10390964 | 3300013100 | Bacteria | 996 |
| 267 | Ga0157371_10000066 | 3300013102 | Bacteria | 168406 |
| 268 | Ga0157370_10000223 | 3300013104 | Bacteria | 72025 |
| 269 | Ga0157370_10001228 | 3300013104 | Bacteria | 32108 |
| 270 | Ga0157370_10004692 | 3300013104 | Bacteria | 15583 |
| 271 | Ga0157370_10035120 | 3300013104 | Bacteria | 4876 |
| 272 | Ga0157370_10061333 | 3300013104 | Bacteria | 3569 |
| 273 | Ga0157369_10086504 | 3300013105 | Bacteria | 3348 |
| 274 | Ga0157369_10237916 | 3300013105 | Bacteria | 1902 |
| 275 | Ga0157369_10495606 | 3300013105 | Bacteria | 1264 |
| 276 | Ga0171463_1001 | 3300013249 | Bacteria | 1406070 |
| 277 | Ga0157374_10097921 | 3300013296 | Bacteria | 2807 |
| 278 | Ga0157378_10013145 | 3300013297 | Bacteria | 7243 |
| 279 | Ga0157378_10327659 | 3300013297 | Bacteria | 1489 |
| 280 | Ga0163162_10116440 | 3300013306 | Bacteria | 2773 |
| 281 | Ga0157372_10004646 | 3300013307 | Bacteria | 14596 |
| 282 | Ga0157372_10011401 | 3300013307 | Bacteria | 9455 |
| 283 | Ga0157372_10014340 | 3300013307 | Bacteria | 8473 |
| 284 | Ga0157372_10049388 | 3300013307 | Bacteria | 4678 |
| 285 | Ga0157372_10116365 | 3300013307 | Bacteria | 3065 |
| 286 | Ga0157375_10034969 | 3300013308 | Bacteria | 4791 |
| 287 | Ga0157375_10367931 | 3300013308 | Bacteria | 1604 |
| 288 | Ga0163163_10000004 | 3300014325 | Bacteria | 416569 |
| 289 | Ga0163163_10315573 | 3300014325 | Bacteria | 1616 |
| 290 | Ga0157380_10629063 | 3300014326 | Bacteria | 1067 |
| 291 | Ga0157379_10001940 | 3300014968 | Bacteria | 17108 |
| 292 | Ga0157379_10009144 | 3300014968 | Bacteria | 8629 |
| 293 | Ga0157379_10022145 | 3300014968 | Bacteria | 5633 |
| 294 | Ga0157379_10299080 | 3300014968 | Bacteria | 1466 |
| 295 | Ga0157376_10009191 | 3300014969 | Bacteria | 7170 |
| 296 | Ga0157376_10194471 | 3300014969 | Bacteria | 1862 |
| 297 | Ga0182007_10000805 | 3300015262 | Bacteria | 17521 |
| 298 | Ga0183363_1266 | 3300015690 | Bacteria | 8469 |
| 299 | Ga0163161_10040297 | 3300017792 | Bacteria | 3354 |
| 300 | Ga0163161_10059986 | 3300017792 | Bacteria | 2768 |
| 301 | Ga0163161_10672612 | 3300017792 | Bacteria | 860 |
| 302 | Ga0214544_1000008 | 3300021320 | Bacteria | 326027 |
| 303 | Ga0214542_1000010 | 3300021321 | Bacteria | 262816 |
| 304 | Ga0214542_1022278 | 3300021321 | Bacteria | 4099 |
| 305 | Ga0214543_1000003 | 3300021327 | Bacteria | 692327 |
| 306 | Ga0214543_1000004 | 3300021327 | Bacteria | 527190 |
| 307 | Ga0213872_10017525 | 3300021361 | Bacteria | 3308 |
| 308 | Ga0213874_10025338 | 3300021377 | Bacteria | 1672 |
| 309 | Ga0213876_10000498 | 3300021384 | Bacteria | 30587 |
| 310 | Ga0213876_10020884 | 3300021384 | Bacteria | 3462 |
| 311 | Ga0228711_1000001 | 3300022739 | Bacteria | 357377 |
| 312 | Ga0228710_1000001 | 3300022740 | Bacteria | 314328 |
| 313 | Ga0209435_100036 | 3300025206 | Bacteria | 126970 |
| 314 | Ga0209436_101062 | 3300025208 | Bacteria | 10405 |
| 315 | Ga0209436_101252 | 3300025208 | Bacteria | 9141 |
| 316 | Ga0209674_108574 | 3300025226 | Bacteria | 1201 |
| 317 | Ga0209672_103497 | 3300025228 | Bacteria | 3227 |
| 318 | Ga0209563_100053 | 3300025230 | Bacteria | 332370 |
| 319 | Ga0207427_107239 | 3300025231 | Bacteria | 1317 |
| 320 | Ga0209437_100033 | 3300025233 | Bacteria | 512520 |
| 321 | Ga0209437_100036 | 3300025233 | Bacteria | 469153 |
| 322 | Ga0207425_1000031 | 3300025245 | Bacteria | 261181 |
| 323 | Ga0207425_1001175 | 3300025245 | Bacteria | 11688 |
| 324 | Ga0207425_1007557 | 3300025245 | Bacteria | 2856 |
| 325 | Ga0207425_1011070 | 3300025245 | Bacteria | 2169 |
| 326 | Ga0209646_1000132 | 3300025246 | Bacteria | 126859 |
| 327 | Ga0209026_1000313 | 3300025250 | Bacteria | 52121 |
| 328 | Ga0209677_100419 | 3300025253 | Bacteria | 25164 |
| 329 | Ga0209677_107461 | 3300025253 | Bacteria | 2321 |
| 330 | Ga0209148_1000159 | 3300025254 | Bacteria | 139560 |
| 331 | Ga0209148_1020173 | 3300025254 | Bacteria | 1099 |
| 332 | Ga0209759_1000417 | 3300025256 | Bacteria | 52121 |
| 333 | Ga0209129_1000053 | 3300025258 | Bacteria | 262823 |
| 334 | Ga0209129_1000125 | 3300025258 | Bacteria | 133506 |
| 335 | Ga0209129_1000465 | 3300025258 | Bacteria | 29855 |
| 336 | Ga0209129_1000945 | 3300025258 | Bacteria | 17461 |
| 337 | Ga0209129_1002143 | 3300025258 | Bacteria | 10013 |
| 338 | Ga0209129_1003204 | 3300025258 | Bacteria | 7312 |
| 339 | Ga0209129_1005526 | 3300025258 | Bacteria | 4433 |
| 340 | Ga0209233_1000006 | 3300025261 | Bacteria | 1473685 |
| 341 | Ga0209233_1000056 | 3300025261 | Bacteria | 438104 |
| 342 | Ga0209233_1000064 | 3300025261 | Bacteria | 392156 |
| 343 | Ga0209233_1000152 | 3300025261 | Bacteria | 175910 |
| 344 | Ga0209233_1015113 | 3300025261 | Bacteria | 2159 |
| 345 | Ga0209455_1000045 | 3300025272 | Bacteria | 383329 |
| 346 | Ga0209455_1005227 | 3300025272 | Bacteria | 4061 |
| 347 | Ga0209673_1000122 | 3300025273 | Bacteria | 170443 |
| 348 | Ga0209673_1000409 | 3300025273 | Bacteria | 75876 |
| 349 | Ga0209673_1003665 | 3300025273 | Bacteria | 8868 |
| 350 | Ga0209673_1004779 | 3300025273 | Bacteria | 7119 |
| 351 | Ga0209673_1005538 | 3300025273 | Bacteria | 6319 |
| 352 | Ga0209673_1008056 | 3300025273 | Bacteria | 4742 |
| 353 | Ga0209673_1008564 | 3300025273 | Bacteria | 4540 |
| 354 | Ga0209673_1010635 | 3300025273 | Bacteria | 3860 |
| 355 | Ga0209673_1024143 | 3300025273 | Bacteria | 2050 |
| 356 | Ga0209130_1000008 | 3300025284 | Bacteria | 581232 |
| 357 | Ga0209130_1000015 | 3300025284 | Bacteria | 409631 |
| 358 | Ga0209130_1006639 | 3300025284 | Bacteria | 3718 |
| 359 | Ga0209130_1010324 | 3300025284 | Bacteria | 2582 |
| 360 | Ga0209675_1018780 | 3300025291 | Bacteria | 1924 |
| 361 | Ga0209676_1000885 | 3300025292 | Bacteria | 38361 |
| 362 | Ga0209676_1027963 | 3300025292 | Bacteria | 1765 |
| 363 | Ga0209676_1046142 | 3300025292 | Bacteria | 1180 |
| 364 | Ga0209025_1000087 | 3300025294 | Bacteria | 261181 |
| 365 | Ga0209025_1000100 | 3300025294 | Bacteria | 229182 |
| 366 | Ga0209025_1000953 | 3300025294 | Bacteria | 43794 |
| 367 | Ga0209025_1001577 | 3300025294 | Bacteria | 28830 |
| 368 | Ga0209025_1009717 | 3300025294 | Bacteria | 6649 |
| 369 | Ga0209025_1011394 | 3300025294 | Bacteria | 5865 |
| 370 | Ga0209025_1011398 | 3300025294 | Bacteria | 5863 |
| 371 | Ga0209025_1020091 | 3300025294 | Bacteria | 3672 |
| 372 | Ga0209025_1027419 | 3300025294 | Bacteria | 2825 |
| 373 | Ga0209564_1000032 | 3300025295 | Bacteria | 464041 |
| 374 | Ga0209564_1000104 | 3300025295 | Bacteria | 219017 |
| 375 | Ga0209564_1001469 | 3300025295 | Bacteria | 23854 |
| 376 | Ga0209564_1001682 | 3300025295 | Bacteria | 21003 |
| 377 | Ga0209564_1002198 | 3300025295 | Bacteria | 16300 |
| 378 | Ga0209564_1006562 | 3300025295 | Bacteria | 6246 |
| 379 | Ga0209564_1010193 | 3300025295 | Bacteria | 4363 |
| 380 | Ga0209758_1000008 | 3300025297 | Bacteria | 1215263 |
| 381 | Ga0209758_1000023 | 3300025297 | Bacteria | 612453 |
| 382 | Ga0209758_1000081 | 3300025297 | Bacteria | 261181 |
| 383 | Ga0209758_1000313 | 3300025297 | Bacteria | 93883 |
| 384 | Ga0209758_1000376 | 3300025297 | Bacteria | 77855 |
| 385 | Ga0209758_1001096 | 3300025297 | Bacteria | 35059 |
| 386 | Ga0209758_1001417 | 3300025297 | Bacteria | 28365 |
| 387 | Ga0209758_1001419 | 3300025297 | Bacteria | 28354 |
| 388 | Ga0209758_1007473 | 3300025297 | Bacteria | 7420 |
| 389 | Ga0209758_1035521 | 3300025297 | Bacteria | 1963 |
| 390 | Ga0209758_1050100 | 3300025297 | Bacteria | 1467 |
| 391 | Ga0209050_1001263 | 3300025298 | Bacteria | 29191 |
| 392 | Ga0209050_1012590 | 3300025298 | Bacteria | 3860 |
| 393 | Ga0209256_1000351 | 3300025299 | Bacteria | 74921 |
| 394 | Ga0209256_1000711 | 3300025299 | Bacteria | 44226 |
| 395 | Ga0209256_1000723 | 3300025299 | Bacteria | 43638 |
| 396 | Ga0209256_1001198 | 3300025299 | Bacteria | 29038 |
| 397 | Ga0209256_1008596 | 3300025299 | Bacteria | 4692 |
| 398 | Ga0209256_1008685 | 3300025299 | Bacteria | 4645 |
| 399 | Ga0209256_1019583 | 3300025299 | Bacteria | 2148 |
| 400 | Ga0209256_1036607 | 3300025299 | Bacteria | 1286 |
| 401 | Ga0207426_1000016 | 3300025302 | Bacteria | 581232 |
| 402 | Ga0207426_1000122 | 3300025302 | Bacteria | 218307 |
| 403 | Ga0207426_1000146 | 3300025302 | Bacteria | 190683 |
| 404 | Ga0207426_1002469 | 3300025302 | Bacteria | 11759 |
| 405 | Ga0209051_1000127 | 3300025303 | Bacteria | 142254 |
| 406 | Ga0209051_1000918 | 3300025303 | Bacteria | 29277 |
| 407 | Ga0209051_1040904 | 3300025303 | Bacteria | 1656 |
| 408 | Ga0209257_1009728 | 3300025304 | Bacteria | 5054 |
| 409 | Ga0209257_1010230 | 3300025304 | Bacteria | 4803 |
| 410 | Ga0207697_10170076 | 3300025315 | Bacteria | 953 |
| 411 | Ga0207682_10089646 | 3300025893 | Bacteria | 1331 |
| 412 | Ga0207710_10073682 | 3300025900 | Bacteria | 1570 |
| 413 | Ga0207688_10008993 | 3300025901 | Bacteria | 5437 |
| 414 | Ga0207688_10106656 | 3300025901 | Bacteria | 1623 |
| 415 | Ga0207680_10012613 | 3300025903 | Bacteria | 4310 |
| 416 | Ga0207680_10106423 | 3300025903 | Bacteria | 1811 |
| 417 | Ga0207647_10042328 | 3300025904 | Bacteria | 2858 |
| 418 | Ga0207699_10000246 | 3300025906 | Bacteria | 30425 |
| 419 | Ga0207699_10030561 | 3300025906 | Bacteria | 3016 |
| 420 | Ga0207645_10025706 | 3300025907 | Bacteria | 3809 |
| 421 | Ga0207645_10025773 | 3300025907 | Bacteria | 3803 |
| 422 | Ga0207645_10122587 | 3300025907 | Bacteria | 1688 |
| 423 | Ga0207645_10158068 | 3300025907 | Bacteria | 1482 |
| 424 | Ga0207643_10076875 | 3300025908 | Bacteria | 1929 |
| 425 | Ga0207705_10001090 | 3300025909 | Bacteria | 22078 |
| 426 | Ga0207705_10002561 | 3300025909 | Bacteria | 13978 |
| 427 | Ga0207705_10030747 | 3300025909 | Bacteria | 3832 |
| 428 | Ga0207705_10187404 | 3300025909 | Bacteria | 1563 |
| 429 | Ga0207705_10456138 | 3300025909 | Bacteria | 991 |
| 430 | Ga0207654_10000436 | 3300025911 | Bacteria | 23923 |
| 431 | Ga0207654_10023858 | 3300025911 | Bacteria | 3282 |
| 432 | Ga0207654_10067032 | 3300025911 | Bacteria | 2119 |
| 433 | Ga0207654_10158876 | 3300025911 | Bacteria | 1458 |
| 434 | Ga0207654_10325064 | 3300025911 | Bacteria | 1052 |
| 435 | Ga0207707_10000001 | 3300025912 | Bacteria | 1212482 |
| 436 | Ga0207707_10000849 | 3300025912 | Bacteria | 29880 |
| 437 | Ga0207707_10091118 | 3300025912 | Bacteria | 2665 |
| 438 | Ga0207707_10125146 | 3300025912 | Bacteria | 2248 |
| 439 | Ga0207695_10000004 | 3300025913 | Bacteria | 1288665 |
| 440 | Ga0207695_10000024 | 3300025913 | Bacteria | 632311 |
| 441 | Ga0207695_10134158 | 3300025913 | Bacteria | 2431 |
| 442 | Ga0207695_10323551 | 3300025913 | Bacteria | 1431 |
| 443 | Ga0207671_10000986 | 3300025914 | Bacteria | 35178 |
| 444 | Ga0207671_10114443 | 3300025914 | Bacteria | 2056 |
| 445 | Ga0207671_10165169 | 3300025914 | Bacteria | 1716 |
| 446 | Ga0207693_10000025 | 3300025915 | Bacteria | 124008 |
| 447 | Ga0207693_10179371 | 3300025915 | Bacteria | 1666 |
| 448 | Ga0207693_10479473 | 3300025915 | Bacteria | 971 |
| 449 | Ga0207663_10007296 | 3300025916 | Bacteria | 5723 |
| 450 | Ga0207663_10134602 | 3300025916 | Bacteria | 1713 |
| 451 | Ga0207663_10187840 | 3300025916 | Bacteria | 1481 |
| 452 | Ga0207663_10320849 | 3300025916 | Bacteria | 1164 |
| 453 | Ga0207663_10365426 | 3300025916 | Bacteria | 1096 |
| 454 | Ga0207663_10487650 | 3300025916 | Bacteria | 956 |
| 455 | Ga0207660_10000081 | 3300025917 | Bacteria | 50936 |
| 456 | Ga0207660_10000597 | 3300025917 | Bacteria | 24328 |
| 457 | Ga0207662_10269853 | 3300025918 | Bacteria | 1122 |
| 458 | Ga0207657_10000129 | 3300025919 | Bacteria | 75856 |
| 459 | Ga0207657_10029697 | 3300025919 | Bacteria | 4972 |
| 460 | Ga0207657_10063239 | 3300025919 | Bacteria | 3165 |
| 461 | Ga0207649_10000029 | 3300025920 | Bacteria | 156557 |
| 462 | Ga0207649_10002212 | 3300025920 | Bacteria | 10988 |
| 463 | Ga0207649_10191186 | 3300025920 | Bacteria | 1440 |
| 464 | Ga0207652_10000413 | 3300025921 | Bacteria | 44358 |
| 465 | Ga0207652_10001120 | 3300025921 | Bacteria | 24155 |
| 466 | Ga0207652_10040972 | 3300025921 | Bacteria | 3935 |
| 467 | Ga0207652_10322291 | 3300025921 | Bacteria | 1395 |
| 468 | Ga0207681_10250457 | 3300025923 | Bacteria | 1383 |
| 469 | Ga0207694_10000044 | 3300025924 | Bacteria | 169595 |
| 470 | Ga0207694_10007860 | 3300025924 | Bacteria | 8073 |
| 471 | Ga0207694_10010063 | 3300025924 | Bacteria | 7127 |
| 472 | Ga0207694_10139800 | 3300025924 | Bacteria | 1947 |
| 473 | Ga0207694_10147588 | 3300025924 | Bacteria | 1894 |
| 474 | Ga0207694_10358826 | 3300025924 | Bacteria | 1207 |
| 475 | Ga0207650_10075462 | 3300025925 | Bacteria | 2544 |
| 476 | Ga0207659_10211292 | 3300025926 | Bacteria | 1555 |
| 477 | Ga0207687_10040805 | 3300025927 | Bacteria | 3183 |
| 478 | Ga0207687_10201009 | 3300025927 | Bacteria | 1557 |
| 479 | Ga0207700_10000005 | 3300025928 | Bacteria | 394836 |
| 480 | Ga0207664_10014667 | 3300025929 | Bacteria | 5668 |
| 481 | Ga0207664_10028363 | 3300025929 | Bacteria | 4254 |
| 482 | Ga0207690_10019088 | 3300025932 | Bacteria | 4213 |
| 483 | Ga0207706_10087732 | 3300025933 | Bacteria | 2736 |
| 484 | Ga0207686_10027757 | 3300025934 | Bacteria | 3318 |
| 485 | Ga0207686_10076356 | 3300025934 | Bacteria | 2172 |
| 486 | Ga0207686_10106587 | 3300025934 | Bacteria | 1882 |
| 487 | Ga0207686_10109017 | 3300025934 | Bacteria | 1864 |
| 488 | Ga0207686_10134106 | 3300025934 | Bacteria | 1702 |
| 489 | Ga0207709_10000047 | 3300025935 | Bacteria | 238649 |
| 490 | Ga0207709_10006691 | 3300025935 | Bacteria | 6461 |
| 491 | Ga0207709_10085278 | 3300025935 | Bacteria | 2047 |
| 492 | Ga0207669_10000361 | 3300025937 | Bacteria | 20623 |
| 493 | Ga0207669_10002871 | 3300025937 | Bacteria | 7390 |
| 494 | Ga0207704_10252729 | 3300025938 | Bacteria | 1324 |
| 495 | Ga0207704_10602279 | 3300025938 | Bacteria | 900 |
| 496 | Ga0207665_10257339 | 3300025939 | Bacteria | 1292 |
| 497 | Ga0207691_10089139 | 3300025940 | Bacteria | 2766 |
| 498 | Ga0207711_10000001 | 3300025941 | Bacteria | 1325674 |
| 499 | Ga0207711_10066517 | 3300025941 | Bacteria | 3117 |
| 500 | Ga0207711_10359853 | 3300025941 | Bacteria | 1348 |
| 501 | Ga0207689_10002603 | 3300025942 | Bacteria | 16690 |
| 502 | Ga0207689_10140017 | 3300025942 | Bacteria | 1993 |
| 503 | Ga0207661_10767387 | 3300025944 | Bacteria | 888 |
| 504 | Ga0207679_10519475 | 3300025945 | Bacteria | 1065 |
| 505 | Ga0207667_10000001 | 3300025949 | Bacteria | 1178522 |
| 506 | Ga0207667_10000012 | 3300025949 | Bacteria | 445492 |
| 507 | Ga0207667_10011654 | 3300025949 | Bacteria | 10203 |
| 508 | Ga0207667_10050944 | 3300025949 | Bacteria | 4366 |
| 509 | Ga0207667_10062277 | 3300025949 | Bacteria | 3901 |
| 510 | Ga0207667_10370050 | 3300025949 | Bacteria | 1460 |
| 511 | Ga0207667_10465960 | 3300025949 | Bacteria | 1283 |
| 512 | Ga0207712_10020572 | 3300025961 | Bacteria | 4324 |
| 513 | Ga0207668_10314034 | 3300025972 | Bacteria | 1298 |
| 514 | Ga0207640_10001051 | 3300025981 | Bacteria | 15254 |
| 515 | Ga0207640_10066239 | 3300025981 | Bacteria | 2413 |
| 516 | Ga0207640_10068650 | 3300025981 | Bacteria | 2377 |
| 517 | Ga0207658_10015385 | 3300025986 | Bacteria | 5249 |
| 518 | Ga0207658_10042984 | 3300025986 | Bacteria | 3282 |
| 519 | Ga0207658_10096946 | 3300025986 | Bacteria | 2301 |
| 520 | Ga0207658_10996918 | 3300025986 | Bacteria | 764 |
| 521 | Ga0207677_10057690 | 3300026023 | Bacteria | 2668 |
| 522 | Ga0207677_10108335 | 3300026023 | Bacteria | 2063 |
| 523 | Ga0207677_10582686 | 3300026023 | Bacteria | 979 |
| 524 | Ga0207703_10009981 | 3300026035 | Bacteria | 7448 |
| 525 | Ga0207703_10160826 | 3300026035 | Bacteria | 1967 |
| 526 | Ga0207703_10729714 | 3300026035 | Bacteria | 943 |
| 527 | Ga0207639_10003115 | 3300026041 | Bacteria | 11152 |
| 528 | Ga0207639_10020962 | 3300026041 | Bacteria | 4688 |
| 529 | Ga0207639_10062536 | 3300026041 | Bacteria | 2879 |
| 530 | Ga0207639_10255781 | 3300026041 | Bacteria | 1529 |
| 531 | Ga0207678_10228681 | 3300026067 | Bacteria | 1592 |
| 532 | Ga0207702_10000055 | 3300026078 | Bacteria | 136325 |
| 533 | Ga0207702_10004975 | 3300026078 | Bacteria | 11677 |
| 534 | Ga0207702_10052450 | 3300026078 | Bacteria | 3451 |
| 535 | Ga0207702_10365173 | 3300026078 | Bacteria | 1384 |
| 536 | Ga0207641_10024349 | 3300026088 | Bacteria | 4989 |
| 537 | Ga0207641_10124096 | 3300026088 | Bacteria | 2309 |
| 538 | Ga0207641_10179019 | 3300026088 | Bacteria | 1941 |
| 539 | Ga0207648_10060368 | 3300026089 | Bacteria | 3307 |
| 540 | Ga0207676_10562852 | 3300026095 | Bacteria | 1090 |
| 541 | Ga0207674_10000004 | 3300026116 | Bacteria | 241430 |
| 542 | Ga0207674_10089492 | 3300026116 | Bacteria | 3071 |
| 543 | Ga0207674_10100136 | 3300026116 | Bacteria | 2879 |
| 544 | Ga0207674_10110585 | 3300026116 | Bacteria | 2723 |
| 545 | Ga0207675_100119035 | 3300026118 | Bacteria | 2498 |
| 546 | Ga0207675_100181377 | 3300026118 | Bacteria | 2016 |
| 547 | Ga0207683_10001314 | 3300026121 | Bacteria | 22455 |
| 548 | Ga0207683_10002290 | 3300026121 | Bacteria | 16792 |
| 549 | Ga0207683_10048501 | 3300026121 | Bacteria | 3719 |
| 550 | Ga0207683_10226751 | 3300026121 | Bacteria | 1703 |
| 551 | Ga0207683_11029538 | 3300026121 | Bacteria | 764 |
| 552 | Ga0207698_10005731 | 3300026142 | Bacteria | 7702 |
| 553 | Ga0207698_10011571 | 3300026142 | Bacteria | 5728 |
| 554 | Ga0207698_10014957 | 3300026142 | Bacteria | 5179 |
| 555 | Ga0207698_10025036 | 3300026142 | Bacteria | 4197 |
| 556 | Ga0209281_1000164 | 3300027111 | Bacteria | 157372 |
| 557 | Ga0209281_1000377 | 3300027111 | Bacteria | 71243 |
| 558 | Ga0209371_1014508 | 3300027312 | Bacteria | 2157 |
| 559 | Ga0209282_1000007 | 3300027666 | Bacteria | 254917 |
| 560 | Ga0268266_10000930 | 3300028379 | Bacteria | 37406 |
| 561 | Ga0268266_10017542 | 3300028379 | Bacteria | 6107 |
| 562 | Ga0268266_10390124 | 3300028379 | Bacteria | 1315 |
| 563 | Ga0268265_10302973 | 3300028380 | Bacteria | 1440 |
| 564 | Ga0268265_10338674 | 3300028380 | Bacteria | 1369 |
| 565 | Ga0268265_10574150 | 3300028380 | Bacteria | 1074 |
| 566 | Ga0268264_10155553 | 3300028381 | Bacteria | 2054 |
| 567 | Ga0268264_10165699 | 3300028381 | Bacteria | 1995 |
| 568 | Ga0268264_10227463 | 3300028381 | Bacteria | 1720 |
| 569 | Ga0268264_10511331 | 3300028381 | Bacteria | 1173 |
| 570 | Ga0265337_1001060 | 3300028556 | Bacteria | 14179 |
| 571 | Ga0265334_10014042 | 3300028573 | Bacteria | 3344 |
| 572 | Ga0265334_10022394 | 3300028573 | Bacteria | 2575 |
| 573 | Ga0265318_10000017 | 3300028577 | Bacteria | 174748 |
| 574 | Ga0265318_10001236 | 3300028577 | Bacteria | 15530 |
| 575 | Ga0307515_10002710 | 3300028794 | Bacteria | 37898 |
| 576 | Ga0307515_10004674 | 3300028794 | Bacteria | 28096 |
| 577 | Ga0265338_10000006 | 3300028800 | Bacteria | 570804 |
| 578 | Ga0265338_10005866 | 3300028800 | Bacteria | 15841 |
| 579 | Ga0265338_10024220 | 3300028800 | Bacteria | 6209 |
| 580 | Ga0265338_10030101 | 3300028800 | Bacteria | 5360 |
| 581 | Ga0265338_10127248 | 3300028800 | Bacteria | 2019 |
| 582 | Ga0268256_1015067 | 3300030500 | Bacteria | 2271 |
| 583 | Ga0265330_10009666 | 3300031235 | Bacteria | 4572 |
| 584 | Ga0265330_10011955 | 3300031235 | Bacteria | 4063 |
| 585 | Ga0265330_10050437 | 3300031235 | Bacteria | 1825 |
| 586 | Ga0265330_10079778 | 3300031235 | Bacteria | 1411 |
| 587 | Ga0265332_10011135 | 3300031238 | Bacteria | 3997 |
| 588 | Ga0265332_10027800 | 3300031238 | Bacteria | 2477 |
| 589 | Ga0265328_10026733 | 3300031239 | Bacteria | 2168 |
| 590 | Ga0265320_10004010 | 3300031240 | Bacteria | 9689 |
| 591 | Ga0265320_10035158 | 3300031240 | Bacteria | 2542 |
| 592 | Ga0265320_10035866 | 3300031240 | Bacteria | 2511 |
| 593 | Ga0265325_10000003 | 3300031241 | Bacteria | 370490 |
| 594 | Ga0265325_10005675 | 3300031241 | Bacteria | 7673 |
| 595 | Ga0265325_10016931 | 3300031241 | Bacteria | 4063 |
| 596 | Ga0265325_10031233 | 3300031241 | Bacteria | 2852 |
| 597 | Ga0265325_10106147 | 3300031241 | Bacteria | 1370 |
| 598 | Ga0265340_10000034 | 3300031247 | Bacteria | 65594 |
| 599 | Ga0265340_10005311 | 3300031247 | Bacteria | 7154 |
| 600 | Ga0265340_10015433 | 3300031247 | Bacteria | 3968 |
| 601 | Ga0265340_10016049 | 3300031247 | Bacteria | 3882 |
| 602 | Ga0265340_10017168 | 3300031247 | Bacteria | 3743 |
| 603 | Ga0265340_10021397 | 3300031247 | Bacteria | 3317 |
| 604 | Ga0265340_10123992 | 3300031247 | Bacteria | 1187 |
| 605 | Ga0265339_10002825 | 3300031249 | Bacteria | 12323 |
| 606 | Ga0265339_10027818 | 3300031249 | Bacteria | 3221 |
| 607 | Ga0265339_10033057 | 3300031249 | Bacteria | 2915 |
| 608 | Ga0265339_10166455 | 3300031249 | Bacteria | 1106 |
| 609 | Ga0265331_10000006 | 3300031250 | Bacteria | 418907 |
| 610 | Ga0265331_10001232 | 3300031250 | Bacteria | 19232 |
| 611 | Ga0265331_10002603 | 3300031250 | Bacteria | 12132 |
| 612 | Ga0265331_10046236 | 3300031250 | Bacteria | 2098 |
| 613 | Ga0265331_10060087 | 3300031250 | Bacteria | 1796 |
| 614 | Ga0265331_10094698 | 3300031250 | Bacteria | 1378 |
| 615 | Ga0265327_10000808 | 3300031251 | Bacteria | 47626 |
| 616 | Ga0265316_10003849 | 3300031344 | Bacteria | 15053 |
| 617 | Ga0265316_10004511 | 3300031344 | Bacteria | 13833 |
| 618 | Ga0265316_10102429 | 3300031344 | Bacteria | 2175 |
| 619 | Ga0307513_10248145 | 3300031456 | Bacteria | 1579 |
| 620 | Ga0307513_10268414 | 3300031456 | Bacteria | 1491 |
| 621 | Ga0307513_10333325 | 3300031456 | Bacteria | 1271 |
| 622 | Ga0307408_100082301 | 3300031548 | Bacteria | 2409 |
| 623 | Ga0307408_100174691 | 3300031548 | Bacteria | 1718 |
| 624 | Ga0265313_10001127 | 3300031595 | Bacteria | 25532 |
| 625 | Ga0265313_10002103 | 3300031595 | Bacteria | 17759 |
| 626 | Ga0265313_10003670 | 3300031595 | Bacteria | 12265 |
| 627 | Ga0265313_10006358 | 3300031595 | Bacteria | 8403 |
| 628 | Ga0265313_10020505 | 3300031595 | Bacteria | 3645 |
| 629 | Ga0265313_10021178 | 3300031595 | Bacteria | 3561 |
| 630 | Ga0265313_10029615 | 3300031595 | Bacteria | 2830 |
| 631 | Ga0265313_10041199 | 3300031595 | Bacteria | 2277 |
| 632 | Ga0265313_10068206 | 3300031595 | Bacteria | 1644 |
| 633 | Ga0265313_10225566 | 3300031595 | Bacteria | 771 |
| 634 | Ga0316575_10121046 | 3300031665 | Bacteria | 1071 |
| 635 | Ga0316579_10111102 | 3300031691 | Bacteria | 1316 |
| 636 | Ga0265314_10005985 | 3300031711 | Bacteria | 10848 |
| 637 | Ga0265314_10006055 | 3300031711 | Bacteria | 10757 |
| 638 | Ga0265314_10017444 | 3300031711 | Bacteria | 5635 |
| 639 | Ga0265314_10018730 | 3300031711 | Bacteria | 5385 |
| 640 | Ga0265314_10026379 | 3300031711 | Bacteria | 4366 |
| 641 | Ga0265314_10068284 | 3300031711 | Bacteria | 2390 |
| 642 | Ga0265314_10072842 | 3300031711 | Bacteria | 2293 |
| 643 | Ga0265314_10076877 | 3300031711 | Bacteria | 2216 |
| 644 | Ga0265314_10102220 | 3300031711 | Bacteria | 1840 |
| 645 | Ga0265342_10008913 | 3300031712 | Bacteria | 7132 |
| 646 | Ga0265342_10038038 | 3300031712 | Bacteria | 2932 |
| 647 | Ga0265342_10043586 | 3300031712 | Bacteria | 2707 |
| 648 | Ga0265342_10054586 | 3300031712 | Bacteria | 2373 |
| 649 | Ga0265342_10074115 | 3300031712 | Bacteria | 1978 |
| 650 | Ga0307516_10010120 | 3300031730 | Bacteria | 10419 |
| 651 | Ga0307516_10037175 | 3300031730 | Bacteria | 4869 |
| 652 | Ga0307516_10260199 | 3300031730 | Bacteria | 1426 |
| 653 | Ga0307405_10008210 | 3300031731 | Bacteria | 5279 |
| 654 | Ga0307406_10008794 | 3300031901 | Bacteria | 5646 |
| 655 | Ga0307412_10000890 | 3300031911 | Bacteria | 17185 |
| 656 | Ga0307412_10190210 | 3300031911 | Bacteria | 1551 |
| 657 | Ga0307412_10406726 | 3300031911 | Bacteria | 1110 |
| 658 | Ga0315914_1000006 | 3300031967 | Bacteria | 239817 |
| 659 | Ga0307415_100474320 | 3300032126 | Bacteria | 1088 |
| 660 | Ga0316583_10040575 | 3300032133 | Bacteria | 1648 |
| 661 | Ga0307510_10197499 | 3300033180 | Bacteria | 1551 |
| 662 | Ga0315913_1000002 | 3300033430 | Bacteria | 241452 |
| 663 | Ga0315915_1000001 | 3300033464 | Bacteria | 481518 |
| 664 | Ga0373932_0080639 | 3300035112 | Bacteria | 1027 |
| 665 | Ga0373954_0223526 | 3300035118 | Bacteria | 926 |
| 666 | Ga0373957_0127707 | 3300035120 | Bacteria | 1033 |
| 667 | Ga0373924_0028183 | 3300035410 | Bacteria | 2237 |
| 668 | Ga0373931_0004426 | 3300035691 | Bacteria | 6419 |
| 669 | Ga0373933_0007071 | 3300035724 | Bacteria | 6113 |
| 670 | Ga0373937_0006384 | 3300036401 | Bacteria | 10174 |
| 671 | Ga0373937_0027165 | 3300036401 | Bacteria | 5173 |
| 672 | Ga0373937_0071180 | 3300036401 | Bacteria | 3207 |
| 673 | Ga0373937_0096417 | 3300036401 | Bacteria | 2743 |
| 674 | Ga0373937_0400258 | 3300036401 | Bacteria | 1303 |
| 675 | Ga0316582_0113749 | 3300036647 | Bacteria | 1804 |
| 676 | Ga0316582_0160070 | 3300036647 | Bacteria | 1525 |
| 677 | Ga0316584_0410610 | 3300036712 | Bacteria | 963 |
| 678 | Ga0373925_0036387 | 3300037068 | Bacteria | 3633 |
| 679 | Ga0373925_0262366 | 3300037068 | Bacteria | 1388 |
| 680 | Ga0395899_0121668 | 3300037312 | Bacteria | 1869 |
| 681 | Ga0395899_0156211 | 3300037312 | Bacteria | 1614 |
| 682 | Ga0395899_0185078 | 3300037312 | Bacteria | 1460 |
| 683 | Ga0395900_0006457 | 3300037418 | Bacteria | 12221 |
| 684 | Ga0395900_0081620 | 3300037418 | Bacteria | 3322 |
| 685 | Ga0395900_0088630 | 3300037418 | Bacteria | 3181 |
| 686 | Ga0395898_0050299 | 3300037466 | Bacteria | 4080 |
| 687 | Ga0395905_0002327 | 3300037471 | Bacteria | 21222 |
| 688 | Ga0395905_0031592 | 3300037471 | Bacteria | 4984 |
| 689 | Ga0395901_0081030 | 3300038443 | Bacteria | 3390 |
| 690 | Ga0395901_0085316 | 3300038443 | Bacteria | 3301 |
| 691 | Ga0395901_0244720 | 3300038443 | Bacteria | 1870 |
| 692 | Ga0395901_0470095 | 3300038443 | Bacteria | 1284 |
| 693 | Ga0400483_016484 | 3300039062 | Bacteria | 10111 |
| 694 | Ga0400483_289717 | 3300039062 | Bacteria | 10717 |
| 695 | Ga0436365_0142070 | 3300039437 | Bacteria | 3157 |
| 696 | Ga0436365_0605749 | 3300039437 | Bacteria | 1033 |
| 697 | Ga0436365_0817918 | 3300039437 | Bacteria | 8092 |
| 698 | Ga0436365_1329101 | 3300039437 | Bacteria | 8072 |
| 699 | Ga0436360_0879069 | 3300039438 | Bacteria | 2512 |
| 700 | Ga0436361_0316796 | 3300039447 | Bacteria | 2721 |
| 701 | Ga0436363_1603152 | 3300039450 | Bacteria | 7812 |
| 702 | Ga0436362_0060280 | 3300039453 | Bacteria | 7293 |
| 703 | Ga0436362_0870149 | 3300039453 | Bacteria | 1600 |
| 704 | Ga0439465_0015180 | 3300041413 | Bacteria | 2403 |
| 705 | Ga0451793_1440556 | 3300041452 | Bacteria | 1460 |
| 706 | Ga0451798_0107945 | 3300041458 | Bacteria | 1036 |
| 707 | Ga0451833_1133924 | 3300041491 | Bacteria | 1295 |
| 708 | Ga0451837_1280992 | 3300041494 | Bacteria | 1787 |
| 709 | Ga0451839_1184329 | 3300041496 | Bacteria | 1089 |
| 710 | Ga0451840_02168 | 3300041497 | Bacteria | 1499 |
| 711 | Ga0451845_0021827 | 3300041501 | Bacteria | 1169 |
| 712 | Ga0451850_35509 | 3300041506 | Bacteria | 1520 |
| 713 | Ga0451851_0808634 | 3300041507 | Bacteria | 1567 |
| 714 | Ga0451853_3113601 | 3300041512 | Bacteria | 2561 |
| 715 | Ga0452271_33868 | 3300041916 | Bacteria | 1714 |
| 716 | Ga0439449_0028934 | 3300042007 | Bacteria | 2065 |
| 717 | Ga0439449_0083622 | 3300042007 | Bacteria | 1177 |
| 718 | Ga0439451_007817 | 3300042009 | Bacteria | 2172 |
| 719 | Ga0439462_0030871 | 3300042015 | Bacteria | 1418 |
| 720 | Ga0450906_003427 | 3300042145 | Bacteria | 3412 |
| 721 | Ga0450918_010433 | 3300042531 | Bacteria | 1622 |
| 722 | Ga0466963_0114634 | 3300044694 | Bacteria | 1852 |
| 723 | Ga0466957_0026460 | 3300044842 | Bacteria | 3442 |
| 724 | Ga0451576_0027253 | 3300045051 | Bacteria | 6139 |
| 725 | Ga0495592_0149599 | 3300046454 | Bacteria | 1616 |
| 726 | Ga0495629_0048637 | 3300046459 | Bacteria | 2973 |
| 727 | Ga0495629_0330228 | 3300046459 | Bacteria | 1042 |
| 728 | Ga0495638_0067952 | 3300046460 | Bacteria | 2187 |
| 729 | Ga0495650_0000644 | 3300046471 | Bacteria | 46276 |
| 730 | Ga0495580_0006620 | 3300046472 | Bacteria | 9414 |
| 731 | Ga0495580_0050627 | 3300046472 | Bacteria | 2937 |
| 732 | Ga0495582_0017413 | 3300046473 | Bacteria | 3932 |
| 733 | Ga0495582_0061724 | 3300046473 | Bacteria | 2070 |
| 734 | Ga0495664_0242269 | 3300046477 | Bacteria | 1091 |
| 735 | Ga0495584_0162093 | 3300046491 | Bacteria | 1136 |
| 736 | Ga0495585_0011394 | 3300046492 | Bacteria | 5263 |
| 737 | Ga0495596_0037661 | 3300046500 | Bacteria | 1912 |
| 738 | Ga0495596_0049562 | 3300046500 | Bacteria | 1646 |
| 739 | Ga0495607_0108792 | 3300046501 | Bacteria | 1472 |
| 740 | Ga0495583_0002390 | 3300046506 | Bacteria | 16164 |
| 741 | Ga0495583_0008443 | 3300046506 | Bacteria | 6292 |
| 742 | Ga0495583_0011239 | 3300046506 | Bacteria | 5153 |
| 743 | Ga0495583_0030249 | 3300046506 | Bacteria | 2640 |
| 744 | Ga0495606_0003115 | 3300046507 | Bacteria | 18007 |
| 745 | Ga0495606_0094062 | 3300046507 | Bacteria | 1837 |
| 746 | Ga0495610_0020171 | 3300046512 | Bacteria | 3707 |
| 747 | Ga0495616_0131817 | 3300046513 | Bacteria | 1145 |
| 748 | Ga0495620_0026506 | 3300046515 | Bacteria | 2725 |
| 749 | Ga0495628_0361359 | 3300046516 | Bacteria | 1066 |
| 750 | Ga0495631_0075521 | 3300046518 | Bacteria | 1454 |
| 751 | Ga0495632_0001060 | 3300046519 | Bacteria | 23600 |
| 752 | Ga0495637_0160131 | 3300046520 | Bacteria | 845 |
| 753 | Ga0495643_0001349 | 3300046522 | Bacteria | 23106 |
| 754 | Ga0495643_0001424 | 3300046522 | Bacteria | 22149 |
| 755 | Ga0495643_0021448 | 3300046522 | Bacteria | 3706 |
| 756 | Ga0495643_0024185 | 3300046522 | Bacteria | 3447 |
| 757 | Ga0495648_0000122 | 3300046524 | Bacteria | 93823 |
| 758 | Ga0495663_0005658 | 3300046525 | Bacteria | 3460 |
| 759 | Ga0495663_0071992 | 3300046525 | Bacteria | 1102 |
| 760 | Ga0495642_0008427 | 3300046528 | Bacteria | 3946 |
| 761 | Ga0495642_0104967 | 3300046528 | Bacteria | 1205 |
| 762 | Ga0495652_0113615 | 3300046529 | Bacteria | 2174 |
| 763 | Ga0495652_0529904 | 3300046529 | Bacteria | 813 |
| 764 | Ga0495654_0190001 | 3300046530 | Bacteria | 885 |
| 765 | Ga0495609_0019743 | 3300046538 | Bacteria | 3116 |
| 766 | Ga0495645_0039649 | 3300046543 | Bacteria | 3435 |
| 767 | Ga0495622_0001189 | 3300046557 | Bacteria | 13441 |
| 768 | Ga0495633_0005483 | 3300046558 | Bacteria | 7727 |
| 769 | Ga0495633_0043700 | 3300046558 | Bacteria | 2125 |
| 770 | Ga0495633_0089964 | 3300046558 | Bacteria | 1427 |
| 771 | Ga0495668_0000377 | 3300046616 | Bacteria | 59127 |
| 772 | Ga0495668_0002121 | 3300046616 | Bacteria | 17116 |
| 773 | Ga0495668_0038640 | 3300046616 | Bacteria | 2666 |
| 774 | Ga0495611_0015937 | 3300046648 | Bacteria | 3212 |
| 775 | Ga0495611_0036306 | 3300046648 | Bacteria | 2186 |
| 776 | Ga0495625_0001416 | 3300046660 | Bacteria | 29318 |
| 777 | Ga0495625_0008470 | 3300046660 | Bacteria | 8776 |
| 778 | Ga0495625_0013176 | 3300046660 | Bacteria | 6660 |
| 779 | Ga0495625_0032622 | 3300046660 | Bacteria | 3859 |
| 780 | Ga0495625_0040459 | 3300046660 | Bacteria | 3399 |
| 781 | Ga0495625_0096310 | 3300046660 | Bacteria | 2039 |
| 782 | Ga0495661_0078481 | 3300046665 | Bacteria | 1910 |
| 783 | Ga0495588_0048496 | 3300046674 | Bacteria | 2182 |
| 784 | Ga0495657_0086551 | 3300046675 | Bacteria | 2018 |
| 785 | Ga0495658_0002459 | 3300046683 | Bacteria | 9327 |
| 786 | Ga0495669_0000773 | 3300046684 | Bacteria | 13683 |
| 787 | Ga0495670_0018044 | 3300046691 | Bacteria | 3476 |
| 788 | Ga0495670_0092919 | 3300046691 | Bacteria | 1546 |
| 789 | Ga0495600_0004633 | 3300046809 | Bacteria | 8241 |
| 790 | Ga0495600_0177057 | 3300046809 | Bacteria | 1375 |
| 791 | Ga0495660_0024138 | 3300046810 | Bacteria | 3464 |
| 792 | Ga0495581_0038894 | 3300047315 | Bacteria | 2754 |
| 793 | Ga0495674_0366898 | 3300047319 | Bacteria | 1167 |
| 794 | Ga0495683_0008061 | 3300047323 | Bacteria | 5653 |
| 795 | Ga0495687_000392 | 3300047443 | Bacteria | 54348 |
| 796 | Ga0495687_005666 | 3300047443 | Bacteria | 7886 |
| 797 | Ga0495687_041977 | 3300047443 | Bacteria | 2003 |
| 798 | Ga0495675_0161026 | 3300047444 | Bacteria | 1382 |
| 799 | Ga0495681_0133831 | 3300047470 | Bacteria | 1053 |
| 800 | Ga0496101_0393033 | 3300048904 | Bacteria | 1092 |
| 801 | Ga0496102_0277264 | 3300048905 | Bacteria | 1580 |
| 802 | Ga0496103_0000165 | 3300048906 | Bacteria | 69702 |
| 803 | Ga0496103_0021567 | 3300048906 | Bacteria | 3876 |
| 804 | Ga0496105_0000467 | 3300048908 | Bacteria | 26582 |
| 805 | Ga0496109_0053887 | 3300048912 | Bacteria | 3670 |
| 806 | Ga0496109_0139312 | 3300048912 | Bacteria | 2268 |
| 807 | Ga0496110_0062535 | 3300048913 | Bacteria | 3288 |
| 808 | Ga0496111_0124262 | 3300048914 | Bacteria | 1907 |
| 809 | Ga0496113_0010427 | 3300048916 | Bacteria | 6145 |
| 810 | Ga0496113_0802189 | 3300048916 | Bacteria | 748 |
| 811 | Ga0496114_0007452 | 3300048917 | Bacteria | 8652 |
| 812 | Ga0496115_0000202 | 3300048918 | Bacteria | 55680 |
| 813 | Ga0496115_0110634 | 3300048918 | Bacteria | 2257 |
| 814 | Ga0496115_0285674 | 3300048918 | Bacteria | 1354 |
| 815 | Ga0496116_0002518 | 3300048919 | Bacteria | 19170 |
| 816 | Ga0496116_0011379 | 3300048919 | Bacteria | 7374 |
| 817 | Ga0496117_0000337 | 3300048920 | Bacteria | 82874 |
| 818 | Ga0496117_0000616 | 3300048920 | Bacteria | 57666 |
| 819 | Ga0496117_0294232 | 3300048920 | Bacteria | 863 |
| 820 | Ga0496118_0000396 | 3300048921 | Bacteria | 73830 |
| 821 | Ga0496118_0000425 | 3300048921 | Bacteria | 70035 |
| 822 | Ga0496119_0006225 | 3300048922 | Bacteria | 11145 |
| 823 | Ga0496119_0061593 | 3300048922 | Bacteria | 2239 |
| 824 | Ga0496121_0000796 | 3300048924 | Bacteria | 57621 |
| 825 | Ga0496121_0001010 | 3300048924 | Bacteria | 50285 |
| 826 | Ga0496121_0002450 | 3300048924 | Bacteria | 28361 |
| 827 | Ga0496121_0026660 | 3300048924 | Bacteria | 5434 |
| 828 | Ga0496121_0070712 | 3300048924 | Bacteria | 2809 |
| 829 | Ga0496122_0000009 | 3300048925 | Bacteria | 584024 |
| 830 | Ga0496122_0003726 | 3300048925 | Bacteria | 19675 |
| 831 | Ga0496122_0005649 | 3300048925 | Bacteria | 14764 |
| 832 | Ga0496122_0100553 | 3300048925 | Bacteria | 1934 |
| 833 | Ga0496123_0000245 | 3300048926 | Bacteria | 109471 |
| 834 | Ga0496123_0007453 | 3300048926 | Bacteria | 10298 |
| 835 | Ga0496123_0117447 | 3300048926 | Bacteria | 1504 |
| 836 | Ga0496124_0000468 | 3300048927 | Bacteria | 69747 |
| 837 | Ga0496124_0011797 | 3300048927 | Bacteria | 8709 |
| 838 | Ga0496124_0040261 | 3300048927 | Bacteria | 4044 |
| 839 | Ga0496124_0055241 | 3300048927 | Bacteria | 3357 |
| 840 | Ga0496124_0113923 | 3300048927 | Bacteria | 2172 |
| 841 | Ga0496125_0000704 | 3300048928 | Bacteria | 55382 |
| 842 | Ga0496125_0001996 | 3300048928 | Bacteria | 27672 |
| 843 | Ga0496125_0007816 | 3300048928 | Bacteria | 11305 |
| 844 | Ga0496126_0000563 | 3300048929 | Bacteria | 71182 |
| 845 | Ga0496126_0001787 | 3300048929 | Bacteria | 31720 |
| 846 | Ga0496126_0013802 | 3300048929 | Bacteria | 8191 |
| 847 | Ga0496126_0120287 | 3300048929 | Bacteria | 2278 |
| 848 | Ga0496126_0197395 | 3300048929 | Bacteria | 1701 |
| 849 | Ga0495682_0002267 | 3300049460 | Bacteria | 9231 |
| 850 | Ga0501031_0001004 | 3300049568 | Bacteria | 17105 |
| 851 | Ga0501031_0090259 | 3300049568 | Bacteria | 1998 |
| 852 | Ga0501031_0247473 | 3300049568 | Bacteria | 1159 |
| 853 | Ga0501031_0369430 | 3300049568 | Bacteria | 928 |
| 854 | Ga0501032_0006719 | 3300049569 | Bacteria | 8444 |
| 855 | Ga0501032_0282253 | 3300049569 | Bacteria | 1075 |
| 856 | Ga0501033_0007260 | 3300049570 | Bacteria | 8644 |
| 857 | Ga0501033_0036043 | 3300049570 | Bacteria | 3707 |
| 858 | Ga0501033_0038110 | 3300049570 | Bacteria | 3596 |
| 859 | Ga0501033_0058328 | 3300049570 | Bacteria | 2851 |
| 860 | Ga0501033_0078329 | 3300049570 | Bacteria | 2425 |
| 861 | Ga0501033_0087270 | 3300049570 | Bacteria | 2283 |
| 862 | Ga0501033_0193801 | 3300049570 | Bacteria | 1453 |
| 863 | Ga0501033_0195259 | 3300049570 | Bacteria | 1447 |
| 864 | Ga0501033_0224584 | 3300049570 | Bacteria | 1336 |
| 865 | Ga0501034_0003097 | 3300049571 | Bacteria | 19167 |
| 866 | Ga0501034_0007556 | 3300049571 | Bacteria | 11565 |
| 867 | Ga0501034_0011474 | 3300049571 | Bacteria | 9183 |
| 868 | Ga0501034_0025228 | 3300049571 | Bacteria | 6050 |
| 869 | Ga0501034_0040458 | 3300049571 | Bacteria | 4719 |
| 870 | Ga0501034_0043919 | 3300049571 | Bacteria | 4520 |
| 871 | Ga0501034_0051684 | 3300049571 | Bacteria | 4143 |
| 872 | Ga0501034_0056225 | 3300049571 | Bacteria | 3960 |
| 873 | Ga0501034_0079282 | 3300049571 | Bacteria | 3288 |
| 874 | Ga0501034_0106710 | 3300049571 | Bacteria | 2794 |
| 875 | Ga0501034_0164534 | 3300049571 | Bacteria | 2187 |
| 876 | Ga0501034_0234799 | 3300049571 | Bacteria | 1782 |
| 877 | Ga0501034_0255974 | 3300049571 | Bacteria | 1694 |
| 878 | Ga0501034_0432178 | 3300049571 | Bacteria | 1236 |
| 879 | Ga0501036_0021174 | 3300049572 | Bacteria | 5461 |
| 880 | Ga0501036_0048788 | 3300049572 | Bacteria | 3584 |
| 881 | Ga0501036_0083022 | 3300049572 | Bacteria | 2708 |
| 882 | Ga0501036_0089967 | 3300049572 | Bacteria | 2593 |
| 883 | Ga0501037_0012313 | 3300049573 | Bacteria | 6295 |
| 884 | Ga0501037_0033875 | 3300049573 | Bacteria | 3771 |
| 885 | Ga0501037_0070110 | 3300049573 | Bacteria | 2551 |
| 886 | Ga0501037_0084935 | 3300049573 | Bacteria | 2292 |
| 887 | Ga0501037_0098678 | 3300049573 | Bacteria | 2110 |
| 888 | Ga0501037_0164128 | 3300049573 | Bacteria | 1582 |
| 889 | Ga0501037_0471594 | 3300049573 | Bacteria | 854 |
| 890 | Ga0501038_0011034 | 3300049574 | Bacteria | 8248 |
| 891 | Ga0501038_0017603 | 3300049574 | Bacteria | 6457 |
| 892 | Ga0501038_0022976 | 3300049574 | Bacteria | 5582 |
| 893 | Ga0501038_0056632 | 3300049574 | Bacteria | 3366 |
| 894 | Ga0501038_0172537 | 3300049574 | Bacteria | 1749 |
| 895 | Ga0501039_0001645 | 3300049575 | Bacteria | 16475 |
| 896 | Ga0501039_0065001 | 3300049575 | Bacteria | 2829 |
| 897 | Ga0501039_0133607 | 3300049575 | Bacteria | 1948 |
| 898 | Ga0501039_0224841 | 3300049575 | Bacteria | 1475 |
| 899 | Ga0501039_0338994 | 3300049575 | Bacteria | 1181 |
| 900 | Ga0501040_0024436 | 3300049576 | Bacteria | 4056 |
| 901 | Ga0501041_0018238 | 3300049577 | Bacteria | 4180 |
| 902 | Ga0501042_0138432 | 3300049578 | Bacteria | 1755 |
| 903 | Ga0501042_0190463 | 3300049578 | Bacteria | 1479 |
| 904 | Ga0501043_0014535 | 3300049579 | Bacteria | 6163 |
| 905 | Ga0501043_0038989 | 3300049579 | Bacteria | 3734 |
| 906 | Ga0501043_0081640 | 3300049579 | Bacteria | 2540 |
| 907 | Ga0501043_0123343 | 3300049579 | Bacteria | 2032 |
| 908 | Ga0501043_0188567 | 3300049579 | Bacteria | 1604 |
| 909 | Ga0501046_0008000 | 3300049580 | Bacteria | 9244 |
| 910 | Ga0501046_0059508 | 3300049580 | Bacteria | 2992 |
| 911 | Ga0501046_0074500 | 3300049580 | Bacteria | 2633 |
| 912 | Ga0501046_0083008 | 3300049580 | Bacteria | 2474 |
| 913 | Ga0501046_0110827 | 3300049580 | Bacteria | 2096 |
| 914 | Ga0501046_0125819 | 3300049580 | Bacteria | 1947 |
| 915 | Ga0501046_0147624 | 3300049580 | Bacteria | 1775 |
| 916 | Ga0501046_0196199 | 3300049580 | Bacteria | 1504 |
| 917 | Ga0501047_0001553 | 3300049581 | Bacteria | 22470 |
| 918 | Ga0501047_0004801 | 3300049581 | Bacteria | 12721 |
| 919 | Ga0501047_0006325 | 3300049581 | Bacteria | 11140 |
| 920 | Ga0501047_0007771 | 3300049581 | Bacteria | 10098 |
| 921 | Ga0501047_0010400 | 3300049581 | Bacteria | 8805 |
| 922 | Ga0501047_0014769 | 3300049581 | Bacteria | 7432 |
| 923 | Ga0501047_0038567 | 3300049581 | Bacteria | 4622 |
| 924 | Ga0501047_0040985 | 3300049581 | Bacteria | 4476 |
| 925 | Ga0501047_0070746 | 3300049581 | Bacteria | 3359 |
| 926 | Ga0501047_0080832 | 3300049581 | Bacteria | 3124 |
| 927 | Ga0501047_0081339 | 3300049581 | Bacteria | 3114 |
| 928 | Ga0501047_0095776 | 3300049581 | Bacteria | 2847 |
| 929 | Ga0501047_0118076 | 3300049581 | Bacteria | 2534 |
| 930 | Ga0501047_0146204 | 3300049581 | Bacteria | 2241 |
| 931 | Ga0501047_0158309 | 3300049581 | Bacteria | 2137 |
| 932 | Ga0501047_0168298 | 3300049581 | Bacteria | 2061 |
| 933 | Ga0501047_0222714 | 3300049581 | Bacteria | 1742 |
| 934 | Ga0501047_0243564 | 3300049581 | Bacteria | 1648 |
| 935 | Ga0501047_0259535 | 3300049581 | Bacteria | 1585 |
| 936 | Ga0501047_0348346 | 3300049581 | Bacteria | 1318 |
| 937 | Ga0501047_0359305 | 3300049581 | Bacteria | 1292 |
| 938 | Ga0501047_0400812 | 3300049581 | Bacteria | 1205 |
| 939 | Ga0501048_0000472 | 3300049582 | Bacteria | 28173 |
| 940 | Ga0501048_0128827 | 3300049582 | Bacteria | 1789 |
| 941 | Ga0501048_0138435 | 3300049582 | Bacteria | 1721 |
| 942 | Ga0501048_0449758 | 3300049582 | Bacteria | 922 |
| 943 | Ga0501067_0000670 | 3300049583 | Bacteria | 18436 |
| 944 | Ga0501067_0014029 | 3300049583 | Bacteria | 4438 |
| 945 | Ga0501067_0024138 | 3300049583 | Bacteria | 3371 |
| 946 | Ga0501067_0029877 | 3300049583 | Bacteria | 3021 |
| 947 | Ga0501067_0071790 | 3300049583 | Bacteria | 1917 |
| 948 | Ga0501067_0244660 | 3300049583 | Bacteria | 998 |
| 949 | Ga0501068_0002277 | 3300049584 | Bacteria | 10225 |
| 950 | Ga0501068_0005529 | 3300049584 | Bacteria | 6923 |
| 951 | Ga0501068_0027170 | 3300049584 | Bacteria | 3377 |
| 952 | Ga0501069_0009734 | 3300049585 | Bacteria | 5077 |
| 953 | Ga0501069_0063092 | 3300049585 | Bacteria | 2069 |
| 954 | Ga0501070_0000110 | 3300049586 | Bacteria | 72071 |
| 955 | Ga0501070_0026046 | 3300049586 | Bacteria | 4907 |
| 956 | Ga0501070_0031086 | 3300049586 | Bacteria | 4472 |
| 957 | Ga0501070_0221657 | 3300049586 | Bacteria | 1551 |
| 958 | Ga0501070_0344607 | 3300049586 | Bacteria | 1210 |
| 959 | Ga0501070_0380798 | 3300049586 | Bacteria | 1143 |
| 960 | Ga0501071_0154640 | 3300049587 | Bacteria | 1712 |
| 961 | Ga0501072_0032281 | 3300049588 | Bacteria | 4101 |
| 962 | Ga0501072_0037555 | 3300049588 | Bacteria | 3799 |
| 963 | Ga0501072_0038176 | 3300049588 | Bacteria | 3769 |
| 964 | Ga0501072_0064402 | 3300049588 | Bacteria | 2891 |
| 965 | Ga0501073_0017929 | 3300049589 | Bacteria | 5121 |
| 966 | Ga0501073_0035965 | 3300049589 | Bacteria | 3519 |
| 967 | Ga0501073_0039911 | 3300049589 | Bacteria | 3324 |
| 968 | Ga0501073_0052570 | 3300049589 | Bacteria | 2852 |
| 969 | Ga0501073_0122980 | 3300049589 | Bacteria | 1798 |
| 970 | Ga0501073_0165071 | 3300049589 | Bacteria | 1534 |
| 971 | Ga0501073_0174266 | 3300049589 | Bacteria | 1489 |
| 972 | Ga0501073_0246483 | 3300049589 | Bacteria | 1233 |
| 973 | Ga0501073_0254286 | 3300049589 | Bacteria | 1213 |
| 974 | Ga0501073_0327609 | 3300049589 | Bacteria | 1057 |
| 975 | Ga0501074_0011675 | 3300049590 | Bacteria | 6383 |
| 976 | Ga0501074_0032456 | 3300049590 | Bacteria | 3783 |
| 977 | Ga0501074_0083783 | 3300049590 | Bacteria | 2286 |
| 978 | Ga0501074_0195088 | 3300049590 | Bacteria | 1443 |
| 979 | Ga0501075_0060975 | 3300049591 | Bacteria | 2841 |
| 980 | Ga0501076_0004128 | 3300049592 | Bacteria | 10268 |
| 981 | Ga0501077_0014578 | 3300049593 | Bacteria | 4942 |
| 982 | Ga0501077_0063681 | 3300049593 | Bacteria | 2339 |
| 983 | Ga0501077_0139432 | 3300049593 | Bacteria | 1538 |
| 984 | Ga0501079_0002380 | 3300049741 | Bacteria | 13648 |
| 985 | Ga0501079_0005104 | 3300049741 | Bacteria | 9749 |
| 986 | Ga0501079_0032431 | 3300049741 | Bacteria | 4016 |
| 987 | Ga0501079_0147634 | 3300049741 | Bacteria | 1833 |
| 988 | Ga0501079_0323647 | 3300049741 | Bacteria | 1207 |
| 989 | Ga0501080_0002037 | 3300049742 | Bacteria | 17480 |
| 990 | Ga0501080_0005758 | 3300049742 | Bacteria | 11085 |
| 991 | Ga0501080_0033607 | 3300049742 | Bacteria | 4787 |
| 992 | Ga0501080_0035760 | 3300049742 | Bacteria | 4636 |
| 993 | Ga0501080_0056611 | 3300049742 | Bacteria | 3650 |
| 994 | Ga0501080_0063381 | 3300049742 | Bacteria | 3440 |
| 995 | Ga0501080_0105651 | 3300049742 | Bacteria | 2611 |
| 996 | Ga0501080_0131735 | 3300049742 | Bacteria | 2315 |
| 997 | Ga0501080_0141800 | 3300049742 | Bacteria | 2221 |
| 998 | Ga0501080_0154648 | 3300049742 | Bacteria | 2119 |
| 999 | Ga0501080_0230141 | 3300049742 | Bacteria | 1694 |
| 1000 | Ga0501080_0431164 | 3300049742 | Bacteria | 1183 |
| 1001 | Ga0501081_0037644 | 3300049743 | Bacteria | 3301 |
| 1002 | Ga0501083_0006881 | 3300049744 | Bacteria | 8073 |
| 1003 | Ga0501083_0012398 | 3300049744 | Bacteria | 5965 |
| 1004 | Ga0501083_0014089 | 3300049744 | Bacteria | 5590 |
| 1005 | Ga0501083_0024080 | 3300049744 | Bacteria | 4220 |
| 1006 | Ga0501083_0049301 | 3300049744 | Bacteria | 2839 |
| 1007 | Ga0501083_0095273 | 3300049744 | Bacteria | 1964 |
| 1008 | Ga0501083_0100260 | 3300049744 | Bacteria | 1910 |
| 1009 | Ga0501280_004260 | 3300049776 | Bacteria | 2114 |
| 1010 | Ga0501035_0000879 | 3300049822 | Bacteria | 31853 |
| 1011 | Ga0501035_0004670 | 3300049822 | Bacteria | 13000 |
| 1012 | Ga0501035_0039706 | 3300049822 | Bacteria | 4258 |
| 1013 | Ga0501035_0042979 | 3300049822 | Bacteria | 4073 |
| 1014 | Ga0501035_0054857 | 3300049822 | Bacteria | 3559 |
| 1015 | Ga0501035_0057766 | 3300049822 | Bacteria | 3459 |
| 1016 | Ga0501035_0066142 | 3300049822 | Bacteria | 3208 |
| 1017 | Ga0501035_0099534 | 3300049822 | Bacteria | 2552 |
| 1018 | Ga0501035_0111615 | 3300049822 | Bacteria | 2396 |
| 1019 | Ga0501035_0114585 | 3300049822 | Bacteria | 2360 |
| 1020 | Ga0501035_0154005 | 3300049822 | Bacteria | 1993 |
| 1021 | Ga0501035_0311576 | 3300049822 | Bacteria | 1324 |
| 1022 | Ga0501044_0003131 | 3300049823 | Bacteria | 18737 |
| 1023 | Ga0501044_0004520 | 3300049823 | Bacteria | 15559 |
| 1024 | Ga0501044_0006575 | 3300049823 | Bacteria | 12828 |
| 1025 | Ga0501044_0013067 | 3300049823 | Bacteria | 8985 |
| 1026 | Ga0501044_0020172 | 3300049823 | Bacteria | 7114 |
| 1027 | Ga0501044_0039017 | 3300049823 | Bacteria | 4957 |
| 1028 | Ga0501044_0064414 | 3300049823 | Bacteria | 3742 |
| 1029 | Ga0501044_0071284 | 3300049823 | Bacteria | 3533 |
| 1030 | Ga0501044_0098850 | 3300049823 | Bacteria | 2937 |
| 1031 | Ga0501044_0165279 | 3300049823 | Bacteria | 2187 |
| 1032 | Ga0501044_0223796 | 3300049823 | Bacteria | 1831 |
| 1033 | Ga0501044_0298807 | 3300049823 | Bacteria | 1539 |
| 1034 | Ga0501044_0302658 | 3300049823 | Bacteria | 1527 |
| 1035 | Ga0501044_0363319 | 3300049823 | Bacteria | 1365 |
| 1036 | Ga0501044_0386727 | 3300049823 | Bacteria | 1313 |
| 1037 | Ga0501044_0453188 | 3300049823 | Bacteria | 1189 |
| 1038 | Ga0501045_0022366 | 3300049824 | Bacteria | 4527 |
| 1039 | Ga0501045_0148923 | 3300049824 | Bacteria | 1741 |
| 1040 | nmdc:mga03683_103920_c1 | 3300050489 | Bacteria | 1251 |
| 1041 | nmdc:mga00v17_13819_c1 | 3300050491 | Bacteria | 4490 |
| 1042 | nmdc:mga0k408_63022_c1 | 3300050493 | Bacteria | 2156 |
| 1043 | nmdc:mga06z11_59422_c1 | 3300050494 | Bacteria | 1987 |
| 1044 | nmdc:mga07m45_212239_c1 | 3300050496 | Bacteria | 1126 |
| 1045 | nmdc:mga05p37_152544_c1 | 3300050507 | Bacteria | 2825 |
| 1046 | nmdc:mga09592_687107_c1 | 3300050508 | Bacteria | 872 |
| 1047 | nmdc:mga06r32_15122_c2 | 3300050510 | Bacteria | 3721 |
| 1048 | nmdc:mga0n895_1692_c1 | 3300050512 | Bacteria | 16660 |
| 1049 | nmdc:mga08x19_51_c1 | 3300050514 | Bacteria | 124093 |
| 1050 | nmdc:mga0sz30_38904_c1 | 3300050516 | Bacteria | 1994 |
| 1051 | Ga0500610_0000074 | 3300053079 | Bacteria | 30194 |
| 1052 | Ga0500610_0066416 | 3300053079 | Bacteria | 1881 |
| 1053 | Ga0500643_000006 | 3300053087 | Bacteria | 479605 |
| 1054 | Ga0500646_0009128 | 3300053090 | Bacteria | 2539 |
| 1055 | Ga0500650_0090740 | 3300053098 | Bacteria | 1430 |
| 1056 | Ga0500555_018291 | 3300053103 | Bacteria | 2020 |
| 1057 | Ga0500557_000411 | 3300053105 | Bacteria | 5605 |
| 1058 | Ga0500569_023101 | 3300053109 | Bacteria | 1666 |
| 1059 | Ga0500595_002621 | 3300053119 | Bacteria | 8758 |
| 1060 | Ga0500595_003650 | 3300053119 | Bacteria | 7123 |
| 1061 | Ga0500608_061413 | 3300053122 | Bacteria | 1796 |
| 1062 | Ga0500618_021027 | 3300053125 | Bacteria | 1595 |
| 1063 | Ga0500642_0140493 | 3300053130 | Bacteria | 1133 |
| 1064 | Ga0500642_0241815 | 3300053130 | Bacteria | 831 |
| 1065 | Ga0500655_021771 | 3300053133 | Bacteria | 1203 |
| 1066 | Ga0500568_0001385 | 3300053139 | Bacteria | 15700 |
| 1067 | Ga0500568_0020966 | 3300053139 | Bacteria | 2818 |
| 1068 | Ga0500573_0000006 | 3300053140 | Bacteria | 285988 |
| 1069 | Ga0500616_0000328 | 3300053153 | Bacteria | 68215 |
| 1070 | Ga0500616_0062840 | 3300053153 | Bacteria | 1916 |
| 1071 | Ga0500619_003933 | 3300053154 | Bacteria | 3124 |
| 1072 | Ga0500627_0045604 | 3300053158 | Bacteria | 1898 |
| 1073 | Ga0500639_023212 | 3300053163 | Bacteria | 3278 |
| 1074 | Ga0500645_000034 | 3300053730 | Bacteria | 116363 |
| 1075 | Ga0500596_002112 | 3300053735 | Bacteria | 3961 |
| 1076 | Ga0501084_0000081 | 3300054114 | Bacteria | 70009 |
| 1077 | Ga0501084_0002711 | 3300054114 | Bacteria | 14264 |
| 1078 | Ga0501084_0010520 | 3300054114 | Bacteria | 7649 |
| 1079 | Ga0501084_0048031 | 3300054114 | Bacteria | 3574 |
| 1080 | Ga0501084_0187301 | 3300054114 | Bacteria | 1746 |
| 1081 | Ga0501084_0208640 | 3300054114 | Bacteria | 1648 |
| 1082 | Ga0501084_0431811 | 3300054114 | Bacteria | 1113 |
| 1083 | Ga0501084_0495700 | 3300054114 | Bacteria | 1032 |
| 1084 | Ga0587088_021284 | 3300059508 | Bacteria | 1084 |
| 1085 | Ga0501082_0004451 | 3300060353 | Bacteria | 12234 |
| 1086 | Ga0501082_0015012 | 3300060353 | Bacteria | 6674 |
| 1087 | Ga0501082_0037576 | 3300060353 | Bacteria | 4174 |
| 1088 | Ga0501082_0090410 | 3300060353 | Bacteria | 2643 |
| 1089 | Ga0501082_0165419 | 3300060353 | Bacteria | 1922 |
| 1090 | Ga0501082_0185409 | 3300060353 | Bacteria | 1810 |
| 1091 | Ga0501082_0249184 | 3300060353 | Bacteria | 1546 |
| 1092 | Ga0501082_0521709 | 3300060353 | Bacteria | 1038 |
| 1093 | Ga0466962_0343528 | 3300061719 | Bacteria | 743 |
| 1094 | Ga0530510_0183887 | 3300061734 | Bacteria | 1550 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041496 | Ga0451839_1184329 | Ga0451839_1184329_436_1062 | 208 |
| 2 | iso_pu_bacteria | 2775507049 | 2776912629 | 215 |
| 3 | iso_pu_bacteria | 2891048133 | 2891051972 | 216 |
| 4 | 3300025284 | Ga0209130_1010324 | Ga0209130_10103242 | 217 |
| 5 | iso_pu_bacteria | 8045864390 | 8045867712 | 217 |
| 6 | iso_pu_bacteria | 2894817345 | 2894819515 | 218 |
| 7 | 3300031901 | Ga0307406_10008794 | Ga0307406_100087943 | 219 |
| 8 | 3300049573 | Ga0501037_0084935 | Ga0501037_0084935_1548_2210 | 219 |
| 9 | iso_pu_bacteria | 2508501122 | 2509107444 | 219 |
| 10 | iso_pu_bacteria | 2509276019 | 2509374564 | 219 |
| 11 | iso_pu_bacteria | 2509276021 | 2509387848 | 219 |
| 12 | iso_pu_bacteria | 2509276033 | 2509443465 | 219 |
| 13 | iso_pu_bacteria | 2510065019 | 2510132169 | 219 |
| 14 | iso_pu_bacteria | 2510065057 | 2510304484 | 219 |
| 15 | iso_pu_bacteria | 2510461076 | 2510898505 | 219 |
| 16 | iso_pu_bacteria | 2510917022 | 2511133618 | 219 |
| 17 | iso_pu_bacteria | 2510917028 | 2511186501 | 219 |
| 18 | iso_pu_bacteria | 2510917030 | 2511196439 | 219 |
| 19 | iso_pu_bacteria | 2511231052 | 2511500899 | 219 |
| 20 | iso_pu_bacteria | 2512047086 | 2512532322 | 219 |
| 21 | iso_pu_bacteria | 2512875026 | 2512972349 | 219 |
| 22 | iso_pu_bacteria | 2513237084 | 2513569003 | 219 |
| 23 | iso_pu_bacteria | 2513237085 | 2513580031 | 219 |
| 24 | iso_pu_bacteria | 2513237086 | 2513583563 | 219 |
| 25 | iso_pu_bacteria | 2513237088 | 2513596124 | 219 |
| 26 | iso_pu_bacteria | 2513237089 | 2513603428 | 219 |
| 27 | iso_pu_bacteria | 2513237091 | 2513617511 | 219 |
| 28 | iso_pu_bacteria | 2513237093 | 2513635700 | 219 |
| 29 | iso_pu_bacteria | 2513237103 | 2513709335 | 219 |
| 30 | iso_pu_bacteria | 2513237138 | 2513865750 | 219 |
| 31 | iso_pu_bacteria | 2513237140 | 2513882776 | 219 |
| 32 | iso_pu_bacteria | 2513237143 | 2513905320 | 219 |
| 33 | iso_pu_bacteria | 2513237146 | 2513925581 | 219 |
| 34 | iso_pu_bacteria | 2513237156 | 2513985379 | 219 |
| 35 | iso_pu_bacteria | 2513237160 | 2514004883 | 219 |
| 36 | iso_pu_bacteria | 2513237162 | 2514023088 | 219 |
| 37 | iso_pu_bacteria | 2515075009 | 2515111150 | 219 |
| 38 | iso_pu_bacteria | 2515154107 | 2515608025 | 219 |
| 39 | iso_pu_bacteria | 2515154113 | 2515636061 | 219 |
| 40 | iso_pu_bacteria | 2515154114 | 2515642714 | 219 |
| 41 | iso_pu_bacteria | 2515154116 | 2515658771 | 219 |
| 42 | iso_pu_bacteria | 2515154134 | 2515743919 | 219 |
| 43 | iso_pu_bacteria | 2516143018 | 2516208779 | 219 |
| 44 | iso_pu_bacteria | 2516653046 | 2516892176 | 219 |
| 45 | iso_pu_bacteria | 2516653077 | 2517039796 | 219 |
| 46 | iso_pu_bacteria | 2516653085 | 2517075316 | 219 |
| 47 | iso_pu_bacteria | 2517287029 | 2517405738 | 219 |
| 48 | iso_pu_bacteria | 2517487022 | 2517568986 | 219 |
| 49 | iso_pu_bacteria | 2519899620 | 2520379842 | 219 |
| 50 | iso_pu_bacteria | 2524023207 | 2524450223 | 219 |
| 51 | iso_pu_bacteria | 2529292951 | 2530644038 | 219 |
| 52 | iso_pu_bacteria | 2534681796 | 2535515593 | 219 |
| 53 | iso_pu_bacteria | 2551306084 | 2551676359 | 219 |
| 54 | iso_pu_bacteria | 2551306085 | 2551687466 | 219 |
| 55 | iso_pu_bacteria | 2551306086 | 2551693397 | 219 |
| 56 | iso_pu_bacteria | 2551306087 | 2551702403 | 219 |
| 57 | iso_pu_bacteria | 2551306089 | 2551714772 | 219 |
| 58 | iso_pu_bacteria | 2551306090 | 2551719031 | 219 |
| 59 | iso_pu_bacteria | 2551306091 | 2551730350 | 219 |
| 60 | iso_pu_bacteria | 2551306092 | 2551733183 | 219 |
| 61 | iso_pu_bacteria | 2551306093 | 2551745408 | 219 |
| 62 | iso_pu_bacteria | 2558860100 | 2558863593 | 219 |
| 63 | iso_pu_bacteria | 2582581294 | 2585202957 | 219 |
| 64 | iso_pu_bacteria | 2582581298 | 2585225396 | 219 |
| 65 | iso_pu_bacteria | 2582581299 | 2585230535 | 219 |
| 66 | iso_pu_bacteria | 2582581304 | 2585256728 | 219 |
| 67 | iso_pu_bacteria | 2582581307 | 2585275770 | 219 |
| 68 | iso_pu_bacteria | 2582581308 | 2585278784 | 219 |
| 69 | iso_pu_bacteria | 2582581316 | 2585329757 | 219 |
| 70 | iso_pu_bacteria | 2582581867 | 2585400271 | 219 |
| 71 | iso_pu_bacteria | 2585427526 | 2585525508 | 219 |
| 72 | iso_pu_bacteria | 2585427527 | 2585535894 | 219 |
| 73 | iso_pu_bacteria | 2585427528 | 2585542643 | 219 |
| 74 | iso_pu_bacteria | 2585427529 | 2585548329 | 219 |
| 75 | iso_pu_bacteria | 2585427530 | 2585554023 | 219 |
| 76 | iso_pu_bacteria | 2585427531 | 2585559311 | 219 |
| 77 | iso_pu_bacteria | 2585427590 | 2585822995 | 219 |
| 78 | iso_pu_bacteria | 2585427593 | 2585838249 | 219 |
| 79 | iso_pu_bacteria | 2585427594 | 2585847330 | 219 |
| 80 | iso_pu_bacteria | 2585427608 | 2585901223 | 219 |
| 81 | iso_pu_bacteria | 2585427609 | 2585905313 | 219 |
| 82 | iso_pu_bacteria | 2585428125 | 2587979572 | 219 |
| 83 | iso_pu_bacteria | 2599185170 | 2599418720 | 219 |
| 84 | iso_pu_bacteria | 2599185352 | 2600191825 | 219 |
| 85 | iso_pu_bacteria | 2615840624 | 2616296776 | 219 |
| 86 | iso_pu_bacteria | 2615840626 | 2616305942 | 219 |
| 87 | iso_pu_bacteria | 2617270742 | 2617381940 | 219 |
| 88 | iso_pu_bacteria | 2643221557 | 2643807313 | 219 |
| 89 | iso_pu_bacteria | 2643221610 | 2644069725 | 219 |
| 90 | iso_pu_bacteria | 2643221618 | 2644109104 | 219 |
| 91 | iso_pu_bacteria | 2643221626 | 2644151624 | 219 |
| 92 | iso_pu_bacteria | 2643221634 | 2644191061 | 219 |
| 93 | iso_pu_bacteria | 2643221643 | 2644242768 | 219 |
| 94 | iso_pu_bacteria | 2643221655 | 2644311760 | 219 |
| 95 | iso_pu_bacteria | 2643221659 | 2644330031 | 219 |
| 96 | iso_pu_bacteria | 2643221668 | 2644380696 | 219 |
| 97 | iso_pu_bacteria | 2643221675 | 2644414601 | 219 |
| 98 | iso_pu_bacteria | 2643221680 | 2644448258 | 219 |
| 99 | iso_pu_bacteria | 2643221698 | 2644543215 | 219 |
| 100 | iso_pu_bacteria | 2643221712 | 2644617558 | 219 |
| 101 | iso_pu_bacteria | 2643221723 | 2644673658 | 219 |
| 102 | iso_pu_bacteria | 2643221726 | 2644689435 | 219 |
| 103 | iso_pu_bacteria | 2657244999 | 2657682212 | 219 |
| 104 | iso_pu_bacteria | 2667528174 | 2671112740 | 219 |
| 105 | iso_pu_bacteria | 2718217882 | 2719180130 | 219 |
| 106 | iso_pu_bacteria | 2718217927 | 2719384726 | 219 |
| 107 | iso_pu_bacteria | 2718217997 | 2719664487 | 219 |
| 108 | iso_pu_bacteria | 2718218009 | 2719730879 | 219 |
| 109 | iso_pu_bacteria | 2718218199 | 2720490907 | 219 |
| 110 | iso_pu_bacteria | 2718218232 | 2720612271 | 219 |
| 111 | iso_pu_bacteria | 2718218233 | 2720619109 | 219 |
| 112 | iso_pu_bacteria | 2718218235 | 2720630511 | 219 |
| 113 | iso_pu_bacteria | 2718218269 | 2720774204 | 219 |
| 114 | iso_pu_bacteria | 2718218363 | 2721146223 | 219 |
| 115 | iso_pu_bacteria | 2718218365 | 2721157744 | 219 |
| 116 | iso_pu_bacteria | 2718218366 | 2721163103 | 219 |
| 117 | iso_pu_bacteria | 2718218423 | 2721398437 | 219 |
| 118 | iso_pu_bacteria | 2721755514 | 2722839273 | 219 |
| 119 | iso_pu_bacteria | 2721755556 | 2723025929 | 219 |
| 120 | iso_pu_bacteria | 2721755684 | 2723559475 | 219 |
| 121 | iso_pu_bacteria | 2721755685 | 2723566092 | 219 |
| 122 | iso_pu_bacteria | 2721755809 | 2724037250 | 219 |
| 123 | iso_pu_bacteria | 2721755810 | 2724043635 | 219 |
| 124 | iso_pu_bacteria | 2721755819 | 2724088811 | 219 |
| 125 | iso_pu_bacteria | 2721755822 | 2724103357 | 219 |
| 126 | iso_pu_bacteria | 2721755823 | 2724109195 | 219 |
| 127 | iso_pu_bacteria | 2724679232 | 2725951102 | 219 |
| 128 | iso_pu_bacteria | 2728369352 | 2730106865 | 219 |
| 129 | iso_pu_bacteria | 2728369365 | 2730163367 | 219 |
| 130 | iso_pu_bacteria | 2728369397 | 2730297376 | 219 |
| 131 | iso_pu_bacteria | 2738541293 | 2738803620 | 219 |
| 132 | iso_pu_bacteria | 2738541333 | 2739035137 | 219 |
| 133 | iso_pu_bacteria | 2765235942 | 2766067734 | 219 |
| 134 | iso_pu_bacteria | 2775507266 | 2778177343 | 219 |
| 135 | iso_pu_bacteria | 2791355082 | 2792584059 | 219 |
| 136 | iso_pu_bacteria | 2791355091 | 2792622138 | 219 |
| 137 | iso_pu_bacteria | 2791355092 | 2792628297 | 219 |
| 138 | iso_pu_bacteria | 2791355256 | 2793298780 | 219 |
| 139 | iso_pu_bacteria | 2791355259 | 2793316936 | 219 |
| 140 | iso_pu_bacteria | 2791355260 | 2793322747 | 219 |
| 141 | iso_pu_bacteria | 2791355261 | 2793329365 | 219 |
| 142 | iso_pu_bacteria | 2791355262 | 2793336118 | 219 |
| 143 | iso_pu_bacteria | 2791355263 | 2793339929 | 219 |
| 144 | iso_pu_bacteria | 2791355264 | 2793350063 | 219 |
| 145 | iso_pu_bacteria | 2791355265 | 2793353445 | 219 |
| 146 | iso_pu_bacteria | 2791355266 | 2793358766 | 219 |
| 147 | iso_pu_bacteria | 2791355267 | 2793368328 | 219 |
| 148 | iso_pu_bacteria | 2802428858 | 2802717629 | 219 |
| 149 | iso_pu_bacteria | 2802428859 | 2802723444 | 219 |
| 150 | iso_pu_bacteria | 2802428860 | 2802731106 | 219 |
| 151 | iso_pu_bacteria | 2802428861 | 2802736112 | 219 |
| 152 | iso_pu_bacteria | 2802428862 | 2802743677 | 219 |
| 153 | iso_pu_bacteria | 2802428863 | 2802750611 | 219 |
| 154 | iso_pu_bacteria | 2802429268 | 2804751231 | 219 |
| 155 | iso_pu_bacteria | 2802429605 | 2805930395 | 219 |
| 156 | iso_pu_bacteria | 2802429606 | 2805936182 | 219 |
| 157 | iso_pu_bacteria | 2802429633 | 2806044425 | 219 |
| 158 | iso_pu_bacteria | 2802429634 | 2806051777 | 219 |
| 159 | iso_pu_bacteria | 2802429635 | 2806058080 | 219 |
| 160 | iso_pu_bacteria | 2802429636 | 2806068961 | 219 |
| 161 | iso_pu_bacteria | 2802429637 | 2806075746 | 219 |
| 162 | iso_pu_bacteria | 2818991448 | 2819613627 | 219 |
| 163 | iso_pu_bacteria | 2818991453 | 2819639371 | 219 |
| 164 | iso_pu_bacteria | 2838016132 | 2838017155 | 219 |
| 165 | iso_pu_bacteria | 2838022645 | 2838026940 | 219 |
| 166 | iso_pu_bacteria | 2838029111 | 2838031292 | 219 |
| 167 | iso_pu_bacteria | 2838035591 | 2838037589 | 219 |
| 168 | iso_pu_bacteria | 2838042994 | 2838047062 | 219 |
| 169 | iso_pu_bacteria | 2838048938 | 2838049360 | 219 |
| 170 | iso_pu_bacteria | 2838061910 | 2838067213 | 219 |
| 171 | iso_pu_bacteria | 2838068647 | 2838073203 | 219 |
| 172 | iso_pu_bacteria | 2838074704 | 2838076336 | 219 |
| 173 | iso_pu_bacteria | 2838661181 | 2838663255 | 219 |
| 174 | iso_pu_bacteria | 2838668709 | 2838670724 | 219 |
| 175 | iso_pu_bacteria | 2838680041 | 2838681177 | 219 |
| 176 | iso_pu_bacteria | 2838686498 | 2838688767 | 219 |
| 177 | iso_pu_bacteria | 2838694306 | 2838694790 | 219 |
| 178 | iso_pu_bacteria | 2838701080 | 2838703095 | 219 |
| 179 | iso_pu_bacteria | 2838707686 | 2838708166 | 219 |
| 180 | iso_pu_bacteria | 2838729681 | 2838731062 | 219 |
| 181 | iso_pu_bacteria | 2838742623 | 2838744044 | 219 |
| 182 | iso_pu_bacteria | 2841851746 | 2841856990 | 219 |
| 183 | iso_pu_bacteria | 2841864319 | 2841870425 | 219 |
| 184 | iso_pu_bacteria | 2842077413 | 2842080601 | 219 |
| 185 | iso_pu_bacteria | 2842110456 | 2842115984 | 219 |
| 186 | iso_pu_bacteria | 2842118031 | 2842121220 | 219 |
| 187 | iso_pu_bacteria | 2842146304 | 2842147681 | 219 |
| 188 | iso_pu_bacteria | 2842156927 | 2842159895 | 219 |
| 189 | iso_pu_bacteria | 2842163707 | 2842168138 | 219 |
| 190 | iso_pu_bacteria | 2842180545 | 2842183488 | 219 |
| 191 | iso_pu_bacteria | 2842192696 | 2842193529 | 219 |
| 192 | iso_pu_bacteria | 2842198810 | 2842202544 | 219 |
| 193 | iso_pu_bacteria | 2842205361 | 2842207824 | 219 |
| 194 | iso_pu_bacteria | 2842217011 | 2842220715 | 219 |
| 195 | iso_pu_bacteria | 2842229732 | 2842234032 | 219 |
| 196 | iso_pu_bacteria | 2842237096 | 2842237578 | 219 |
| 197 | iso_pu_bacteria | 2842243621 | 2842245508 | 219 |
| 198 | iso_pu_bacteria | 2842250916 | 2842252747 | 219 |
| 199 | iso_pu_bacteria | 2842257432 | 2842259842 | 219 |
| 200 | iso_pu_bacteria | 2842264693 | 2842269209 | 219 |
| 201 | iso_pu_bacteria | 2842271015 | 2842274681 | 219 |
| 202 | iso_pu_bacteria | 2842278818 | 2842281381 | 219 |
| 203 | iso_pu_bacteria | 2842285085 | 2842287246 | 219 |
| 204 | iso_pu_bacteria | 2842291075 | 2842294259 | 219 |
| 205 | iso_pu_bacteria | 2842304105 | 2842306926 | 219 |
| 206 | iso_pu_bacteria | 2842311132 | 2842314583 | 219 |
| 207 | iso_pu_bacteria | 2842317721 | 2842318776 | 219 |
| 208 | iso_pu_bacteria | 2842341865 | 2842343733 | 219 |
| 209 | iso_pu_bacteria | 2842363717 | 2842365040 | 219 |
| 210 | iso_pu_bacteria | 2842370503 | 2842371640 | 219 |
| 211 | iso_pu_bacteria | 2842377471 | 2842380656 | 219 |
| 212 | iso_pu_bacteria | 2842384541 | 2842387727 | 219 |
| 213 | iso_pu_bacteria | 2842395702 | 2842400866 | 219 |
| 214 | iso_pu_bacteria | 2842402390 | 2842404514 | 219 |
| 215 | iso_pu_bacteria | 2842409023 | 2842410801 | 219 |
| 216 | iso_pu_bacteria | 2842415677 | 2842417743 | 219 |
| 217 | iso_pu_bacteria | 2842422224 | 2842426624 | 219 |
| 218 | iso_pu_bacteria | 2842428310 | 2842433308 | 219 |
| 219 | iso_pu_bacteria | 2842434925 | 2842439733 | 219 |
| 220 | iso_pu_bacteria | 2842441272 | 2842446362 | 219 |
| 221 | iso_pu_bacteria | 2842447887 | 2842452039 | 219 |
| 222 | iso_pu_bacteria | 2842462802 | 2842467592 | 219 |
| 223 | iso_pu_bacteria | 2842469257 | 2842474245 | 219 |
| 224 | iso_pu_bacteria | 2842475841 | 2842478113 | 219 |
| 225 | iso_pu_bacteria | 2842482326 | 2842482732 | 219 |
| 226 | iso_pu_bacteria | 2842489311 | 2842494888 | 219 |
| 227 | iso_pu_bacteria | 2842495871 | 2842497411 | 219 |
| 228 | iso_pu_bacteria | 2842502639 | 2842504922 | 219 |
| 229 | iso_pu_bacteria | 2844163670 | 2844163890 | 219 |
| 230 | iso_pu_bacteria | 2844454524 | 2844455292 | 219 |
| 231 | iso_pu_bacteria | 2850079185 | 2850080368 | 219 |
| 232 | iso_pu_bacteria | 2855825444 | 2855831250 | 219 |
| 233 | iso_pu_bacteria | 2855839649 | 2855840375 | 219 |
| 234 | iso_pu_bacteria | 2857516855 | 2857520423 | 219 |
| 235 | iso_pu_bacteria | 2858800743 | 2858800905 | 219 |
| 236 | iso_pu_bacteria | 2896384573 | 2896386538 | 219 |
| 237 | iso_pu_bacteria | 2899803654 | 2899806120 | 219 |
| 238 | iso_pu_bacteria | 2913295892 | 2913297544 | 219 |
| 239 | iso_pu_bacteria | 2915980308 | 2915986108 | 219 |
| 240 | iso_pu_bacteria | 2915986958 | 2915993303 | 219 |
| 241 | iso_pu_bacteria | 2915993759 | 2915997896 | 219 |
| 242 | iso_pu_bacteria | 2916000859 | 2916005710 | 219 |
| 243 | iso_pu_bacteria | 2916007675 | 2916012791 | 219 |
| 244 | iso_pu_bacteria | 2916014648 | 2916020965 | 219 |
| 245 | iso_pu_bacteria | 2916021584 | 2916022516 | 219 |
| 246 | iso_pu_bacteria | 2916028427 | 2916034599 | 219 |
| 247 | iso_pu_bacteria | 2916035215 | 2916035346 | 219 |
| 248 | iso_pu_bacteria | 2916041962 | 2916043286 | 219 |
| 249 | iso_pu_bacteria | 2916048683 | 2916052485 | 219 |
| 250 | iso_pu_bacteria | 2916055098 | 2916057602 | 219 |
| 251 | iso_pu_bacteria | 2916061851 | 2916068008 | 219 |
| 252 | iso_pu_bacteria | 2916068649 | 2916072968 | 219 |
| 253 | iso_pu_bacteria | 2916076590 | 2916076733 | 219 |
| 254 | iso_pu_bacteria | 2919100787 | 2919100791 | 219 |
| 255 | iso_pu_bacteria | 2919408235 | 2919409179 | 219 |
| 256 | iso_pu_bacteria | 2920760137 | 2920762977 | 219 |
| 257 | iso_pu_bacteria | 2920822456 | 2920823741 | 219 |
| 258 | iso_pu_bacteria | 2921201388 | 2921201768 | 219 |
| 259 | iso_pu_bacteria | 2921208531 | 2921209729 | 219 |
| 260 | iso_pu_bacteria | 2921237296 | 2921243923 | 219 |
| 261 | iso_pu_bacteria | 2921244191 | 2921245960 | 219 |
| 262 | iso_pu_bacteria | 2921250672 | 2921250892 | 219 |
| 263 | iso_pu_bacteria | 2921257292 | 2921261021 | 219 |
| 264 | iso_pu_bacteria | 2921263974 | 2921269349 | 219 |
| 265 | iso_pu_bacteria | 2921282425 | 2921286415 | 219 |
| 266 | iso_pu_bacteria | 2921289301 | 2921294054 | 219 |
| 267 | iso_pu_bacteria | 2921296804 | 2921300521 | 219 |
| 268 | iso_pu_bacteria | 2923556063 | 2923557700 | 219 |
| 269 | iso_pu_bacteria | 2924144063 | 2924146928 | 219 |
| 270 | iso_pu_bacteria | 2924150972 | 2924156266 | 219 |
| 271 | iso_pu_bacteria | 2924158325 | 2924160500 | 219 |
| 272 | iso_pu_bacteria | 2924165586 | 2924166119 | 219 |
| 273 | iso_pu_bacteria | 2924172951 | 2924178555 | 219 |
| 274 | iso_pu_bacteria | 2924179722 | 2924181498 | 219 |
| 275 | iso_pu_bacteria | 2924186466 | 2924190284 | 219 |
| 276 | iso_pu_bacteria | 2924193448 | 2924195961 | 219 |
| 277 | iso_pu_bacteria | 2924200457 | 2924204395 | 219 |
| 278 | iso_pu_bacteria | 2924207177 | 2924207431 | 219 |
| 279 | iso_pu_bacteria | 2924214083 | 2924216465 | 219 |
| 280 | iso_pu_bacteria | 2924221636 | 2924224441 | 219 |
| 281 | iso_pu_bacteria | 2924228884 | 2924234863 | 219 |
| 282 | iso_pu_bacteria | 2933570622 | 2933572959 | 219 |
| 283 | iso_pu_bacteria | 2933586486 | 2933592057 | 219 |
| 284 | iso_pu_bacteria | 2933599457 | 2933603396 | 219 |
| 285 | iso_pu_bacteria | 2935894831 | 2935895312 | 219 |
| 286 | iso_pu_bacteria | 2935901341 | 2935904289 | 219 |
| 287 | iso_pu_bacteria | 2936367885 | 2936368259 | 219 |
| 288 | iso_pu_bacteria | 2936375103 | 2936376093 | 219 |
| 289 | iso_pu_bacteria | 2936381700 | 2936386843 | 219 |
| 290 | iso_pu_bacteria | 2936996657 | 2937000455 | 219 |
| 291 | iso_pu_bacteria | 2937002841 | 2937009588 | 219 |
| 292 | iso_pu_bacteria | 2937009748 | 2937010814 | 219 |
| 293 | iso_pu_bacteria | 2937016420 | 2937020810 | 219 |
| 294 | iso_pu_bacteria | 2937023124 | 2937027997 | 219 |
| 295 | iso_pu_bacteria | 2937029754 | 2937029930 | 219 |
| 296 | iso_pu_bacteria | 2937036028 | 2937041557 | 219 |
| 297 | iso_pu_bacteria | 2937042894 | 2937049621 | 219 |
| 298 | iso_pu_bacteria | 2937049772 | 2937052650 | 219 |
| 299 | iso_pu_bacteria | 2937056579 | 2937061606 | 219 |
| 300 | iso_pu_bacteria | 2937063883 | 2937066485 | 219 |
| 301 | iso_pu_bacteria | 2937071275 | 2937073807 | 219 |
| 302 | iso_pu_bacteria | 2937078374 | 2937083037 | 219 |
| 303 | iso_pu_bacteria | 2937084907 | 2937088739 | 219 |
| 304 | iso_pu_bacteria | 2937091812 | 2937093504 | 219 |
| 305 | iso_pu_bacteria | 2937098957 | 2937103700 | 219 |
| 306 | iso_pu_bacteria | 2937106411 | 2937111585 | 219 |
| 307 | iso_pu_bacteria | 2937113482 | 2937118245 | 219 |
| 308 | iso_pu_bacteria | 2937119839 | 2937121113 | 219 |
| 309 | iso_pu_bacteria | 2937126314 | 2937130158 | 219 |
| 310 | iso_pu_bacteria | 2941499720 | 2941500326 | 219 |
| 311 | iso_pu_bacteria | 2957375807 | 2957380089 | 219 |
| 312 | iso_pu_bacteria | 2957382221 | 2957385141 | 219 |
| 313 | iso_pu_bacteria | 2957388812 | 2957389204 | 219 |
| 314 | iso_pu_bacteria | 2957395598 | 2957398632 | 219 |
| 315 | iso_pu_bacteria | 2957402308 | 2957402679 | 219 |
| 316 | iso_pu_bacteria | 2957408893 | 2957415207 | 219 |
| 317 | iso_pu_bacteria | 2957415311 | 2957418014 | 219 |
| 318 | iso_pu_bacteria | 2957422303 | 2957425749 | 219 |
| 319 | iso_pu_bacteria | 2957430029 | 2957433147 | 219 |
| 320 | iso_pu_bacteria | 2957437181 | 2957443778 | 219 |
| 321 | iso_pu_bacteria | 2957443900 | 2957449912 | 219 |
| 322 | iso_pu_bacteria | 2957450854 | 2957453512 | 219 |
| 323 | iso_pu_bacteria | 2957457609 | 2957457832 | 219 |
| 324 | iso_pu_bacteria | 2957464669 | 2957466442 | 219 |
| 325 | iso_pu_bacteria | 2957471148 | 2957473987 | 219 |
| 326 | iso_pu_bacteria | 2957478035 | 2957483735 | 219 |
| 327 | iso_pu_bacteria | 2957484790 | 2957485862 | 219 |
| 328 | iso_pu_bacteria | 2957491536 | 2957495923 | 219 |
| 329 | iso_pu_bacteria | 2957498199 | 2957499806 | 219 |
| 330 | iso_pu_bacteria | 2957505466 | 2957510307 | 219 |
| 331 | iso_pu_bacteria | 2960584000 | 2960588007 | 219 |
| 332 | iso_pu_bacteria | 2960591022 | 2960595508 | 219 |
| 333 | iso_pu_bacteria | 2960597568 | 2960600647 | 219 |
| 334 | iso_pu_bacteria | 2960603979 | 2960609424 | 219 |
| 335 | iso_pu_bacteria | 2960610863 | 2960613803 | 219 |
| 336 | iso_pu_bacteria | 2960617483 | 2960617634 | 219 |
| 337 | iso_pu_bacteria | 2960624210 | 2960625475 | 219 |
| 338 | iso_pu_bacteria | 2960631154 | 2960633292 | 219 |
| 339 | iso_pu_bacteria | 2960637947 | 2960642339 | 219 |
| 340 | iso_pu_bacteria | 2960645483 | 2960652782 | 219 |
| 341 | iso_pu_bacteria | 2960652885 | 2960656801 | 219 |
| 342 | iso_pu_bacteria | 2960660292 | 2960662311 | 219 |
| 343 | iso_pu_bacteria | 2960667422 | 2960673853 | 219 |
| 344 | iso_pu_bacteria | 2960674078 | 2960676132 | 219 |
| 345 | iso_pu_bacteria | 2960680706 | 2960684098 | 219 |
| 346 | iso_pu_bacteria | 2960687367 | 2960691077 | 219 |
| 347 | iso_pu_bacteria | 2960693952 | 2960696309 | 219 |
| 348 | iso_pu_bacteria | 2964607997 | 2964612090 | 219 |
| 349 | iso_pu_bacteria | 2964615318 | 2964617610 | 219 |
| 350 | iso_pu_bacteria | 2964621998 | 2964623237 | 219 |
| 351 | iso_pu_bacteria | 2964628898 | 2964633189 | 219 |
| 352 | iso_pu_bacteria | 2964636051 | 2964642110 | 219 |
| 353 | iso_pu_bacteria | 2964643177 | 2964648738 | 219 |
| 354 | iso_pu_bacteria | 2964649959 | 2964653030 | 219 |
| 355 | iso_pu_bacteria | 2964656573 | 2964661100 | 219 |
| 356 | iso_pu_bacteria | 2964663802 | 2964666045 | 219 |
| 357 | iso_pu_bacteria | 2964670856 | 2964677684 | 219 |
| 358 | iso_pu_bacteria | 2964678106 | 2964683674 | 219 |
| 359 | iso_pu_bacteria | 2964685014 | 2964689159 | 219 |
| 360 | iso_pu_bacteria | 2964691889 | 2964695769 | 219 |
| 361 | iso_pu_bacteria | 2964698721 | 2964701885 | 219 |
| 362 | iso_pu_bacteria | 2964705432 | 2964712394 | 219 |
| 363 | iso_pu_bacteria | 2964712639 | 2964718626 | 219 |
| 364 | iso_pu_bacteria | 2964719344 | 2964726200 | 219 |
| 365 | iso_pu_bacteria | 2967664464 | 2967669703 | 219 |
| 366 | iso_pu_bacteria | 2967671571 | 2967673707 | 219 |
| 367 | iso_pu_bacteria | 2967678726 | 2967678852 | 219 |
| 368 | iso_pu_bacteria | 2967686174 | 2967686351 | 219 |
| 369 | iso_pu_bacteria | 2967693043 | 2967693173 | 219 |
| 370 | iso_pu_bacteria | 2967699805 | 2967702586 | 219 |
| 371 | iso_pu_bacteria | 2967706974 | 2967709239 | 219 |
| 372 | iso_pu_bacteria | 2967714385 | 2967716602 | 219 |
| 373 | iso_pu_bacteria | 2967721400 | 2967724786 | 219 |
| 374 | iso_pu_bacteria | 2967728569 | 2967734799 | 219 |
| 375 | iso_pu_bacteria | 2967735183 | 2967740970 | 219 |
| 376 | iso_pu_bacteria | 2967742019 | 2967746059 | 219 |
| 377 | iso_pu_bacteria | 2967748971 | 2967752177 | 219 |
| 378 | iso_pu_bacteria | 2967755722 | 2967757662 | 219 |
| 379 | iso_pu_bacteria | 2967762386 | 2967763747 | 219 |
| 380 | iso_pu_bacteria | 2967769361 | 2967773129 | 219 |
| 381 | iso_pu_bacteria | 2967775926 | 2967777199 | 219 |
| 382 | iso_pu_bacteria | 2970019648 | 2970025998 | 219 |
| 383 | iso_pu_bacteria | 2970026789 | 2970032882 | 219 |
| 384 | iso_pu_bacteria | 2970033650 | 2970039150 | 219 |
| 385 | iso_pu_bacteria | 2970040964 | 2970047622 | 219 |
| 386 | iso_pu_bacteria | 2970047711 | 2970049991 | 219 |
| 387 | iso_pu_bacteria | 2970054988 | 2970059680 | 219 |
| 388 | iso_pu_bacteria | 2970061556 | 2970067854 | 219 |
| 389 | iso_pu_bacteria | 2970068827 | 2970074948 | 219 |
| 390 | iso_pu_bacteria | 2970076120 | 2970076436 | 219 |
| 391 | iso_pu_bacteria | 2970082768 | 2970086615 | 219 |
| 392 | iso_pu_bacteria | 2970088815 | 2970093475 | 219 |
| 393 | iso_pu_bacteria | 2970095765 | 2970098071 | 219 |
| 394 | iso_pu_bacteria | 2970102677 | 2970108492 | 219 |
| 395 | iso_pu_bacteria | 2970109326 | 2970109891 | 219 |
| 396 | iso_pu_bacteria | 2970116247 | 2970118040 | 219 |
| 397 | iso_pu_bacteria | 2970122695 | 2970128243 | 219 |
| 398 | iso_pu_bacteria | 2970129317 | 2970129446 | 219 |
| 399 | iso_pu_bacteria | 2970136068 | 2970136955 | 219 |
| 400 | iso_pu_bacteria | 2970143518 | 2970149079 | 219 |
| 401 | iso_pu_bacteria | 2970149975 | 2970153886 | 219 |
| 402 | iso_pu_bacteria | 2970156795 | 2970162378 | 219 |
| 403 | iso_pu_bacteria | 2970164137 | 2970167432 | 219 |
| 404 | iso_pu_bacteria | 2970170962 | 2970171533 | 219 |
| 405 | iso_pu_bacteria | 2970177841 | 2970182207 | 219 |
| 406 | iso_pu_bacteria | 2970184632 | 2970189428 | 219 |
| 407 | iso_pu_bacteria | 2970191845 | 2970198396 | 219 |
| 408 | iso_pu_bacteria | 2977516862 | 2977518632 | 219 |
| 409 | iso_pu_bacteria | 2977523885 | 2977527203 | 219 |
| 410 | iso_pu_bacteria | 2977530762 | 2977533354 | 219 |
| 411 | iso_pu_bacteria | 2977537788 | 2977537917 | 219 |
| 412 | iso_pu_bacteria | 2977544691 | 2977544867 | 219 |
| 413 | iso_pu_bacteria | 2977551784 | 2977551914 | 219 |
| 414 | iso_pu_bacteria | 2977558990 | 2977563126 | 219 |
| 415 | iso_pu_bacteria | 2977565890 | 2977568915 | 219 |
| 416 | iso_pu_bacteria | 2977572785 | 2977579033 | 219 |
| 417 | iso_pu_bacteria | 2977579622 | 2977581566 | 219 |
| 418 | iso_pu_bacteria | 2989771324 | 2989771928 | 219 |
| 419 | iso_pu_bacteria | 2996887358 | 2996889518 | 219 |
| 420 | iso_pu_bacteria | 2996893221 | 2996895383 | 219 |
| 421 | iso_pu_bacteria | 3003930520 | 3003932545 | 219 |
| 422 | iso_pu_bacteria | 3005409236 | 3005412267 | 219 |
| 423 | iso_pu_bacteria | 3005416602 | 3005417723 | 219 |
| 424 | iso_pu_bacteria | 3005445848 | 3005446626 | 219 |
| 425 | iso_pu_bacteria | 639633055 | 639647309 | 219 |
| 426 | iso_pu_bacteria | 648276728 | 648740531 | 219 |
| 427 | iso_pu_bacteria | 8003992118 | 8003992792 | 219 |
| 428 | iso_pu_bacteria | 8003999396 | 8004000118 | 219 |
| 429 | iso_pu_bacteria | 8005258706 | 8005260864 | 219 |
| 430 | iso_pu_bacteria | 8005275841 | 8005279443 | 219 |
| 431 | iso_pu_bacteria | 8005282627 | 8005283878 | 219 |
| 432 | iso_pu_bacteria | 8005289223 | 8005292668 | 219 |
| 433 | iso_pu_bacteria | 8005301065 | 8005304439 | 219 |
| 434 | iso_pu_bacteria | 8005307578 | 8005309015 | 219 |
| 435 | iso_pu_bacteria | 8005314921 | 8005315079 | 219 |
| 436 | iso_pu_bacteria | 8005321885 | 8005324045 | 219 |
| 437 | iso_pu_bacteria | 8005376324 | 8005376748 | 219 |
| 438 | iso_pu_bacteria | 8005382845 | 8005386127 | 219 |
| 439 | iso_pu_bacteria | 8005395548 | 8005397475 | 219 |
| 440 | iso_pu_bacteria | 8005430974 | 8005434528 | 219 |
| 441 | iso_pu_bacteria | 8005460587 | 8005461791 | 219 |
| 442 | iso_pu_bacteria | 8005497431 | 8005499201 | 219 |
| 443 | iso_pu_bacteria | 8005542996 | 8005544222 | 219 |
| 444 | iso_pu_bacteria | 8005556819 | 8005563008 | 219 |
| 445 | iso_pu_bacteria | 8005563573 | 8005570305 | 219 |
| 446 | iso_pu_bacteria | 8005570704 | 8005577541 | 219 |
| 447 | iso_pu_bacteria | 8005619151 | 8005620394 | 219 |
| 448 | iso_pu_bacteria | 8005626139 | 8005626633 | 219 |
| 449 | iso_pu_bacteria | 8005645114 | 8005648108 | 219 |
| 450 | iso_pu_bacteria | 8005668836 | 8005670617 | 219 |
| 451 | iso_pu_bacteria | 8005682033 | 8005684723 | 219 |
| 452 | iso_pu_bacteria | 8005688590 | 8005690860 | 219 |
| 453 | iso_pu_bacteria | 8005695170 | 8005698925 | 219 |
| 454 | iso_pu_bacteria | 8018127388 | 8018131166 | 219 |
| 455 | iso_pu_bacteria | 8018163183 | 8018168307 | 219 |
| 456 | iso_pu_bacteria | 8018176218 | 8018177385 | 219 |
| 457 | iso_pu_bacteria | 8023680758 | 8023687134 | 219 |
| 458 | iso_pu_bacteria | 8024479707 | 8024480969 | 219 |
| 459 | iso_pu_bacteria | 8024486573 | 8024489870 | 219 |
| 460 | iso_pu_bacteria | 8024501048 | 8024503387 | 219 |
| 461 | iso_pu_bacteria | 8049293176 | 8049293812 | 219 |
| 462 | iso_pu_bacteria | 8054558443 | 8054563588 | 219 |
| 463 | iso_pu_bacteria | 8056375014 | 8056379436 | 219 |
| 464 | iso_pu_bacteria | 8056382006 | 8056384882 | 219 |
| 465 | iso_pu_bacteria | 8057874678 | 8057879611 | 219 |
| 466 | 3300003187 | JGI25151J46595_10003599 | JGI25151J46595_100035994 | 220 |
| 467 | 3300003187 | JGI25151J46595_10004214 | JGI25151J46595_100042144 | 220 |
| 468 | 3300003771 | Ga0055526_1000042 | Ga0055526_1000042106 | 220 |
| 469 | 3300003771 | Ga0055526_1005449 | Ga0055526_10054496 | 220 |
| 470 | 3300003775 | Ga0055524_1011277 | Ga0055524_10112774 | 220 |
| 471 | 3300003775 | Ga0055524_1012192 | Ga0055524_10121924 | 220 |
| 472 | 3300003790 | Ga0055528_1000607 | Ga0055528_10006078 | 220 |
| 473 | 3300005440 | Ga0070705_100119002 | Ga0070705_1001190022 | 220 |
| 474 | 3300009098 | Ga0105245_10162320 | Ga0105245_101623203 | 220 |
| 475 | 3300021361 | Ga0213872_10017525 | Ga0213872_100175253 | 220 |
| 476 | 3300025245 | Ga0207425_1011070 | Ga0207425_10110702 | 220 |
| 477 | 3300025258 | Ga0209129_1000125 | Ga0209129_100012579 | 220 |
| 478 | 3300025273 | Ga0209673_1000122 | Ga0209673_1000122124 | 220 |
| 479 | 3300025292 | Ga0209676_1027963 | Ga0209676_10279632 | 220 |
| 480 | 3300025294 | Ga0209025_1000953 | Ga0209025_100095347 | 220 |
| 481 | 3300025294 | Ga0209025_1009717 | Ga0209025_10097175 | 220 |
| 482 | 3300025295 | Ga0209564_1000032 | Ga0209564_1000032148 | 220 |
| 483 | 3300025295 | Ga0209564_1006562 | Ga0209564_10065625 | 220 |
| 484 | 3300025299 | Ga0209256_1001198 | Ga0209256_100119818 | 220 |
| 485 | 3300025303 | Ga0209051_1040904 | Ga0209051_10409042 | 220 |
| 486 | 3300025918 | Ga0207662_10269853 | Ga0207662_102698532 | 220 |
| 487 | 3300031240 | Ga0265320_10004010 | Ga0265320_100040103 | 220 |
| 488 | 3300031241 | Ga0265325_10005675 | Ga0265325_100056757 | 220 |
| 489 | 3300031249 | Ga0265339_10166455 | Ga0265339_101664552 | 220 |
| 490 | 3300031250 | Ga0265331_10060087 | Ga0265331_100600872 | 220 |
| 491 | 3300031344 | Ga0265316_10102429 | Ga0265316_101024293 | 220 |
| 492 | 3300031595 | Ga0265313_10068206 | Ga0265313_100682061 | 220 |
| 493 | 3300031711 | Ga0265314_10072842 | Ga0265314_100728423 | 220 |
| 494 | 3300031711 | Ga0265314_10102220 | Ga0265314_101022203 | 220 |
| 495 | 3300039437 | Ga0436365_0142070 | Ga0436365_0142070_1434_2102 | 220 |
| 496 | 3300039447 | Ga0436361_0316796 | Ga0436361_0316796_1338_2003 | 220 |
| 497 | 3300039453 | Ga0436362_0060280 | Ga0436362_0060280_4066_4734 | 220 |
| 498 | 3300048912 | Ga0496109_0139312 | Ga0496109_0139312_1287_1949 | 220 |
| 499 | 3300048913 | Ga0496110_0062535 | Ga0496110_0062535_1476_2138 | 220 |
| 500 | 3300048916 | Ga0496113_0010427 | Ga0496113_0010427_3956_4618 | 220 |
| 501 | 3300048925 | Ga0496122_0100553 | Ga0496122_0100553_943_1605 | 220 |
| 502 | 3300048926 | Ga0496123_0117447 | Ga0496123_0117447_184_846 | 220 |
| 503 | 3300048929 | Ga0496126_0001787 | Ga0496126_0001787_24732_25400 | 220 |
| 504 | 3300048929 | Ga0496126_0120287 | Ga0496126_0120287_45_707 | 220 |
| 505 | 3300049570 | Ga0501033_0224584 | Ga0501033_0224584_316_987 | 220 |
| 506 | 3300049581 | Ga0501047_0158309 | Ga0501047_0158309_1106_1768 | 220 |
| 507 | 3300049823 | Ga0501044_0039017 | Ga0501044_0039017_1476_2147 | 220 |
| 508 | iso_pu_bacteria | 8005658619 | 8005660089 | 220 |
| 509 | iso_pu_bacteria | 8055431914 | 8055434053 | 220 |
| 510 | 3300005331 | Ga0070670_100169119 | Ga0070670_1001691192 | 221 |
| 511 | 3300005347 | Ga0070668_100053738 | Ga0070668_1000537383 | 221 |
| 512 | 3300005457 | Ga0070662_100276456 | Ga0070662_1002764562 | 221 |
| 513 | 3300005459 | Ga0068867_100114855 | Ga0068867_1001148552 | 221 |
| 514 | 3300005536 | Ga0070697_100625443 | Ga0070697_1006254432 | 221 |
| 515 | 3300005844 | Ga0068862_100267796 | Ga0068862_1002677962 | 221 |
| 516 | 3300006051 | Ga0075364_10032539 | Ga0075364_100325394 | 221 |
| 517 | 3300006353 | Ga0075370_10113838 | Ga0075370_101138383 | 221 |
| 518 | 3300006847 | Ga0075431_100012097 | Ga0075431_1000120975 | 221 |
| 519 | 3300006880 | Ga0075429_100723170 | Ga0075429_1007231701 | 221 |
| 520 | 3300009147 | Ga0114129_10031485 | Ga0114129_100314855 | 221 |
| 521 | 3300014326 | Ga0157380_10629063 | Ga0157380_106290632 | 221 |
| 522 | 3300025907 | Ga0207645_10158068 | Ga0207645_101580682 | 221 |
| 523 | 3300025923 | Ga0207681_10250457 | Ga0207681_102504572 | 221 |
| 524 | 3300025934 | Ga0207686_10106587 | Ga0207686_101065872 | 221 |
| 525 | 3300025935 | Ga0207709_10085278 | Ga0207709_100852783 | 221 |
| 526 | 3300025972 | Ga0207668_10314034 | Ga0207668_103140342 | 221 |
| 527 | 3300025986 | Ga0207658_10096946 | Ga0207658_100969462 | 221 |
| 528 | 3300028381 | Ga0268264_10511331 | Ga0268264_105113312 | 221 |
| 529 | 3300037312 | Ga0395899_0156211 | Ga0395899_0156211_651_1316 | 221 |
| 530 | 3300037418 | Ga0395900_0088630 | Ga0395900_0088630_2332_2997 | 221 |
| 531 | 3300038443 | Ga0395901_0081030 | Ga0395901_0081030_203_868 | 221 |
| 532 | 3300039453 | Ga0436362_0870149 | Ga0436362_0870149_23_694 | 221 |
| 533 | 3300041458 | Ga0451798_0107945 | Ga0451798_0107945_164_835 | 221 |
| 534 | 3300042009 | Ga0439451_007817 | Ga0439451_007817_466_1137 | 221 |
| 535 | 3300047319 | Ga0495674_0366898 | Ga0495674_0366898_57_731 | 221 |
| 536 | 3300048916 | Ga0496113_0802189 | Ga0496113_0802189_48_719 | 221 |
| 537 | 3300049568 | Ga0501031_0090259 | Ga0501031_0090259_157_822 | 221 |
| 538 | 3300049568 | Ga0501031_0247473 | Ga0501031_0247473_15_680 | 221 |
| 539 | 3300049570 | Ga0501033_0036043 | Ga0501033_0036043_538_1203 | 221 |
| 540 | 3300049570 | Ga0501033_0195259 | Ga0501033_0195259_497_1168 | 221 |
| 541 | 3300049571 | Ga0501034_0003097 | Ga0501034_0003097_2019_2684 | 221 |
| 542 | 3300049571 | Ga0501034_0051684 | Ga0501034_0051684_447_1112 | 221 |
| 543 | 3300049571 | Ga0501034_0164534 | Ga0501034_0164534_695_1360 | 221 |
| 544 | 3300049571 | Ga0501034_0234799 | Ga0501034_0234799_1087_1758 | 221 |
| 545 | 3300049572 | Ga0501036_0048788 | Ga0501036_0048788_1205_1870 | 221 |
| 546 | 3300049572 | Ga0501036_0089967 | Ga0501036_0089967_497_1168 | 221 |
| 547 | 3300049573 | Ga0501037_0033875 | Ga0501037_0033875_75_740 | 221 |
| 548 | 3300049573 | Ga0501037_0098678 | Ga0501037_0098678_395_1066 | 221 |
| 549 | 3300049574 | Ga0501038_0056632 | Ga0501038_0056632_538_1203 | 221 |
| 550 | 3300049575 | Ga0501039_0065001 | Ga0501039_0065001_609_1280 | 221 |
| 551 | 3300049575 | Ga0501039_0338994 | Ga0501039_0338994_442_1107 | 221 |
| 552 | 3300049576 | Ga0501040_0024436 | Ga0501040_0024436_1699_2370 | 221 |
| 553 | 3300049577 | Ga0501041_0018238 | Ga0501041_0018238_2062_2733 | 221 |
| 554 | 3300049578 | Ga0501042_0138432 | Ga0501042_0138432_828_1499 | 221 |
| 555 | 3300049578 | Ga0501042_0190463 | Ga0501042_0190463_515_1186 | 221 |
| 556 | 3300049579 | Ga0501043_0081640 | Ga0501043_0081640_1801_2466 | 221 |
| 557 | 3300049580 | Ga0501046_0059508 | Ga0501046_0059508_1088_1759 | 221 |
| 558 | 3300049580 | Ga0501046_0110827 | Ga0501046_0110827_1296_1961 | 221 |
| 559 | 3300049581 | Ga0501047_0118076 | Ga0501047_0118076_1840_2505 | 221 |
| 560 | 3300049581 | Ga0501047_0168298 | Ga0501047_0168298_101_766 | 221 |
| 561 | 3300049582 | Ga0501048_0128827 | Ga0501048_0128827_699_1370 | 221 |
| 562 | 3300049582 | Ga0501048_0449758 | Ga0501048_0449758_122_787 | 221 |
| 563 | 3300049584 | Ga0501068_0002277 | Ga0501068_0002277_9052_9717 | 221 |
| 564 | 3300049586 | Ga0501070_0380798 | Ga0501070_0380798_11_691 | 221 |
| 565 | 3300049587 | Ga0501071_0154640 | Ga0501071_0154640_744_1415 | 221 |
| 566 | 3300049588 | Ga0501072_0038176 | Ga0501072_0038176_2436_3107 | 221 |
| 567 | 3300049590 | Ga0501074_0195088 | Ga0501074_0195088_758_1423 | 221 |
| 568 | 3300049591 | Ga0501075_0060975 | Ga0501075_0060975_843_1514 | 221 |
| 569 | 3300049592 | Ga0501076_0004128 | Ga0501076_0004128_3948_4619 | 221 |
| 570 | 3300049593 | Ga0501077_0014578 | Ga0501077_0014578_1632_2303 | 221 |
| 571 | 3300049741 | Ga0501079_0032431 | Ga0501079_0032431_1966_2637 | 221 |
| 572 | 3300049742 | Ga0501080_0033607 | Ga0501080_0033607_2280_2951 | 221 |
| 573 | 3300049743 | Ga0501081_0037644 | Ga0501081_0037644_591_1262 | 221 |
| 574 | 3300049744 | Ga0501083_0095273 | Ga0501083_0095273_479_1150 | 221 |
| 575 | 3300049776 | Ga0501280_004260 | Ga0501280_004260_258_923 | 221 |
| 576 | 3300049822 | Ga0501035_0004670 | Ga0501035_0004670_7615_8280 | 221 |
| 577 | 3300049822 | Ga0501035_0111615 | Ga0501035_0111615_1049_1720 | 221 |
| 578 | 3300049823 | Ga0501044_0071284 | Ga0501044_0071284_2331_2996 | 221 |
| 579 | 3300049824 | Ga0501045_0148923 | Ga0501045_0148923_811_1482 | 221 |
| 580 | 3300050491 | nmdc:mga00v17_13819_c1 | nmdc:mga00v17_13819_c1_2424_3089 | 221 |
| 581 | 3300050496 | nmdc:mga07m45_212239_c1 | nmdc:mga07m45_212239_c1_242_913 | 221 |
| 582 | 3300050507 | nmdc:mga05p37_152544_c1 | nmdc:mga05p37_152544_c1_1355_2026 | 221 |
| 583 | 3300050508 | nmdc:mga09592_687107_c1 | nmdc:mga09592_687107_c1_38_709 | 221 |
| 584 | 3300050510 | nmdc:mga06r32_15122_c2 | nmdc:mga06r32_15122_c2_1342_2013 | 221 |
| 585 | 3300053098 | Ga0500650_0090740 | Ga0500650_0090740_217_888 | 221 |
| 586 | 3300053103 | Ga0500555_018291 | Ga0500555_018291_161_832 | 221 |
| 587 | 3300054114 | Ga0501084_0010520 | Ga0501084_0010520_6482_7153 | 221 |
| 588 | 3300060353 | Ga0501082_0015012 | Ga0501082_0015012_5161_5832 | 221 |
| 589 | 3300061719 | Ga0466962_0343528 | Ga0466962_0343528_12_683 | 221 |
| 590 | 3300061734 | Ga0530510_0183887 | Ga0530510_0183887_453_1124 | 221 |
| 591 | iso_pu_bacteria | 2513237159 | 2513999444 | 221 |
| 592 | iso_pu_bacteria | 2582581283 | 2585165438 | 221 |
| 593 | iso_pu_bacteria | 2582581306 | 2585266300 | 221 |
| 594 | iso_pu_bacteria | 2582581865 | 2585387301 | 221 |
| 595 | iso_pu_bacteria | 2582581866 | 2585397802 | 221 |
| 596 | iso_pu_bacteria | 2599185156 | 2599333900 | 221 |
| 597 | iso_pu_bacteria | 2643221607 | 2644046695 | 221 |
| 598 | iso_pu_bacteria | 2643221636 | 2644202402 | 221 |
| 599 | iso_pu_bacteria | 2643221637 | 2644206317 | 221 |
| 600 | iso_pu_bacteria | 2643221686 | 2644479484 | 221 |
| 601 | iso_pu_bacteria | 2643221718 | 2644649965 | 221 |
| 602 | iso_pu_bacteria | 2791355253 | 2793282853 | 221 |
| 603 | iso_pu_bacteria | 2837651117 | 2837652570 | 221 |
| 604 | iso_pu_bacteria | 2842521101 | 2842525237 | 221 |
| 605 | iso_pu_bacteria | 2842922631 | 2842923701 | 221 |
| 606 | 3300005335 | Ga0070666_10008438 | Ga0070666_100084382 | 222 |
| 607 | 3300005341 | Ga0070691_10002680 | Ga0070691_100026804 | 222 |
| 608 | 3300005434 | Ga0070709_10001001 | Ga0070709_1000100112 | 222 |
| 609 | 3300005434 | Ga0070709_10493890 | Ga0070709_104938901 | 222 |
| 610 | 3300005435 | Ga0070714_100012979 | Ga0070714_1000129794 | 222 |
| 611 | 3300005435 | Ga0070714_100865222 | Ga0070714_1008652222 | 222 |
| 612 | 3300005436 | Ga0070713_100000262 | Ga0070713_10000026230 | 222 |
| 613 | 3300005439 | Ga0070711_100197511 | Ga0070711_1001975112 | 222 |
| 614 | 3300005440 | Ga0070705_100324345 | Ga0070705_1003243452 | 222 |
| 615 | 3300005458 | Ga0070681_10082403 | Ga0070681_100824033 | 222 |
| 616 | 3300005468 | Ga0070707_100742212 | Ga0070707_1007422121 | 222 |
| 617 | 3300005530 | Ga0070679_100163594 | Ga0070679_1001635942 | 222 |
| 618 | 3300005548 | Ga0070665_100181852 | Ga0070665_1001818522 | 222 |
| 619 | 3300005548 | Ga0070665_101068319 | Ga0070665_1010683191 | 222 |
| 620 | 3300005563 | Ga0068855_100066217 | Ga0068855_1000662175 | 222 |
| 621 | 3300005563 | Ga0068855_100113925 | Ga0068855_1001139252 | 222 |
| 622 | 3300005577 | Ga0068857_100001171 | Ga0068857_1000011719 | 222 |
| 623 | 3300005614 | Ga0068856_100003455 | Ga0068856_10000345512 | 222 |
| 624 | 3300005614 | Ga0068856_100003973 | Ga0068856_10000397312 | 222 |
| 625 | 3300005616 | Ga0068852_100005263 | Ga0068852_1000052637 | 222 |
| 626 | 3300005842 | Ga0068858_100017646 | Ga0068858_1000176463 | 222 |
| 627 | 3300005843 | Ga0068860_100190810 | Ga0068860_1001908103 | 222 |
| 628 | 3300006173 | Ga0070716_100007829 | Ga0070716_1000078295 | 222 |
| 629 | 3300006175 | Ga0070712_100000171 | Ga0070712_1000001712 | 222 |
| 630 | 3300006175 | Ga0070712_100008256 | Ga0070712_1000082565 | 222 |
| 631 | 3300006237 | Ga0097621_100577839 | Ga0097621_1005778392 | 222 |
| 632 | 3300006871 | Ga0075434_100029143 | Ga0075434_1000291436 | 222 |
| 633 | 3300006914 | Ga0075436_100001738 | Ga0075436_10000173811 | 222 |
| 634 | 3300006914 | Ga0075436_100055208 | Ga0075436_1000552083 | 222 |
| 635 | 3300007076 | Ga0075435_100119646 | Ga0075435_1001196462 | 222 |
| 636 | 3300009093 | Ga0105240_10002102 | Ga0105240_1000210226 | 222 |
| 637 | 3300009098 | Ga0105245_10030128 | Ga0105245_100301282 | 222 |
| 638 | 3300009174 | Ga0105241_10010758 | Ga0105241_100107584 | 222 |
| 639 | 3300009174 | Ga0105241_10782045 | Ga0105241_107820452 | 222 |
| 640 | 3300009177 | Ga0105248_10539530 | Ga0105248_105395302 | 222 |
| 641 | 3300009545 | Ga0105237_10056896 | Ga0105237_100568964 | 222 |
| 642 | 3300013100 | Ga0157373_10029739 | Ga0157373_100297393 | 222 |
| 643 | 3300013104 | Ga0157370_10004692 | Ga0157370_100046924 | 222 |
| 644 | 3300013105 | Ga0157369_10086504 | Ga0157369_100865043 | 222 |
| 645 | 3300013306 | Ga0163162_10116440 | Ga0163162_101164405 | 222 |
| 646 | 3300013307 | Ga0157372_10014340 | Ga0157372_100143409 | 222 |
| 647 | 3300014968 | Ga0157379_10001940 | Ga0157379_1000194011 | 222 |
| 648 | 3300014968 | Ga0157379_10009144 | Ga0157379_100091444 | 222 |
| 649 | 3300014968 | Ga0157379_10022145 | Ga0157379_100221454 | 222 |
| 650 | 3300017792 | Ga0163161_10672612 | Ga0163161_106726122 | 222 |
| 651 | 3300021384 | Ga0213876_10020884 | Ga0213876_100208843 | 222 |
| 652 | 3300025906 | Ga0207699_10000246 | Ga0207699_1000024614 | 222 |
| 653 | 3300025906 | Ga0207699_10030561 | Ga0207699_100305614 | 222 |
| 654 | 3300025911 | Ga0207654_10067032 | Ga0207654_100670322 | 222 |
| 655 | 3300025912 | Ga0207707_10125146 | Ga0207707_101251462 | 222 |
| 656 | 3300025914 | Ga0207671_10114443 | Ga0207671_101144432 | 222 |
| 657 | 3300025915 | Ga0207693_10000025 | Ga0207693_1000002523 | 222 |
| 658 | 3300025916 | Ga0207663_10007296 | Ga0207663_100072963 | 222 |
| 659 | 3300025916 | Ga0207663_10320849 | Ga0207663_103208492 | 222 |
| 660 | 3300025916 | Ga0207663_10365426 | Ga0207663_103654262 | 222 |
| 661 | 3300025921 | Ga0207652_10322291 | Ga0207652_103222912 | 222 |
| 662 | 3300025928 | Ga0207700_10000005 | Ga0207700_10000005411 | 222 |
| 663 | 3300025929 | Ga0207664_10014667 | Ga0207664_100146675 | 222 |
| 664 | 3300025941 | Ga0207711_10359853 | Ga0207711_103598532 | 222 |
| 665 | 3300025949 | Ga0207667_10011654 | Ga0207667_100116549 | 222 |
| 666 | 3300025949 | Ga0207667_10050944 | Ga0207667_100509443 | 222 |
| 667 | 3300025981 | Ga0207640_10066239 | Ga0207640_100662393 | 222 |
| 668 | 3300026035 | Ga0207703_10009981 | Ga0207703_100099814 | 222 |
| 669 | 3300026078 | Ga0207702_10000055 | Ga0207702_1000005522 | 222 |
| 670 | 3300026088 | Ga0207641_10124096 | Ga0207641_101240963 | 222 |
| 671 | 3300026116 | Ga0207674_10000004 | Ga0207674_10000004200 | 222 |
| 672 | 3300026142 | Ga0207698_10011571 | Ga0207698_100115718 | 222 |
| 673 | 3300028381 | Ga0268264_10165699 | Ga0268264_101656992 | 222 |
| 674 | 3300028577 | Ga0265318_10001236 | Ga0265318_1000123619 | 222 |
| 675 | 3300031235 | Ga0265330_10079778 | Ga0265330_100797782 | 222 |
| 676 | 3300031239 | Ga0265328_10026733 | Ga0265328_100267332 | 222 |
| 677 | 3300031240 | Ga0265320_10035158 | Ga0265320_100351582 | 222 |
| 678 | 3300031240 | Ga0265320_10035866 | Ga0265320_100358662 | 222 |
| 679 | 3300031241 | Ga0265325_10016931 | Ga0265325_100169312 | 222 |
| 680 | 3300031241 | Ga0265325_10106147 | Ga0265325_101061472 | 222 |
| 681 | 3300031595 | Ga0265313_10002103 | Ga0265313_1000210316 | 222 |
| 682 | 3300031595 | Ga0265313_10003670 | Ga0265313_100036709 | 222 |
| 683 | 3300031711 | Ga0265314_10005985 | Ga0265314_100059854 | 222 |
| 684 | 3300031711 | Ga0265314_10006055 | Ga0265314_100060559 | 222 |
| 685 | 3300031712 | Ga0265342_10043586 | Ga0265342_100435864 | 222 |
| 686 | 3300035691 | Ga0373931_0004426 | Ga0373931_0004426_3463_4137 | 222 |
| 687 | 3300035724 | Ga0373933_0007071 | Ga0373933_0007071_2014_2688 | 222 |
| 688 | 3300036401 | Ga0373937_0027165 | Ga0373937_0027165_974_1648 | 222 |
| 689 | 3300036401 | Ga0373937_0071180 | Ga0373937_0071180_193_867 | 222 |
| 690 | 3300037068 | Ga0373925_0036387 | Ga0373925_0036387_1166_1840 | 222 |
| 691 | 3300037418 | Ga0395900_0081620 | Ga0395900_0081620_1252_1965 | 222 |
| 692 | 3300037471 | Ga0395905_0002327 | Ga0395905_0002327_7469_8137 | 222 |
| 693 | 3300037471 | Ga0395905_0031592 | Ga0395905_0031592_3961_4674 | 222 |
| 694 | 3300038443 | Ga0395901_0470095 | Ga0395901_0470095_35_748 | 222 |
| 695 | 3300039437 | Ga0436365_1329101 | Ga0436365_1329101_5241_5912 | 222 |
| 696 | 3300046675 | Ga0495657_0086551 | Ga0495657_0086551_245_919 | 222 |
| 697 | 3300048904 | Ga0496101_0393033 | Ga0496101_0393033_145_819 | 222 |
| 698 | 3300048914 | Ga0496111_0124262 | Ga0496111_0124262_325_999 | 222 |
| 699 | 3300049570 | Ga0501033_0087270 | Ga0501033_0087270_742_1413 | 222 |
| 700 | 3300049571 | Ga0501034_0011474 | Ga0501034_0011474_2917_3588 | 222 |
| 701 | 3300049571 | Ga0501034_0056225 | Ga0501034_0056225_2878_3546 | 222 |
| 702 | 3300049571 | Ga0501034_0079282 | Ga0501034_0079282_1411_2082 | 222 |
| 703 | 3300049571 | Ga0501034_0255974 | Ga0501034_0255974_71_742 | 222 |
| 704 | 3300049573 | Ga0501037_0164128 | Ga0501037_0164128_92_763 | 222 |
| 705 | 3300049580 | Ga0501046_0008000 | Ga0501046_0008000_6471_7142 | 222 |
| 706 | 3300049581 | Ga0501047_0001553 | Ga0501047_0001553_3050_3721 | 222 |
| 707 | 3300049582 | Ga0501048_0138435 | Ga0501048_0138435_570_1241 | 222 |
| 708 | 3300049742 | Ga0501080_0105651 | Ga0501080_0105651_32_703 | 222 |
| 709 | 3300049742 | Ga0501080_0154648 | Ga0501080_0154648_265_936 | 222 |
| 710 | 3300049822 | Ga0501035_0054857 | Ga0501035_0054857_2393_3064 | 222 |
| 711 | 3300049823 | Ga0501044_0223796 | Ga0501044_0223796_874_1545 | 222 |
| 712 | 3300049823 | Ga0501044_0298807 | Ga0501044_0298807_763_1434 | 222 |
| 713 | 3300049823 | Ga0501044_0386727 | Ga0501044_0386727_457_1128 | 222 |
| 714 | 3300050512 | nmdc:mga0n895_1692_c1 | nmdc:mga0n895_1692_c1_3705_4379 | 222 |
| 715 | 3300050514 | nmdc:mga08x19_51_c1 | nmdc:mga08x19_51_c1_35323_35997 | 222 |
| 716 | 3300001979 | JGI24740J21852_10001706 | JGI24740J21852_1000170610 | 223 |
| 717 | 3300002704 | JGI25155J39150_1000089 | JGI25155J39150_10000894 | 223 |
| 718 | 3300002705 | JGI25156J39149_1000147 | JGI25156J39149_10001474 | 223 |
| 719 | 3300002737 | JGI25162J39368_1000243 | JGI25162J39368_100024356 | 223 |
| 720 | 3300002737 | JGI25162J39368_1000372 | JGI25162J39368_10003728 | 223 |
| 721 | 3300002738 | JGI25154J39366_1000160 | JGI25154J39366_100016060 | 223 |
| 722 | 3300002739 | JGI25158J39367_1000293 | JGI25158J39367_10002934 | 223 |
| 723 | 3300002739 | JGI25158J39367_1001028 | JGI25158J39367_10010287 | 223 |
| 724 | 3300002741 | JGI25157J39369_1000190 | JGI25157J39369_10001904 | 223 |
| 725 | 3300002773 | JGI25152J39213_1003430 | JGI25152J39213_10034304 | 223 |
| 726 | 3300002773 | JGI25152J39213_1004848 | JGI25152J39213_10048485 | 223 |
| 727 | 3300002773 | JGI25152J39213_1006337 | JGI25152J39213_10063374 | 223 |
| 728 | 3300002773 | JGI25152J39213_1006342 | JGI25152J39213_10063424 | 223 |
| 729 | 3300002773 | JGI25152J39213_1006896 | JGI25152J39213_10068964 | 223 |
| 730 | 3300002774 | JGI25150J39212_1000031 | JGI25150J39212_10000315 | 223 |
| 731 | 3300002987 | JGI25159J45721_1000001 | JGI25159J45721_1000001294 | 223 |
| 732 | 3300002987 | JGI25159J45721_1000264 | JGI25159J45721_100026431 | 223 |
| 733 | 3300003187 | JGI25151J46595_10000062 | JGI25151J46595_10000062119 | 223 |
| 734 | 3300003187 | JGI25151J46595_10014854 | JGI25151J46595_100148544 | 223 |
| 735 | 3300003187 | JGI25151J46595_10036908 | JGI25151J46595_100369083 | 223 |
| 736 | 3300003214 | JGI25165J46597_1000318 | JGI25165J46597_100031812 | 223 |
| 737 | 3300003214 | JGI25165J46597_1000413 | JGI25165J46597_100041343 | 223 |
| 738 | 3300003214 | JGI25165J46597_1004436 | JGI25165J46597_10044365 | 223 |
| 739 | 3300003215 | JGI25153J46596_10002646 | JGI25153J46596_1000264610 | 223 |
| 740 | 3300003215 | JGI25153J46596_10006186 | JGI25153J46596_100061866 | 223 |
| 741 | 3300003215 | JGI25153J46596_10034305 | JGI25153J46596_100343051 | 223 |
| 742 | 3300003215 | JGI25153J46596_10034323 | JGI25153J46596_100343231 | 223 |
| 743 | 3300003316 | rootH1_10006292 | rootH1_100062926 | 223 |
| 744 | 3300003354 | JGI25160J50197_1000002 | JGI25160J50197_100000220 | 223 |
| 745 | 3300003354 | JGI25160J50197_1000855 | JGI25160J50197_100085516 | 223 |
| 746 | 3300003354 | JGI25160J50197_1001062 | JGI25160J50197_100106214 | 223 |
| 747 | 3300003354 | JGI25160J50197_1013067 | JGI25160J50197_10130674 | 223 |
| 748 | 3300003374 | JGI25161J50226_1000338 | JGI25161J50226_10003384 | 223 |
| 749 | 3300003374 | JGI25161J50226_1000742 | JGI25161J50226_10007427 | 223 |
| 750 | 3300003374 | JGI25161J50226_1001156 | JGI25161J50226_10011569 | 223 |
| 751 | 3300003771 | Ga0055526_1000805 | Ga0055526_100080515 | 223 |
| 752 | 3300003771 | Ga0055526_1010411 | Ga0055526_10104113 | 223 |
| 753 | 3300003771 | Ga0055526_1019686 | Ga0055526_10196863 | 223 |
| 754 | 3300003771 | Ga0055526_1020429 | Ga0055526_10204292 | 223 |
| 755 | 3300003771 | Ga0055526_1030080 | Ga0055526_10300801 | 223 |
| 756 | 3300003775 | Ga0055524_1000650 | Ga0055524_100065019 | 223 |
| 757 | 3300003775 | Ga0055524_1006021 | Ga0055524_10060213 | 223 |
| 758 | 3300003775 | Ga0055524_1017549 | Ga0055524_10175492 | 223 |
| 759 | 3300003775 | Ga0055524_1022121 | Ga0055524_10221214 | 223 |
| 760 | 3300003775 | Ga0055524_1024531 | Ga0055524_10245312 | 223 |
| 761 | 3300003781 | Ga0055536_1000427 | Ga0055536_10004276 | 223 |
| 762 | 3300003790 | Ga0055528_1000798 | Ga0055528_100079824 | 223 |
| 763 | 3300003790 | Ga0055528_1005643 | Ga0055528_10056437 | 223 |
| 764 | 3300003790 | Ga0055528_1013886 | Ga0055528_10138862 | 223 |
| 765 | 3300003790 | Ga0055528_1030911 | Ga0055528_10309112 | 223 |
| 766 | 3300003791 | Ga0055530_10004975 | Ga0055530_100049752 | 223 |
| 767 | 3300003792 | Ga0055540_1000380 | Ga0055540_100038045 | 223 |
| 768 | 3300003792 | Ga0055540_1010288 | Ga0055540_10102885 | 223 |
| 769 | 3300003792 | Ga0055540_1013681 | Ga0055540_10136812 | 223 |
| 770 | 3300003792 | Ga0055540_1033501 | Ga0055540_10335012 | 223 |
| 771 | 3300003794 | Ga0055531_10029444 | Ga0055531_100294442 | 223 |
| 772 | 3300003856 | Ga0058692_1013229 | Ga0058692_10132292 | 223 |
| 773 | 3300004625 | Ga0055543_1000115 | Ga0055543_100011576 | 223 |
| 774 | 3300004625 | Ga0055543_1000137 | Ga0055543_100013766 | 223 |
| 775 | 3300004625 | Ga0055543_1003775 | Ga0055543_10037755 | 223 |
| 776 | 3300005262 | Ga0065165_1000004 | Ga0065165_1000004362 | 223 |
| 777 | 3300005262 | Ga0065165_1003706 | Ga0065165_100370610 | 223 |
| 778 | 3300005547 | Ga0070693_100081219 | Ga0070693_1000812191 | 223 |
| 779 | 3300005578 | Ga0068854_100037323 | Ga0068854_1000373234 | 223 |
| 780 | 3300005616 | Ga0068852_100036960 | Ga0068852_1000369602 | 223 |
| 781 | 3300005834 | Ga0068851_10253758 | Ga0068851_102537581 | 223 |
| 782 | 3300005844 | Ga0068862_100281608 | Ga0068862_1002816083 | 223 |
| 783 | 3300006038 | Ga0075365_10075176 | Ga0075365_100751762 | 223 |
| 784 | 3300006042 | Ga0075368_10227118 | Ga0075368_102271181 | 223 |
| 785 | 3300006048 | Ga0075363_100153505 | Ga0075363_1001535052 | 223 |
| 786 | 3300006177 | Ga0075362_10070603 | Ga0075362_100706032 | 223 |
| 787 | 3300006178 | Ga0075367_10023622 | Ga0075367_100236222 | 223 |
| 788 | 3300006178 | Ga0075367_10127194 | Ga0075367_101271943 | 223 |
| 789 | 3300006178 | Ga0075367_10184832 | Ga0075367_101848322 | 223 |
| 790 | 3300006178 | Ga0075367_10204975 | Ga0075367_102049752 | 223 |
| 791 | 3300006195 | Ga0075366_10050728 | Ga0075366_100507284 | 223 |
| 792 | 3300006353 | Ga0075370_10112041 | Ga0075370_101120413 | 223 |
| 793 | 3300006946 | Ga0079104_1001952 | Ga0079104_100195215 | 223 |
| 794 | 3300006946 | Ga0079104_1006397 | Ga0079104_10063975 | 223 |
| 795 | 3300009092 | Ga0105250_10027216 | Ga0105250_100272165 | 223 |
| 796 | 3300009093 | Ga0105240_10000027 | Ga0105240_10000027291 | 223 |
| 797 | 3300009177 | Ga0105248_10060975 | Ga0105248_100609752 | 223 |
| 798 | 3300009765 | Ga0123341_1000006 | Ga0123341_1000006104 | 223 |
| 799 | 3300009766 | Ga0123342_1004514 | Ga0123342_100451414 | 223 |
| 800 | 3300013100 | Ga0157373_10390964 | Ga0157373_103909642 | 223 |
| 801 | 3300013104 | Ga0157370_10000223 | Ga0157370_1000022320 | 223 |
| 802 | 3300013249 | Ga0171463_1001 | Ga0171463_1001334 | 223 |
| 803 | 3300015262 | Ga0182007_10000805 | Ga0182007_1000080512 | 223 |
| 804 | 3300015690 | Ga0183363_1266 | Ga0183363_12667 | 223 |
| 805 | 3300021320 | Ga0214544_1000008 | Ga0214544_100000855 | 223 |
| 806 | 3300021321 | Ga0214542_1000010 | Ga0214542_100001011 | 223 |
| 807 | 3300021321 | Ga0214542_1022278 | Ga0214542_10222786 | 223 |
| 808 | 3300021327 | Ga0214543_1000003 | Ga0214543_1000003369 | 223 |
| 809 | 3300021327 | Ga0214543_1000004 | Ga0214543_100000433 | 223 |
| 810 | 3300022739 | Ga0228711_1000001 | Ga0228711_1000001180 | 223 |
| 811 | 3300022740 | Ga0228710_1000001 | Ga0228710_1000001144 | 223 |
| 812 | 3300025206 | Ga0209435_100036 | Ga0209435_10003659 | 223 |
| 813 | 3300025208 | Ga0209436_101062 | Ga0209436_1010623 | 223 |
| 814 | 3300025208 | Ga0209436_101252 | Ga0209436_1012524 | 223 |
| 815 | 3300025228 | Ga0209672_103497 | Ga0209672_1034972 | 223 |
| 816 | 3300025233 | Ga0209437_100033 | Ga0209437_100033154 | 223 |
| 817 | 3300025233 | Ga0209437_100036 | Ga0209437_100036406 | 223 |
| 818 | 3300025245 | Ga0207425_1000031 | Ga0207425_1000031235 | 223 |
| 819 | 3300025245 | Ga0207425_1001175 | Ga0207425_100117513 | 223 |
| 820 | 3300025245 | Ga0207425_1007557 | Ga0207425_10075573 | 223 |
| 821 | 3300025246 | Ga0209646_1000132 | Ga0209646_100013259 | 223 |
| 822 | 3300025250 | Ga0209026_1000313 | Ga0209026_10003134 | 223 |
| 823 | 3300025253 | Ga0209677_100419 | Ga0209677_10041925 | 223 |
| 824 | 3300025254 | Ga0209148_1020173 | Ga0209148_10201732 | 223 |
| 825 | 3300025256 | Ga0209759_1000417 | Ga0209759_10004174 | 223 |
| 826 | 3300025258 | Ga0209129_1000053 | Ga0209129_1000053236 | 223 |
| 827 | 3300025258 | Ga0209129_1000465 | Ga0209129_10004656 | 223 |
| 828 | 3300025258 | Ga0209129_1000945 | Ga0209129_10009457 | 223 |
| 829 | 3300025258 | Ga0209129_1002143 | Ga0209129_10021434 | 223 |
| 830 | 3300025258 | Ga0209129_1003204 | Ga0209129_10032045 | 223 |
| 831 | 3300025258 | Ga0209129_1005526 | Ga0209129_10055263 | 223 |
| 832 | 3300025261 | Ga0209233_1000056 | Ga0209233_1000056184 | 223 |
| 833 | 3300025261 | Ga0209233_1000064 | Ga0209233_1000064270 | 223 |
| 834 | 3300025261 | Ga0209233_1000152 | Ga0209233_100015226 | 223 |
| 835 | 3300025273 | Ga0209673_1000409 | Ga0209673_100040945 | 223 |
| 836 | 3300025273 | Ga0209673_1003665 | Ga0209673_10036659 | 223 |
| 837 | 3300025273 | Ga0209673_1004779 | Ga0209673_10047796 | 223 |
| 838 | 3300025273 | Ga0209673_1005538 | Ga0209673_10055386 | 223 |
| 839 | 3300025273 | Ga0209673_1008056 | Ga0209673_10080562 | 223 |
| 840 | 3300025273 | Ga0209673_1008564 | Ga0209673_10085642 | 223 |
| 841 | 3300025273 | Ga0209673_1010635 | Ga0209673_10106354 | 223 |
| 842 | 3300025273 | Ga0209673_1024143 | Ga0209673_10241433 | 223 |
| 843 | 3300025284 | Ga0209130_1000008 | Ga0209130_1000008520 | 223 |
| 844 | 3300025284 | Ga0209130_1000015 | Ga0209130_10000154 | 223 |
| 845 | 3300025291 | Ga0209675_1018780 | Ga0209675_10187802 | 223 |
| 846 | 3300025292 | Ga0209676_1000885 | Ga0209676_100088510 | 223 |
| 847 | 3300025292 | Ga0209676_1046142 | Ga0209676_10461422 | 223 |
| 848 | 3300025294 | Ga0209025_1000087 | Ga0209025_1000087235 | 223 |
| 849 | 3300025294 | Ga0209025_1000100 | Ga0209025_1000100106 | 223 |
| 850 | 3300025294 | Ga0209025_1001577 | Ga0209025_10015774 | 223 |
| 851 | 3300025294 | Ga0209025_1011394 | Ga0209025_10113946 | 223 |
| 852 | 3300025294 | Ga0209025_1011398 | Ga0209025_10113984 | 223 |
| 853 | 3300025294 | Ga0209025_1020091 | Ga0209025_10200913 | 223 |
| 854 | 3300025295 | Ga0209564_1000104 | Ga0209564_1000104202 | 223 |
| 855 | 3300025295 | Ga0209564_1001469 | Ga0209564_100146916 | 223 |
| 856 | 3300025295 | Ga0209564_1001682 | Ga0209564_100168224 | 223 |
| 857 | 3300025295 | Ga0209564_1002198 | Ga0209564_100219826 | 223 |
| 858 | 3300025295 | Ga0209564_1010193 | Ga0209564_10101932 | 223 |
| 859 | 3300025297 | Ga0209758_1000081 | Ga0209758_1000081235 | 223 |
| 860 | 3300025297 | Ga0209758_1000313 | Ga0209758_100031371 | 223 |
| 861 | 3300025297 | Ga0209758_1000376 | Ga0209758_100037686 | 223 |
| 862 | 3300025297 | Ga0209758_1001096 | Ga0209758_10010966 | 223 |
| 863 | 3300025297 | Ga0209758_1001417 | Ga0209758_100141732 | 223 |
| 864 | 3300025297 | Ga0209758_1001419 | Ga0209758_100141932 | 223 |
| 865 | 3300025297 | Ga0209758_1007473 | Ga0209758_10074734 | 223 |
| 866 | 3300025297 | Ga0209758_1035521 | Ga0209758_10355212 | 223 |
| 867 | 3300025298 | Ga0209050_1001263 | Ga0209050_10012636 | 223 |
| 868 | 3300025298 | Ga0209050_1012590 | Ga0209050_10125902 | 223 |
| 869 | 3300025299 | Ga0209256_1000351 | Ga0209256_100035158 | 223 |
| 870 | 3300025299 | Ga0209256_1000711 | Ga0209256_10007114 | 223 |
| 871 | 3300025299 | Ga0209256_1000723 | Ga0209256_100072348 | 223 |
| 872 | 3300025299 | Ga0209256_1008596 | Ga0209256_10085964 | 223 |
| 873 | 3300025299 | Ga0209256_1008685 | Ga0209256_10086853 | 223 |
| 874 | 3300025299 | Ga0209256_1019583 | Ga0209256_10195832 | 223 |
| 875 | 3300025299 | Ga0209256_1036607 | Ga0209256_10366072 | 223 |
| 876 | 3300025302 | Ga0207426_1000016 | Ga0207426_100001642 | 223 |
| 877 | 3300025302 | Ga0207426_1000122 | Ga0207426_1000122228 | 223 |
| 878 | 3300025302 | Ga0207426_1000146 | Ga0207426_1000146217 | 223 |
| 879 | 3300025302 | Ga0207426_1002469 | Ga0207426_10024692 | 223 |
| 880 | 3300025303 | Ga0209051_1000127 | Ga0209051_10001274 | 223 |
| 881 | 3300025303 | Ga0209051_1000918 | Ga0209051_100091820 | 223 |
| 882 | 3300025304 | Ga0209257_1009728 | Ga0209257_10097286 | 223 |
| 883 | 3300025304 | Ga0209257_1010230 | Ga0209257_10102302 | 223 |
| 884 | 3300025913 | Ga0207695_10000024 | Ga0207695_10000024339 | 223 |
| 885 | 3300025914 | Ga0207671_10000986 | Ga0207671_100009868 | 223 |
| 886 | 3300025981 | Ga0207640_10068650 | Ga0207640_100686501 | 223 |
| 887 | 3300025986 | Ga0207658_10996918 | Ga0207658_109969181 | 223 |
| 888 | 3300026067 | Ga0207678_10228681 | Ga0207678_102286812 | 223 |
| 889 | 3300026078 | Ga0207702_10052450 | Ga0207702_100524502 | 223 |
| 890 | 3300026142 | Ga0207698_10014957 | Ga0207698_100149576 | 223 |
| 891 | 3300027111 | Ga0209281_1000164 | Ga0209281_100016485 | 223 |
| 892 | 3300027111 | Ga0209281_1000377 | Ga0209281_100037737 | 223 |
| 893 | 3300027312 | Ga0209371_1014508 | Ga0209371_10145082 | 223 |
| 894 | 3300027666 | Ga0209282_1000007 | Ga0209282_100000771 | 223 |
| 895 | 3300028379 | Ga0268266_10390124 | Ga0268266_103901242 | 223 |
| 896 | 3300028380 | Ga0268265_10302973 | Ga0268265_103029733 | 223 |
| 897 | 3300030500 | Ga0268256_1015067 | Ga0268256_10150672 | 223 |
| 898 | 3300031235 | Ga0265330_10011955 | Ga0265330_100119555 | 223 |
| 899 | 3300031241 | Ga0265325_10031233 | Ga0265325_100312333 | 223 |
| 900 | 3300031247 | Ga0265340_10015433 | Ga0265340_100154332 | 223 |
| 901 | 3300031249 | Ga0265339_10027818 | Ga0265339_100278184 | 223 |
| 902 | 3300031456 | Ga0307513_10268414 | Ga0307513_102684142 | 223 |
| 903 | 3300031548 | Ga0307408_100174691 | Ga0307408_1001746912 | 223 |
| 904 | 3300031595 | Ga0265313_10041199 | Ga0265313_100411992 | 223 |
| 905 | 3300031595 | Ga0265313_10225566 | Ga0265313_102255661 | 223 |
| 906 | 3300031691 | Ga0316579_10111102 | Ga0316579_101111021 | 223 |
| 907 | 3300031712 | Ga0265342_10038038 | Ga0265342_100380384 | 223 |
| 908 | 3300031731 | Ga0307405_10008210 | Ga0307405_100082104 | 223 |
| 909 | 3300031911 | Ga0307412_10000890 | Ga0307412_1000089023 | 223 |
| 910 | 3300031911 | Ga0307412_10406726 | Ga0307412_104067262 | 223 |
| 911 | 3300031967 | Ga0315914_1000006 | Ga0315914_1000006171 | 223 |
| 912 | 3300032133 | Ga0316583_10040575 | Ga0316583_100405752 | 223 |
| 913 | 3300033430 | Ga0315913_1000002 | Ga0315913_100000271 | 223 |
| 914 | 3300033464 | Ga0315915_1000001 | Ga0315915_1000001415 | 223 |
| 915 | 3300036647 | Ga0316582_0160070 | Ga0316582_0160070_478_1149 | 223 |
| 916 | 3300039062 | Ga0400483_016484 | Ga0400483_016484_5234_5905 | 223 |
| 917 | 3300039062 | Ga0400483_289717 | Ga0400483_289717_5440_6111 | 223 |
| 918 | 3300041413 | Ga0439465_0015180 | Ga0439465_0015180_1407_2078 | 223 |
| 919 | 3300041491 | Ga0451833_1133924 | Ga0451833_1133924_248_919 | 223 |
| 920 | 3300041494 | Ga0451837_1280992 | Ga0451837_1280992_781_1452 | 223 |
| 921 | 3300041497 | Ga0451840_02168 | Ga0451840_02168_492_1163 | 223 |
| 922 | 3300041501 | Ga0451845_0021827 | Ga0451845_0021827_125_796 | 223 |
| 923 | 3300041506 | Ga0451850_35509 | Ga0451850_35509_529_1200 | 223 |
| 924 | 3300041507 | Ga0451851_0808634 | Ga0451851_0808634_520_1191 | 223 |
| 925 | 3300041512 | Ga0451853_3113601 | Ga0451853_3113601_1256_1927 | 223 |
| 926 | 3300041916 | Ga0452271_33868 | Ga0452271_33868_560_1231 | 223 |
| 927 | 3300042007 | Ga0439449_0028934 | Ga0439449_0028934_1113_1784 | 223 |
| 928 | 3300042007 | Ga0439449_0083622 | Ga0439449_0083622_416_1087 | 223 |
| 929 | 3300045051 | Ga0451576_0027253 | Ga0451576_0027253_2968_3666 | 223 |
| 930 | 3300046460 | Ga0495638_0067952 | Ga0495638_0067952_770_1441 | 223 |
| 931 | 3300046492 | Ga0495585_0011394 | Ga0495585_0011394_2799_3470 | 223 |
| 932 | 3300046500 | Ga0495596_0037661 | Ga0495596_0037661_793_1464 | 223 |
| 933 | 3300046501 | Ga0495607_0108792 | Ga0495607_0108792_365_1036 | 223 |
| 934 | 3300046506 | Ga0495583_0002390 | Ga0495583_0002390_8586_9257 | 223 |
| 935 | 3300046506 | Ga0495583_0030249 | Ga0495583_0030249_1634_2305 | 223 |
| 936 | 3300046507 | Ga0495606_0094062 | Ga0495606_0094062_515_1186 | 223 |
| 937 | 3300046512 | Ga0495610_0020171 | Ga0495610_0020171_1861_2532 | 223 |
| 938 | 3300046515 | Ga0495620_0026506 | Ga0495620_0026506_1333_2004 | 223 |
| 939 | 3300046519 | Ga0495632_0001060 | Ga0495632_0001060_19461_20132 | 223 |
| 940 | 3300046522 | Ga0495643_0024185 | Ga0495643_0024185_217_888 | 223 |
| 941 | 3300046525 | Ga0495663_0071992 | Ga0495663_0071992_82_753 | 223 |
| 942 | 3300046528 | Ga0495642_0104967 | Ga0495642_0104967_187_858 | 223 |
| 943 | 3300046558 | Ga0495633_0043700 | Ga0495633_0043700_1390_2061 | 223 |
| 944 | 3300046558 | Ga0495633_0089964 | Ga0495633_0089964_284_955 | 223 |
| 945 | 3300046616 | Ga0495668_0002121 | Ga0495668_0002121_9226_9897 | 223 |
| 946 | 3300046616 | Ga0495668_0038640 | Ga0495668_0038640_1386_2057 | 223 |
| 947 | 3300046648 | Ga0495611_0036306 | Ga0495611_0036306_1424_2095 | 223 |
| 948 | 3300046660 | Ga0495625_0013176 | Ga0495625_0013176_310_981 | 223 |
| 949 | 3300046660 | Ga0495625_0032622 | Ga0495625_0032622_2226_2897 | 223 |
| 950 | 3300046660 | Ga0495625_0096310 | Ga0495625_0096310_631_1302 | 223 |
| 951 | 3300046674 | Ga0495588_0048496 | Ga0495588_0048496_792_1463 | 223 |
| 952 | 3300046691 | Ga0495670_0018044 | Ga0495670_0018044_558_1229 | 223 |
| 953 | 3300046810 | Ga0495660_0024138 | Ga0495660_0024138_1049_1720 | 223 |
| 954 | 3300047443 | Ga0495687_041977 | Ga0495687_041977_269_940 | 223 |
| 955 | 3300048905 | Ga0496102_0277264 | Ga0496102_0277264_97_768 | 223 |
| 956 | 3300048906 | Ga0496103_0021567 | Ga0496103_0021567_3106_3777 | 223 |
| 957 | 3300048919 | Ga0496116_0002518 | Ga0496116_0002518_12685_13356 | 223 |
| 958 | 3300048920 | Ga0496117_0000337 | Ga0496117_0000337_829_1500 | 223 |
| 959 | 3300048920 | Ga0496117_0294232 | Ga0496117_0294232_33_704 | 223 |
| 960 | 3300048921 | Ga0496118_0000396 | Ga0496118_0000396_51548_52219 | 223 |
| 961 | 3300048922 | Ga0496119_0061593 | Ga0496119_0061593_1344_2015 | 223 |
| 962 | 3300048924 | Ga0496121_0001010 | Ga0496121_0001010_43417_44088 | 223 |
| 963 | 3300048924 | Ga0496121_0026660 | Ga0496121_0026660_27_698 | 223 |
| 964 | 3300048924 | Ga0496121_0070712 | Ga0496121_0070712_1756_2427 | 223 |
| 965 | 3300048925 | Ga0496122_0000009 | Ga0496122_0000009_89589_90260 | 223 |
| 966 | 3300048925 | Ga0496122_0005649 | Ga0496122_0005649_12681_13352 | 223 |
| 967 | 3300048926 | Ga0496123_0000245 | Ga0496123_0000245_105280_105951 | 223 |
| 968 | 3300048926 | Ga0496123_0007453 | Ga0496123_0007453_3823_4494 | 223 |
| 969 | 3300048927 | Ga0496124_0011797 | Ga0496124_0011797_7654_8325 | 223 |
| 970 | 3300048927 | Ga0496124_0040261 | Ga0496124_0040261_1469_2140 | 223 |
| 971 | 3300048927 | Ga0496124_0055241 | Ga0496124_0055241_1717_2388 | 223 |
| 972 | 3300048927 | Ga0496124_0113923 | Ga0496124_0113923_662_1333 | 223 |
| 973 | 3300048928 | Ga0496125_0001996 | Ga0496125_0001996_23820_24491 | 223 |
| 974 | 3300048928 | Ga0496125_0007816 | Ga0496125_0007816_8605_9276 | 223 |
| 975 | 3300048929 | Ga0496126_0013802 | Ga0496126_0013802_3323_3994 | 223 |
| 976 | 3300048929 | Ga0496126_0197395 | Ga0496126_0197395_498_1169 | 223 |
| 977 | 3300049573 | Ga0501037_0471594 | Ga0501037_0471594_49_720 | 223 |
| 978 | 3300049574 | Ga0501038_0022976 | Ga0501038_0022976_3378_4049 | 223 |
| 979 | 3300049575 | Ga0501039_0224841 | Ga0501039_0224841_111_782 | 223 |
| 980 | 3300049581 | Ga0501047_0080832 | Ga0501047_0080832_2019_2690 | 223 |
| 981 | 3300049581 | Ga0501047_0146204 | Ga0501047_0146204_414_1085 | 223 |
| 982 | 3300049581 | Ga0501047_0222714 | Ga0501047_0222714_944_1615 | 223 |
| 983 | 3300049581 | Ga0501047_0400812 | Ga0501047_0400812_508_1179 | 223 |
| 984 | 3300049583 | Ga0501067_0014029 | Ga0501067_0014029_1593_2264 | 223 |
| 985 | 3300049583 | Ga0501067_0029877 | Ga0501067_0029877_845_1516 | 223 |
| 986 | 3300049583 | Ga0501067_0244660 | Ga0501067_0244660_305_976 | 223 |
| 987 | 3300049586 | Ga0501070_0221657 | Ga0501070_0221657_136_807 | 223 |
| 988 | 3300049589 | Ga0501073_0165071 | Ga0501073_0165071_405_1076 | 223 |
| 989 | 3300049589 | Ga0501073_0174266 | Ga0501073_0174266_399_1070 | 223 |
| 990 | 3300049589 | Ga0501073_0246483 | Ga0501073_0246483_64_735 | 223 |
| 991 | 3300049593 | Ga0501077_0063681 | Ga0501077_0063681_1379_2050 | 223 |
| 992 | 3300049593 | Ga0501077_0139432 | Ga0501077_0139432_600_1271 | 223 |
| 993 | 3300049741 | Ga0501079_0323647 | Ga0501079_0323647_21_692 | 223 |
| 994 | 3300049742 | Ga0501080_0131735 | Ga0501080_0131735_1630_2301 | 223 |
| 995 | 3300049742 | Ga0501080_0431164 | Ga0501080_0431164_51_722 | 223 |
| 996 | 3300049744 | Ga0501083_0006881 | Ga0501083_0006881_519_1190 | 223 |
| 997 | 3300049744 | Ga0501083_0012398 | Ga0501083_0012398_4938_5609 | 223 |
| 998 | 3300049744 | Ga0501083_0024080 | Ga0501083_0024080_509_1180 | 223 |
| 999 | 3300049823 | Ga0501044_0363319 | Ga0501044_0363319_239_910 | 223 |
| 1000 | 3300050489 | nmdc:mga03683_103920_c1 | nmdc:mga03683_103920_c1_132_803 | 223 |
| 1001 | 3300050493 | nmdc:mga0k408_63022_c1 | nmdc:mga0k408_63022_c1_284_955 | 223 |
| 1002 | 3300050494 | nmdc:mga06z11_59422_c1 | nmdc:mga06z11_59422_c1_1071_1742 | 223 |
| 1003 | 3300050516 | nmdc:mga0sz30_38904_c1 | nmdc:mga0sz30_38904_c1_501_1172 | 223 |
| 1004 | 3300053079 | Ga0500610_0066416 | Ga0500610_0066416_513_1184 | 223 |
| 1005 | 3300053105 | Ga0500557_000411 | Ga0500557_000411_3511_4182 | 223 |
| 1006 | 3300053109 | Ga0500569_023101 | Ga0500569_023101_554_1225 | 223 |
| 1007 | 3300053122 | Ga0500608_061413 | Ga0500608_061413_223_894 | 223 |
| 1008 | 3300053125 | Ga0500618_021027 | Ga0500618_021027_611_1282 | 223 |
| 1009 | 3300053139 | Ga0500568_0001385 | Ga0500568_0001385_4503_5174 | 223 |
| 1010 | 3300053153 | Ga0500616_0000328 | Ga0500616_0000328_34764_35435 | 223 |
| 1011 | 3300053153 | Ga0500616_0062840 | Ga0500616_0062840_833_1504 | 223 |
| 1012 | 3300053158 | Ga0500627_0045604 | Ga0500627_0045604_756_1427 | 223 |
| 1013 | 3300054114 | Ga0501084_0187301 | Ga0501084_0187301_908_1579 | 223 |
| 1014 | 3300054114 | Ga0501084_0431811 | Ga0501084_0431811_193_864 | 223 |
| 1015 | 3300054114 | Ga0501084_0495700 | Ga0501084_0495700_23_694 | 223 |
| 1016 | 3300059508 | Ga0587088_021284 | Ga0587088_021284_179_850 | 223 |
| 1017 | 3300060353 | Ga0501082_0037576 | Ga0501082_0037576_223_894 | 223 |
| 1018 | 3300060353 | Ga0501082_0090410 | Ga0501082_0090410_198_869 | 223 |
| 1019 | 3300060353 | Ga0501082_0185409 | Ga0501082_0185409_656_1327 | 223 |
| 1020 | 3300060353 | Ga0501082_0249184 | Ga0501082_0249184_110_781 | 223 |
| 1021 | 3300060353 | Ga0501082_0521709 | Ga0501082_0521709_315_986 | 223 |
| 1022 | 3300005341 | Ga0070691_10281054 | Ga0070691_102810541 | 224 |
| 1023 | 3300005366 | Ga0070659_100095870 | Ga0070659_1000958704 | 224 |
| 1024 | 3300005439 | Ga0070711_100902852 | Ga0070711_1009028521 | 224 |
| 1025 | 3300005458 | Ga0070681_10075303 | Ga0070681_100753032 | 224 |
| 1026 | 3300005466 | Ga0070685_10338153 | Ga0070685_103381532 | 224 |
| 1027 | 3300005563 | Ga0068855_100031230 | Ga0068855_1000312307 | 224 |
| 1028 | 3300013104 | Ga0157370_10035120 | Ga0157370_100351206 | 224 |
| 1029 | 3300014325 | Ga0163163_10315573 | Ga0163163_103155732 | 224 |
| 1030 | 3300025912 | Ga0207707_10091118 | Ga0207707_100911182 | 224 |
| 1031 | 3300025915 | Ga0207693_10179371 | Ga0207693_101793712 | 224 |
| 1032 | 3300025916 | Ga0207663_10134602 | Ga0207663_101346022 | 224 |
| 1033 | 3300025916 | Ga0207663_10187840 | Ga0207663_101878402 | 224 |
| 1034 | 3300025932 | Ga0207690_10019088 | Ga0207690_100190883 | 224 |
| 1035 | 3300025944 | Ga0207661_10767387 | Ga0207661_107673871 | 224 |
| 1036 | 3300025949 | Ga0207667_10370050 | Ga0207667_103700502 | 224 |
| 1037 | 3300028556 | Ga0265337_1001060 | Ga0265337_100106013 | 224 |
| 1038 | 3300028573 | Ga0265334_10014042 | Ga0265334_100140423 | 224 |
| 1039 | 3300028800 | Ga0265338_10024220 | Ga0265338_1002422012 | 224 |
| 1040 | 3300031595 | Ga0265313_10020505 | Ga0265313_100205053 | 224 |
| 1041 | 3300031712 | Ga0265342_10054586 | Ga0265342_100545862 | 224 |
| 1042 | 3300035112 | Ga0373932_0080639 | Ga0373932_0080639_234_914 | 224 |
| 1043 | 3300035118 | Ga0373954_0223526 | Ga0373954_0223526_28_708 | 224 |
| 1044 | 3300035120 | Ga0373957_0127707 | Ga0373957_0127707_207_887 | 224 |
| 1045 | 3300035410 | Ga0373924_0028183 | Ga0373924_0028183_599_1279 | 224 |
| 1046 | 3300036401 | Ga0373937_0006384 | Ga0373937_0006384_2216_2896 | 224 |
| 1047 | 3300036401 | Ga0373937_0096417 | Ga0373937_0096417_203_883 | 224 |
| 1048 | 3300037068 | Ga0373925_0262366 | Ga0373925_0262366_556_1236 | 224 |
| 1049 | 3300038443 | Ga0395901_0244720 | Ga0395901_0244720_1066_1743 | 224 |
| 1050 | 3300046459 | Ga0495629_0330228 | Ga0495629_0330228_84_764 | 224 |
| 1051 | 3300046472 | Ga0495580_0050627 | Ga0495580_0050627_2035_2715 | 224 |
| 1052 | 3300046473 | Ga0495582_0061724 | Ga0495582_0061724_639_1319 | 224 |
| 1053 | 3300046477 | Ga0495664_0242269 | Ga0495664_0242269_337_1017 | 224 |
| 1054 | 3300049568 | Ga0501031_0001004 | Ga0501031_0001004_8702_9379 | 224 |
| 1055 | 3300049569 | Ga0501032_0006719 | Ga0501032_0006719_1525_2202 | 224 |
| 1056 | 3300049571 | Ga0501034_0025228 | Ga0501034_0025228_321_998 | 224 |
| 1057 | 3300049571 | Ga0501034_0432178 | Ga0501034_0432178_189_866 | 224 |
| 1058 | 3300049572 | Ga0501036_0021174 | Ga0501036_0021174_1703_2380 | 224 |
| 1059 | 3300049573 | Ga0501037_0012313 | Ga0501037_0012313_226_903 | 224 |
| 1060 | 3300049574 | Ga0501038_0011034 | Ga0501038_0011034_321_998 | 224 |
| 1061 | 3300049575 | Ga0501039_0001645 | Ga0501039_0001645_1873_2550 | 224 |
| 1062 | 3300049579 | Ga0501043_0038989 | Ga0501043_0038989_291_968 | 224 |
| 1063 | 3300049580 | Ga0501046_0074500 | Ga0501046_0074500_321_998 | 224 |
| 1064 | 3300049581 | Ga0501047_0040985 | Ga0501047_0040985_2800_3477 | 224 |
| 1065 | 3300049581 | Ga0501047_0070746 | Ga0501047_0070746_981_1658 | 224 |
| 1066 | 3300049581 | Ga0501047_0243564 | Ga0501047_0243564_320_1000 | 224 |
| 1067 | 3300049582 | Ga0501048_0000472 | Ga0501048_0000472_10034_10711 | 224 |
| 1068 | 3300049583 | Ga0501067_0000670 | Ga0501067_0000670_15337_16014 | 224 |
| 1069 | 3300049584 | Ga0501068_0005529 | Ga0501068_0005529_3848_4525 | 224 |
| 1070 | 3300049585 | Ga0501069_0009734 | Ga0501069_0009734_2792_3469 | 224 |
| 1071 | 3300049586 | Ga0501070_0031086 | Ga0501070_0031086_1298_1975 | 224 |
| 1072 | 3300049588 | Ga0501072_0037555 | Ga0501072_0037555_2073_2750 | 224 |
| 1073 | 3300049589 | Ga0501073_0035965 | Ga0501073_0035965_163_840 | 224 |
| 1074 | 3300049590 | Ga0501074_0011675 | Ga0501074_0011675_2234_2911 | 224 |
| 1075 | 3300049741 | Ga0501079_0002380 | Ga0501079_0002380_5264_5941 | 224 |
| 1076 | 3300049742 | Ga0501080_0063381 | Ga0501080_0063381_1764_2441 | 224 |
| 1077 | 3300049742 | Ga0501080_0230141 | Ga0501080_0230141_939_1616 | 224 |
| 1078 | 3300049744 | Ga0501083_0014089 | Ga0501083_0014089_1872_2549 | 224 |
| 1079 | 3300049822 | Ga0501035_0042979 | Ga0501035_0042979_604_1281 | 224 |
| 1080 | 3300049822 | Ga0501035_0057766 | Ga0501035_0057766_1459_2136 | 224 |
| 1081 | 3300049823 | Ga0501044_0098850 | Ga0501044_0098850_1764_2441 | 224 |
| 1082 | 3300049823 | Ga0501044_0165279 | Ga0501044_0165279_68_745 | 224 |
| 1083 | 3300049823 | Ga0501044_0453188 | Ga0501044_0453188_82_759 | 224 |
| 1084 | 3300049824 | Ga0501045_0022366 | Ga0501045_0022366_891_1568 | 224 |
| 1085 | 3300054114 | Ga0501084_0002711 | Ga0501084_0002711_10966_11643 | 224 |
| 1086 | 3300060353 | Ga0501082_0004451 | Ga0501082_0004451_5281_5958 | 224 |
| 1087 | 3300005327 | Ga0070658_10075769 | Ga0070658_100757693 | 225 |
| 1088 | 3300009177 | Ga0105248_10000001 | Ga0105248_10000001983 | 225 |
| 1089 | 3300025284 | Ga0209130_1006639 | Ga0209130_10066394 | 225 |
| 1090 | 3300025294 | Ga0209025_1027419 | Ga0209025_10274194 | 225 |
| 1091 | 3300025297 | Ga0209758_1050100 | Ga0209758_10501002 | 225 |
| 1092 | 3300025909 | Ga0207705_10456138 | Ga0207705_104561382 | 225 |
| 1093 | 3300025941 | Ga0207711_10000001 | Ga0207711_10000001888 | 225 |
| 1094 | 3300028577 | Ga0265318_10000017 | Ga0265318_1000001768 | 225 |
| 1095 | 3300028794 | Ga0307515_10002710 | Ga0307515_1000271030 | 225 |
| 1096 | 3300028794 | Ga0307515_10004674 | Ga0307515_1000467417 | 225 |
| 1097 | 3300031235 | Ga0265330_10050437 | Ga0265330_100504372 | 225 |
| 1098 | 3300031247 | Ga0265340_10000034 | Ga0265340_1000003422 | 225 |
| 1099 | 3300031247 | Ga0265340_10005311 | Ga0265340_100053113 | 225 |
| 1100 | 3300031247 | Ga0265340_10021397 | Ga0265340_100213975 | 225 |
| 1101 | 3300031250 | Ga0265331_10046236 | Ga0265331_100462362 | 225 |
| 1102 | 3300031344 | Ga0265316_10003849 | Ga0265316_1000384911 | 225 |
| 1103 | 3300031344 | Ga0265316_10004511 | Ga0265316_100045118 | 225 |
| 1104 | 3300031456 | Ga0307513_10333325 | Ga0307513_103333252 | 225 |
| 1105 | 3300031548 | Ga0307408_100082301 | Ga0307408_1000823012 | 225 |
| 1106 | 3300031595 | Ga0265313_10021178 | Ga0265313_100211784 | 225 |
| 1107 | 3300031711 | Ga0265314_10026379 | Ga0265314_100263797 | 225 |
| 1108 | 3300031712 | Ga0265342_10008913 | Ga0265342_100089132 | 225 |
| 1109 | 3300031911 | Ga0307412_10190210 | Ga0307412_101902102 | 225 |
| 1110 | 3300042015 | Ga0439462_0030871 | Ga0439462_0030871_505_1191 | 225 |
| 1111 | 3300042145 | Ga0450906_003427 | Ga0450906_003427_1445_2131 | 225 |
| 1112 | 3300042531 | Ga0450918_010433 | Ga0450918_010433_612_1298 | 225 |
| 1113 | 3300049570 | Ga0501033_0078329 | Ga0501033_0078329_561_1238 | 225 |
| 1114 | 3300049580 | Ga0501046_0196199 | Ga0501046_0196199_91_768 | 225 |
| 1115 | 3300049581 | Ga0501047_0038567 | Ga0501047_0038567_1003_1680 | 225 |
| 1116 | 3300049581 | Ga0501047_0348346 | Ga0501047_0348346_413_1138 | 225 |
| 1117 | 3300049586 | Ga0501070_0026046 | Ga0501070_0026046_1591_2274 | 225 |
| 1118 | 3300049588 | Ga0501072_0064402 | Ga0501072_0064402_2064_2744 | 225 |
| 1119 | 3300049822 | Ga0501035_0039706 | Ga0501035_0039706_1286_1963 | 225 |
| 1120 | 3300049822 | Ga0501035_0154005 | Ga0501035_0154005_1125_1802 | 225 |
| 1121 | 3300049823 | Ga0501044_0003131 | Ga0501044_0003131_12506_13183 | 225 |
| 1122 | 3300049823 | Ga0501044_0013067 | Ga0501044_0013067_4570_5256 | 225 |
| 1123 | 3300049823 | Ga0501044_0020172 | Ga0501044_0020172_701_1378 | 225 |
| 1124 | 3300001915 | JGI24741J21665_1001068 | JGI24741J21665_10010683 | 226 |
| 1125 | 3300001979 | JGI24740J21852_10011169 | JGI24740J21852_100111692 | 226 |
| 1126 | 3300001989 | JGI24739J22299_10014633 | JGI24739J22299_100146334 | 226 |
| 1127 | 3300001990 | JGI24737J22298_10010599 | JGI24737J22298_100105992 | 226 |
| 1128 | 3300001990 | JGI24737J22298_10018602 | JGI24737J22298_100186024 | 226 |
| 1129 | 3300003214 | JGI25165J46597_1000017 | JGI25165J46597_100001775 | 226 |
| 1130 | 3300003215 | JGI25153J46596_10000021 | JGI25153J46596_10000021103 | 226 |
| 1131 | 3300003215 | JGI25153J46596_10000755 | JGI25153J46596_100007558 | 226 |
| 1132 | 3300003759 | Ga0055525_1000070 | Ga0055525_100007040 | 226 |
| 1133 | 3300003762 | Ga0055542_1000102 | Ga0055542_100010214 | 226 |
| 1134 | 3300003763 | Ga0055529_1000136 | Ga0055529_10001362 | 226 |
| 1135 | 3300005262 | Ga0065165_1045465 | Ga0065165_10454652 | 226 |
| 1136 | 3300005327 | Ga0070658_10010959 | Ga0070658_100109592 | 226 |
| 1137 | 3300005327 | Ga0070658_10053726 | Ga0070658_100537263 | 226 |
| 1138 | 3300005328 | Ga0070676_10005044 | Ga0070676_100050443 | 226 |
| 1139 | 3300005330 | Ga0070690_100400562 | Ga0070690_1004005622 | 226 |
| 1140 | 3300005331 | Ga0070670_100091084 | Ga0070670_1000910843 | 226 |
| 1141 | 3300005331 | Ga0070670_100098407 | Ga0070670_1000984074 | 226 |
| 1142 | 3300005334 | Ga0068869_100003248 | Ga0068869_1000032485 | 226 |
| 1143 | 3300005335 | Ga0070666_10005936 | Ga0070666_100059363 | 226 |
| 1144 | 3300005336 | Ga0070680_100000100 | Ga0070680_10000010065 | 226 |
| 1145 | 3300005336 | Ga0070680_100096703 | Ga0070680_1000967032 | 226 |
| 1146 | 3300005338 | Ga0068868_100156958 | Ga0068868_1001569581 | 226 |
| 1147 | 3300005338 | Ga0068868_100468459 | Ga0068868_1004684591 | 226 |
| 1148 | 3300005339 | Ga0070660_100004214 | Ga0070660_1000042147 | 226 |
| 1149 | 3300005339 | Ga0070660_100017038 | Ga0070660_1000170384 | 226 |
| 1150 | 3300005339 | Ga0070660_100058836 | Ga0070660_1000588362 | 226 |
| 1151 | 3300005339 | Ga0070660_100579161 | Ga0070660_1005791612 | 226 |
| 1152 | 3300005340 | Ga0070689_100219546 | Ga0070689_1002195462 | 226 |
| 1153 | 3300005341 | Ga0070691_10001507 | Ga0070691_100015075 | 226 |
| 1154 | 3300005344 | Ga0070661_100000160 | Ga0070661_10000016015 | 226 |
| 1155 | 3300005344 | Ga0070661_100010954 | Ga0070661_1000109542 | 226 |
| 1156 | 3300005344 | Ga0070661_100034466 | Ga0070661_1000344662 | 226 |
| 1157 | 3300005344 | Ga0070661_100302359 | Ga0070661_1003023592 | 226 |
| 1158 | 3300005347 | Ga0070668_100146586 | Ga0070668_1001465862 | 226 |
| 1159 | 3300005354 | Ga0070675_100274295 | Ga0070675_1002742952 | 226 |
| 1160 | 3300005356 | Ga0070674_100101869 | Ga0070674_1001018692 | 226 |
| 1161 | 3300005364 | Ga0070673_100031659 | Ga0070673_1000316592 | 226 |
| 1162 | 3300005365 | Ga0070688_100203110 | Ga0070688_1002031102 | 226 |
| 1163 | 3300005366 | Ga0070659_100028368 | Ga0070659_1000283682 | 226 |
| 1164 | 3300005367 | Ga0070667_100122040 | Ga0070667_1001220402 | 226 |
| 1165 | 3300005435 | Ga0070714_100022269 | Ga0070714_1000222694 | 226 |
| 1166 | 3300005436 | Ga0070713_100061009 | Ga0070713_1000610092 | 226 |
| 1167 | 3300005437 | Ga0070710_10334401 | Ga0070710_103344012 | 226 |
| 1168 | 3300005439 | Ga0070711_100635050 | Ga0070711_1006350502 | 226 |
| 1169 | 3300005456 | Ga0070678_100000139 | Ga0070678_10000013916 | 226 |
| 1170 | 3300005456 | Ga0070678_100262262 | Ga0070678_1002622622 | 226 |
| 1171 | 3300005456 | Ga0070678_100837028 | Ga0070678_1008370281 | 226 |
| 1172 | 3300005458 | Ga0070681_10000003 | Ga0070681_10000003112 | 226 |
| 1173 | 3300005458 | Ga0070681_10040066 | Ga0070681_100400662 | 226 |
| 1174 | 3300005459 | Ga0068867_100018286 | Ga0068867_1000182864 | 226 |
| 1175 | 3300005459 | Ga0068867_100100775 | Ga0068867_1001007752 | 226 |
| 1176 | 3300005459 | Ga0068867_100412646 | Ga0068867_1004126461 | 226 |
| 1177 | 3300005530 | Ga0070679_100001255 | Ga0070679_1000012558 | 226 |
| 1178 | 3300005530 | Ga0070679_100015724 | Ga0070679_1000157247 | 226 |
| 1179 | 3300005530 | Ga0070679_100353154 | Ga0070679_1003531542 | 226 |
| 1180 | 3300005535 | Ga0070684_100245317 | Ga0070684_1002453172 | 226 |
| 1181 | 3300005539 | Ga0068853_100029148 | Ga0068853_1000291482 | 226 |
| 1182 | 3300005539 | Ga0068853_100063732 | Ga0068853_1000637324 | 226 |
| 1183 | 3300005539 | Ga0068853_100147644 | Ga0068853_1001476441 | 226 |
| 1184 | 3300005539 | Ga0068853_100203524 | Ga0068853_1002035242 | 226 |
| 1185 | 3300005543 | Ga0070672_100054920 | Ga0070672_1000549203 | 226 |
| 1186 | 3300005544 | Ga0070686_100642102 | Ga0070686_1006421021 | 226 |
| 1187 | 3300005547 | Ga0070693_100187440 | Ga0070693_1001874402 | 226 |
| 1188 | 3300005548 | Ga0070665_100001553 | Ga0070665_10000155326 | 226 |
| 1189 | 3300005548 | Ga0070665_100316226 | Ga0070665_1003162262 | 226 |
| 1190 | 3300005563 | Ga0068855_100000374 | Ga0068855_10000037455 | 226 |
| 1191 | 3300005563 | Ga0068855_100025478 | Ga0068855_1000254784 | 226 |
| 1192 | 3300005563 | Ga0068855_100716604 | Ga0068855_1007166041 | 226 |
| 1193 | 3300005564 | Ga0070664_100248465 | Ga0070664_1002484651 | 226 |
| 1194 | 3300005577 | Ga0068857_100066779 | Ga0068857_1000667795 | 226 |
| 1195 | 3300005719 | Ga0068861_100038208 | Ga0068861_1000382083 | 226 |
| 1196 | 3300005719 | Ga0068861_100078905 | Ga0068861_1000789052 | 226 |
| 1197 | 3300005841 | Ga0068863_100171572 | Ga0068863_1001715722 | 226 |
| 1198 | 3300005842 | Ga0068858_100122719 | Ga0068858_1001227193 | 226 |
| 1199 | 3300005842 | Ga0068858_100404699 | Ga0068858_1004046992 | 226 |
| 1200 | 3300005843 | Ga0068860_100152944 | Ga0068860_1001529442 | 226 |
| 1201 | 3300005844 | Ga0068862_100046983 | Ga0068862_1000469833 | 226 |
| 1202 | 3300006195 | Ga0075366_10012273 | Ga0075366_100122735 | 226 |
| 1203 | 3300006237 | Ga0097621_100073785 | Ga0097621_1000737853 | 226 |
| 1204 | 3300006358 | Ga0068871_100026285 | Ga0068871_1000262855 | 226 |
| 1205 | 3300006358 | Ga0068871_100165022 | Ga0068871_1001650221 | 226 |
| 1206 | 3300009093 | Ga0105240_10002036 | Ga0105240_1000203627 | 226 |
| 1207 | 3300009093 | Ga0105240_10410921 | Ga0105240_104109212 | 226 |
| 1208 | 3300009093 | Ga0105240_10434757 | Ga0105240_104347573 | 226 |
| 1209 | 3300009093 | Ga0105240_10488377 | Ga0105240_104883772 | 226 |
| 1210 | 3300009098 | Ga0105245_10072143 | Ga0105245_100721432 | 226 |
| 1211 | 3300009098 | Ga0105245_10952398 | Ga0105245_109523981 | 226 |
| 1212 | 3300009101 | Ga0105247_10080264 | Ga0105247_100802643 | 226 |
| 1213 | 3300009101 | Ga0105247_10102920 | Ga0105247_101029202 | 226 |
| 1214 | 3300009101 | Ga0105247_10417463 | Ga0105247_104174632 | 226 |
| 1215 | 3300009148 | Ga0105243_10000367 | Ga0105243_1000036721 | 226 |
| 1216 | 3300009148 | Ga0105243_10007689 | Ga0105243_100076894 | 226 |
| 1217 | 3300009174 | Ga0105241_10044755 | Ga0105241_100447553 | 226 |
| 1218 | 3300009174 | Ga0105241_10051327 | Ga0105241_100513273 | 226 |
| 1219 | 3300009174 | Ga0105241_10077387 | Ga0105241_100773873 | 226 |
| 1220 | 3300009174 | Ga0105241_10078979 | Ga0105241_100789792 | 226 |
| 1221 | 3300009176 | Ga0105242_10012664 | Ga0105242_100126643 | 226 |
| 1222 | 3300009176 | Ga0105242_10043250 | Ga0105242_100432503 | 226 |
| 1223 | 3300009176 | Ga0105242_10048929 | Ga0105242_100489293 | 226 |
| 1224 | 3300009177 | Ga0105248_10091837 | Ga0105248_100918373 | 226 |
| 1225 | 3300009545 | Ga0105237_10139538 | Ga0105237_101395382 | 226 |
| 1226 | 3300009545 | Ga0105237_10162691 | Ga0105237_101626912 | 226 |
| 1227 | 3300009545 | Ga0105237_10175205 | Ga0105237_101752052 | 226 |
| 1228 | 3300009545 | Ga0105237_10315632 | Ga0105237_103156322 | 226 |
| 1229 | 3300009545 | Ga0105237_10320520 | Ga0105237_103205201 | 226 |
| 1230 | 3300009551 | Ga0105238_10007661 | Ga0105238_100076616 | 226 |
| 1231 | 3300009551 | Ga0105238_10009150 | Ga0105238_100091505 | 226 |
| 1232 | 3300009551 | Ga0105238_10019021 | Ga0105238_100190213 | 226 |
| 1233 | 3300009551 | Ga0105238_10051343 | Ga0105238_100513434 | 226 |
| 1234 | 3300009553 | Ga0105249_10219821 | Ga0105249_102198212 | 226 |
| 1235 | 3300010375 | Ga0105239_10047501 | Ga0105239_100475013 | 226 |
| 1236 | 3300011119 | Ga0105246_10089264 | Ga0105246_100892642 | 226 |
| 1237 | 3300011119 | Ga0105246_10186534 | Ga0105246_101865342 | 226 |
| 1238 | 3300013100 | Ga0157373_10037466 | Ga0157373_100374665 | 226 |
| 1239 | 3300013100 | Ga0157373_10071232 | Ga0157373_100712322 | 226 |
| 1240 | 3300013102 | Ga0157371_10000066 | Ga0157371_100000665 | 226 |
| 1241 | 3300013104 | Ga0157370_10001228 | Ga0157370_100012287 | 226 |
| 1242 | 3300013104 | Ga0157370_10061333 | Ga0157370_100613333 | 226 |
| 1243 | 3300013105 | Ga0157369_10237916 | Ga0157369_102379162 | 226 |
| 1244 | 3300013105 | Ga0157369_10495606 | Ga0157369_104956062 | 226 |
| 1245 | 3300013296 | Ga0157374_10097921 | Ga0157374_100979212 | 226 |
| 1246 | 3300013297 | Ga0157378_10013145 | Ga0157378_100131453 | 226 |
| 1247 | 3300013297 | Ga0157378_10327659 | Ga0157378_103276592 | 226 |
| 1248 | 3300013307 | Ga0157372_10004646 | Ga0157372_1000464610 | 226 |
| 1249 | 3300013307 | Ga0157372_10011401 | Ga0157372_100114018 | 226 |
| 1250 | 3300013307 | Ga0157372_10049388 | Ga0157372_100493883 | 226 |
| 1251 | 3300013307 | Ga0157372_10116365 | Ga0157372_101163653 | 226 |
| 1252 | 3300013308 | Ga0157375_10034969 | Ga0157375_100349692 | 226 |
| 1253 | 3300013308 | Ga0157375_10367931 | Ga0157375_103679312 | 226 |
| 1254 | 3300014325 | Ga0163163_10000004 | Ga0163163_10000004308 | 226 |
| 1255 | 3300014968 | Ga0157379_10299080 | Ga0157379_102990802 | 226 |
| 1256 | 3300014969 | Ga0157376_10009191 | Ga0157376_100091915 | 226 |
| 1257 | 3300014969 | Ga0157376_10194471 | Ga0157376_101944712 | 226 |
| 1258 | 3300017792 | Ga0163161_10040297 | Ga0163161_100402971 | 226 |
| 1259 | 3300017792 | Ga0163161_10059986 | Ga0163161_100599862 | 226 |
| 1260 | 3300021377 | Ga0213874_10025338 | Ga0213874_100253382 | 226 |
| 1261 | 3300021384 | Ga0213876_10000498 | Ga0213876_1000049835 | 226 |
| 1262 | 3300025226 | Ga0209674_108574 | Ga0209674_1085742 | 226 |
| 1263 | 3300025230 | Ga0209563_100053 | Ga0209563_100053157 | 226 |
| 1264 | 3300025231 | Ga0207427_107239 | Ga0207427_1072392 | 226 |
| 1265 | 3300025253 | Ga0209677_107461 | Ga0209677_1074612 | 226 |
| 1266 | 3300025254 | Ga0209148_1000159 | Ga0209148_100015934 | 226 |
| 1267 | 3300025261 | Ga0209233_1000006 | Ga0209233_1000006265 | 226 |
| 1268 | 3300025261 | Ga0209233_1015113 | Ga0209233_10151132 | 226 |
| 1269 | 3300025272 | Ga0209455_1000045 | Ga0209455_1000045109 | 226 |
| 1270 | 3300025272 | Ga0209455_1005227 | Ga0209455_10052277 | 226 |
| 1271 | 3300025297 | Ga0209758_1000008 | Ga0209758_1000008754 | 226 |
| 1272 | 3300025297 | Ga0209758_1000023 | Ga0209758_1000023180 | 226 |
| 1273 | 3300025315 | Ga0207697_10170076 | Ga0207697_101700762 | 226 |
| 1274 | 3300025893 | Ga0207682_10089646 | Ga0207682_100896462 | 226 |
| 1275 | 3300025900 | Ga0207710_10073682 | Ga0207710_100736822 | 226 |
| 1276 | 3300025901 | Ga0207688_10008993 | Ga0207688_100089932 | 226 |
| 1277 | 3300025901 | Ga0207688_10106656 | Ga0207688_101066563 | 226 |
| 1278 | 3300025903 | Ga0207680_10012613 | Ga0207680_100126134 | 226 |
| 1279 | 3300025903 | Ga0207680_10106423 | Ga0207680_101064232 | 226 |
| 1280 | 3300025904 | Ga0207647_10042328 | Ga0207647_100423283 | 226 |
| 1281 | 3300025907 | Ga0207645_10025706 | Ga0207645_100257065 | 226 |
| 1282 | 3300025907 | Ga0207645_10025773 | Ga0207645_100257733 | 226 |
| 1283 | 3300025907 | Ga0207645_10122587 | Ga0207645_101225872 | 226 |
| 1284 | 3300025908 | Ga0207643_10076875 | Ga0207643_100768752 | 226 |
| 1285 | 3300025909 | Ga0207705_10001090 | Ga0207705_1000109016 | 226 |
| 1286 | 3300025909 | Ga0207705_10002561 | Ga0207705_1000256113 | 226 |
| 1287 | 3300025909 | Ga0207705_10030747 | Ga0207705_100307472 | 226 |
| 1288 | 3300025909 | Ga0207705_10187404 | Ga0207705_101874042 | 226 |
| 1289 | 3300025911 | Ga0207654_10000436 | Ga0207654_1000043620 | 226 |
| 1290 | 3300025911 | Ga0207654_10023858 | Ga0207654_100238581 | 226 |
| 1291 | 3300025911 | Ga0207654_10158876 | Ga0207654_101588762 | 226 |
| 1292 | 3300025911 | Ga0207654_10325064 | Ga0207654_103250642 | 226 |
| 1293 | 3300025912 | Ga0207707_10000001 | Ga0207707_10000001939 | 226 |
| 1294 | 3300025912 | Ga0207707_10000849 | Ga0207707_100008496 | 226 |
| 1295 | 3300025913 | Ga0207695_10000004 | Ga0207695_10000004497 | 226 |
| 1296 | 3300025913 | Ga0207695_10134158 | Ga0207695_101341582 | 226 |
| 1297 | 3300025913 | Ga0207695_10323551 | Ga0207695_103235512 | 226 |
| 1298 | 3300025914 | Ga0207671_10165169 | Ga0207671_101651692 | 226 |
| 1299 | 3300025915 | Ga0207693_10479473 | Ga0207693_104794732 | 226 |
| 1300 | 3300025916 | Ga0207663_10487650 | Ga0207663_104876502 | 226 |
| 1301 | 3300025917 | Ga0207660_10000081 | Ga0207660_1000008130 | 226 |
| 1302 | 3300025917 | Ga0207660_10000597 | Ga0207660_100005976 | 226 |
| 1303 | 3300025919 | Ga0207657_10000129 | Ga0207657_1000012970 | 226 |
| 1304 | 3300025919 | Ga0207657_10029697 | Ga0207657_100296973 | 226 |
| 1305 | 3300025919 | Ga0207657_10063239 | Ga0207657_100632393 | 226 |
| 1306 | 3300025920 | Ga0207649_10000029 | Ga0207649_1000002979 | 226 |
| 1307 | 3300025920 | Ga0207649_10002212 | Ga0207649_100022125 | 226 |
| 1308 | 3300025920 | Ga0207649_10191186 | Ga0207649_101911862 | 226 |
| 1309 | 3300025921 | Ga0207652_10000413 | Ga0207652_1000041311 | 226 |
| 1310 | 3300025921 | Ga0207652_10001120 | Ga0207652_1000112019 | 226 |
| 1311 | 3300025921 | Ga0207652_10040972 | Ga0207652_100409722 | 226 |
| 1312 | 3300025924 | Ga0207694_10000044 | Ga0207694_10000044153 | 226 |
| 1313 | 3300025924 | Ga0207694_10007860 | Ga0207694_100078603 | 226 |
| 1314 | 3300025924 | Ga0207694_10010063 | Ga0207694_100100634 | 226 |
| 1315 | 3300025924 | Ga0207694_10139800 | Ga0207694_101398002 | 226 |
| 1316 | 3300025924 | Ga0207694_10147588 | Ga0207694_101475881 | 226 |
| 1317 | 3300025924 | Ga0207694_10358826 | Ga0207694_103588262 | 226 |
| 1318 | 3300025925 | Ga0207650_10075462 | Ga0207650_100754622 | 226 |
| 1319 | 3300025926 | Ga0207659_10211292 | Ga0207659_102112922 | 226 |
| 1320 | 3300025927 | Ga0207687_10040805 | Ga0207687_100408052 | 226 |
| 1321 | 3300025927 | Ga0207687_10201009 | Ga0207687_102010092 | 226 |
| 1322 | 3300025929 | Ga0207664_10028363 | Ga0207664_100283632 | 226 |
| 1323 | 3300025933 | Ga0207706_10087732 | Ga0207706_100877323 | 226 |
| 1324 | 3300025934 | Ga0207686_10027757 | Ga0207686_100277573 | 226 |
| 1325 | 3300025934 | Ga0207686_10076356 | Ga0207686_100763562 | 226 |
| 1326 | 3300025934 | Ga0207686_10109017 | Ga0207686_101090173 | 226 |
| 1327 | 3300025934 | Ga0207686_10134106 | Ga0207686_101341062 | 226 |
| 1328 | 3300025935 | Ga0207709_10000047 | Ga0207709_1000004791 | 226 |
| 1329 | 3300025935 | Ga0207709_10006691 | Ga0207709_100066915 | 226 |
| 1330 | 3300025937 | Ga0207669_10000361 | Ga0207669_100003615 | 226 |
| 1331 | 3300025937 | Ga0207669_10002871 | Ga0207669_100028715 | 226 |
| 1332 | 3300025938 | Ga0207704_10252729 | Ga0207704_102527292 | 226 |
| 1333 | 3300025938 | Ga0207704_10602279 | Ga0207704_106022792 | 226 |
| 1334 | 3300025939 | Ga0207665_10257339 | Ga0207665_102573392 | 226 |
| 1335 | 3300025940 | Ga0207691_10089139 | Ga0207691_100891392 | 226 |
| 1336 | 3300025941 | Ga0207711_10066517 | Ga0207711_100665171 | 226 |
| 1337 | 3300025942 | Ga0207689_10002603 | Ga0207689_100026033 | 226 |
| 1338 | 3300025942 | Ga0207689_10140017 | Ga0207689_101400171 | 226 |
| 1339 | 3300025945 | Ga0207679_10519475 | Ga0207679_105194752 | 226 |
| 1340 | 3300025949 | Ga0207667_10000001 | Ga0207667_1000000140 | 226 |
| 1341 | 3300025949 | Ga0207667_10000012 | Ga0207667_10000012316 | 226 |
| 1342 | 3300025949 | Ga0207667_10062277 | Ga0207667_100622775 | 226 |
| 1343 | 3300025949 | Ga0207667_10465960 | Ga0207667_104659601 | 226 |
| 1344 | 3300025961 | Ga0207712_10020572 | Ga0207712_100205722 | 226 |
| 1345 | 3300025981 | Ga0207640_10001051 | Ga0207640_100010518 | 226 |
| 1346 | 3300025986 | Ga0207658_10015385 | Ga0207658_100153854 | 226 |
| 1347 | 3300025986 | Ga0207658_10042984 | Ga0207658_100429842 | 226 |
| 1348 | 3300026023 | Ga0207677_10057690 | Ga0207677_100576902 | 226 |
| 1349 | 3300026023 | Ga0207677_10108335 | Ga0207677_101083352 | 226 |
| 1350 | 3300026023 | Ga0207677_10582686 | Ga0207677_105826862 | 226 |
| 1351 | 3300026035 | Ga0207703_10160826 | Ga0207703_101608262 | 226 |
| 1352 | 3300026035 | Ga0207703_10729714 | Ga0207703_107297141 | 226 |
| 1353 | 3300026041 | Ga0207639_10003115 | Ga0207639_100031153 | 226 |
| 1354 | 3300026041 | Ga0207639_10020962 | Ga0207639_100209624 | 226 |
| 1355 | 3300026041 | Ga0207639_10062536 | Ga0207639_100625362 | 226 |
| 1356 | 3300026041 | Ga0207639_10255781 | Ga0207639_102557812 | 226 |
| 1357 | 3300026078 | Ga0207702_10004975 | Ga0207702_1000497511 | 226 |
| 1358 | 3300026078 | Ga0207702_10365173 | Ga0207702_103651732 | 226 |
| 1359 | 3300026088 | Ga0207641_10024349 | Ga0207641_100243493 | 226 |
| 1360 | 3300026088 | Ga0207641_10179019 | Ga0207641_101790193 | 226 |
| 1361 | 3300026089 | Ga0207648_10060368 | Ga0207648_100603684 | 226 |
| 1362 | 3300026095 | Ga0207676_10562852 | Ga0207676_105628522 | 226 |
| 1363 | 3300026116 | Ga0207674_10089492 | Ga0207674_100894921 | 226 |
| 1364 | 3300026116 | Ga0207674_10100136 | Ga0207674_101001362 | 226 |
| 1365 | 3300026116 | Ga0207674_10110585 | Ga0207674_101105853 | 226 |
| 1366 | 3300026118 | Ga0207675_100119035 | Ga0207675_1001190353 | 226 |
| 1367 | 3300026118 | Ga0207675_100181377 | Ga0207675_1001813772 | 226 |
| 1368 | 3300026121 | Ga0207683_10001314 | Ga0207683_1000131417 | 226 |
| 1369 | 3300026121 | Ga0207683_10002290 | Ga0207683_1000229011 | 226 |
| 1370 | 3300026121 | Ga0207683_10048501 | Ga0207683_100485012 | 226 |
| 1371 | 3300026121 | Ga0207683_10226751 | Ga0207683_102267512 | 226 |
| 1372 | 3300026121 | Ga0207683_11029538 | Ga0207683_110295381 | 226 |
| 1373 | 3300026142 | Ga0207698_10005731 | Ga0207698_100057314 | 226 |
| 1374 | 3300026142 | Ga0207698_10025036 | Ga0207698_100250362 | 226 |
| 1375 | 3300028379 | Ga0268266_10000930 | Ga0268266_1000093034 | 226 |
| 1376 | 3300028379 | Ga0268266_10017542 | Ga0268266_100175425 | 226 |
| 1377 | 3300028380 | Ga0268265_10338674 | Ga0268265_103386742 | 226 |
| 1378 | 3300028380 | Ga0268265_10574150 | Ga0268265_105741502 | 226 |
| 1379 | 3300028381 | Ga0268264_10155553 | Ga0268264_101555532 | 226 |
| 1380 | 3300028381 | Ga0268264_10227463 | Ga0268264_102274632 | 226 |
| 1381 | 3300028573 | Ga0265334_10022394 | Ga0265334_100223944 | 226 |
| 1382 | 3300028800 | Ga0265338_10000006 | Ga0265338_10000006589 | 226 |
| 1383 | 3300028800 | Ga0265338_10005866 | Ga0265338_1000586619 | 226 |
| 1384 | 3300028800 | Ga0265338_10030101 | Ga0265338_100301014 | 226 |
| 1385 | 3300028800 | Ga0265338_10127248 | Ga0265338_101272482 | 226 |
| 1386 | 3300031235 | Ga0265330_10009666 | Ga0265330_100096665 | 226 |
| 1387 | 3300031238 | Ga0265332_10011135 | Ga0265332_100111353 | 226 |
| 1388 | 3300031238 | Ga0265332_10027800 | Ga0265332_100278003 | 226 |
| 1389 | 3300031241 | Ga0265325_10000003 | Ga0265325_10000003233 | 226 |
| 1390 | 3300031247 | Ga0265340_10016049 | Ga0265340_100160497 | 226 |
| 1391 | 3300031247 | Ga0265340_10017168 | Ga0265340_100171683 | 226 |
| 1392 | 3300031247 | Ga0265340_10123992 | Ga0265340_101239922 | 226 |
| 1393 | 3300031249 | Ga0265339_10002825 | Ga0265339_100028252 | 226 |
| 1394 | 3300031249 | Ga0265339_10033057 | Ga0265339_100330575 | 226 |
| 1395 | 3300031250 | Ga0265331_10000006 | Ga0265331_10000006279 | 226 |
| 1396 | 3300031250 | Ga0265331_10001232 | Ga0265331_100012324 | 226 |
| 1397 | 3300031250 | Ga0265331_10002603 | Ga0265331_100026032 | 226 |
| 1398 | 3300031250 | Ga0265331_10094698 | Ga0265331_100946982 | 226 |
| 1399 | 3300031251 | Ga0265327_10000808 | Ga0265327_1000080835 | 226 |
| 1400 | 3300031456 | Ga0307513_10248145 | Ga0307513_102481452 | 226 |
| 1401 | 3300031595 | Ga0265313_10001127 | Ga0265313_1000112712 | 226 |
| 1402 | 3300031595 | Ga0265313_10006358 | Ga0265313_100063587 | 226 |
| 1403 | 3300031595 | Ga0265313_10029615 | Ga0265313_100296152 | 226 |
| 1404 | 3300031665 | Ga0316575_10121046 | Ga0316575_101210462 | 226 |
| 1405 | 3300031711 | Ga0265314_10017444 | Ga0265314_100174444 | 226 |
| 1406 | 3300031711 | Ga0265314_10018730 | Ga0265314_100187304 | 226 |
| 1407 | 3300031711 | Ga0265314_10068284 | Ga0265314_100682844 | 226 |
| 1408 | 3300031711 | Ga0265314_10076877 | Ga0265314_100768772 | 226 |
| 1409 | 3300031712 | Ga0265342_10074115 | Ga0265342_100741152 | 226 |
| 1410 | 3300031730 | Ga0307516_10010120 | Ga0307516_100101204 | 226 |
| 1411 | 3300031730 | Ga0307516_10037175 | Ga0307516_100371752 | 226 |
| 1412 | 3300031730 | Ga0307516_10260199 | Ga0307516_102601992 | 226 |
| 1413 | 3300032126 | Ga0307415_100474320 | Ga0307415_1004743202 | 226 |
| 1414 | 3300033180 | Ga0307510_10197499 | Ga0307510_101974992 | 226 |
| 1415 | 3300036401 | Ga0373937_0400258 | Ga0373937_0400258_554_1243 | 226 |
| 1416 | 3300036647 | Ga0316582_0113749 | Ga0316582_0113749_767_1450 | 226 |
| 1417 | 3300036712 | Ga0316584_0410610 | Ga0316584_0410610_24_707 | 226 |
| 1418 | 3300037312 | Ga0395899_0121668 | Ga0395899_0121668_99_785 | 226 |
| 1419 | 3300037312 | Ga0395899_0185078 | Ga0395899_0185078_352_1032 | 226 |
| 1420 | 3300037418 | Ga0395900_0006457 | Ga0395900_0006457_10699_11385 | 226 |
| 1421 | 3300037466 | Ga0395898_0050299 | Ga0395898_0050299_3189_3875 | 226 |
| 1422 | 3300038443 | Ga0395901_0085316 | Ga0395901_0085316_592_1278 | 226 |
| 1423 | 3300039437 | Ga0436365_0605749 | Ga0436365_0605749_282_968 | 226 |
| 1424 | 3300039437 | Ga0436365_0817918 | Ga0436365_0817918_4427_5116 | 226 |
| 1425 | 3300039438 | Ga0436360_0879069 | Ga0436360_0879069_1439_2203 | 226 |
| 1426 | 3300039450 | Ga0436363_1603152 | Ga0436363_1603152_860_1549 | 226 |
| 1427 | 3300041452 | Ga0451793_1440556 | Ga0451793_1440556_25_711 | 226 |
| 1428 | 3300044694 | Ga0466963_0114634 | Ga0466963_0114634_1101_1787 | 226 |
| 1429 | 3300044842 | Ga0466957_0026460 | Ga0466957_0026460_873_1559 | 226 |
| 1430 | 3300046454 | Ga0495592_0149599 | Ga0495592_0149599_523_1212 | 226 |
| 1431 | 3300046459 | Ga0495629_0048637 | Ga0495629_0048637_788_1480 | 226 |
| 1432 | 3300046471 | Ga0495650_0000644 | Ga0495650_0000644_29141_29821 | 226 |
| 1433 | 3300046472 | Ga0495580_0006620 | Ga0495580_0006620_5493_6185 | 226 |
| 1434 | 3300046473 | Ga0495582_0017413 | Ga0495582_0017413_2207_2899 | 226 |
| 1435 | 3300046491 | Ga0495584_0162093 | Ga0495584_0162093_113_793 | 226 |
| 1436 | 3300046500 | Ga0495596_0049562 | Ga0495596_0049562_358_1038 | 226 |
| 1437 | 3300046506 | Ga0495583_0008443 | Ga0495583_0008443_790_1470 | 226 |
| 1438 | 3300046506 | Ga0495583_0011239 | Ga0495583_0011239_2058_2738 | 226 |
| 1439 | 3300046507 | Ga0495606_0003115 | Ga0495606_0003115_13794_14474 | 226 |
| 1440 | 3300046513 | Ga0495616_0131817 | Ga0495616_0131817_249_935 | 226 |
| 1441 | 3300046516 | Ga0495628_0361359 | Ga0495628_0361359_178_867 | 226 |
| 1442 | 3300046518 | Ga0495631_0075521 | Ga0495631_0075521_71_751 | 226 |
| 1443 | 3300046520 | Ga0495637_0160131 | Ga0495637_0160131_83_763 | 226 |
| 1444 | 3300046522 | Ga0495643_0001349 | Ga0495643_0001349_14171_14851 | 226 |
| 1445 | 3300046522 | Ga0495643_0001424 | Ga0495643_0001424_9597_10277 | 226 |
| 1446 | 3300046522 | Ga0495643_0021448 | Ga0495643_0021448_2333_3013 | 226 |
| 1447 | 3300046524 | Ga0495648_0000122 | Ga0495648_0000122_51563_52243 | 226 |
| 1448 | 3300046525 | Ga0495663_0005658 | Ga0495663_0005658_666_1346 | 226 |
| 1449 | 3300046528 | Ga0495642_0008427 | Ga0495642_0008427_1190_1870 | 226 |
| 1450 | 3300046529 | Ga0495652_0113615 | Ga0495652_0113615_1316_2005 | 226 |
| 1451 | 3300046529 | Ga0495652_0529904 | Ga0495652_0529904_95_781 | 226 |
| 1452 | 3300046530 | Ga0495654_0190001 | Ga0495654_0190001_188_874 | 226 |
| 1453 | 3300046538 | Ga0495609_0019743 | Ga0495609_0019743_1605_2291 | 226 |
| 1454 | 3300046543 | Ga0495645_0039649 | Ga0495645_0039649_1583_2272 | 226 |
| 1455 | 3300046557 | Ga0495622_0001189 | Ga0495622_0001189_9522_10208 | 226 |
| 1456 | 3300046558 | Ga0495633_0005483 | Ga0495633_0005483_725_1405 | 226 |
| 1457 | 3300046616 | Ga0495668_0000377 | Ga0495668_0000377_31625_32305 | 226 |
| 1458 | 3300046648 | Ga0495611_0015937 | Ga0495611_0015937_985_1665 | 226 |
| 1459 | 3300046660 | Ga0495625_0001416 | Ga0495625_0001416_12078_12758 | 226 |
| 1460 | 3300046660 | Ga0495625_0008470 | Ga0495625_0008470_1797_2477 | 226 |
| 1461 | 3300046660 | Ga0495625_0040459 | Ga0495625_0040459_1973_2653 | 226 |
| 1462 | 3300046665 | Ga0495661_0078481 | Ga0495661_0078481_56_736 | 226 |
| 1463 | 3300046683 | Ga0495658_0002459 | Ga0495658_0002459_5877_6569 | 226 |
| 1464 | 3300046684 | Ga0495669_0000773 | Ga0495669_0000773_6682_7362 | 226 |
| 1465 | 3300046691 | Ga0495670_0092919 | Ga0495670_0092919_356_1042 | 226 |
| 1466 | 3300046809 | Ga0495600_0004633 | Ga0495600_0004633_1348_2028 | 226 |
| 1467 | 3300046809 | Ga0495600_0177057 | Ga0495600_0177057_203_895 | 226 |
| 1468 | 3300047315 | Ga0495581_0038894 | Ga0495581_0038894_435_1127 | 226 |
| 1469 | 3300047323 | Ga0495683_0008061 | Ga0495683_0008061_3205_3885 | 226 |
| 1470 | 3300047443 | Ga0495687_000392 | Ga0495687_000392_22736_23416 | 226 |
| 1471 | 3300047443 | Ga0495687_005666 | Ga0495687_005666_725_1405 | 226 |
| 1472 | 3300047444 | Ga0495675_0161026 | Ga0495675_0161026_326_1018 | 226 |
| 1473 | 3300047470 | Ga0495681_0133831 | Ga0495681_0133831_160_858 | 226 |
| 1474 | 3300048906 | Ga0496103_0000165 | Ga0496103_0000165_41880_42560 | 226 |
| 1475 | 3300048908 | Ga0496105_0000467 | Ga0496105_0000467_13279_13959 | 226 |
| 1476 | 3300048912 | Ga0496109_0053887 | Ga0496109_0053887_1419_2099 | 226 |
| 1477 | 3300048917 | Ga0496114_0007452 | Ga0496114_0007452_4262_4942 | 226 |
| 1478 | 3300048918 | Ga0496115_0000202 | Ga0496115_0000202_25542_26222 | 226 |
| 1479 | 3300048918 | Ga0496115_0110634 | Ga0496115_0110634_78_764 | 226 |
| 1480 | 3300048918 | Ga0496115_0285674 | Ga0496115_0285674_161_847 | 226 |
| 1481 | 3300048919 | Ga0496116_0011379 | Ga0496116_0011379_2197_2877 | 226 |
| 1482 | 3300048920 | Ga0496117_0000616 | Ga0496117_0000616_27027_27707 | 226 |
| 1483 | 3300048921 | Ga0496118_0000425 | Ga0496118_0000425_41868_42548 | 226 |
| 1484 | 3300048922 | Ga0496119_0006225 | Ga0496119_0006225_1865_2545 | 226 |
| 1485 | 3300048924 | Ga0496121_0000796 | Ga0496121_0000796_27107_27787 | 226 |
| 1486 | 3300048924 | Ga0496121_0002450 | Ga0496121_0002450_22817_23503 | 226 |
| 1487 | 3300048925 | Ga0496122_0003726 | Ga0496122_0003726_5716_6396 | 226 |
| 1488 | 3300048927 | Ga0496124_0000468 | Ga0496124_0000468_41892_42572 | 226 |
| 1489 | 3300048928 | Ga0496125_0000704 | Ga0496125_0000704_29869_30549 | 226 |
| 1490 | 3300048929 | Ga0496126_0000563 | Ga0496126_0000563_27005_27685 | 226 |
| 1491 | 3300049460 | Ga0495682_0002267 | Ga0495682_0002267_8009_8698 | 226 |
| 1492 | 3300049568 | Ga0501031_0369430 | Ga0501031_0369430_230_913 | 226 |
| 1493 | 3300049569 | Ga0501032_0282253 | Ga0501032_0282253_175_864 | 226 |
| 1494 | 3300049570 | Ga0501033_0007260 | Ga0501033_0007260_751_1434 | 226 |
| 1495 | 3300049570 | Ga0501033_0038110 | Ga0501033_0038110_598_1290 | 226 |
| 1496 | 3300049570 | Ga0501033_0058328 | Ga0501033_0058328_952_1638 | 226 |
| 1497 | 3300049570 | Ga0501033_0193801 | Ga0501033_0193801_528_1217 | 226 |
| 1498 | 3300049571 | Ga0501034_0007556 | Ga0501034_0007556_7475_8179 | 226 |
| 1499 | 3300049571 | Ga0501034_0040458 | Ga0501034_0040458_1868_2554 | 226 |
| 1500 | 3300049571 | Ga0501034_0043919 | Ga0501034_0043919_239_931 | 226 |
| 1501 | 3300049571 | Ga0501034_0106710 | Ga0501034_0106710_1655_2359 | 226 |
| 1502 | 3300049572 | Ga0501036_0083022 | Ga0501036_0083022_581_1273 | 226 |
| 1503 | 3300049573 | Ga0501037_0070110 | Ga0501037_0070110_108_797 | 226 |
| 1504 | 3300049574 | Ga0501038_0017603 | Ga0501038_0017603_5464_6156 | 226 |
| 1505 | 3300049574 | Ga0501038_0172537 | Ga0501038_0172537_738_1427 | 226 |
| 1506 | 3300049575 | Ga0501039_0133607 | Ga0501039_0133607_1040_1729 | 226 |
| 1507 | 3300049579 | Ga0501043_0014535 | Ga0501043_0014535_4803_5495 | 226 |
| 1508 | 3300049579 | Ga0501043_0123343 | Ga0501043_0123343_285_974 | 226 |
| 1509 | 3300049579 | Ga0501043_0188567 | Ga0501043_0188567_306_989 | 226 |
| 1510 | 3300049580 | Ga0501046_0083008 | Ga0501046_0083008_1673_2365 | 226 |
| 1511 | 3300049580 | Ga0501046_0125819 | Ga0501046_0125819_1105_1842 | 226 |
| 1512 | 3300049580 | Ga0501046_0147624 | Ga0501046_0147624_117_803 | 226 |
| 1513 | 3300049581 | Ga0501047_0004801 | Ga0501047_0004801_8247_8933 | 226 |
| 1514 | 3300049581 | Ga0501047_0006325 | Ga0501047_0006325_3030_3713 | 226 |
| 1515 | 3300049581 | Ga0501047_0007771 | Ga0501047_0007771_1020_1724 | 226 |
| 1516 | 3300049581 | Ga0501047_0010400 | Ga0501047_0010400_295_1032 | 226 |
| 1517 | 3300049581 | Ga0501047_0014769 | Ga0501047_0014769_5096_5788 | 226 |
| 1518 | 3300049581 | Ga0501047_0081339 | Ga0501047_0081339_1297_1983 | 226 |
| 1519 | 3300049581 | Ga0501047_0095776 | Ga0501047_0095776_1455_2141 | 226 |
| 1520 | 3300049581 | Ga0501047_0259535 | Ga0501047_0259535_513_1217 | 226 |
| 1521 | 3300049581 | Ga0501047_0359305 | Ga0501047_0359305_307_996 | 226 |
| 1522 | 3300049583 | Ga0501067_0024138 | Ga0501067_0024138_277_981 | 226 |
| 1523 | 3300049583 | Ga0501067_0071790 | Ga0501067_0071790_1013_1717 | 226 |
| 1524 | 3300049584 | Ga0501068_0027170 | Ga0501068_0027170_661_1353 | 226 |
| 1525 | 3300049585 | Ga0501069_0063092 | Ga0501069_0063092_905_1609 | 226 |
| 1526 | 3300049586 | Ga0501070_0000110 | Ga0501070_0000110_38293_38982 | 226 |
| 1527 | 3300049586 | Ga0501070_0344607 | Ga0501070_0344607_114_803 | 226 |
| 1528 | 3300049588 | Ga0501072_0032281 | Ga0501072_0032281_1448_2152 | 226 |
| 1529 | 3300049589 | Ga0501073_0017929 | Ga0501073_0017929_911_1615 | 226 |
| 1530 | 3300049589 | Ga0501073_0039911 | Ga0501073_0039911_46_738 | 226 |
| 1531 | 3300049589 | Ga0501073_0052570 | Ga0501073_0052570_1084_1770 | 226 |
| 1532 | 3300049589 | Ga0501073_0122980 | Ga0501073_0122980_854_1558 | 226 |
| 1533 | 3300049589 | Ga0501073_0254286 | Ga0501073_0254286_97_786 | 226 |
| 1534 | 3300049589 | Ga0501073_0327609 | Ga0501073_0327609_12_704 | 226 |
| 1535 | 3300049590 | Ga0501074_0032456 | Ga0501074_0032456_882_1586 | 226 |
| 1536 | 3300049590 | Ga0501074_0083783 | Ga0501074_0083783_292_996 | 226 |
| 1537 | 3300049741 | Ga0501079_0005104 | Ga0501079_0005104_8975_9679 | 226 |
| 1538 | 3300049741 | Ga0501079_0147634 | Ga0501079_0147634_193_897 | 226 |
| 1539 | 3300049742 | Ga0501080_0002037 | Ga0501080_0002037_4534_5223 | 226 |
| 1540 | 3300049742 | Ga0501080_0005758 | Ga0501080_0005758_1378_2067 | 226 |
| 1541 | 3300049742 | Ga0501080_0035760 | Ga0501080_0035760_1385_2089 | 226 |
| 1542 | 3300049742 | Ga0501080_0056611 | Ga0501080_0056611_2193_2897 | 226 |
| 1543 | 3300049742 | Ga0501080_0141800 | Ga0501080_0141800_414_1106 | 226 |
| 1544 | 3300049744 | Ga0501083_0049301 | Ga0501083_0049301_45_731 | 226 |
| 1545 | 3300049744 | Ga0501083_0100260 | Ga0501083_0100260_907_1599 | 226 |
| 1546 | 3300049822 | Ga0501035_0000879 | Ga0501035_0000879_2069_2758 | 226 |
| 1547 | 3300049822 | Ga0501035_0066142 | Ga0501035_0066142_2276_2959 | 226 |
| 1548 | 3300049822 | Ga0501035_0099534 | Ga0501035_0099534_467_1171 | 226 |
| 1549 | 3300049822 | Ga0501035_0114585 | Ga0501035_0114585_1458_2141 | 226 |
| 1550 | 3300049822 | Ga0501035_0311576 | Ga0501035_0311576_378_1115 | 226 |
| 1551 | 3300049823 | Ga0501044_0004520 | Ga0501044_0004520_7876_8562 | 226 |
| 1552 | 3300049823 | Ga0501044_0006575 | Ga0501044_0006575_1932_2621 | 226 |
| 1553 | 3300049823 | Ga0501044_0064414 | Ga0501044_0064414_1208_1891 | 226 |
| 1554 | 3300049823 | Ga0501044_0302658 | Ga0501044_0302658_455_1159 | 226 |
| 1555 | 3300053079 | Ga0500610_0000074 | Ga0500610_0000074_27056_27736 | 226 |
| 1556 | 3300053087 | Ga0500643_000006 | Ga0500643_000006_416576_417262 | 226 |
| 1557 | 3300053090 | Ga0500646_0009128 | Ga0500646_0009128_32_718 | 226 |
| 1558 | 3300053119 | Ga0500595_002621 | Ga0500595_002621_3895_4581 | 226 |
| 1559 | 3300053119 | Ga0500595_003650 | Ga0500595_003650_470_1150 | 226 |
| 1560 | 3300053130 | Ga0500642_0140493 | Ga0500642_0140493_370_1056 | 226 |
| 1561 | 3300053130 | Ga0500642_0241815 | Ga0500642_0241815_116_802 | 226 |
| 1562 | 3300053133 | Ga0500655_021771 | Ga0500655_021771_128_817 | 226 |
| 1563 | 3300053139 | Ga0500568_0020966 | Ga0500568_0020966_1823_2509 | 226 |
| 1564 | 3300053140 | Ga0500573_0000006 | Ga0500573_0000006_264670_265356 | 226 |
| 1565 | 3300053154 | Ga0500619_003933 | Ga0500619_003933_1029_1709 | 226 |
| 1566 | 3300053163 | Ga0500639_023212 | Ga0500639_023212_2066_2752 | 226 |
| 1567 | 3300053730 | Ga0500645_000034 | Ga0500645_000034_38951_39631 | 226 |
| 1568 | 3300053735 | Ga0500596_002112 | Ga0500596_002112_2930_3610 | 226 |
| 1569 | 3300054114 | Ga0501084_0000081 | Ga0501084_0000081_41550_42239 | 226 |
| 1570 | 3300054114 | Ga0501084_0048031 | Ga0501084_0048031_781_1485 | 226 |
| 1571 | 3300054114 | Ga0501084_0208640 | Ga0501084_0208640_583_1269 | 226 |
| 1572 | 3300060353 | Ga0501082_0165419 | Ga0501082_0165419_82_771 | 226 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6cqg-assembly1.cif.gz_A | yycf effector domain structure without dna bound | 0.934 | 128 | 218 |
| 1mvo-assembly1.cif.gz_A-2 | crystal structure of the phop receiver domain from bacillus subtilis | 0.9293 | 2 | 118 |
| 5x5j-assembly1.cif.gz_A | crystal structure of response regulator ader receiver domain | 0.929 | 2 | 118 |
| 7cci-assembly1.cif.gz_A | acinetobacter baumannii response regulator ader with disordered n terminus | 0.9262 | 2 | 119 |
| 6is2-assembly1.cif.gz_A | crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg | 0.9258 | 1 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O07776_22_102_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9902 | 1 | 80 | 3.40.50.2300 |
| af_Q2FXN6_3_86_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9875 | 1 | 83 | 3.40.50.2300 |
| af_P76340_1_79_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9869 | 1 | 80 | 3.40.50.2300 |
| af_P9WGM1_5_87_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.985 | 2 | 80 | 3.40.50.2300 |
| af_Q9KJN4_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9826 | 1 | 80 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-D6LNY5-F1-model_v4 | deleted | 0.9187 | 23 | 221 |
|
| AF-A0A318H352-F1-model_v4 | deleted | 0.8829 | 1 | 218 |
|
| AF-D6LNY5-F1-model_v4 | deleted | 0.8685 | 23 | 221 |
|
| AF-A0A318H352-F1-model_v4 | deleted | 0.8506 | 1 | 218 |
|
| AF-Q2IUG0-F1-model_v4 | Two component transcriptional regulator, winged helix family | 0.7923 | 1 | 220 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar