F494832

General Info

Members Datasets Scaffolds Average Seq Length
1572 923 1094 224

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0879069|Ga0436360_0879069_1439_2203
Length 254
Sequence MHLKDFSSPLWVGFIQQPQYTLDGITMRILLVEDDMDLQRLLKKALSEAGYVVDTAADGEEGHFLGDTEPYDAVVLDLGLPKMDGVTVLEKWRAAGRTMPVLILTARDRWSDKVAGFDAGADDYLAKPFYTEELLARLRALLRRAAGLATADIEVGKLRIDTRASRVTFDGNPVKLTSQEYRLLSYLAHHRGKVVSRTELVEHLYDQDFDRDSNTIEVFIGRLRKKLDAGLIQTVRGLGYSLEDPKLGGTAAEA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
9 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
10 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
11 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
12 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
13 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
14 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
15 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
16 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
17 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
18 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
19 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
20 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
21 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
22 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
23 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
24 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
25 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
26 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
27 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
28 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
29 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
30 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
31 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
32 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
33 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
34 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
35 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
36 2516143018 Ensifer sp. BR816 Isolate Nodule
37 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
38 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
39 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
40 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
41 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
42 2519899620 Rhizobium sp. Pop5 Isolate Nodule
43 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
44 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
45 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
46 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
47 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
48 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
49 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
50 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
51 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
52 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
53 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
54 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
55 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
56 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
57 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
58 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
59 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
60 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
61 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
62 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
63 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
64 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
65 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
66 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
67 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
68 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
69 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
70 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
71 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
72 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
73 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
74 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
75 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
76 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
77 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
78 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
79 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
80 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
81 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
82 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
83 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
84 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
85 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
86 2643221557 Ensifer sp. Root558 Isolate Unclassified
87 2643221607 Rhizobium sp. Root73 Isolate Unclassified
88 2643221610 Ensifer sp. Root74 Isolate Unclassified
89 2643221618 Ensifer sp. Root231 Isolate Unclassified
90 2643221626 Ensifer sp. Root31 Isolate Unclassified
91 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
92 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
93 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
94 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
95 2643221655 Ensifer sp. Root1252 Isolate Unclassified
96 2643221659 Ensifer sp. Root127 Isolate Unclassified
97 2643221668 Ensifer sp. Root423 Isolate Unclassified
98 2643221675 Ensifer sp. Root1298 Isolate Unclassified
99 2643221680 Ensifer sp. Root1312 Isolate Unclassified
100 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
101 2643221698 Ensifer sp. Root142 Isolate Unclassified
102 2643221712 Ensifer sp. Root258 Isolate Unclassified
103 2643221718 Rhizobium sp. Root268 Isolate Unclassified
104 2643221723 Ensifer sp. Root278 Isolate Unclassified
105 2643221726 Ensifer sp. Root954 Isolate Unclassified
106 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
107 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
108 2718217882 Rhizobium sp. N741 Isolate Nodule
109 2718217927 Rhizobium sp. N324 Isolate Nodule
110 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
111 2718218009 Rhizobium sp. N561 Isolate Nodule
112 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
113 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
114 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
115 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
116 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
117 2718218363 Rhizobium sp. N113 Isolate Nodule
118 2718218365 Rhizobium sp. N731 Isolate Nodule
119 2718218366 Rhizobium sp. N621 Isolate Nodule
120 2718218423 Rhizobium sp. N941 Isolate Nodule
121 2721755514 Rhizobium sp. N6212 Isolate Nodule
122 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
123 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
124 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
125 2721755809 Rhizobium sp. N541 Isolate Nodule
126 2721755810 Rhizobium sp. N871 Isolate Nodule
127 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
128 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
129 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
130 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
131 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
132 2728369365 Rhizobium sp. N1341 Isolate Nodule
133 2728369397 Rhizobium sp. N1314 Isolate Nodule
134 2738541293 Rhizobium sp. GV031 Isolate Unclassified
135 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
136 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
137 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
138 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
139 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
140 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
141 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
142 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
143 2791355256 Rhizobium sp. M10 Isolate Nodule
144 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
145 2791355260 Rhizobium sp. L9 Isolate Nodule
146 2791355261 Rhizobium sp. J15 Isolate Nodule
147 2791355262 Rhizobium sp. M1 Isolate Nodule
148 2791355263 Rhizobium chutanense C5 Isolate Nodule
149 2791355264 Rhizobium sp. S9 Isolate Nodule
150 2791355265 Rhizobium sp. H4 Isolate Nodule
151 2791355266 Rhizobium sp. L43 Isolate Nodule
152 2791355267 Rhizobium sp. L18 Isolate Nodule
153 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
154 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
155 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
156 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
157 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
158 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
159 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
160 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
161 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
162 2802429633 Rhizobium anhuiense J3 Isolate Nodule
163 2802429634 Rhizobium anhuiense S10 Isolate Nodule
164 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
165 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
166 2802429637 Rhizobium anhuiense C15 Isolate Nodule
167 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
168 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
169 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
170 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
171 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
172 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
173 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
174 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
175 2838048938 Rhizobium pisi 27/80 Isolate Nodule
176 2838061910 Rhizobium phaseoli L15 Isolate Nodule
177 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
178 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
179 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
180 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
181 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
182 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
183 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
184 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
185 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
186 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
187 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
188 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
189 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
190 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
191 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
192 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
193 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
194 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
195 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
196 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
197 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
198 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
199 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
200 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
201 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
202 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
203 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
204 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
205 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
206 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
207 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
208 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
209 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
210 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
211 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
212 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
213 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
214 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
215 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
216 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
217 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
218 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
219 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
220 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
221 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
222 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
223 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
224 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
225 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
226 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
227 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
228 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
229 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
230 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
231 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
232 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
233 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
234 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
235 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
236 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
237 2844163670 Ensifer sp. 1H6 Isolate Unclassified
238 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
239 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
240 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
241 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
242 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
243 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
244 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
245 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
246 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
247 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
248 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
249 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
250 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
251 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
252 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
253 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
254 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
255 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
256 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
257 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
258 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
259 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
260 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
261 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
262 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
263 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
264 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
265 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
266 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
267 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
268 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
269 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
270 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
271 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
272 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
273 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
274 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
275 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
276 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
277 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
278 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
279 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
280 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
281 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
282 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
283 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
284 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
285 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
286 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
287 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
288 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
289 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
290 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
291 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
292 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
293 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
294 2933599457 Rhizobium phaseoli M3 Isolate Nodule
295 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
296 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
297 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
298 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
299 2936381700 Rhizobium chutanense C16 Isolate Unclassified
300 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
301 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
302 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
303 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
304 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
305 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
306 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
307 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
308 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
309 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
310 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
311 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
312 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
313 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
314 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
315 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
316 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
317 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
318 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
319 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
320 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
321 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
322 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
323 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
324 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
325 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
326 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
327 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
328 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
329 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
330 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
331 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
332 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
333 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
334 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
335 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
336 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
337 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
338 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
339 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
340 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
341 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
342 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
343 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
344 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
345 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
346 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
347 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
348 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
349 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
350 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
351 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
352 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
353 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
354 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
355 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
356 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
357 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
358 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
359 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
360 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
361 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
362 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
363 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
364 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
365 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
366 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
367 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
368 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
369 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
370 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
371 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
372 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
373 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
374 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
375 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
376 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
377 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
378 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
379 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
380 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
381 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
382 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
383 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
384 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
385 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
386 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
387 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
388 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
389 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
390 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
391 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
392 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
393 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
394 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
395 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
396 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
397 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
398 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
399 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
400 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
401 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
402 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
403 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
404 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
405 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
406 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
407 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
408 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
409 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
410 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
411 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
412 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
413 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
414 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
415 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
416 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
417 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
418 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
419 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
420 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
421 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
422 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
423 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
424 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
425 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
426 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
427 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
428 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
429 2996887358 Rhizobium sp. R711 Isolate Nodule
430 2996893221 Rhizobium sp. R635 Isolate Nodule
431 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
432 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
433 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
434 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
435 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
436 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
437 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
438 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
439 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
440 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
441 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
442 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
443 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
444 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
445 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
446 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
447 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
448 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
449 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
450 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
451 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
452 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
453 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
454 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
455 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
456 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
457 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
458 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
459 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
460 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
461 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
462 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
463 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
464 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
465 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
466 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
467 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
468 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
469 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
470 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
471 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
472 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
473 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
474 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
475 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
476 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
477 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
478 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
479 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
480 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
481 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
482 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
483 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
484 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
485 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
486 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
487 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
488 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
489 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
490 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
491 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
492 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
493 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
494 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
495 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
496 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
497 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
498 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
499 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
500 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
501 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
502 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
503 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
504 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
505 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
506 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
507 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
508 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
509 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
510 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
511 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
512 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
513 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
514 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
515 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
516 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
517 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
518 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
519 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
520 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
521 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
522 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
523 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
524 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
525 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
526 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
527 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
528 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
529 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
530 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
531 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
532 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
533 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
534 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
535 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
536 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
537 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
538 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
539 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
540 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
541 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
542 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
543 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
544 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
545 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
546 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
547 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
548 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
549 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
550 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
551 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
552 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
553 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
554 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
555 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
556 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
557 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
558 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
559 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
560 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
561 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
562 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
563 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
564 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
565 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
566 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
567 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
568 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
569 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
570 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
571 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
572 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
573 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
574 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
575 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
576 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
577 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
578 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
579 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
580 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
581 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
582 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
583 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
584 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
585 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
586 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
587 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
588 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
589 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
590 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
591 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
592 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
593 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
594 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
595 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
596 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
597 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
598 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
599 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
600 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
601 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
602 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
603 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
604 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
605 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
606 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
607 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
608 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
609 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
610 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
611 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
612 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
613 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
614 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
615 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
616 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
617 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
618 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
619 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
620 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
621 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
622 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
623 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
624 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
625 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
626 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
627 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
628 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
629 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
630 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
631 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
632 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
633 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
634 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
635 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
636 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
637 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
638 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
639 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
640 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
641 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
642 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
643 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
644 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
645 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
646 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
647 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
648 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
649 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
650 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
651 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
652 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
653 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
654 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
655 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
656 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
657 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
658 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
659 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
660 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
661 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
662 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
663 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
664 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
665 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
666 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
667 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
668 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
669 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
670 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
671 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
672 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
673 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
674 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
675 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
676 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
677 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
678 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
679 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
680 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
681 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
682 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
683 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
684 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
685 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
686 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
687 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
688 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
689 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
690 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
691 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
692 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
693 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
694 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
695 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
696 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
697 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
698 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
699 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
700 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
701 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
702 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
703 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
704 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
705 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
706 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
707 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
708 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
709 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
710 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
711 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
712 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
713 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
714 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
715 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
716 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
717 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
718 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
719 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
720 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
721 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
722 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
723 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
724 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
725 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
726 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
727 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
728 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
729 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
730 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
731 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
732 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
733 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
734 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
735 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
736 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
737 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
738 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
739 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
740 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
741 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
742 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
743 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
744 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
745 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
746 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
747 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
748 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
749 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
750 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
751 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
752 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
753 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
754 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
755 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
756 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
757 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
758 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
759 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
760 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
761 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
762 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
763 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
764 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
765 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
766 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
767 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
768 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
769 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
770 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
771 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
772 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
773 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
774 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
775 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
776 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
777 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
778 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
779 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
780 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
781 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
782 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
783 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
784 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
785 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
786 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
787 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
788 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
789 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
790 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
791 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
792 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
793 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
794 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
795 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
796 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
797 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
798 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
799 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
800 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
801 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
802 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
803 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
804 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
805 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
806 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
807 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
808 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
809 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
810 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
811 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
812 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
813 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
814 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
815 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
816 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
817 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
818 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
819 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
820 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
821 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
822 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
823 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
824 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
825 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
826 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
827 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
828 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
829 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
830 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
831 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
832 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
833 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
834 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
835 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
836 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
837 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
838 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
839 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
840 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
841 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
842 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
843 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
844 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
845 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
846 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
847 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
848 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
849 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
850 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
851 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
852 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
853 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
854 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
855 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
856 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
857 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
858 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
859 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
860 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
861 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
862 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
863 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
864 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
865 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
866 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
867 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
868 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
869 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
870 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
871 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
872 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
873 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
874 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
875 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
876 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
877 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
878 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
879 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
880 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
881 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
882 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
883 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
884 8005258706 Rhizobium sp. R693 Isolate Nodule
885 8005275841 Rhizobium sp. N4311 Isolate Nodule
886 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
887 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
888 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
889 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
890 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
891 8005321885 Rhizobium sp. R72 Isolate Nodule
892 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
893 8005382845 Rhizobium sp. R634 Isolate Nodule
894 8005395548 Rhizobium sp. R339 Isolate Nodule
895 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
896 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
897 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
898 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
899 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
900 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
901 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
902 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
903 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
904 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
905 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
906 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
907 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
908 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
909 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
910 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
911 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
912 8018176218 Rhizobium sp. N122 Isolate Nodule
913 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
914 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
915 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
916 8024501048 Rhizobium sp. H4 Isolate Nodule
917 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
918 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
919 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
920 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
921 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
922 8056382006 Rhizobium croatiense 13T Isolate Nodule
923 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 69.34
Metatranscriptomes 0.25
Isolates 30.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.1
Nodule 25.38
Rhizoplane 1.27
Rhizosphere 52.1
Stem 0
Stem Tuber 0
Unclassified 8.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1001068 3300001915 Bacteria 8189
2 JGI24740J21852_10001706 3300001979 Bacteria 10085
3 JGI24740J21852_10011169 3300001979 Bacteria 3428
4 JGI24739J22299_10014633 3300001989 Bacteria 2851
5 JGI24737J22298_10010599 3300001990 Bacteria 3038
6 JGI24737J22298_10018602 3300001990 Bacteria 2228
7 JGI25155J39150_1000089 3300002704 Bacteria 51946
8 JGI25156J39149_1000147 3300002705 Bacteria 51946
9 JGI25162J39368_1000243 3300002737 Bacteria 54503
10 JGI25162J39368_1000372 3300002737 Bacteria 38119
11 JGI25154J39366_1000160 3300002738 Bacteria 51946
12 JGI25158J39367_1000293 3300002739 Bacteria 11361
13 JGI25158J39367_1001028 3300002739 Bacteria 5095
14 JGI25157J39369_1000190 3300002741 Bacteria 51946
15 JGI25152J39213_1003430 3300002773 Bacteria 5419
16 JGI25152J39213_1004848 3300002773 Bacteria 4112
17 JGI25152J39213_1006337 3300002773 Bacteria 3248
18 JGI25152J39213_1006342 3300002773 Bacteria 3247
19 JGI25152J39213_1006896 3300002773 Bacteria 3006
20 JGI25150J39212_1000031 3300002774 Bacteria 100456
21 JGI25159J45721_1000001 3300002987 Bacteria 303489
22 JGI25159J45721_1000264 3300002987 Bacteria 24458
23 JGI25151J46595_10000062 3300003187 Bacteria 146687
24 JGI25151J46595_10003599 3300003187 Bacteria 8487
25 JGI25151J46595_10004214 3300003187 Bacteria 7650
26 JGI25151J46595_10014854 3300003187 Bacteria 3456
27 JGI25151J46595_10036908 3300003187 Bacteria 1838
28 JGI25165J46597_1000017 3300003214 Bacteria 377013
29 JGI25165J46597_1000318 3300003214 Bacteria 57977
30 JGI25165J46597_1000413 3300003214 Bacteria 44960
31 JGI25165J46597_1004436 3300003214 Bacteria 3013
32 JGI25153J46596_10000021 3300003215 Bacteria 252651
33 JGI25153J46596_10000755 3300003215 Bacteria 19791
34 JGI25153J46596_10002646 3300003215 Bacteria 10240
35 JGI25153J46596_10006186 3300003215 Bacteria 6124
36 JGI25153J46596_10034305 3300003215 Bacteria 1661
37 JGI25153J46596_10034323 3300003215 Bacteria 1660
38 rootH1_10006292 3300003316 Bacteria 6778
39 JGI25160J50197_1000002 3300003354 Bacteria 561707
40 JGI25160J50197_1000855 3300003354 Bacteria 16156
41 JGI25160J50197_1001062 3300003354 Bacteria 14110
42 JGI25160J50197_1013067 3300003354 Bacteria 2848
43 JGI25161J50226_1000338 3300003374 Bacteria 25195
44 JGI25161J50226_1000742 3300003374 Bacteria 12536
45 JGI25161J50226_1001156 3300003374 Bacteria 8773
46 Ga0055525_1000070 3300003759 Bacteria 183047
47 Ga0055542_1000102 3300003762 Bacteria 115614
48 Ga0055529_1000136 3300003763 Bacteria 104102
49 Ga0055526_1000042 3300003771 Bacteria 124886
50 Ga0055526_1000805 3300003771 Bacteria 23389
51 Ga0055526_1005449 3300003771 Bacteria 7317
52 Ga0055526_1010411 3300003771 Bacteria 4328
53 Ga0055526_1019686 3300003771 Bacteria 2446
54 Ga0055526_1020429 3300003771 Bacteria 2357
55 Ga0055526_1030080 3300003771 Bacteria 1593
56 Ga0055524_1000650 3300003775 Bacteria 24635
57 Ga0055524_1006021 3300003775 Bacteria 5324
58 Ga0055524_1011277 3300003775 Bacteria 3507
59 Ga0055524_1012192 3300003775 Bacteria 3314
60 Ga0055524_1017549 3300003775 Bacteria 2522
61 Ga0055524_1022121 3300003775 Bacteria 2086
62 Ga0055524_1024531 3300003775 Bacteria 1910
63 Ga0055536_1000427 3300003781 Bacteria 30054
64 Ga0055528_1000607 3300003790 Bacteria 26876
65 Ga0055528_1000798 3300003790 Bacteria 21827
66 Ga0055528_1005643 3300003790 Bacteria 5778
67 Ga0055528_1013886 3300003790 Bacteria 3021
68 Ga0055528_1030911 3300003790 Bacteria 1407
69 Ga0055530_10004975 3300003791 Bacteria 6570
70 Ga0055540_1000380 3300003792 Bacteria 37153
71 Ga0055540_1010288 3300003792 Bacteria 3125
72 Ga0055540_1013681 3300003792 Bacteria 2463
73 Ga0055540_1033501 3300003792 Bacteria 1163
74 Ga0055531_10029444 3300003794 Bacteria 1869
75 Ga0058692_1013229 3300003856 Bacteria 1928
76 Ga0055543_1000115 3300004625 Bacteria 68252
77 Ga0055543_1000137 3300004625 Bacteria 60651
78 Ga0055543_1003775 3300004625 Bacteria 4323
79 Ga0065165_1000004 3300005262 Bacteria 377081
80 Ga0065165_1003706 3300005262 Bacteria 10353
81 Ga0065165_1045465 3300005262 Bacteria 1279
82 Ga0070658_10010959 3300005327 Bacteria 7266
83 Ga0070658_10053726 3300005327 Bacteria 3270
84 Ga0070658_10075769 3300005327 Bacteria 2760
85 Ga0070676_10005044 3300005328 Bacteria 6995
86 Ga0070690_100400562 3300005330 Bacteria 1008
87 Ga0070670_100091084 3300005331 Bacteria 2621
88 Ga0070670_100098407 3300005331 Bacteria 2517
89 Ga0070670_100169119 3300005331 Bacteria 1896
90 Ga0068869_100003248 3300005334 Bacteria 9934
91 Ga0070666_10005936 3300005335 Bacteria 7498
92 Ga0070666_10008438 3300005335 Bacteria 6398
93 Ga0070680_100000100 3300005336 Bacteria 49540
94 Ga0070680_100096703 3300005336 Bacteria 2448
95 Ga0068868_100156958 3300005338 Bacteria 1877
96 Ga0068868_100468459 3300005338 Bacteria 1098
97 Ga0070660_100004214 3300005339 Bacteria 9925
98 Ga0070660_100017038 3300005339 Bacteria 5289
99 Ga0070660_100058836 3300005339 Bacteria 2979
100 Ga0070660_100579161 3300005339 Bacteria 937
101 Ga0070689_100219546 3300005340 Bacteria 1559
102 Ga0070691_10001507 3300005341 Bacteria 10004
103 Ga0070691_10002680 3300005341 Bacteria 7928
104 Ga0070691_10281054 3300005341 Bacteria 903
105 Ga0070661_100000160 3300005344 Bacteria 55287
106 Ga0070661_100010954 3300005344 Bacteria 6319
107 Ga0070661_100034466 3300005344 Bacteria 3670
108 Ga0070661_100302359 3300005344 Bacteria 1246
109 Ga0070668_100053738 3300005347 Bacteria 3106
110 Ga0070668_100146586 3300005347 Bacteria 1906
111 Ga0070675_100274295 3300005354 Bacteria 1481
112 Ga0070674_100101869 3300005356 Bacteria 2094
113 Ga0070673_100031659 3300005364 Bacteria 3973
114 Ga0070688_100203110 3300005365 Bacteria 1388
115 Ga0070659_100028368 3300005366 Bacteria 4322
116 Ga0070659_100095870 3300005366 Bacteria 2383
117 Ga0070667_100122040 3300005367 Bacteria 2267
118 Ga0070709_10001001 3300005434 Bacteria 15591
119 Ga0070709_10493890 3300005434 Bacteria 929
120 Ga0070714_100012979 3300005435 Bacteria 6663
121 Ga0070714_100022269 3300005435 Bacteria 5194
122 Ga0070714_100865222 3300005435 Bacteria 877
123 Ga0070713_100000262 3300005436 Bacteria 34628
124 Ga0070713_100061009 3300005436 Bacteria 3154
125 Ga0070710_10334401 3300005437 Bacteria 998
126 Ga0070711_100197511 3300005439 Bacteria 1550
127 Ga0070711_100635050 3300005439 Bacteria 894
128 Ga0070711_100902852 3300005439 Bacteria 754
129 Ga0070705_100119002 3300005440 Bacteria 1702
130 Ga0070705_100324345 3300005440 Bacteria 1113
131 Ga0070678_100000139 3300005456 Bacteria 29667
132 Ga0070678_100262262 3300005456 Bacteria 1454
133 Ga0070678_100837028 3300005456 Bacteria 838
134 Ga0070662_100276456 3300005457 Bacteria 1358
135 Ga0070681_10000003 3300005458 Bacteria 252785
136 Ga0070681_10040066 3300005458 Bacteria 4697
137 Ga0070681_10075303 3300005458 Bacteria 3335
138 Ga0070681_10082403 3300005458 Bacteria 3172
139 Ga0068867_100018286 3300005459 Bacteria 4981
140 Ga0068867_100100775 3300005459 Bacteria 2205
141 Ga0068867_100114855 3300005459 Bacteria 2073
142 Ga0068867_100412646 3300005459 Bacteria 1142
143 Ga0070685_10338153 3300005466 Bacteria 1026
144 Ga0070707_100742212 3300005468 Bacteria 945
145 Ga0070679_100001255 3300005530 Bacteria 22375
146 Ga0070679_100015724 3300005530 Bacteria 7277
147 Ga0070679_100163594 3300005530 Bacteria 2199
148 Ga0070679_100353154 3300005530 Bacteria 1418
149 Ga0070684_100245317 3300005535 Bacteria 1637
150 Ga0070697_100625443 3300005536 Bacteria 947
151 Ga0068853_100029148 3300005539 Bacteria 4650
152 Ga0068853_100063732 3300005539 Bacteria 3193
153 Ga0068853_100147644 3300005539 Bacteria 2114
154 Ga0068853_100203524 3300005539 Bacteria 1802
155 Ga0070672_100054920 3300005543 Bacteria 3119
156 Ga0070686_100642102 3300005544 Bacteria 841
157 Ga0070693_100081219 3300005547 Bacteria 1933
158 Ga0070693_100187440 3300005547 Bacteria 1336
159 Ga0070665_100001553 3300005548 Bacteria 26522
160 Ga0070665_100181852 3300005548 Bacteria 2104
161 Ga0070665_100316226 3300005548 Bacteria 1565
162 Ga0070665_101068319 3300005548 Bacteria 819
163 Ga0068855_100000374 3300005563 Bacteria 55329
164 Ga0068855_100025478 3300005563 Bacteria 7076
165 Ga0068855_100031230 3300005563 Bacteria 6361
166 Ga0068855_100066217 3300005563 Bacteria 4212
167 Ga0068855_100113925 3300005563 Bacteria 3101
168 Ga0068855_100716604 3300005563 Bacteria 1069
169 Ga0070664_100248465 3300005564 Bacteria 1598
170 Ga0068857_100001171 3300005577 Bacteria 20458
171 Ga0068857_100066779 3300005577 Bacteria 3201
172 Ga0068854_100037323 3300005578 Bacteria 3410
173 Ga0068856_100003455 3300005614 Bacteria 15973
174 Ga0068856_100003973 3300005614 Bacteria 14814
175 Ga0068852_100005263 3300005616 Bacteria 9233
176 Ga0068852_100036960 3300005616 Bacteria 4092
177 Ga0068861_100038208 3300005719 Bacteria 3573
178 Ga0068861_100078905 3300005719 Bacteria 2572
179 Ga0068851_10253758 3300005834 Bacteria 998
180 Ga0068863_100171572 3300005841 Bacteria 2080
181 Ga0068858_100017646 3300005842 Bacteria 6690
182 Ga0068858_100122719 3300005842 Bacteria 2431
183 Ga0068858_100404699 3300005842 Bacteria 1311
184 Ga0068860_100152944 3300005843 Bacteria 2222
185 Ga0068860_100190810 3300005843 Bacteria 1983
186 Ga0068862_100046983 3300005844 Bacteria 3683
187 Ga0068862_100267796 3300005844 Bacteria 1561
188 Ga0068862_100281608 3300005844 Bacteria 1524
189 Ga0075365_10075176 3300006038 Bacteria 2279
190 Ga0075368_10227118 3300006042 Bacteria 794
191 Ga0075363_100153505 3300006048 Bacteria 1301
192 Ga0075364_10032539 3300006051 Bacteria 3353
193 Ga0070716_100007829 3300006173 Bacteria 5281
194 Ga0070712_100000171 3300006175 Bacteria 35631
195 Ga0070712_100008256 3300006175 Bacteria 6542
196 Ga0075362_10070603 3300006177 Bacteria 1594
197 Ga0075367_10023622 3300006178 Bacteria 3462
198 Ga0075367_10127194 3300006178 Bacteria 1573
199 Ga0075367_10184832 3300006178 Bacteria 1300
200 Ga0075367_10204975 3300006178 Bacteria 1232
201 Ga0075366_10012273 3300006195 Bacteria 4858
202 Ga0075366_10050728 3300006195 Bacteria 2464
203 Ga0097621_100073785 3300006237 Bacteria 2825
204 Ga0097621_100577839 3300006237 Bacteria 1025
205 Ga0075370_10112041 3300006353 Bacteria 1585
206 Ga0075370_10113838 3300006353 Bacteria 1572
207 Ga0068871_100026285 3300006358 Bacteria 4541
208 Ga0068871_100165022 3300006358 Bacteria 1896
209 Ga0075431_100012097 3300006847 Bacteria 8707
210 Ga0075434_100029143 3300006871 Bacteria 5429
211 Ga0075429_100723170 3300006880 Bacteria 872
212 Ga0075436_100001738 3300006914 Bacteria 14913
213 Ga0075436_100055208 3300006914 Bacteria 2743
214 Ga0079104_1001952 3300006946 Bacteria 12226
215 Ga0079104_1006397 3300006946 Bacteria 4466
216 Ga0075435_100119646 3300007076 Bacteria 2197
217 Ga0105250_10027216 3300009092 Bacteria 2304
218 Ga0105240_10000027 3300009093 Bacteria 348486
219 Ga0105240_10002036 3300009093 Bacteria 33289
220 Ga0105240_10002102 3300009093 Bacteria 32589
221 Ga0105240_10410921 3300009093 Bacteria 1522
222 Ga0105240_10434757 3300009093 Bacteria 1472
223 Ga0105240_10488377 3300009093 Bacteria 1371
224 Ga0105245_10030128 3300009098 Bacteria 4797
225 Ga0105245_10072143 3300009098 Bacteria 3136
226 Ga0105245_10162320 3300009098 Bacteria 2121
227 Ga0105245_10952398 3300009098 Bacteria 901
228 Ga0105247_10080264 3300009101 Bacteria 2054
229 Ga0105247_10102920 3300009101 Bacteria 1828
230 Ga0105247_10417463 3300009101 Bacteria 960
231 Ga0114129_10031485 3300009147 Bacteria 7498
232 Ga0105243_10000367 3300009148 Bacteria 48386
233 Ga0105243_10007689 3300009148 Bacteria 8283
234 Ga0105241_10010758 3300009174 Bacteria 6715
235 Ga0105241_10044755 3300009174 Bacteria 3355
236 Ga0105241_10051327 3300009174 Bacteria 3145
237 Ga0105241_10077387 3300009174 Bacteria 2596
238 Ga0105241_10078979 3300009174 Bacteria 2572
239 Ga0105241_10782045 3300009174 Bacteria 878
240 Ga0105242_10012664 3300009176 Bacteria 6495
241 Ga0105242_10043250 3300009176 Bacteria 3644
242 Ga0105242_10048929 3300009176 Bacteria 3438
243 Ga0105248_10000001 3300009177 Bacteria 1881304
244 Ga0105248_10060975 3300009177 Bacteria 4234
245 Ga0105248_10091837 3300009177 Bacteria 3419
246 Ga0105248_10539530 3300009177 Bacteria 1316
247 Ga0105237_10056896 3300009545 Bacteria 3913
248 Ga0105237_10139538 3300009545 Bacteria 2418
249 Ga0105237_10162691 3300009545 Bacteria 2230
250 Ga0105237_10175205 3300009545 Bacteria 2145
251 Ga0105237_10315632 3300009545 Bacteria 1566
252 Ga0105237_10320520 3300009545 Bacteria 1553
253 Ga0105238_10007661 3300009551 Bacteria 10805
254 Ga0105238_10009150 3300009551 Bacteria 9916
255 Ga0105238_10019021 3300009551 Bacteria 6995
256 Ga0105238_10051343 3300009551 Bacteria 4148
257 Ga0105249_10219821 3300009553 Bacteria 1869
258 Ga0123341_1000006 3300009765 Bacteria 149197
259 Ga0123342_1004514 3300009766 Bacteria 21146
260 Ga0105239_10047501 3300010375 Bacteria 4704
261 Ga0105246_10089264 3300011119 Bacteria 2217
262 Ga0105246_10186534 3300011119 Bacteria 1602
263 Ga0157373_10029739 3300013100 Bacteria 3933
264 Ga0157373_10037466 3300013100 Bacteria 3476
265 Ga0157373_10071232 3300013100 Bacteria 2456
266 Ga0157373_10390964 3300013100 Bacteria 996
267 Ga0157371_10000066 3300013102 Bacteria 168406
268 Ga0157370_10000223 3300013104 Bacteria 72025
269 Ga0157370_10001228 3300013104 Bacteria 32108
270 Ga0157370_10004692 3300013104 Bacteria 15583
271 Ga0157370_10035120 3300013104 Bacteria 4876
272 Ga0157370_10061333 3300013104 Bacteria 3569
273 Ga0157369_10086504 3300013105 Bacteria 3348
274 Ga0157369_10237916 3300013105 Bacteria 1902
275 Ga0157369_10495606 3300013105 Bacteria 1264
276 Ga0171463_1001 3300013249 Bacteria 1406070
277 Ga0157374_10097921 3300013296 Bacteria 2807
278 Ga0157378_10013145 3300013297 Bacteria 7243
279 Ga0157378_10327659 3300013297 Bacteria 1489
280 Ga0163162_10116440 3300013306 Bacteria 2773
281 Ga0157372_10004646 3300013307 Bacteria 14596
282 Ga0157372_10011401 3300013307 Bacteria 9455
283 Ga0157372_10014340 3300013307 Bacteria 8473
284 Ga0157372_10049388 3300013307 Bacteria 4678
285 Ga0157372_10116365 3300013307 Bacteria 3065
286 Ga0157375_10034969 3300013308 Bacteria 4791
287 Ga0157375_10367931 3300013308 Bacteria 1604
288 Ga0163163_10000004 3300014325 Bacteria 416569
289 Ga0163163_10315573 3300014325 Bacteria 1616
290 Ga0157380_10629063 3300014326 Bacteria 1067
291 Ga0157379_10001940 3300014968 Bacteria 17108
292 Ga0157379_10009144 3300014968 Bacteria 8629
293 Ga0157379_10022145 3300014968 Bacteria 5633
294 Ga0157379_10299080 3300014968 Bacteria 1466
295 Ga0157376_10009191 3300014969 Bacteria 7170
296 Ga0157376_10194471 3300014969 Bacteria 1862
297 Ga0182007_10000805 3300015262 Bacteria 17521
298 Ga0183363_1266 3300015690 Bacteria 8469
299 Ga0163161_10040297 3300017792 Bacteria 3354
300 Ga0163161_10059986 3300017792 Bacteria 2768
301 Ga0163161_10672612 3300017792 Bacteria 860
302 Ga0214544_1000008 3300021320 Bacteria 326027
303 Ga0214542_1000010 3300021321 Bacteria 262816
304 Ga0214542_1022278 3300021321 Bacteria 4099
305 Ga0214543_1000003 3300021327 Bacteria 692327
306 Ga0214543_1000004 3300021327 Bacteria 527190
307 Ga0213872_10017525 3300021361 Bacteria 3308
308 Ga0213874_10025338 3300021377 Bacteria 1672
309 Ga0213876_10000498 3300021384 Bacteria 30587
310 Ga0213876_10020884 3300021384 Bacteria 3462
311 Ga0228711_1000001 3300022739 Bacteria 357377
312 Ga0228710_1000001 3300022740 Bacteria 314328
313 Ga0209435_100036 3300025206 Bacteria 126970
314 Ga0209436_101062 3300025208 Bacteria 10405
315 Ga0209436_101252 3300025208 Bacteria 9141
316 Ga0209674_108574 3300025226 Bacteria 1201
317 Ga0209672_103497 3300025228 Bacteria 3227
318 Ga0209563_100053 3300025230 Bacteria 332370
319 Ga0207427_107239 3300025231 Bacteria 1317
320 Ga0209437_100033 3300025233 Bacteria 512520
321 Ga0209437_100036 3300025233 Bacteria 469153
322 Ga0207425_1000031 3300025245 Bacteria 261181
323 Ga0207425_1001175 3300025245 Bacteria 11688
324 Ga0207425_1007557 3300025245 Bacteria 2856
325 Ga0207425_1011070 3300025245 Bacteria 2169
326 Ga0209646_1000132 3300025246 Bacteria 126859
327 Ga0209026_1000313 3300025250 Bacteria 52121
328 Ga0209677_100419 3300025253 Bacteria 25164
329 Ga0209677_107461 3300025253 Bacteria 2321
330 Ga0209148_1000159 3300025254 Bacteria 139560
331 Ga0209148_1020173 3300025254 Bacteria 1099
332 Ga0209759_1000417 3300025256 Bacteria 52121
333 Ga0209129_1000053 3300025258 Bacteria 262823
334 Ga0209129_1000125 3300025258 Bacteria 133506
335 Ga0209129_1000465 3300025258 Bacteria 29855
336 Ga0209129_1000945 3300025258 Bacteria 17461
337 Ga0209129_1002143 3300025258 Bacteria 10013
338 Ga0209129_1003204 3300025258 Bacteria 7312
339 Ga0209129_1005526 3300025258 Bacteria 4433
340 Ga0209233_1000006 3300025261 Bacteria 1473685
341 Ga0209233_1000056 3300025261 Bacteria 438104
342 Ga0209233_1000064 3300025261 Bacteria 392156
343 Ga0209233_1000152 3300025261 Bacteria 175910
344 Ga0209233_1015113 3300025261 Bacteria 2159
345 Ga0209455_1000045 3300025272 Bacteria 383329
346 Ga0209455_1005227 3300025272 Bacteria 4061
347 Ga0209673_1000122 3300025273 Bacteria 170443
348 Ga0209673_1000409 3300025273 Bacteria 75876
349 Ga0209673_1003665 3300025273 Bacteria 8868
350 Ga0209673_1004779 3300025273 Bacteria 7119
351 Ga0209673_1005538 3300025273 Bacteria 6319
352 Ga0209673_1008056 3300025273 Bacteria 4742
353 Ga0209673_1008564 3300025273 Bacteria 4540
354 Ga0209673_1010635 3300025273 Bacteria 3860
355 Ga0209673_1024143 3300025273 Bacteria 2050
356 Ga0209130_1000008 3300025284 Bacteria 581232
357 Ga0209130_1000015 3300025284 Bacteria 409631
358 Ga0209130_1006639 3300025284 Bacteria 3718
359 Ga0209130_1010324 3300025284 Bacteria 2582
360 Ga0209675_1018780 3300025291 Bacteria 1924
361 Ga0209676_1000885 3300025292 Bacteria 38361
362 Ga0209676_1027963 3300025292 Bacteria 1765
363 Ga0209676_1046142 3300025292 Bacteria 1180
364 Ga0209025_1000087 3300025294 Bacteria 261181
365 Ga0209025_1000100 3300025294 Bacteria 229182
366 Ga0209025_1000953 3300025294 Bacteria 43794
367 Ga0209025_1001577 3300025294 Bacteria 28830
368 Ga0209025_1009717 3300025294 Bacteria 6649
369 Ga0209025_1011394 3300025294 Bacteria 5865
370 Ga0209025_1011398 3300025294 Bacteria 5863
371 Ga0209025_1020091 3300025294 Bacteria 3672
372 Ga0209025_1027419 3300025294 Bacteria 2825
373 Ga0209564_1000032 3300025295 Bacteria 464041
374 Ga0209564_1000104 3300025295 Bacteria 219017
375 Ga0209564_1001469 3300025295 Bacteria 23854
376 Ga0209564_1001682 3300025295 Bacteria 21003
377 Ga0209564_1002198 3300025295 Bacteria 16300
378 Ga0209564_1006562 3300025295 Bacteria 6246
379 Ga0209564_1010193 3300025295 Bacteria 4363
380 Ga0209758_1000008 3300025297 Bacteria 1215263
381 Ga0209758_1000023 3300025297 Bacteria 612453
382 Ga0209758_1000081 3300025297 Bacteria 261181
383 Ga0209758_1000313 3300025297 Bacteria 93883
384 Ga0209758_1000376 3300025297 Bacteria 77855
385 Ga0209758_1001096 3300025297 Bacteria 35059
386 Ga0209758_1001417 3300025297 Bacteria 28365
387 Ga0209758_1001419 3300025297 Bacteria 28354
388 Ga0209758_1007473 3300025297 Bacteria 7420
389 Ga0209758_1035521 3300025297 Bacteria 1963
390 Ga0209758_1050100 3300025297 Bacteria 1467
391 Ga0209050_1001263 3300025298 Bacteria 29191
392 Ga0209050_1012590 3300025298 Bacteria 3860
393 Ga0209256_1000351 3300025299 Bacteria 74921
394 Ga0209256_1000711 3300025299 Bacteria 44226
395 Ga0209256_1000723 3300025299 Bacteria 43638
396 Ga0209256_1001198 3300025299 Bacteria 29038
397 Ga0209256_1008596 3300025299 Bacteria 4692
398 Ga0209256_1008685 3300025299 Bacteria 4645
399 Ga0209256_1019583 3300025299 Bacteria 2148
400 Ga0209256_1036607 3300025299 Bacteria 1286
401 Ga0207426_1000016 3300025302 Bacteria 581232
402 Ga0207426_1000122 3300025302 Bacteria 218307
403 Ga0207426_1000146 3300025302 Bacteria 190683
404 Ga0207426_1002469 3300025302 Bacteria 11759
405 Ga0209051_1000127 3300025303 Bacteria 142254
406 Ga0209051_1000918 3300025303 Bacteria 29277
407 Ga0209051_1040904 3300025303 Bacteria 1656
408 Ga0209257_1009728 3300025304 Bacteria 5054
409 Ga0209257_1010230 3300025304 Bacteria 4803
410 Ga0207697_10170076 3300025315 Bacteria 953
411 Ga0207682_10089646 3300025893 Bacteria 1331
412 Ga0207710_10073682 3300025900 Bacteria 1570
413 Ga0207688_10008993 3300025901 Bacteria 5437
414 Ga0207688_10106656 3300025901 Bacteria 1623
415 Ga0207680_10012613 3300025903 Bacteria 4310
416 Ga0207680_10106423 3300025903 Bacteria 1811
417 Ga0207647_10042328 3300025904 Bacteria 2858
418 Ga0207699_10000246 3300025906 Bacteria 30425
419 Ga0207699_10030561 3300025906 Bacteria 3016
420 Ga0207645_10025706 3300025907 Bacteria 3809
421 Ga0207645_10025773 3300025907 Bacteria 3803
422 Ga0207645_10122587 3300025907 Bacteria 1688
423 Ga0207645_10158068 3300025907 Bacteria 1482
424 Ga0207643_10076875 3300025908 Bacteria 1929
425 Ga0207705_10001090 3300025909 Bacteria 22078
426 Ga0207705_10002561 3300025909 Bacteria 13978
427 Ga0207705_10030747 3300025909 Bacteria 3832
428 Ga0207705_10187404 3300025909 Bacteria 1563
429 Ga0207705_10456138 3300025909 Bacteria 991
430 Ga0207654_10000436 3300025911 Bacteria 23923
431 Ga0207654_10023858 3300025911 Bacteria 3282
432 Ga0207654_10067032 3300025911 Bacteria 2119
433 Ga0207654_10158876 3300025911 Bacteria 1458
434 Ga0207654_10325064 3300025911 Bacteria 1052
435 Ga0207707_10000001 3300025912 Bacteria 1212482
436 Ga0207707_10000849 3300025912 Bacteria 29880
437 Ga0207707_10091118 3300025912 Bacteria 2665
438 Ga0207707_10125146 3300025912 Bacteria 2248
439 Ga0207695_10000004 3300025913 Bacteria 1288665
440 Ga0207695_10000024 3300025913 Bacteria 632311
441 Ga0207695_10134158 3300025913 Bacteria 2431
442 Ga0207695_10323551 3300025913 Bacteria 1431
443 Ga0207671_10000986 3300025914 Bacteria 35178
444 Ga0207671_10114443 3300025914 Bacteria 2056
445 Ga0207671_10165169 3300025914 Bacteria 1716
446 Ga0207693_10000025 3300025915 Bacteria 124008
447 Ga0207693_10179371 3300025915 Bacteria 1666
448 Ga0207693_10479473 3300025915 Bacteria 971
449 Ga0207663_10007296 3300025916 Bacteria 5723
450 Ga0207663_10134602 3300025916 Bacteria 1713
451 Ga0207663_10187840 3300025916 Bacteria 1481
452 Ga0207663_10320849 3300025916 Bacteria 1164
453 Ga0207663_10365426 3300025916 Bacteria 1096
454 Ga0207663_10487650 3300025916 Bacteria 956
455 Ga0207660_10000081 3300025917 Bacteria 50936
456 Ga0207660_10000597 3300025917 Bacteria 24328
457 Ga0207662_10269853 3300025918 Bacteria 1122
458 Ga0207657_10000129 3300025919 Bacteria 75856
459 Ga0207657_10029697 3300025919 Bacteria 4972
460 Ga0207657_10063239 3300025919 Bacteria 3165
461 Ga0207649_10000029 3300025920 Bacteria 156557
462 Ga0207649_10002212 3300025920 Bacteria 10988
463 Ga0207649_10191186 3300025920 Bacteria 1440
464 Ga0207652_10000413 3300025921 Bacteria 44358
465 Ga0207652_10001120 3300025921 Bacteria 24155
466 Ga0207652_10040972 3300025921 Bacteria 3935
467 Ga0207652_10322291 3300025921 Bacteria 1395
468 Ga0207681_10250457 3300025923 Bacteria 1383
469 Ga0207694_10000044 3300025924 Bacteria 169595
470 Ga0207694_10007860 3300025924 Bacteria 8073
471 Ga0207694_10010063 3300025924 Bacteria 7127
472 Ga0207694_10139800 3300025924 Bacteria 1947
473 Ga0207694_10147588 3300025924 Bacteria 1894
474 Ga0207694_10358826 3300025924 Bacteria 1207
475 Ga0207650_10075462 3300025925 Bacteria 2544
476 Ga0207659_10211292 3300025926 Bacteria 1555
477 Ga0207687_10040805 3300025927 Bacteria 3183
478 Ga0207687_10201009 3300025927 Bacteria 1557
479 Ga0207700_10000005 3300025928 Bacteria 394836
480 Ga0207664_10014667 3300025929 Bacteria 5668
481 Ga0207664_10028363 3300025929 Bacteria 4254
482 Ga0207690_10019088 3300025932 Bacteria 4213
483 Ga0207706_10087732 3300025933 Bacteria 2736
484 Ga0207686_10027757 3300025934 Bacteria 3318
485 Ga0207686_10076356 3300025934 Bacteria 2172
486 Ga0207686_10106587 3300025934 Bacteria 1882
487 Ga0207686_10109017 3300025934 Bacteria 1864
488 Ga0207686_10134106 3300025934 Bacteria 1702
489 Ga0207709_10000047 3300025935 Bacteria 238649
490 Ga0207709_10006691 3300025935 Bacteria 6461
491 Ga0207709_10085278 3300025935 Bacteria 2047
492 Ga0207669_10000361 3300025937 Bacteria 20623
493 Ga0207669_10002871 3300025937 Bacteria 7390
494 Ga0207704_10252729 3300025938 Bacteria 1324
495 Ga0207704_10602279 3300025938 Bacteria 900
496 Ga0207665_10257339 3300025939 Bacteria 1292
497 Ga0207691_10089139 3300025940 Bacteria 2766
498 Ga0207711_10000001 3300025941 Bacteria 1325674
499 Ga0207711_10066517 3300025941 Bacteria 3117
500 Ga0207711_10359853 3300025941 Bacteria 1348
501 Ga0207689_10002603 3300025942 Bacteria 16690
502 Ga0207689_10140017 3300025942 Bacteria 1993
503 Ga0207661_10767387 3300025944 Bacteria 888
504 Ga0207679_10519475 3300025945 Bacteria 1065
505 Ga0207667_10000001 3300025949 Bacteria 1178522
506 Ga0207667_10000012 3300025949 Bacteria 445492
507 Ga0207667_10011654 3300025949 Bacteria 10203
508 Ga0207667_10050944 3300025949 Bacteria 4366
509 Ga0207667_10062277 3300025949 Bacteria 3901
510 Ga0207667_10370050 3300025949 Bacteria 1460
511 Ga0207667_10465960 3300025949 Bacteria 1283
512 Ga0207712_10020572 3300025961 Bacteria 4324
513 Ga0207668_10314034 3300025972 Bacteria 1298
514 Ga0207640_10001051 3300025981 Bacteria 15254
515 Ga0207640_10066239 3300025981 Bacteria 2413
516 Ga0207640_10068650 3300025981 Bacteria 2377
517 Ga0207658_10015385 3300025986 Bacteria 5249
518 Ga0207658_10042984 3300025986 Bacteria 3282
519 Ga0207658_10096946 3300025986 Bacteria 2301
520 Ga0207658_10996918 3300025986 Bacteria 764
521 Ga0207677_10057690 3300026023 Bacteria 2668
522 Ga0207677_10108335 3300026023 Bacteria 2063
523 Ga0207677_10582686 3300026023 Bacteria 979
524 Ga0207703_10009981 3300026035 Bacteria 7448
525 Ga0207703_10160826 3300026035 Bacteria 1967
526 Ga0207703_10729714 3300026035 Bacteria 943
527 Ga0207639_10003115 3300026041 Bacteria 11152
528 Ga0207639_10020962 3300026041 Bacteria 4688
529 Ga0207639_10062536 3300026041 Bacteria 2879
530 Ga0207639_10255781 3300026041 Bacteria 1529
531 Ga0207678_10228681 3300026067 Bacteria 1592
532 Ga0207702_10000055 3300026078 Bacteria 136325
533 Ga0207702_10004975 3300026078 Bacteria 11677
534 Ga0207702_10052450 3300026078 Bacteria 3451
535 Ga0207702_10365173 3300026078 Bacteria 1384
536 Ga0207641_10024349 3300026088 Bacteria 4989
537 Ga0207641_10124096 3300026088 Bacteria 2309
538 Ga0207641_10179019 3300026088 Bacteria 1941
539 Ga0207648_10060368 3300026089 Bacteria 3307
540 Ga0207676_10562852 3300026095 Bacteria 1090
541 Ga0207674_10000004 3300026116 Bacteria 241430
542 Ga0207674_10089492 3300026116 Bacteria 3071
543 Ga0207674_10100136 3300026116 Bacteria 2879
544 Ga0207674_10110585 3300026116 Bacteria 2723
545 Ga0207675_100119035 3300026118 Bacteria 2498
546 Ga0207675_100181377 3300026118 Bacteria 2016
547 Ga0207683_10001314 3300026121 Bacteria 22455
548 Ga0207683_10002290 3300026121 Bacteria 16792
549 Ga0207683_10048501 3300026121 Bacteria 3719
550 Ga0207683_10226751 3300026121 Bacteria 1703
551 Ga0207683_11029538 3300026121 Bacteria 764
552 Ga0207698_10005731 3300026142 Bacteria 7702
553 Ga0207698_10011571 3300026142 Bacteria 5728
554 Ga0207698_10014957 3300026142 Bacteria 5179
555 Ga0207698_10025036 3300026142 Bacteria 4197
556 Ga0209281_1000164 3300027111 Bacteria 157372
557 Ga0209281_1000377 3300027111 Bacteria 71243
558 Ga0209371_1014508 3300027312 Bacteria 2157
559 Ga0209282_1000007 3300027666 Bacteria 254917
560 Ga0268266_10000930 3300028379 Bacteria 37406
561 Ga0268266_10017542 3300028379 Bacteria 6107
562 Ga0268266_10390124 3300028379 Bacteria 1315
563 Ga0268265_10302973 3300028380 Bacteria 1440
564 Ga0268265_10338674 3300028380 Bacteria 1369
565 Ga0268265_10574150 3300028380 Bacteria 1074
566 Ga0268264_10155553 3300028381 Bacteria 2054
567 Ga0268264_10165699 3300028381 Bacteria 1995
568 Ga0268264_10227463 3300028381 Bacteria 1720
569 Ga0268264_10511331 3300028381 Bacteria 1173
570 Ga0265337_1001060 3300028556 Bacteria 14179
571 Ga0265334_10014042 3300028573 Bacteria 3344
572 Ga0265334_10022394 3300028573 Bacteria 2575
573 Ga0265318_10000017 3300028577 Bacteria 174748
574 Ga0265318_10001236 3300028577 Bacteria 15530
575 Ga0307515_10002710 3300028794 Bacteria 37898
576 Ga0307515_10004674 3300028794 Bacteria 28096
577 Ga0265338_10000006 3300028800 Bacteria 570804
578 Ga0265338_10005866 3300028800 Bacteria 15841
579 Ga0265338_10024220 3300028800 Bacteria 6209
580 Ga0265338_10030101 3300028800 Bacteria 5360
581 Ga0265338_10127248 3300028800 Bacteria 2019
582 Ga0268256_1015067 3300030500 Bacteria 2271
583 Ga0265330_10009666 3300031235 Bacteria 4572
584 Ga0265330_10011955 3300031235 Bacteria 4063
585 Ga0265330_10050437 3300031235 Bacteria 1825
586 Ga0265330_10079778 3300031235 Bacteria 1411
587 Ga0265332_10011135 3300031238 Bacteria 3997
588 Ga0265332_10027800 3300031238 Bacteria 2477
589 Ga0265328_10026733 3300031239 Bacteria 2168
590 Ga0265320_10004010 3300031240 Bacteria 9689
591 Ga0265320_10035158 3300031240 Bacteria 2542
592 Ga0265320_10035866 3300031240 Bacteria 2511
593 Ga0265325_10000003 3300031241 Bacteria 370490
594 Ga0265325_10005675 3300031241 Bacteria 7673
595 Ga0265325_10016931 3300031241 Bacteria 4063
596 Ga0265325_10031233 3300031241 Bacteria 2852
597 Ga0265325_10106147 3300031241 Bacteria 1370
598 Ga0265340_10000034 3300031247 Bacteria 65594
599 Ga0265340_10005311 3300031247 Bacteria 7154
600 Ga0265340_10015433 3300031247 Bacteria 3968
601 Ga0265340_10016049 3300031247 Bacteria 3882
602 Ga0265340_10017168 3300031247 Bacteria 3743
603 Ga0265340_10021397 3300031247 Bacteria 3317
604 Ga0265340_10123992 3300031247 Bacteria 1187
605 Ga0265339_10002825 3300031249 Bacteria 12323
606 Ga0265339_10027818 3300031249 Bacteria 3221
607 Ga0265339_10033057 3300031249 Bacteria 2915
608 Ga0265339_10166455 3300031249 Bacteria 1106
609 Ga0265331_10000006 3300031250 Bacteria 418907
610 Ga0265331_10001232 3300031250 Bacteria 19232
611 Ga0265331_10002603 3300031250 Bacteria 12132
612 Ga0265331_10046236 3300031250 Bacteria 2098
613 Ga0265331_10060087 3300031250 Bacteria 1796
614 Ga0265331_10094698 3300031250 Bacteria 1378
615 Ga0265327_10000808 3300031251 Bacteria 47626
616 Ga0265316_10003849 3300031344 Bacteria 15053
617 Ga0265316_10004511 3300031344 Bacteria 13833
618 Ga0265316_10102429 3300031344 Bacteria 2175
619 Ga0307513_10248145 3300031456 Bacteria 1579
620 Ga0307513_10268414 3300031456 Bacteria 1491
621 Ga0307513_10333325 3300031456 Bacteria 1271
622 Ga0307408_100082301 3300031548 Bacteria 2409
623 Ga0307408_100174691 3300031548 Bacteria 1718
624 Ga0265313_10001127 3300031595 Bacteria 25532
625 Ga0265313_10002103 3300031595 Bacteria 17759
626 Ga0265313_10003670 3300031595 Bacteria 12265
627 Ga0265313_10006358 3300031595 Bacteria 8403
628 Ga0265313_10020505 3300031595 Bacteria 3645
629 Ga0265313_10021178 3300031595 Bacteria 3561
630 Ga0265313_10029615 3300031595 Bacteria 2830
631 Ga0265313_10041199 3300031595 Bacteria 2277
632 Ga0265313_10068206 3300031595 Bacteria 1644
633 Ga0265313_10225566 3300031595 Bacteria 771
634 Ga0316575_10121046 3300031665 Bacteria 1071
635 Ga0316579_10111102 3300031691 Bacteria 1316
636 Ga0265314_10005985 3300031711 Bacteria 10848
637 Ga0265314_10006055 3300031711 Bacteria 10757
638 Ga0265314_10017444 3300031711 Bacteria 5635
639 Ga0265314_10018730 3300031711 Bacteria 5385
640 Ga0265314_10026379 3300031711 Bacteria 4366
641 Ga0265314_10068284 3300031711 Bacteria 2390
642 Ga0265314_10072842 3300031711 Bacteria 2293
643 Ga0265314_10076877 3300031711 Bacteria 2216
644 Ga0265314_10102220 3300031711 Bacteria 1840
645 Ga0265342_10008913 3300031712 Bacteria 7132
646 Ga0265342_10038038 3300031712 Bacteria 2932
647 Ga0265342_10043586 3300031712 Bacteria 2707
648 Ga0265342_10054586 3300031712 Bacteria 2373
649 Ga0265342_10074115 3300031712 Bacteria 1978
650 Ga0307516_10010120 3300031730 Bacteria 10419
651 Ga0307516_10037175 3300031730 Bacteria 4869
652 Ga0307516_10260199 3300031730 Bacteria 1426
653 Ga0307405_10008210 3300031731 Bacteria 5279
654 Ga0307406_10008794 3300031901 Bacteria 5646
655 Ga0307412_10000890 3300031911 Bacteria 17185
656 Ga0307412_10190210 3300031911 Bacteria 1551
657 Ga0307412_10406726 3300031911 Bacteria 1110
658 Ga0315914_1000006 3300031967 Bacteria 239817
659 Ga0307415_100474320 3300032126 Bacteria 1088
660 Ga0316583_10040575 3300032133 Bacteria 1648
661 Ga0307510_10197499 3300033180 Bacteria 1551
662 Ga0315913_1000002 3300033430 Bacteria 241452
663 Ga0315915_1000001 3300033464 Bacteria 481518
664 Ga0373932_0080639 3300035112 Bacteria 1027
665 Ga0373954_0223526 3300035118 Bacteria 926
666 Ga0373957_0127707 3300035120 Bacteria 1033
667 Ga0373924_0028183 3300035410 Bacteria 2237
668 Ga0373931_0004426 3300035691 Bacteria 6419
669 Ga0373933_0007071 3300035724 Bacteria 6113
670 Ga0373937_0006384 3300036401 Bacteria 10174
671 Ga0373937_0027165 3300036401 Bacteria 5173
672 Ga0373937_0071180 3300036401 Bacteria 3207
673 Ga0373937_0096417 3300036401 Bacteria 2743
674 Ga0373937_0400258 3300036401 Bacteria 1303
675 Ga0316582_0113749 3300036647 Bacteria 1804
676 Ga0316582_0160070 3300036647 Bacteria 1525
677 Ga0316584_0410610 3300036712 Bacteria 963
678 Ga0373925_0036387 3300037068 Bacteria 3633
679 Ga0373925_0262366 3300037068 Bacteria 1388
680 Ga0395899_0121668 3300037312 Bacteria 1869
681 Ga0395899_0156211 3300037312 Bacteria 1614
682 Ga0395899_0185078 3300037312 Bacteria 1460
683 Ga0395900_0006457 3300037418 Bacteria 12221
684 Ga0395900_0081620 3300037418 Bacteria 3322
685 Ga0395900_0088630 3300037418 Bacteria 3181
686 Ga0395898_0050299 3300037466 Bacteria 4080
687 Ga0395905_0002327 3300037471 Bacteria 21222
688 Ga0395905_0031592 3300037471 Bacteria 4984
689 Ga0395901_0081030 3300038443 Bacteria 3390
690 Ga0395901_0085316 3300038443 Bacteria 3301
691 Ga0395901_0244720 3300038443 Bacteria 1870
692 Ga0395901_0470095 3300038443 Bacteria 1284
693 Ga0400483_016484 3300039062 Bacteria 10111
694 Ga0400483_289717 3300039062 Bacteria 10717
695 Ga0436365_0142070 3300039437 Bacteria 3157
696 Ga0436365_0605749 3300039437 Bacteria 1033
697 Ga0436365_0817918 3300039437 Bacteria 8092
698 Ga0436365_1329101 3300039437 Bacteria 8072
699 Ga0436360_0879069 3300039438 Bacteria 2512
700 Ga0436361_0316796 3300039447 Bacteria 2721
701 Ga0436363_1603152 3300039450 Bacteria 7812
702 Ga0436362_0060280 3300039453 Bacteria 7293
703 Ga0436362_0870149 3300039453 Bacteria 1600
704 Ga0439465_0015180 3300041413 Bacteria 2403
705 Ga0451793_1440556 3300041452 Bacteria 1460
706 Ga0451798_0107945 3300041458 Bacteria 1036
707 Ga0451833_1133924 3300041491 Bacteria 1295
708 Ga0451837_1280992 3300041494 Bacteria 1787
709 Ga0451839_1184329 3300041496 Bacteria 1089
710 Ga0451840_02168 3300041497 Bacteria 1499
711 Ga0451845_0021827 3300041501 Bacteria 1169
712 Ga0451850_35509 3300041506 Bacteria 1520
713 Ga0451851_0808634 3300041507 Bacteria 1567
714 Ga0451853_3113601 3300041512 Bacteria 2561
715 Ga0452271_33868 3300041916 Bacteria 1714
716 Ga0439449_0028934 3300042007 Bacteria 2065
717 Ga0439449_0083622 3300042007 Bacteria 1177
718 Ga0439451_007817 3300042009 Bacteria 2172
719 Ga0439462_0030871 3300042015 Bacteria 1418
720 Ga0450906_003427 3300042145 Bacteria 3412
721 Ga0450918_010433 3300042531 Bacteria 1622
722 Ga0466963_0114634 3300044694 Bacteria 1852
723 Ga0466957_0026460 3300044842 Bacteria 3442
724 Ga0451576_0027253 3300045051 Bacteria 6139
725 Ga0495592_0149599 3300046454 Bacteria 1616
726 Ga0495629_0048637 3300046459 Bacteria 2973
727 Ga0495629_0330228 3300046459 Bacteria 1042
728 Ga0495638_0067952 3300046460 Bacteria 2187
729 Ga0495650_0000644 3300046471 Bacteria 46276
730 Ga0495580_0006620 3300046472 Bacteria 9414
731 Ga0495580_0050627 3300046472 Bacteria 2937
732 Ga0495582_0017413 3300046473 Bacteria 3932
733 Ga0495582_0061724 3300046473 Bacteria 2070
734 Ga0495664_0242269 3300046477 Bacteria 1091
735 Ga0495584_0162093 3300046491 Bacteria 1136
736 Ga0495585_0011394 3300046492 Bacteria 5263
737 Ga0495596_0037661 3300046500 Bacteria 1912
738 Ga0495596_0049562 3300046500 Bacteria 1646
739 Ga0495607_0108792 3300046501 Bacteria 1472
740 Ga0495583_0002390 3300046506 Bacteria 16164
741 Ga0495583_0008443 3300046506 Bacteria 6292
742 Ga0495583_0011239 3300046506 Bacteria 5153
743 Ga0495583_0030249 3300046506 Bacteria 2640
744 Ga0495606_0003115 3300046507 Bacteria 18007
745 Ga0495606_0094062 3300046507 Bacteria 1837
746 Ga0495610_0020171 3300046512 Bacteria 3707
747 Ga0495616_0131817 3300046513 Bacteria 1145
748 Ga0495620_0026506 3300046515 Bacteria 2725
749 Ga0495628_0361359 3300046516 Bacteria 1066
750 Ga0495631_0075521 3300046518 Bacteria 1454
751 Ga0495632_0001060 3300046519 Bacteria 23600
752 Ga0495637_0160131 3300046520 Bacteria 845
753 Ga0495643_0001349 3300046522 Bacteria 23106
754 Ga0495643_0001424 3300046522 Bacteria 22149
755 Ga0495643_0021448 3300046522 Bacteria 3706
756 Ga0495643_0024185 3300046522 Bacteria 3447
757 Ga0495648_0000122 3300046524 Bacteria 93823
758 Ga0495663_0005658 3300046525 Bacteria 3460
759 Ga0495663_0071992 3300046525 Bacteria 1102
760 Ga0495642_0008427 3300046528 Bacteria 3946
761 Ga0495642_0104967 3300046528 Bacteria 1205
762 Ga0495652_0113615 3300046529 Bacteria 2174
763 Ga0495652_0529904 3300046529 Bacteria 813
764 Ga0495654_0190001 3300046530 Bacteria 885
765 Ga0495609_0019743 3300046538 Bacteria 3116
766 Ga0495645_0039649 3300046543 Bacteria 3435
767 Ga0495622_0001189 3300046557 Bacteria 13441
768 Ga0495633_0005483 3300046558 Bacteria 7727
769 Ga0495633_0043700 3300046558 Bacteria 2125
770 Ga0495633_0089964 3300046558 Bacteria 1427
771 Ga0495668_0000377 3300046616 Bacteria 59127
772 Ga0495668_0002121 3300046616 Bacteria 17116
773 Ga0495668_0038640 3300046616 Bacteria 2666
774 Ga0495611_0015937 3300046648 Bacteria 3212
775 Ga0495611_0036306 3300046648 Bacteria 2186
776 Ga0495625_0001416 3300046660 Bacteria 29318
777 Ga0495625_0008470 3300046660 Bacteria 8776
778 Ga0495625_0013176 3300046660 Bacteria 6660
779 Ga0495625_0032622 3300046660 Bacteria 3859
780 Ga0495625_0040459 3300046660 Bacteria 3399
781 Ga0495625_0096310 3300046660 Bacteria 2039
782 Ga0495661_0078481 3300046665 Bacteria 1910
783 Ga0495588_0048496 3300046674 Bacteria 2182
784 Ga0495657_0086551 3300046675 Bacteria 2018
785 Ga0495658_0002459 3300046683 Bacteria 9327
786 Ga0495669_0000773 3300046684 Bacteria 13683
787 Ga0495670_0018044 3300046691 Bacteria 3476
788 Ga0495670_0092919 3300046691 Bacteria 1546
789 Ga0495600_0004633 3300046809 Bacteria 8241
790 Ga0495600_0177057 3300046809 Bacteria 1375
791 Ga0495660_0024138 3300046810 Bacteria 3464
792 Ga0495581_0038894 3300047315 Bacteria 2754
793 Ga0495674_0366898 3300047319 Bacteria 1167
794 Ga0495683_0008061 3300047323 Bacteria 5653
795 Ga0495687_000392 3300047443 Bacteria 54348
796 Ga0495687_005666 3300047443 Bacteria 7886
797 Ga0495687_041977 3300047443 Bacteria 2003
798 Ga0495675_0161026 3300047444 Bacteria 1382
799 Ga0495681_0133831 3300047470 Bacteria 1053
800 Ga0496101_0393033 3300048904 Bacteria 1092
801 Ga0496102_0277264 3300048905 Bacteria 1580
802 Ga0496103_0000165 3300048906 Bacteria 69702
803 Ga0496103_0021567 3300048906 Bacteria 3876
804 Ga0496105_0000467 3300048908 Bacteria 26582
805 Ga0496109_0053887 3300048912 Bacteria 3670
806 Ga0496109_0139312 3300048912 Bacteria 2268
807 Ga0496110_0062535 3300048913 Bacteria 3288
808 Ga0496111_0124262 3300048914 Bacteria 1907
809 Ga0496113_0010427 3300048916 Bacteria 6145
810 Ga0496113_0802189 3300048916 Bacteria 748
811 Ga0496114_0007452 3300048917 Bacteria 8652
812 Ga0496115_0000202 3300048918 Bacteria 55680
813 Ga0496115_0110634 3300048918 Bacteria 2257
814 Ga0496115_0285674 3300048918 Bacteria 1354
815 Ga0496116_0002518 3300048919 Bacteria 19170
816 Ga0496116_0011379 3300048919 Bacteria 7374
817 Ga0496117_0000337 3300048920 Bacteria 82874
818 Ga0496117_0000616 3300048920 Bacteria 57666
819 Ga0496117_0294232 3300048920 Bacteria 863
820 Ga0496118_0000396 3300048921 Bacteria 73830
821 Ga0496118_0000425 3300048921 Bacteria 70035
822 Ga0496119_0006225 3300048922 Bacteria 11145
823 Ga0496119_0061593 3300048922 Bacteria 2239
824 Ga0496121_0000796 3300048924 Bacteria 57621
825 Ga0496121_0001010 3300048924 Bacteria 50285
826 Ga0496121_0002450 3300048924 Bacteria 28361
827 Ga0496121_0026660 3300048924 Bacteria 5434
828 Ga0496121_0070712 3300048924 Bacteria 2809
829 Ga0496122_0000009 3300048925 Bacteria 584024
830 Ga0496122_0003726 3300048925 Bacteria 19675
831 Ga0496122_0005649 3300048925 Bacteria 14764
832 Ga0496122_0100553 3300048925 Bacteria 1934
833 Ga0496123_0000245 3300048926 Bacteria 109471
834 Ga0496123_0007453 3300048926 Bacteria 10298
835 Ga0496123_0117447 3300048926 Bacteria 1504
836 Ga0496124_0000468 3300048927 Bacteria 69747
837 Ga0496124_0011797 3300048927 Bacteria 8709
838 Ga0496124_0040261 3300048927 Bacteria 4044
839 Ga0496124_0055241 3300048927 Bacteria 3357
840 Ga0496124_0113923 3300048927 Bacteria 2172
841 Ga0496125_0000704 3300048928 Bacteria 55382
842 Ga0496125_0001996 3300048928 Bacteria 27672
843 Ga0496125_0007816 3300048928 Bacteria 11305
844 Ga0496126_0000563 3300048929 Bacteria 71182
845 Ga0496126_0001787 3300048929 Bacteria 31720
846 Ga0496126_0013802 3300048929 Bacteria 8191
847 Ga0496126_0120287 3300048929 Bacteria 2278
848 Ga0496126_0197395 3300048929 Bacteria 1701
849 Ga0495682_0002267 3300049460 Bacteria 9231
850 Ga0501031_0001004 3300049568 Bacteria 17105
851 Ga0501031_0090259 3300049568 Bacteria 1998
852 Ga0501031_0247473 3300049568 Bacteria 1159
853 Ga0501031_0369430 3300049568 Bacteria 928
854 Ga0501032_0006719 3300049569 Bacteria 8444
855 Ga0501032_0282253 3300049569 Bacteria 1075
856 Ga0501033_0007260 3300049570 Bacteria 8644
857 Ga0501033_0036043 3300049570 Bacteria 3707
858 Ga0501033_0038110 3300049570 Bacteria 3596
859 Ga0501033_0058328 3300049570 Bacteria 2851
860 Ga0501033_0078329 3300049570 Bacteria 2425
861 Ga0501033_0087270 3300049570 Bacteria 2283
862 Ga0501033_0193801 3300049570 Bacteria 1453
863 Ga0501033_0195259 3300049570 Bacteria 1447
864 Ga0501033_0224584 3300049570 Bacteria 1336
865 Ga0501034_0003097 3300049571 Bacteria 19167
866 Ga0501034_0007556 3300049571 Bacteria 11565
867 Ga0501034_0011474 3300049571 Bacteria 9183
868 Ga0501034_0025228 3300049571 Bacteria 6050
869 Ga0501034_0040458 3300049571 Bacteria 4719
870 Ga0501034_0043919 3300049571 Bacteria 4520
871 Ga0501034_0051684 3300049571 Bacteria 4143
872 Ga0501034_0056225 3300049571 Bacteria 3960
873 Ga0501034_0079282 3300049571 Bacteria 3288
874 Ga0501034_0106710 3300049571 Bacteria 2794
875 Ga0501034_0164534 3300049571 Bacteria 2187
876 Ga0501034_0234799 3300049571 Bacteria 1782
877 Ga0501034_0255974 3300049571 Bacteria 1694
878 Ga0501034_0432178 3300049571 Bacteria 1236
879 Ga0501036_0021174 3300049572 Bacteria 5461
880 Ga0501036_0048788 3300049572 Bacteria 3584
881 Ga0501036_0083022 3300049572 Bacteria 2708
882 Ga0501036_0089967 3300049572 Bacteria 2593
883 Ga0501037_0012313 3300049573 Bacteria 6295
884 Ga0501037_0033875 3300049573 Bacteria 3771
885 Ga0501037_0070110 3300049573 Bacteria 2551
886 Ga0501037_0084935 3300049573 Bacteria 2292
887 Ga0501037_0098678 3300049573 Bacteria 2110
888 Ga0501037_0164128 3300049573 Bacteria 1582
889 Ga0501037_0471594 3300049573 Bacteria 854
890 Ga0501038_0011034 3300049574 Bacteria 8248
891 Ga0501038_0017603 3300049574 Bacteria 6457
892 Ga0501038_0022976 3300049574 Bacteria 5582
893 Ga0501038_0056632 3300049574 Bacteria 3366
894 Ga0501038_0172537 3300049574 Bacteria 1749
895 Ga0501039_0001645 3300049575 Bacteria 16475
896 Ga0501039_0065001 3300049575 Bacteria 2829
897 Ga0501039_0133607 3300049575 Bacteria 1948
898 Ga0501039_0224841 3300049575 Bacteria 1475
899 Ga0501039_0338994 3300049575 Bacteria 1181
900 Ga0501040_0024436 3300049576 Bacteria 4056
901 Ga0501041_0018238 3300049577 Bacteria 4180
902 Ga0501042_0138432 3300049578 Bacteria 1755
903 Ga0501042_0190463 3300049578 Bacteria 1479
904 Ga0501043_0014535 3300049579 Bacteria 6163
905 Ga0501043_0038989 3300049579 Bacteria 3734
906 Ga0501043_0081640 3300049579 Bacteria 2540
907 Ga0501043_0123343 3300049579 Bacteria 2032
908 Ga0501043_0188567 3300049579 Bacteria 1604
909 Ga0501046_0008000 3300049580 Bacteria 9244
910 Ga0501046_0059508 3300049580 Bacteria 2992
911 Ga0501046_0074500 3300049580 Bacteria 2633
912 Ga0501046_0083008 3300049580 Bacteria 2474
913 Ga0501046_0110827 3300049580 Bacteria 2096
914 Ga0501046_0125819 3300049580 Bacteria 1947
915 Ga0501046_0147624 3300049580 Bacteria 1775
916 Ga0501046_0196199 3300049580 Bacteria 1504
917 Ga0501047_0001553 3300049581 Bacteria 22470
918 Ga0501047_0004801 3300049581 Bacteria 12721
919 Ga0501047_0006325 3300049581 Bacteria 11140
920 Ga0501047_0007771 3300049581 Bacteria 10098
921 Ga0501047_0010400 3300049581 Bacteria 8805
922 Ga0501047_0014769 3300049581 Bacteria 7432
923 Ga0501047_0038567 3300049581 Bacteria 4622
924 Ga0501047_0040985 3300049581 Bacteria 4476
925 Ga0501047_0070746 3300049581 Bacteria 3359
926 Ga0501047_0080832 3300049581 Bacteria 3124
927 Ga0501047_0081339 3300049581 Bacteria 3114
928 Ga0501047_0095776 3300049581 Bacteria 2847
929 Ga0501047_0118076 3300049581 Bacteria 2534
930 Ga0501047_0146204 3300049581 Bacteria 2241
931 Ga0501047_0158309 3300049581 Bacteria 2137
932 Ga0501047_0168298 3300049581 Bacteria 2061
933 Ga0501047_0222714 3300049581 Bacteria 1742
934 Ga0501047_0243564 3300049581 Bacteria 1648
935 Ga0501047_0259535 3300049581 Bacteria 1585
936 Ga0501047_0348346 3300049581 Bacteria 1318
937 Ga0501047_0359305 3300049581 Bacteria 1292
938 Ga0501047_0400812 3300049581 Bacteria 1205
939 Ga0501048_0000472 3300049582 Bacteria 28173
940 Ga0501048_0128827 3300049582 Bacteria 1789
941 Ga0501048_0138435 3300049582 Bacteria 1721
942 Ga0501048_0449758 3300049582 Bacteria 922
943 Ga0501067_0000670 3300049583 Bacteria 18436
944 Ga0501067_0014029 3300049583 Bacteria 4438
945 Ga0501067_0024138 3300049583 Bacteria 3371
946 Ga0501067_0029877 3300049583 Bacteria 3021
947 Ga0501067_0071790 3300049583 Bacteria 1917
948 Ga0501067_0244660 3300049583 Bacteria 998
949 Ga0501068_0002277 3300049584 Bacteria 10225
950 Ga0501068_0005529 3300049584 Bacteria 6923
951 Ga0501068_0027170 3300049584 Bacteria 3377
952 Ga0501069_0009734 3300049585 Bacteria 5077
953 Ga0501069_0063092 3300049585 Bacteria 2069
954 Ga0501070_0000110 3300049586 Bacteria 72071
955 Ga0501070_0026046 3300049586 Bacteria 4907
956 Ga0501070_0031086 3300049586 Bacteria 4472
957 Ga0501070_0221657 3300049586 Bacteria 1551
958 Ga0501070_0344607 3300049586 Bacteria 1210
959 Ga0501070_0380798 3300049586 Bacteria 1143
960 Ga0501071_0154640 3300049587 Bacteria 1712
961 Ga0501072_0032281 3300049588 Bacteria 4101
962 Ga0501072_0037555 3300049588 Bacteria 3799
963 Ga0501072_0038176 3300049588 Bacteria 3769
964 Ga0501072_0064402 3300049588 Bacteria 2891
965 Ga0501073_0017929 3300049589 Bacteria 5121
966 Ga0501073_0035965 3300049589 Bacteria 3519
967 Ga0501073_0039911 3300049589 Bacteria 3324
968 Ga0501073_0052570 3300049589 Bacteria 2852
969 Ga0501073_0122980 3300049589 Bacteria 1798
970 Ga0501073_0165071 3300049589 Bacteria 1534
971 Ga0501073_0174266 3300049589 Bacteria 1489
972 Ga0501073_0246483 3300049589 Bacteria 1233
973 Ga0501073_0254286 3300049589 Bacteria 1213
974 Ga0501073_0327609 3300049589 Bacteria 1057
975 Ga0501074_0011675 3300049590 Bacteria 6383
976 Ga0501074_0032456 3300049590 Bacteria 3783
977 Ga0501074_0083783 3300049590 Bacteria 2286
978 Ga0501074_0195088 3300049590 Bacteria 1443
979 Ga0501075_0060975 3300049591 Bacteria 2841
980 Ga0501076_0004128 3300049592 Bacteria 10268
981 Ga0501077_0014578 3300049593 Bacteria 4942
982 Ga0501077_0063681 3300049593 Bacteria 2339
983 Ga0501077_0139432 3300049593 Bacteria 1538
984 Ga0501079_0002380 3300049741 Bacteria 13648
985 Ga0501079_0005104 3300049741 Bacteria 9749
986 Ga0501079_0032431 3300049741 Bacteria 4016
987 Ga0501079_0147634 3300049741 Bacteria 1833
988 Ga0501079_0323647 3300049741 Bacteria 1207
989 Ga0501080_0002037 3300049742 Bacteria 17480
990 Ga0501080_0005758 3300049742 Bacteria 11085
991 Ga0501080_0033607 3300049742 Bacteria 4787
992 Ga0501080_0035760 3300049742 Bacteria 4636
993 Ga0501080_0056611 3300049742 Bacteria 3650
994 Ga0501080_0063381 3300049742 Bacteria 3440
995 Ga0501080_0105651 3300049742 Bacteria 2611
996 Ga0501080_0131735 3300049742 Bacteria 2315
997 Ga0501080_0141800 3300049742 Bacteria 2221
998 Ga0501080_0154648 3300049742 Bacteria 2119
999 Ga0501080_0230141 3300049742 Bacteria 1694
1000 Ga0501080_0431164 3300049742 Bacteria 1183
1001 Ga0501081_0037644 3300049743 Bacteria 3301
1002 Ga0501083_0006881 3300049744 Bacteria 8073
1003 Ga0501083_0012398 3300049744 Bacteria 5965
1004 Ga0501083_0014089 3300049744 Bacteria 5590
1005 Ga0501083_0024080 3300049744 Bacteria 4220
1006 Ga0501083_0049301 3300049744 Bacteria 2839
1007 Ga0501083_0095273 3300049744 Bacteria 1964
1008 Ga0501083_0100260 3300049744 Bacteria 1910
1009 Ga0501280_004260 3300049776 Bacteria 2114
1010 Ga0501035_0000879 3300049822 Bacteria 31853
1011 Ga0501035_0004670 3300049822 Bacteria 13000
1012 Ga0501035_0039706 3300049822 Bacteria 4258
1013 Ga0501035_0042979 3300049822 Bacteria 4073
1014 Ga0501035_0054857 3300049822 Bacteria 3559
1015 Ga0501035_0057766 3300049822 Bacteria 3459
1016 Ga0501035_0066142 3300049822 Bacteria 3208
1017 Ga0501035_0099534 3300049822 Bacteria 2552
1018 Ga0501035_0111615 3300049822 Bacteria 2396
1019 Ga0501035_0114585 3300049822 Bacteria 2360
1020 Ga0501035_0154005 3300049822 Bacteria 1993
1021 Ga0501035_0311576 3300049822 Bacteria 1324
1022 Ga0501044_0003131 3300049823 Bacteria 18737
1023 Ga0501044_0004520 3300049823 Bacteria 15559
1024 Ga0501044_0006575 3300049823 Bacteria 12828
1025 Ga0501044_0013067 3300049823 Bacteria 8985
1026 Ga0501044_0020172 3300049823 Bacteria 7114
1027 Ga0501044_0039017 3300049823 Bacteria 4957
1028 Ga0501044_0064414 3300049823 Bacteria 3742
1029 Ga0501044_0071284 3300049823 Bacteria 3533
1030 Ga0501044_0098850 3300049823 Bacteria 2937
1031 Ga0501044_0165279 3300049823 Bacteria 2187
1032 Ga0501044_0223796 3300049823 Bacteria 1831
1033 Ga0501044_0298807 3300049823 Bacteria 1539
1034 Ga0501044_0302658 3300049823 Bacteria 1527
1035 Ga0501044_0363319 3300049823 Bacteria 1365
1036 Ga0501044_0386727 3300049823 Bacteria 1313
1037 Ga0501044_0453188 3300049823 Bacteria 1189
1038 Ga0501045_0022366 3300049824 Bacteria 4527
1039 Ga0501045_0148923 3300049824 Bacteria 1741
1040 nmdc:mga03683_103920_c1 3300050489 Bacteria 1251
1041 nmdc:mga00v17_13819_c1 3300050491 Bacteria 4490
1042 nmdc:mga0k408_63022_c1 3300050493 Bacteria 2156
1043 nmdc:mga06z11_59422_c1 3300050494 Bacteria 1987
1044 nmdc:mga07m45_212239_c1 3300050496 Bacteria 1126
1045 nmdc:mga05p37_152544_c1 3300050507 Bacteria 2825
1046 nmdc:mga09592_687107_c1 3300050508 Bacteria 872
1047 nmdc:mga06r32_15122_c2 3300050510 Bacteria 3721
1048 nmdc:mga0n895_1692_c1 3300050512 Bacteria 16660
1049 nmdc:mga08x19_51_c1 3300050514 Bacteria 124093
1050 nmdc:mga0sz30_38904_c1 3300050516 Bacteria 1994
1051 Ga0500610_0000074 3300053079 Bacteria 30194
1052 Ga0500610_0066416 3300053079 Bacteria 1881
1053 Ga0500643_000006 3300053087 Bacteria 479605
1054 Ga0500646_0009128 3300053090 Bacteria 2539
1055 Ga0500650_0090740 3300053098 Bacteria 1430
1056 Ga0500555_018291 3300053103 Bacteria 2020
1057 Ga0500557_000411 3300053105 Bacteria 5605
1058 Ga0500569_023101 3300053109 Bacteria 1666
1059 Ga0500595_002621 3300053119 Bacteria 8758
1060 Ga0500595_003650 3300053119 Bacteria 7123
1061 Ga0500608_061413 3300053122 Bacteria 1796
1062 Ga0500618_021027 3300053125 Bacteria 1595
1063 Ga0500642_0140493 3300053130 Bacteria 1133
1064 Ga0500642_0241815 3300053130 Bacteria 831
1065 Ga0500655_021771 3300053133 Bacteria 1203
1066 Ga0500568_0001385 3300053139 Bacteria 15700
1067 Ga0500568_0020966 3300053139 Bacteria 2818
1068 Ga0500573_0000006 3300053140 Bacteria 285988
1069 Ga0500616_0000328 3300053153 Bacteria 68215
1070 Ga0500616_0062840 3300053153 Bacteria 1916
1071 Ga0500619_003933 3300053154 Bacteria 3124
1072 Ga0500627_0045604 3300053158 Bacteria 1898
1073 Ga0500639_023212 3300053163 Bacteria 3278
1074 Ga0500645_000034 3300053730 Bacteria 116363
1075 Ga0500596_002112 3300053735 Bacteria 3961
1076 Ga0501084_0000081 3300054114 Bacteria 70009
1077 Ga0501084_0002711 3300054114 Bacteria 14264
1078 Ga0501084_0010520 3300054114 Bacteria 7649
1079 Ga0501084_0048031 3300054114 Bacteria 3574
1080 Ga0501084_0187301 3300054114 Bacteria 1746
1081 Ga0501084_0208640 3300054114 Bacteria 1648
1082 Ga0501084_0431811 3300054114 Bacteria 1113
1083 Ga0501084_0495700 3300054114 Bacteria 1032
1084 Ga0587088_021284 3300059508 Bacteria 1084
1085 Ga0501082_0004451 3300060353 Bacteria 12234
1086 Ga0501082_0015012 3300060353 Bacteria 6674
1087 Ga0501082_0037576 3300060353 Bacteria 4174
1088 Ga0501082_0090410 3300060353 Bacteria 2643
1089 Ga0501082_0165419 3300060353 Bacteria 1922
1090 Ga0501082_0185409 3300060353 Bacteria 1810
1091 Ga0501082_0249184 3300060353 Bacteria 1546
1092 Ga0501082_0521709 3300060353 Bacteria 1038
1093 Ga0466962_0343528 3300061719 Bacteria 743
1094 Ga0530510_0183887 3300061734 Bacteria 1550

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041496 Ga0451839_1184329 Ga0451839_1184329_436_1062 208
2 iso_pu_bacteria 2775507049 2776912629 215
3 iso_pu_bacteria 2891048133 2891051972 216
4 3300025284 Ga0209130_1010324 Ga0209130_10103242 217
5 iso_pu_bacteria 8045864390 8045867712 217
6 iso_pu_bacteria 2894817345 2894819515 218
7 3300031901 Ga0307406_10008794 Ga0307406_100087943 219
8 3300049573 Ga0501037_0084935 Ga0501037_0084935_1548_2210 219
9 iso_pu_bacteria 2508501122 2509107444 219
10 iso_pu_bacteria 2509276019 2509374564 219
11 iso_pu_bacteria 2509276021 2509387848 219
12 iso_pu_bacteria 2509276033 2509443465 219
13 iso_pu_bacteria 2510065019 2510132169 219
14 iso_pu_bacteria 2510065057 2510304484 219
15 iso_pu_bacteria 2510461076 2510898505 219
16 iso_pu_bacteria 2510917022 2511133618 219
17 iso_pu_bacteria 2510917028 2511186501 219
18 iso_pu_bacteria 2510917030 2511196439 219
19 iso_pu_bacteria 2511231052 2511500899 219
20 iso_pu_bacteria 2512047086 2512532322 219
21 iso_pu_bacteria 2512875026 2512972349 219
22 iso_pu_bacteria 2513237084 2513569003 219
23 iso_pu_bacteria 2513237085 2513580031 219
24 iso_pu_bacteria 2513237086 2513583563 219
25 iso_pu_bacteria 2513237088 2513596124 219
26 iso_pu_bacteria 2513237089 2513603428 219
27 iso_pu_bacteria 2513237091 2513617511 219
28 iso_pu_bacteria 2513237093 2513635700 219
29 iso_pu_bacteria 2513237103 2513709335 219
30 iso_pu_bacteria 2513237138 2513865750 219
31 iso_pu_bacteria 2513237140 2513882776 219
32 iso_pu_bacteria 2513237143 2513905320 219
33 iso_pu_bacteria 2513237146 2513925581 219
34 iso_pu_bacteria 2513237156 2513985379 219
35 iso_pu_bacteria 2513237160 2514004883 219
36 iso_pu_bacteria 2513237162 2514023088 219
37 iso_pu_bacteria 2515075009 2515111150 219
38 iso_pu_bacteria 2515154107 2515608025 219
39 iso_pu_bacteria 2515154113 2515636061 219
40 iso_pu_bacteria 2515154114 2515642714 219
41 iso_pu_bacteria 2515154116 2515658771 219
42 iso_pu_bacteria 2515154134 2515743919 219
43 iso_pu_bacteria 2516143018 2516208779 219
44 iso_pu_bacteria 2516653046 2516892176 219
45 iso_pu_bacteria 2516653077 2517039796 219
46 iso_pu_bacteria 2516653085 2517075316 219
47 iso_pu_bacteria 2517287029 2517405738 219
48 iso_pu_bacteria 2517487022 2517568986 219
49 iso_pu_bacteria 2519899620 2520379842 219
50 iso_pu_bacteria 2524023207 2524450223 219
51 iso_pu_bacteria 2529292951 2530644038 219
52 iso_pu_bacteria 2534681796 2535515593 219
53 iso_pu_bacteria 2551306084 2551676359 219
54 iso_pu_bacteria 2551306085 2551687466 219
55 iso_pu_bacteria 2551306086 2551693397 219
56 iso_pu_bacteria 2551306087 2551702403 219
57 iso_pu_bacteria 2551306089 2551714772 219
58 iso_pu_bacteria 2551306090 2551719031 219
59 iso_pu_bacteria 2551306091 2551730350 219
60 iso_pu_bacteria 2551306092 2551733183 219
61 iso_pu_bacteria 2551306093 2551745408 219
62 iso_pu_bacteria 2558860100 2558863593 219
63 iso_pu_bacteria 2582581294 2585202957 219
64 iso_pu_bacteria 2582581298 2585225396 219
65 iso_pu_bacteria 2582581299 2585230535 219
66 iso_pu_bacteria 2582581304 2585256728 219
67 iso_pu_bacteria 2582581307 2585275770 219
68 iso_pu_bacteria 2582581308 2585278784 219
69 iso_pu_bacteria 2582581316 2585329757 219
70 iso_pu_bacteria 2582581867 2585400271 219
71 iso_pu_bacteria 2585427526 2585525508 219
72 iso_pu_bacteria 2585427527 2585535894 219
73 iso_pu_bacteria 2585427528 2585542643 219
74 iso_pu_bacteria 2585427529 2585548329 219
75 iso_pu_bacteria 2585427530 2585554023 219
76 iso_pu_bacteria 2585427531 2585559311 219
77 iso_pu_bacteria 2585427590 2585822995 219
78 iso_pu_bacteria 2585427593 2585838249 219
79 iso_pu_bacteria 2585427594 2585847330 219
80 iso_pu_bacteria 2585427608 2585901223 219
81 iso_pu_bacteria 2585427609 2585905313 219
82 iso_pu_bacteria 2585428125 2587979572 219
83 iso_pu_bacteria 2599185170 2599418720 219
84 iso_pu_bacteria 2599185352 2600191825 219
85 iso_pu_bacteria 2615840624 2616296776 219
86 iso_pu_bacteria 2615840626 2616305942 219
87 iso_pu_bacteria 2617270742 2617381940 219
88 iso_pu_bacteria 2643221557 2643807313 219
89 iso_pu_bacteria 2643221610 2644069725 219
90 iso_pu_bacteria 2643221618 2644109104 219
91 iso_pu_bacteria 2643221626 2644151624 219
92 iso_pu_bacteria 2643221634 2644191061 219
93 iso_pu_bacteria 2643221643 2644242768 219
94 iso_pu_bacteria 2643221655 2644311760 219
95 iso_pu_bacteria 2643221659 2644330031 219
96 iso_pu_bacteria 2643221668 2644380696 219
97 iso_pu_bacteria 2643221675 2644414601 219
98 iso_pu_bacteria 2643221680 2644448258 219
99 iso_pu_bacteria 2643221698 2644543215 219
100 iso_pu_bacteria 2643221712 2644617558 219
101 iso_pu_bacteria 2643221723 2644673658 219
102 iso_pu_bacteria 2643221726 2644689435 219
103 iso_pu_bacteria 2657244999 2657682212 219
104 iso_pu_bacteria 2667528174 2671112740 219
105 iso_pu_bacteria 2718217882 2719180130 219
106 iso_pu_bacteria 2718217927 2719384726 219
107 iso_pu_bacteria 2718217997 2719664487 219
108 iso_pu_bacteria 2718218009 2719730879 219
109 iso_pu_bacteria 2718218199 2720490907 219
110 iso_pu_bacteria 2718218232 2720612271 219
111 iso_pu_bacteria 2718218233 2720619109 219
112 iso_pu_bacteria 2718218235 2720630511 219
113 iso_pu_bacteria 2718218269 2720774204 219
114 iso_pu_bacteria 2718218363 2721146223 219
115 iso_pu_bacteria 2718218365 2721157744 219
116 iso_pu_bacteria 2718218366 2721163103 219
117 iso_pu_bacteria 2718218423 2721398437 219
118 iso_pu_bacteria 2721755514 2722839273 219
119 iso_pu_bacteria 2721755556 2723025929 219
120 iso_pu_bacteria 2721755684 2723559475 219
121 iso_pu_bacteria 2721755685 2723566092 219
122 iso_pu_bacteria 2721755809 2724037250 219
123 iso_pu_bacteria 2721755810 2724043635 219
124 iso_pu_bacteria 2721755819 2724088811 219
125 iso_pu_bacteria 2721755822 2724103357 219
126 iso_pu_bacteria 2721755823 2724109195 219
127 iso_pu_bacteria 2724679232 2725951102 219
128 iso_pu_bacteria 2728369352 2730106865 219
129 iso_pu_bacteria 2728369365 2730163367 219
130 iso_pu_bacteria 2728369397 2730297376 219
131 iso_pu_bacteria 2738541293 2738803620 219
132 iso_pu_bacteria 2738541333 2739035137 219
133 iso_pu_bacteria 2765235942 2766067734 219
134 iso_pu_bacteria 2775507266 2778177343 219
135 iso_pu_bacteria 2791355082 2792584059 219
136 iso_pu_bacteria 2791355091 2792622138 219
137 iso_pu_bacteria 2791355092 2792628297 219
138 iso_pu_bacteria 2791355256 2793298780 219
139 iso_pu_bacteria 2791355259 2793316936 219
140 iso_pu_bacteria 2791355260 2793322747 219
141 iso_pu_bacteria 2791355261 2793329365 219
142 iso_pu_bacteria 2791355262 2793336118 219
143 iso_pu_bacteria 2791355263 2793339929 219
144 iso_pu_bacteria 2791355264 2793350063 219
145 iso_pu_bacteria 2791355265 2793353445 219
146 iso_pu_bacteria 2791355266 2793358766 219
147 iso_pu_bacteria 2791355267 2793368328 219
148 iso_pu_bacteria 2802428858 2802717629 219
149 iso_pu_bacteria 2802428859 2802723444 219
150 iso_pu_bacteria 2802428860 2802731106 219
151 iso_pu_bacteria 2802428861 2802736112 219
152 iso_pu_bacteria 2802428862 2802743677 219
153 iso_pu_bacteria 2802428863 2802750611 219
154 iso_pu_bacteria 2802429268 2804751231 219
155 iso_pu_bacteria 2802429605 2805930395 219
156 iso_pu_bacteria 2802429606 2805936182 219
157 iso_pu_bacteria 2802429633 2806044425 219
158 iso_pu_bacteria 2802429634 2806051777 219
159 iso_pu_bacteria 2802429635 2806058080 219
160 iso_pu_bacteria 2802429636 2806068961 219
161 iso_pu_bacteria 2802429637 2806075746 219
162 iso_pu_bacteria 2818991448 2819613627 219
163 iso_pu_bacteria 2818991453 2819639371 219
164 iso_pu_bacteria 2838016132 2838017155 219
165 iso_pu_bacteria 2838022645 2838026940 219
166 iso_pu_bacteria 2838029111 2838031292 219
167 iso_pu_bacteria 2838035591 2838037589 219
168 iso_pu_bacteria 2838042994 2838047062 219
169 iso_pu_bacteria 2838048938 2838049360 219
170 iso_pu_bacteria 2838061910 2838067213 219
171 iso_pu_bacteria 2838068647 2838073203 219
172 iso_pu_bacteria 2838074704 2838076336 219
173 iso_pu_bacteria 2838661181 2838663255 219
174 iso_pu_bacteria 2838668709 2838670724 219
175 iso_pu_bacteria 2838680041 2838681177 219
176 iso_pu_bacteria 2838686498 2838688767 219
177 iso_pu_bacteria 2838694306 2838694790 219
178 iso_pu_bacteria 2838701080 2838703095 219
179 iso_pu_bacteria 2838707686 2838708166 219
180 iso_pu_bacteria 2838729681 2838731062 219
181 iso_pu_bacteria 2838742623 2838744044 219
182 iso_pu_bacteria 2841851746 2841856990 219
183 iso_pu_bacteria 2841864319 2841870425 219
184 iso_pu_bacteria 2842077413 2842080601 219
185 iso_pu_bacteria 2842110456 2842115984 219
186 iso_pu_bacteria 2842118031 2842121220 219
187 iso_pu_bacteria 2842146304 2842147681 219
188 iso_pu_bacteria 2842156927 2842159895 219
189 iso_pu_bacteria 2842163707 2842168138 219
190 iso_pu_bacteria 2842180545 2842183488 219
191 iso_pu_bacteria 2842192696 2842193529 219
192 iso_pu_bacteria 2842198810 2842202544 219
193 iso_pu_bacteria 2842205361 2842207824 219
194 iso_pu_bacteria 2842217011 2842220715 219
195 iso_pu_bacteria 2842229732 2842234032 219
196 iso_pu_bacteria 2842237096 2842237578 219
197 iso_pu_bacteria 2842243621 2842245508 219
198 iso_pu_bacteria 2842250916 2842252747 219
199 iso_pu_bacteria 2842257432 2842259842 219
200 iso_pu_bacteria 2842264693 2842269209 219
201 iso_pu_bacteria 2842271015 2842274681 219
202 iso_pu_bacteria 2842278818 2842281381 219
203 iso_pu_bacteria 2842285085 2842287246 219
204 iso_pu_bacteria 2842291075 2842294259 219
205 iso_pu_bacteria 2842304105 2842306926 219
206 iso_pu_bacteria 2842311132 2842314583 219
207 iso_pu_bacteria 2842317721 2842318776 219
208 iso_pu_bacteria 2842341865 2842343733 219
209 iso_pu_bacteria 2842363717 2842365040 219
210 iso_pu_bacteria 2842370503 2842371640 219
211 iso_pu_bacteria 2842377471 2842380656 219
212 iso_pu_bacteria 2842384541 2842387727 219
213 iso_pu_bacteria 2842395702 2842400866 219
214 iso_pu_bacteria 2842402390 2842404514 219
215 iso_pu_bacteria 2842409023 2842410801 219
216 iso_pu_bacteria 2842415677 2842417743 219
217 iso_pu_bacteria 2842422224 2842426624 219
218 iso_pu_bacteria 2842428310 2842433308 219
219 iso_pu_bacteria 2842434925 2842439733 219
220 iso_pu_bacteria 2842441272 2842446362 219
221 iso_pu_bacteria 2842447887 2842452039 219
222 iso_pu_bacteria 2842462802 2842467592 219
223 iso_pu_bacteria 2842469257 2842474245 219
224 iso_pu_bacteria 2842475841 2842478113 219
225 iso_pu_bacteria 2842482326 2842482732 219
226 iso_pu_bacteria 2842489311 2842494888 219
227 iso_pu_bacteria 2842495871 2842497411 219
228 iso_pu_bacteria 2842502639 2842504922 219
229 iso_pu_bacteria 2844163670 2844163890 219
230 iso_pu_bacteria 2844454524 2844455292 219
231 iso_pu_bacteria 2850079185 2850080368 219
232 iso_pu_bacteria 2855825444 2855831250 219
233 iso_pu_bacteria 2855839649 2855840375 219
234 iso_pu_bacteria 2857516855 2857520423 219
235 iso_pu_bacteria 2858800743 2858800905 219
236 iso_pu_bacteria 2896384573 2896386538 219
237 iso_pu_bacteria 2899803654 2899806120 219
238 iso_pu_bacteria 2913295892 2913297544 219
239 iso_pu_bacteria 2915980308 2915986108 219
240 iso_pu_bacteria 2915986958 2915993303 219
241 iso_pu_bacteria 2915993759 2915997896 219
242 iso_pu_bacteria 2916000859 2916005710 219
243 iso_pu_bacteria 2916007675 2916012791 219
244 iso_pu_bacteria 2916014648 2916020965 219
245 iso_pu_bacteria 2916021584 2916022516 219
246 iso_pu_bacteria 2916028427 2916034599 219
247 iso_pu_bacteria 2916035215 2916035346 219
248 iso_pu_bacteria 2916041962 2916043286 219
249 iso_pu_bacteria 2916048683 2916052485 219
250 iso_pu_bacteria 2916055098 2916057602 219
251 iso_pu_bacteria 2916061851 2916068008 219
252 iso_pu_bacteria 2916068649 2916072968 219
253 iso_pu_bacteria 2916076590 2916076733 219
254 iso_pu_bacteria 2919100787 2919100791 219
255 iso_pu_bacteria 2919408235 2919409179 219
256 iso_pu_bacteria 2920760137 2920762977 219
257 iso_pu_bacteria 2920822456 2920823741 219
258 iso_pu_bacteria 2921201388 2921201768 219
259 iso_pu_bacteria 2921208531 2921209729 219
260 iso_pu_bacteria 2921237296 2921243923 219
261 iso_pu_bacteria 2921244191 2921245960 219
262 iso_pu_bacteria 2921250672 2921250892 219
263 iso_pu_bacteria 2921257292 2921261021 219
264 iso_pu_bacteria 2921263974 2921269349 219
265 iso_pu_bacteria 2921282425 2921286415 219
266 iso_pu_bacteria 2921289301 2921294054 219
267 iso_pu_bacteria 2921296804 2921300521 219
268 iso_pu_bacteria 2923556063 2923557700 219
269 iso_pu_bacteria 2924144063 2924146928 219
270 iso_pu_bacteria 2924150972 2924156266 219
271 iso_pu_bacteria 2924158325 2924160500 219
272 iso_pu_bacteria 2924165586 2924166119 219
273 iso_pu_bacteria 2924172951 2924178555 219
274 iso_pu_bacteria 2924179722 2924181498 219
275 iso_pu_bacteria 2924186466 2924190284 219
276 iso_pu_bacteria 2924193448 2924195961 219
277 iso_pu_bacteria 2924200457 2924204395 219
278 iso_pu_bacteria 2924207177 2924207431 219
279 iso_pu_bacteria 2924214083 2924216465 219
280 iso_pu_bacteria 2924221636 2924224441 219
281 iso_pu_bacteria 2924228884 2924234863 219
282 iso_pu_bacteria 2933570622 2933572959 219
283 iso_pu_bacteria 2933586486 2933592057 219
284 iso_pu_bacteria 2933599457 2933603396 219
285 iso_pu_bacteria 2935894831 2935895312 219
286 iso_pu_bacteria 2935901341 2935904289 219
287 iso_pu_bacteria 2936367885 2936368259 219
288 iso_pu_bacteria 2936375103 2936376093 219
289 iso_pu_bacteria 2936381700 2936386843 219
290 iso_pu_bacteria 2936996657 2937000455 219
291 iso_pu_bacteria 2937002841 2937009588 219
292 iso_pu_bacteria 2937009748 2937010814 219
293 iso_pu_bacteria 2937016420 2937020810 219
294 iso_pu_bacteria 2937023124 2937027997 219
295 iso_pu_bacteria 2937029754 2937029930 219
296 iso_pu_bacteria 2937036028 2937041557 219
297 iso_pu_bacteria 2937042894 2937049621 219
298 iso_pu_bacteria 2937049772 2937052650 219
299 iso_pu_bacteria 2937056579 2937061606 219
300 iso_pu_bacteria 2937063883 2937066485 219
301 iso_pu_bacteria 2937071275 2937073807 219
302 iso_pu_bacteria 2937078374 2937083037 219
303 iso_pu_bacteria 2937084907 2937088739 219
304 iso_pu_bacteria 2937091812 2937093504 219
305 iso_pu_bacteria 2937098957 2937103700 219
306 iso_pu_bacteria 2937106411 2937111585 219
307 iso_pu_bacteria 2937113482 2937118245 219
308 iso_pu_bacteria 2937119839 2937121113 219
309 iso_pu_bacteria 2937126314 2937130158 219
310 iso_pu_bacteria 2941499720 2941500326 219
311 iso_pu_bacteria 2957375807 2957380089 219
312 iso_pu_bacteria 2957382221 2957385141 219
313 iso_pu_bacteria 2957388812 2957389204 219
314 iso_pu_bacteria 2957395598 2957398632 219
315 iso_pu_bacteria 2957402308 2957402679 219
316 iso_pu_bacteria 2957408893 2957415207 219
317 iso_pu_bacteria 2957415311 2957418014 219
318 iso_pu_bacteria 2957422303 2957425749 219
319 iso_pu_bacteria 2957430029 2957433147 219
320 iso_pu_bacteria 2957437181 2957443778 219
321 iso_pu_bacteria 2957443900 2957449912 219
322 iso_pu_bacteria 2957450854 2957453512 219
323 iso_pu_bacteria 2957457609 2957457832 219
324 iso_pu_bacteria 2957464669 2957466442 219
325 iso_pu_bacteria 2957471148 2957473987 219
326 iso_pu_bacteria 2957478035 2957483735 219
327 iso_pu_bacteria 2957484790 2957485862 219
328 iso_pu_bacteria 2957491536 2957495923 219
329 iso_pu_bacteria 2957498199 2957499806 219
330 iso_pu_bacteria 2957505466 2957510307 219
331 iso_pu_bacteria 2960584000 2960588007 219
332 iso_pu_bacteria 2960591022 2960595508 219
333 iso_pu_bacteria 2960597568 2960600647 219
334 iso_pu_bacteria 2960603979 2960609424 219
335 iso_pu_bacteria 2960610863 2960613803 219
336 iso_pu_bacteria 2960617483 2960617634 219
337 iso_pu_bacteria 2960624210 2960625475 219
338 iso_pu_bacteria 2960631154 2960633292 219
339 iso_pu_bacteria 2960637947 2960642339 219
340 iso_pu_bacteria 2960645483 2960652782 219
341 iso_pu_bacteria 2960652885 2960656801 219
342 iso_pu_bacteria 2960660292 2960662311 219
343 iso_pu_bacteria 2960667422 2960673853 219
344 iso_pu_bacteria 2960674078 2960676132 219
345 iso_pu_bacteria 2960680706 2960684098 219
346 iso_pu_bacteria 2960687367 2960691077 219
347 iso_pu_bacteria 2960693952 2960696309 219
348 iso_pu_bacteria 2964607997 2964612090 219
349 iso_pu_bacteria 2964615318 2964617610 219
350 iso_pu_bacteria 2964621998 2964623237 219
351 iso_pu_bacteria 2964628898 2964633189 219
352 iso_pu_bacteria 2964636051 2964642110 219
353 iso_pu_bacteria 2964643177 2964648738 219
354 iso_pu_bacteria 2964649959 2964653030 219
355 iso_pu_bacteria 2964656573 2964661100 219
356 iso_pu_bacteria 2964663802 2964666045 219
357 iso_pu_bacteria 2964670856 2964677684 219
358 iso_pu_bacteria 2964678106 2964683674 219
359 iso_pu_bacteria 2964685014 2964689159 219
360 iso_pu_bacteria 2964691889 2964695769 219
361 iso_pu_bacteria 2964698721 2964701885 219
362 iso_pu_bacteria 2964705432 2964712394 219
363 iso_pu_bacteria 2964712639 2964718626 219
364 iso_pu_bacteria 2964719344 2964726200 219
365 iso_pu_bacteria 2967664464 2967669703 219
366 iso_pu_bacteria 2967671571 2967673707 219
367 iso_pu_bacteria 2967678726 2967678852 219
368 iso_pu_bacteria 2967686174 2967686351 219
369 iso_pu_bacteria 2967693043 2967693173 219
370 iso_pu_bacteria 2967699805 2967702586 219
371 iso_pu_bacteria 2967706974 2967709239 219
372 iso_pu_bacteria 2967714385 2967716602 219
373 iso_pu_bacteria 2967721400 2967724786 219
374 iso_pu_bacteria 2967728569 2967734799 219
375 iso_pu_bacteria 2967735183 2967740970 219
376 iso_pu_bacteria 2967742019 2967746059 219
377 iso_pu_bacteria 2967748971 2967752177 219
378 iso_pu_bacteria 2967755722 2967757662 219
379 iso_pu_bacteria 2967762386 2967763747 219
380 iso_pu_bacteria 2967769361 2967773129 219
381 iso_pu_bacteria 2967775926 2967777199 219
382 iso_pu_bacteria 2970019648 2970025998 219
383 iso_pu_bacteria 2970026789 2970032882 219
384 iso_pu_bacteria 2970033650 2970039150 219
385 iso_pu_bacteria 2970040964 2970047622 219
386 iso_pu_bacteria 2970047711 2970049991 219
387 iso_pu_bacteria 2970054988 2970059680 219
388 iso_pu_bacteria 2970061556 2970067854 219
389 iso_pu_bacteria 2970068827 2970074948 219
390 iso_pu_bacteria 2970076120 2970076436 219
391 iso_pu_bacteria 2970082768 2970086615 219
392 iso_pu_bacteria 2970088815 2970093475 219
393 iso_pu_bacteria 2970095765 2970098071 219
394 iso_pu_bacteria 2970102677 2970108492 219
395 iso_pu_bacteria 2970109326 2970109891 219
396 iso_pu_bacteria 2970116247 2970118040 219
397 iso_pu_bacteria 2970122695 2970128243 219
398 iso_pu_bacteria 2970129317 2970129446 219
399 iso_pu_bacteria 2970136068 2970136955 219
400 iso_pu_bacteria 2970143518 2970149079 219
401 iso_pu_bacteria 2970149975 2970153886 219
402 iso_pu_bacteria 2970156795 2970162378 219
403 iso_pu_bacteria 2970164137 2970167432 219
404 iso_pu_bacteria 2970170962 2970171533 219
405 iso_pu_bacteria 2970177841 2970182207 219
406 iso_pu_bacteria 2970184632 2970189428 219
407 iso_pu_bacteria 2970191845 2970198396 219
408 iso_pu_bacteria 2977516862 2977518632 219
409 iso_pu_bacteria 2977523885 2977527203 219
410 iso_pu_bacteria 2977530762 2977533354 219
411 iso_pu_bacteria 2977537788 2977537917 219
412 iso_pu_bacteria 2977544691 2977544867 219
413 iso_pu_bacteria 2977551784 2977551914 219
414 iso_pu_bacteria 2977558990 2977563126 219
415 iso_pu_bacteria 2977565890 2977568915 219
416 iso_pu_bacteria 2977572785 2977579033 219
417 iso_pu_bacteria 2977579622 2977581566 219
418 iso_pu_bacteria 2989771324 2989771928 219
419 iso_pu_bacteria 2996887358 2996889518 219
420 iso_pu_bacteria 2996893221 2996895383 219
421 iso_pu_bacteria 3003930520 3003932545 219
422 iso_pu_bacteria 3005409236 3005412267 219
423 iso_pu_bacteria 3005416602 3005417723 219
424 iso_pu_bacteria 3005445848 3005446626 219
425 iso_pu_bacteria 639633055 639647309 219
426 iso_pu_bacteria 648276728 648740531 219
427 iso_pu_bacteria 8003992118 8003992792 219
428 iso_pu_bacteria 8003999396 8004000118 219
429 iso_pu_bacteria 8005258706 8005260864 219
430 iso_pu_bacteria 8005275841 8005279443 219
431 iso_pu_bacteria 8005282627 8005283878 219
432 iso_pu_bacteria 8005289223 8005292668 219
433 iso_pu_bacteria 8005301065 8005304439 219
434 iso_pu_bacteria 8005307578 8005309015 219
435 iso_pu_bacteria 8005314921 8005315079 219
436 iso_pu_bacteria 8005321885 8005324045 219
437 iso_pu_bacteria 8005376324 8005376748 219
438 iso_pu_bacteria 8005382845 8005386127 219
439 iso_pu_bacteria 8005395548 8005397475 219
440 iso_pu_bacteria 8005430974 8005434528 219
441 iso_pu_bacteria 8005460587 8005461791 219
442 iso_pu_bacteria 8005497431 8005499201 219
443 iso_pu_bacteria 8005542996 8005544222 219
444 iso_pu_bacteria 8005556819 8005563008 219
445 iso_pu_bacteria 8005563573 8005570305 219
446 iso_pu_bacteria 8005570704 8005577541 219
447 iso_pu_bacteria 8005619151 8005620394 219
448 iso_pu_bacteria 8005626139 8005626633 219
449 iso_pu_bacteria 8005645114 8005648108 219
450 iso_pu_bacteria 8005668836 8005670617 219
451 iso_pu_bacteria 8005682033 8005684723 219
452 iso_pu_bacteria 8005688590 8005690860 219
453 iso_pu_bacteria 8005695170 8005698925 219
454 iso_pu_bacteria 8018127388 8018131166 219
455 iso_pu_bacteria 8018163183 8018168307 219
456 iso_pu_bacteria 8018176218 8018177385 219
457 iso_pu_bacteria 8023680758 8023687134 219
458 iso_pu_bacteria 8024479707 8024480969 219
459 iso_pu_bacteria 8024486573 8024489870 219
460 iso_pu_bacteria 8024501048 8024503387 219
461 iso_pu_bacteria 8049293176 8049293812 219
462 iso_pu_bacteria 8054558443 8054563588 219
463 iso_pu_bacteria 8056375014 8056379436 219
464 iso_pu_bacteria 8056382006 8056384882 219
465 iso_pu_bacteria 8057874678 8057879611 219
466 3300003187 JGI25151J46595_10003599 JGI25151J46595_100035994 220
467 3300003187 JGI25151J46595_10004214 JGI25151J46595_100042144 220
468 3300003771 Ga0055526_1000042 Ga0055526_1000042106 220
469 3300003771 Ga0055526_1005449 Ga0055526_10054496 220
470 3300003775 Ga0055524_1011277 Ga0055524_10112774 220
471 3300003775 Ga0055524_1012192 Ga0055524_10121924 220
472 3300003790 Ga0055528_1000607 Ga0055528_10006078 220
473 3300005440 Ga0070705_100119002 Ga0070705_1001190022 220
474 3300009098 Ga0105245_10162320 Ga0105245_101623203 220
475 3300021361 Ga0213872_10017525 Ga0213872_100175253 220
476 3300025245 Ga0207425_1011070 Ga0207425_10110702 220
477 3300025258 Ga0209129_1000125 Ga0209129_100012579 220
478 3300025273 Ga0209673_1000122 Ga0209673_1000122124 220
479 3300025292 Ga0209676_1027963 Ga0209676_10279632 220
480 3300025294 Ga0209025_1000953 Ga0209025_100095347 220
481 3300025294 Ga0209025_1009717 Ga0209025_10097175 220
482 3300025295 Ga0209564_1000032 Ga0209564_1000032148 220
483 3300025295 Ga0209564_1006562 Ga0209564_10065625 220
484 3300025299 Ga0209256_1001198 Ga0209256_100119818 220
485 3300025303 Ga0209051_1040904 Ga0209051_10409042 220
486 3300025918 Ga0207662_10269853 Ga0207662_102698532 220
487 3300031240 Ga0265320_10004010 Ga0265320_100040103 220
488 3300031241 Ga0265325_10005675 Ga0265325_100056757 220
489 3300031249 Ga0265339_10166455 Ga0265339_101664552 220
490 3300031250 Ga0265331_10060087 Ga0265331_100600872 220
491 3300031344 Ga0265316_10102429 Ga0265316_101024293 220
492 3300031595 Ga0265313_10068206 Ga0265313_100682061 220
493 3300031711 Ga0265314_10072842 Ga0265314_100728423 220
494 3300031711 Ga0265314_10102220 Ga0265314_101022203 220
495 3300039437 Ga0436365_0142070 Ga0436365_0142070_1434_2102 220
496 3300039447 Ga0436361_0316796 Ga0436361_0316796_1338_2003 220
497 3300039453 Ga0436362_0060280 Ga0436362_0060280_4066_4734 220
498 3300048912 Ga0496109_0139312 Ga0496109_0139312_1287_1949 220
499 3300048913 Ga0496110_0062535 Ga0496110_0062535_1476_2138 220
500 3300048916 Ga0496113_0010427 Ga0496113_0010427_3956_4618 220
501 3300048925 Ga0496122_0100553 Ga0496122_0100553_943_1605 220
502 3300048926 Ga0496123_0117447 Ga0496123_0117447_184_846 220
503 3300048929 Ga0496126_0001787 Ga0496126_0001787_24732_25400 220
504 3300048929 Ga0496126_0120287 Ga0496126_0120287_45_707 220
505 3300049570 Ga0501033_0224584 Ga0501033_0224584_316_987 220
506 3300049581 Ga0501047_0158309 Ga0501047_0158309_1106_1768 220
507 3300049823 Ga0501044_0039017 Ga0501044_0039017_1476_2147 220
508 iso_pu_bacteria 8005658619 8005660089 220
509 iso_pu_bacteria 8055431914 8055434053 220
510 3300005331 Ga0070670_100169119 Ga0070670_1001691192 221
511 3300005347 Ga0070668_100053738 Ga0070668_1000537383 221
512 3300005457 Ga0070662_100276456 Ga0070662_1002764562 221
513 3300005459 Ga0068867_100114855 Ga0068867_1001148552 221
514 3300005536 Ga0070697_100625443 Ga0070697_1006254432 221
515 3300005844 Ga0068862_100267796 Ga0068862_1002677962 221
516 3300006051 Ga0075364_10032539 Ga0075364_100325394 221
517 3300006353 Ga0075370_10113838 Ga0075370_101138383 221
518 3300006847 Ga0075431_100012097 Ga0075431_1000120975 221
519 3300006880 Ga0075429_100723170 Ga0075429_1007231701 221
520 3300009147 Ga0114129_10031485 Ga0114129_100314855 221
521 3300014326 Ga0157380_10629063 Ga0157380_106290632 221
522 3300025907 Ga0207645_10158068 Ga0207645_101580682 221
523 3300025923 Ga0207681_10250457 Ga0207681_102504572 221
524 3300025934 Ga0207686_10106587 Ga0207686_101065872 221
525 3300025935 Ga0207709_10085278 Ga0207709_100852783 221
526 3300025972 Ga0207668_10314034 Ga0207668_103140342 221
527 3300025986 Ga0207658_10096946 Ga0207658_100969462 221
528 3300028381 Ga0268264_10511331 Ga0268264_105113312 221
529 3300037312 Ga0395899_0156211 Ga0395899_0156211_651_1316 221
530 3300037418 Ga0395900_0088630 Ga0395900_0088630_2332_2997 221
531 3300038443 Ga0395901_0081030 Ga0395901_0081030_203_868 221
532 3300039453 Ga0436362_0870149 Ga0436362_0870149_23_694 221
533 3300041458 Ga0451798_0107945 Ga0451798_0107945_164_835 221
534 3300042009 Ga0439451_007817 Ga0439451_007817_466_1137 221
535 3300047319 Ga0495674_0366898 Ga0495674_0366898_57_731 221
536 3300048916 Ga0496113_0802189 Ga0496113_0802189_48_719 221
537 3300049568 Ga0501031_0090259 Ga0501031_0090259_157_822 221
538 3300049568 Ga0501031_0247473 Ga0501031_0247473_15_680 221
539 3300049570 Ga0501033_0036043 Ga0501033_0036043_538_1203 221
540 3300049570 Ga0501033_0195259 Ga0501033_0195259_497_1168 221
541 3300049571 Ga0501034_0003097 Ga0501034_0003097_2019_2684 221
542 3300049571 Ga0501034_0051684 Ga0501034_0051684_447_1112 221
543 3300049571 Ga0501034_0164534 Ga0501034_0164534_695_1360 221
544 3300049571 Ga0501034_0234799 Ga0501034_0234799_1087_1758 221
545 3300049572 Ga0501036_0048788 Ga0501036_0048788_1205_1870 221
546 3300049572 Ga0501036_0089967 Ga0501036_0089967_497_1168 221
547 3300049573 Ga0501037_0033875 Ga0501037_0033875_75_740 221
548 3300049573 Ga0501037_0098678 Ga0501037_0098678_395_1066 221
549 3300049574 Ga0501038_0056632 Ga0501038_0056632_538_1203 221
550 3300049575 Ga0501039_0065001 Ga0501039_0065001_609_1280 221
551 3300049575 Ga0501039_0338994 Ga0501039_0338994_442_1107 221
552 3300049576 Ga0501040_0024436 Ga0501040_0024436_1699_2370 221
553 3300049577 Ga0501041_0018238 Ga0501041_0018238_2062_2733 221
554 3300049578 Ga0501042_0138432 Ga0501042_0138432_828_1499 221
555 3300049578 Ga0501042_0190463 Ga0501042_0190463_515_1186 221
556 3300049579 Ga0501043_0081640 Ga0501043_0081640_1801_2466 221
557 3300049580 Ga0501046_0059508 Ga0501046_0059508_1088_1759 221
558 3300049580 Ga0501046_0110827 Ga0501046_0110827_1296_1961 221
559 3300049581 Ga0501047_0118076 Ga0501047_0118076_1840_2505 221
560 3300049581 Ga0501047_0168298 Ga0501047_0168298_101_766 221
561 3300049582 Ga0501048_0128827 Ga0501048_0128827_699_1370 221
562 3300049582 Ga0501048_0449758 Ga0501048_0449758_122_787 221
563 3300049584 Ga0501068_0002277 Ga0501068_0002277_9052_9717 221
564 3300049586 Ga0501070_0380798 Ga0501070_0380798_11_691 221
565 3300049587 Ga0501071_0154640 Ga0501071_0154640_744_1415 221
566 3300049588 Ga0501072_0038176 Ga0501072_0038176_2436_3107 221
567 3300049590 Ga0501074_0195088 Ga0501074_0195088_758_1423 221
568 3300049591 Ga0501075_0060975 Ga0501075_0060975_843_1514 221
569 3300049592 Ga0501076_0004128 Ga0501076_0004128_3948_4619 221
570 3300049593 Ga0501077_0014578 Ga0501077_0014578_1632_2303 221
571 3300049741 Ga0501079_0032431 Ga0501079_0032431_1966_2637 221
572 3300049742 Ga0501080_0033607 Ga0501080_0033607_2280_2951 221
573 3300049743 Ga0501081_0037644 Ga0501081_0037644_591_1262 221
574 3300049744 Ga0501083_0095273 Ga0501083_0095273_479_1150 221
575 3300049776 Ga0501280_004260 Ga0501280_004260_258_923 221
576 3300049822 Ga0501035_0004670 Ga0501035_0004670_7615_8280 221
577 3300049822 Ga0501035_0111615 Ga0501035_0111615_1049_1720 221
578 3300049823 Ga0501044_0071284 Ga0501044_0071284_2331_2996 221
579 3300049824 Ga0501045_0148923 Ga0501045_0148923_811_1482 221
580 3300050491 nmdc:mga00v17_13819_c1 nmdc:mga00v17_13819_c1_2424_3089 221
581 3300050496 nmdc:mga07m45_212239_c1 nmdc:mga07m45_212239_c1_242_913 221
582 3300050507 nmdc:mga05p37_152544_c1 nmdc:mga05p37_152544_c1_1355_2026 221
583 3300050508 nmdc:mga09592_687107_c1 nmdc:mga09592_687107_c1_38_709 221
584 3300050510 nmdc:mga06r32_15122_c2 nmdc:mga06r32_15122_c2_1342_2013 221
585 3300053098 Ga0500650_0090740 Ga0500650_0090740_217_888 221
586 3300053103 Ga0500555_018291 Ga0500555_018291_161_832 221
587 3300054114 Ga0501084_0010520 Ga0501084_0010520_6482_7153 221
588 3300060353 Ga0501082_0015012 Ga0501082_0015012_5161_5832 221
589 3300061719 Ga0466962_0343528 Ga0466962_0343528_12_683 221
590 3300061734 Ga0530510_0183887 Ga0530510_0183887_453_1124 221
591 iso_pu_bacteria 2513237159 2513999444 221
592 iso_pu_bacteria 2582581283 2585165438 221
593 iso_pu_bacteria 2582581306 2585266300 221
594 iso_pu_bacteria 2582581865 2585387301 221
595 iso_pu_bacteria 2582581866 2585397802 221
596 iso_pu_bacteria 2599185156 2599333900 221
597 iso_pu_bacteria 2643221607 2644046695 221
598 iso_pu_bacteria 2643221636 2644202402 221
599 iso_pu_bacteria 2643221637 2644206317 221
600 iso_pu_bacteria 2643221686 2644479484 221
601 iso_pu_bacteria 2643221718 2644649965 221
602 iso_pu_bacteria 2791355253 2793282853 221
603 iso_pu_bacteria 2837651117 2837652570 221
604 iso_pu_bacteria 2842521101 2842525237 221
605 iso_pu_bacteria 2842922631 2842923701 221
606 3300005335 Ga0070666_10008438 Ga0070666_100084382 222
607 3300005341 Ga0070691_10002680 Ga0070691_100026804 222
608 3300005434 Ga0070709_10001001 Ga0070709_1000100112 222
609 3300005434 Ga0070709_10493890 Ga0070709_104938901 222
610 3300005435 Ga0070714_100012979 Ga0070714_1000129794 222
611 3300005435 Ga0070714_100865222 Ga0070714_1008652222 222
612 3300005436 Ga0070713_100000262 Ga0070713_10000026230 222
613 3300005439 Ga0070711_100197511 Ga0070711_1001975112 222
614 3300005440 Ga0070705_100324345 Ga0070705_1003243452 222
615 3300005458 Ga0070681_10082403 Ga0070681_100824033 222
616 3300005468 Ga0070707_100742212 Ga0070707_1007422121 222
617 3300005530 Ga0070679_100163594 Ga0070679_1001635942 222
618 3300005548 Ga0070665_100181852 Ga0070665_1001818522 222
619 3300005548 Ga0070665_101068319 Ga0070665_1010683191 222
620 3300005563 Ga0068855_100066217 Ga0068855_1000662175 222
621 3300005563 Ga0068855_100113925 Ga0068855_1001139252 222
622 3300005577 Ga0068857_100001171 Ga0068857_1000011719 222
623 3300005614 Ga0068856_100003455 Ga0068856_10000345512 222
624 3300005614 Ga0068856_100003973 Ga0068856_10000397312 222
625 3300005616 Ga0068852_100005263 Ga0068852_1000052637 222
626 3300005842 Ga0068858_100017646 Ga0068858_1000176463 222
627 3300005843 Ga0068860_100190810 Ga0068860_1001908103 222
628 3300006173 Ga0070716_100007829 Ga0070716_1000078295 222
629 3300006175 Ga0070712_100000171 Ga0070712_1000001712 222
630 3300006175 Ga0070712_100008256 Ga0070712_1000082565 222
631 3300006237 Ga0097621_100577839 Ga0097621_1005778392 222
632 3300006871 Ga0075434_100029143 Ga0075434_1000291436 222
633 3300006914 Ga0075436_100001738 Ga0075436_10000173811 222
634 3300006914 Ga0075436_100055208 Ga0075436_1000552083 222
635 3300007076 Ga0075435_100119646 Ga0075435_1001196462 222
636 3300009093 Ga0105240_10002102 Ga0105240_1000210226 222
637 3300009098 Ga0105245_10030128 Ga0105245_100301282 222
638 3300009174 Ga0105241_10010758 Ga0105241_100107584 222
639 3300009174 Ga0105241_10782045 Ga0105241_107820452 222
640 3300009177 Ga0105248_10539530 Ga0105248_105395302 222
641 3300009545 Ga0105237_10056896 Ga0105237_100568964 222
642 3300013100 Ga0157373_10029739 Ga0157373_100297393 222
643 3300013104 Ga0157370_10004692 Ga0157370_100046924 222
644 3300013105 Ga0157369_10086504 Ga0157369_100865043 222
645 3300013306 Ga0163162_10116440 Ga0163162_101164405 222
646 3300013307 Ga0157372_10014340 Ga0157372_100143409 222
647 3300014968 Ga0157379_10001940 Ga0157379_1000194011 222
648 3300014968 Ga0157379_10009144 Ga0157379_100091444 222
649 3300014968 Ga0157379_10022145 Ga0157379_100221454 222
650 3300017792 Ga0163161_10672612 Ga0163161_106726122 222
651 3300021384 Ga0213876_10020884 Ga0213876_100208843 222
652 3300025906 Ga0207699_10000246 Ga0207699_1000024614 222
653 3300025906 Ga0207699_10030561 Ga0207699_100305614 222
654 3300025911 Ga0207654_10067032 Ga0207654_100670322 222
655 3300025912 Ga0207707_10125146 Ga0207707_101251462 222
656 3300025914 Ga0207671_10114443 Ga0207671_101144432 222
657 3300025915 Ga0207693_10000025 Ga0207693_1000002523 222
658 3300025916 Ga0207663_10007296 Ga0207663_100072963 222
659 3300025916 Ga0207663_10320849 Ga0207663_103208492 222
660 3300025916 Ga0207663_10365426 Ga0207663_103654262 222
661 3300025921 Ga0207652_10322291 Ga0207652_103222912 222
662 3300025928 Ga0207700_10000005 Ga0207700_10000005411 222
663 3300025929 Ga0207664_10014667 Ga0207664_100146675 222
664 3300025941 Ga0207711_10359853 Ga0207711_103598532 222
665 3300025949 Ga0207667_10011654 Ga0207667_100116549 222
666 3300025949 Ga0207667_10050944 Ga0207667_100509443 222
667 3300025981 Ga0207640_10066239 Ga0207640_100662393 222
668 3300026035 Ga0207703_10009981 Ga0207703_100099814 222
669 3300026078 Ga0207702_10000055 Ga0207702_1000005522 222
670 3300026088 Ga0207641_10124096 Ga0207641_101240963 222
671 3300026116 Ga0207674_10000004 Ga0207674_10000004200 222
672 3300026142 Ga0207698_10011571 Ga0207698_100115718 222
673 3300028381 Ga0268264_10165699 Ga0268264_101656992 222
674 3300028577 Ga0265318_10001236 Ga0265318_1000123619 222
675 3300031235 Ga0265330_10079778 Ga0265330_100797782 222
676 3300031239 Ga0265328_10026733 Ga0265328_100267332 222
677 3300031240 Ga0265320_10035158 Ga0265320_100351582 222
678 3300031240 Ga0265320_10035866 Ga0265320_100358662 222
679 3300031241 Ga0265325_10016931 Ga0265325_100169312 222
680 3300031241 Ga0265325_10106147 Ga0265325_101061472 222
681 3300031595 Ga0265313_10002103 Ga0265313_1000210316 222
682 3300031595 Ga0265313_10003670 Ga0265313_100036709 222
683 3300031711 Ga0265314_10005985 Ga0265314_100059854 222
684 3300031711 Ga0265314_10006055 Ga0265314_100060559 222
685 3300031712 Ga0265342_10043586 Ga0265342_100435864 222
686 3300035691 Ga0373931_0004426 Ga0373931_0004426_3463_4137 222
687 3300035724 Ga0373933_0007071 Ga0373933_0007071_2014_2688 222
688 3300036401 Ga0373937_0027165 Ga0373937_0027165_974_1648 222
689 3300036401 Ga0373937_0071180 Ga0373937_0071180_193_867 222
690 3300037068 Ga0373925_0036387 Ga0373925_0036387_1166_1840 222
691 3300037418 Ga0395900_0081620 Ga0395900_0081620_1252_1965 222
692 3300037471 Ga0395905_0002327 Ga0395905_0002327_7469_8137 222
693 3300037471 Ga0395905_0031592 Ga0395905_0031592_3961_4674 222
694 3300038443 Ga0395901_0470095 Ga0395901_0470095_35_748 222
695 3300039437 Ga0436365_1329101 Ga0436365_1329101_5241_5912 222
696 3300046675 Ga0495657_0086551 Ga0495657_0086551_245_919 222
697 3300048904 Ga0496101_0393033 Ga0496101_0393033_145_819 222
698 3300048914 Ga0496111_0124262 Ga0496111_0124262_325_999 222
699 3300049570 Ga0501033_0087270 Ga0501033_0087270_742_1413 222
700 3300049571 Ga0501034_0011474 Ga0501034_0011474_2917_3588 222
701 3300049571 Ga0501034_0056225 Ga0501034_0056225_2878_3546 222
702 3300049571 Ga0501034_0079282 Ga0501034_0079282_1411_2082 222
703 3300049571 Ga0501034_0255974 Ga0501034_0255974_71_742 222
704 3300049573 Ga0501037_0164128 Ga0501037_0164128_92_763 222
705 3300049580 Ga0501046_0008000 Ga0501046_0008000_6471_7142 222
706 3300049581 Ga0501047_0001553 Ga0501047_0001553_3050_3721 222
707 3300049582 Ga0501048_0138435 Ga0501048_0138435_570_1241 222
708 3300049742 Ga0501080_0105651 Ga0501080_0105651_32_703 222
709 3300049742 Ga0501080_0154648 Ga0501080_0154648_265_936 222
710 3300049822 Ga0501035_0054857 Ga0501035_0054857_2393_3064 222
711 3300049823 Ga0501044_0223796 Ga0501044_0223796_874_1545 222
712 3300049823 Ga0501044_0298807 Ga0501044_0298807_763_1434 222
713 3300049823 Ga0501044_0386727 Ga0501044_0386727_457_1128 222
714 3300050512 nmdc:mga0n895_1692_c1 nmdc:mga0n895_1692_c1_3705_4379 222
715 3300050514 nmdc:mga08x19_51_c1 nmdc:mga08x19_51_c1_35323_35997 222
716 3300001979 JGI24740J21852_10001706 JGI24740J21852_1000170610 223
717 3300002704 JGI25155J39150_1000089 JGI25155J39150_10000894 223
718 3300002705 JGI25156J39149_1000147 JGI25156J39149_10001474 223
719 3300002737 JGI25162J39368_1000243 JGI25162J39368_100024356 223
720 3300002737 JGI25162J39368_1000372 JGI25162J39368_10003728 223
721 3300002738 JGI25154J39366_1000160 JGI25154J39366_100016060 223
722 3300002739 JGI25158J39367_1000293 JGI25158J39367_10002934 223
723 3300002739 JGI25158J39367_1001028 JGI25158J39367_10010287 223
724 3300002741 JGI25157J39369_1000190 JGI25157J39369_10001904 223
725 3300002773 JGI25152J39213_1003430 JGI25152J39213_10034304 223
726 3300002773 JGI25152J39213_1004848 JGI25152J39213_10048485 223
727 3300002773 JGI25152J39213_1006337 JGI25152J39213_10063374 223
728 3300002773 JGI25152J39213_1006342 JGI25152J39213_10063424 223
729 3300002773 JGI25152J39213_1006896 JGI25152J39213_10068964 223
730 3300002774 JGI25150J39212_1000031 JGI25150J39212_10000315 223
731 3300002987 JGI25159J45721_1000001 JGI25159J45721_1000001294 223
732 3300002987 JGI25159J45721_1000264 JGI25159J45721_100026431 223
733 3300003187 JGI25151J46595_10000062 JGI25151J46595_10000062119 223
734 3300003187 JGI25151J46595_10014854 JGI25151J46595_100148544 223
735 3300003187 JGI25151J46595_10036908 JGI25151J46595_100369083 223
736 3300003214 JGI25165J46597_1000318 JGI25165J46597_100031812 223
737 3300003214 JGI25165J46597_1000413 JGI25165J46597_100041343 223
738 3300003214 JGI25165J46597_1004436 JGI25165J46597_10044365 223
739 3300003215 JGI25153J46596_10002646 JGI25153J46596_1000264610 223
740 3300003215 JGI25153J46596_10006186 JGI25153J46596_100061866 223
741 3300003215 JGI25153J46596_10034305 JGI25153J46596_100343051 223
742 3300003215 JGI25153J46596_10034323 JGI25153J46596_100343231 223
743 3300003316 rootH1_10006292 rootH1_100062926 223
744 3300003354 JGI25160J50197_1000002 JGI25160J50197_100000220 223
745 3300003354 JGI25160J50197_1000855 JGI25160J50197_100085516 223
746 3300003354 JGI25160J50197_1001062 JGI25160J50197_100106214 223
747 3300003354 JGI25160J50197_1013067 JGI25160J50197_10130674 223
748 3300003374 JGI25161J50226_1000338 JGI25161J50226_10003384 223
749 3300003374 JGI25161J50226_1000742 JGI25161J50226_10007427 223
750 3300003374 JGI25161J50226_1001156 JGI25161J50226_10011569 223
751 3300003771 Ga0055526_1000805 Ga0055526_100080515 223
752 3300003771 Ga0055526_1010411 Ga0055526_10104113 223
753 3300003771 Ga0055526_1019686 Ga0055526_10196863 223
754 3300003771 Ga0055526_1020429 Ga0055526_10204292 223
755 3300003771 Ga0055526_1030080 Ga0055526_10300801 223
756 3300003775 Ga0055524_1000650 Ga0055524_100065019 223
757 3300003775 Ga0055524_1006021 Ga0055524_10060213 223
758 3300003775 Ga0055524_1017549 Ga0055524_10175492 223
759 3300003775 Ga0055524_1022121 Ga0055524_10221214 223
760 3300003775 Ga0055524_1024531 Ga0055524_10245312 223
761 3300003781 Ga0055536_1000427 Ga0055536_10004276 223
762 3300003790 Ga0055528_1000798 Ga0055528_100079824 223
763 3300003790 Ga0055528_1005643 Ga0055528_10056437 223
764 3300003790 Ga0055528_1013886 Ga0055528_10138862 223
765 3300003790 Ga0055528_1030911 Ga0055528_10309112 223
766 3300003791 Ga0055530_10004975 Ga0055530_100049752 223
767 3300003792 Ga0055540_1000380 Ga0055540_100038045 223
768 3300003792 Ga0055540_1010288 Ga0055540_10102885 223
769 3300003792 Ga0055540_1013681 Ga0055540_10136812 223
770 3300003792 Ga0055540_1033501 Ga0055540_10335012 223
771 3300003794 Ga0055531_10029444 Ga0055531_100294442 223
772 3300003856 Ga0058692_1013229 Ga0058692_10132292 223
773 3300004625 Ga0055543_1000115 Ga0055543_100011576 223
774 3300004625 Ga0055543_1000137 Ga0055543_100013766 223
775 3300004625 Ga0055543_1003775 Ga0055543_10037755 223
776 3300005262 Ga0065165_1000004 Ga0065165_1000004362 223
777 3300005262 Ga0065165_1003706 Ga0065165_100370610 223
778 3300005547 Ga0070693_100081219 Ga0070693_1000812191 223
779 3300005578 Ga0068854_100037323 Ga0068854_1000373234 223
780 3300005616 Ga0068852_100036960 Ga0068852_1000369602 223
781 3300005834 Ga0068851_10253758 Ga0068851_102537581 223
782 3300005844 Ga0068862_100281608 Ga0068862_1002816083 223
783 3300006038 Ga0075365_10075176 Ga0075365_100751762 223
784 3300006042 Ga0075368_10227118 Ga0075368_102271181 223
785 3300006048 Ga0075363_100153505 Ga0075363_1001535052 223
786 3300006177 Ga0075362_10070603 Ga0075362_100706032 223
787 3300006178 Ga0075367_10023622 Ga0075367_100236222 223
788 3300006178 Ga0075367_10127194 Ga0075367_101271943 223
789 3300006178 Ga0075367_10184832 Ga0075367_101848322 223
790 3300006178 Ga0075367_10204975 Ga0075367_102049752 223
791 3300006195 Ga0075366_10050728 Ga0075366_100507284 223
792 3300006353 Ga0075370_10112041 Ga0075370_101120413 223
793 3300006946 Ga0079104_1001952 Ga0079104_100195215 223
794 3300006946 Ga0079104_1006397 Ga0079104_10063975 223
795 3300009092 Ga0105250_10027216 Ga0105250_100272165 223
796 3300009093 Ga0105240_10000027 Ga0105240_10000027291 223
797 3300009177 Ga0105248_10060975 Ga0105248_100609752 223
798 3300009765 Ga0123341_1000006 Ga0123341_1000006104 223
799 3300009766 Ga0123342_1004514 Ga0123342_100451414 223
800 3300013100 Ga0157373_10390964 Ga0157373_103909642 223
801 3300013104 Ga0157370_10000223 Ga0157370_1000022320 223
802 3300013249 Ga0171463_1001 Ga0171463_1001334 223
803 3300015262 Ga0182007_10000805 Ga0182007_1000080512 223
804 3300015690 Ga0183363_1266 Ga0183363_12667 223
805 3300021320 Ga0214544_1000008 Ga0214544_100000855 223
806 3300021321 Ga0214542_1000010 Ga0214542_100001011 223
807 3300021321 Ga0214542_1022278 Ga0214542_10222786 223
808 3300021327 Ga0214543_1000003 Ga0214543_1000003369 223
809 3300021327 Ga0214543_1000004 Ga0214543_100000433 223
810 3300022739 Ga0228711_1000001 Ga0228711_1000001180 223
811 3300022740 Ga0228710_1000001 Ga0228710_1000001144 223
812 3300025206 Ga0209435_100036 Ga0209435_10003659 223
813 3300025208 Ga0209436_101062 Ga0209436_1010623 223
814 3300025208 Ga0209436_101252 Ga0209436_1012524 223
815 3300025228 Ga0209672_103497 Ga0209672_1034972 223
816 3300025233 Ga0209437_100033 Ga0209437_100033154 223
817 3300025233 Ga0209437_100036 Ga0209437_100036406 223
818 3300025245 Ga0207425_1000031 Ga0207425_1000031235 223
819 3300025245 Ga0207425_1001175 Ga0207425_100117513 223
820 3300025245 Ga0207425_1007557 Ga0207425_10075573 223
821 3300025246 Ga0209646_1000132 Ga0209646_100013259 223
822 3300025250 Ga0209026_1000313 Ga0209026_10003134 223
823 3300025253 Ga0209677_100419 Ga0209677_10041925 223
824 3300025254 Ga0209148_1020173 Ga0209148_10201732 223
825 3300025256 Ga0209759_1000417 Ga0209759_10004174 223
826 3300025258 Ga0209129_1000053 Ga0209129_1000053236 223
827 3300025258 Ga0209129_1000465 Ga0209129_10004656 223
828 3300025258 Ga0209129_1000945 Ga0209129_10009457 223
829 3300025258 Ga0209129_1002143 Ga0209129_10021434 223
830 3300025258 Ga0209129_1003204 Ga0209129_10032045 223
831 3300025258 Ga0209129_1005526 Ga0209129_10055263 223
832 3300025261 Ga0209233_1000056 Ga0209233_1000056184 223
833 3300025261 Ga0209233_1000064 Ga0209233_1000064270 223
834 3300025261 Ga0209233_1000152 Ga0209233_100015226 223
835 3300025273 Ga0209673_1000409 Ga0209673_100040945 223
836 3300025273 Ga0209673_1003665 Ga0209673_10036659 223
837 3300025273 Ga0209673_1004779 Ga0209673_10047796 223
838 3300025273 Ga0209673_1005538 Ga0209673_10055386 223
839 3300025273 Ga0209673_1008056 Ga0209673_10080562 223
840 3300025273 Ga0209673_1008564 Ga0209673_10085642 223
841 3300025273 Ga0209673_1010635 Ga0209673_10106354 223
842 3300025273 Ga0209673_1024143 Ga0209673_10241433 223
843 3300025284 Ga0209130_1000008 Ga0209130_1000008520 223
844 3300025284 Ga0209130_1000015 Ga0209130_10000154 223
845 3300025291 Ga0209675_1018780 Ga0209675_10187802 223
846 3300025292 Ga0209676_1000885 Ga0209676_100088510 223
847 3300025292 Ga0209676_1046142 Ga0209676_10461422 223
848 3300025294 Ga0209025_1000087 Ga0209025_1000087235 223
849 3300025294 Ga0209025_1000100 Ga0209025_1000100106 223
850 3300025294 Ga0209025_1001577 Ga0209025_10015774 223
851 3300025294 Ga0209025_1011394 Ga0209025_10113946 223
852 3300025294 Ga0209025_1011398 Ga0209025_10113984 223
853 3300025294 Ga0209025_1020091 Ga0209025_10200913 223
854 3300025295 Ga0209564_1000104 Ga0209564_1000104202 223
855 3300025295 Ga0209564_1001469 Ga0209564_100146916 223
856 3300025295 Ga0209564_1001682 Ga0209564_100168224 223
857 3300025295 Ga0209564_1002198 Ga0209564_100219826 223
858 3300025295 Ga0209564_1010193 Ga0209564_10101932 223
859 3300025297 Ga0209758_1000081 Ga0209758_1000081235 223
860 3300025297 Ga0209758_1000313 Ga0209758_100031371 223
861 3300025297 Ga0209758_1000376 Ga0209758_100037686 223
862 3300025297 Ga0209758_1001096 Ga0209758_10010966 223
863 3300025297 Ga0209758_1001417 Ga0209758_100141732 223
864 3300025297 Ga0209758_1001419 Ga0209758_100141932 223
865 3300025297 Ga0209758_1007473 Ga0209758_10074734 223
866 3300025297 Ga0209758_1035521 Ga0209758_10355212 223
867 3300025298 Ga0209050_1001263 Ga0209050_10012636 223
868 3300025298 Ga0209050_1012590 Ga0209050_10125902 223
869 3300025299 Ga0209256_1000351 Ga0209256_100035158 223
870 3300025299 Ga0209256_1000711 Ga0209256_10007114 223
871 3300025299 Ga0209256_1000723 Ga0209256_100072348 223
872 3300025299 Ga0209256_1008596 Ga0209256_10085964 223
873 3300025299 Ga0209256_1008685 Ga0209256_10086853 223
874 3300025299 Ga0209256_1019583 Ga0209256_10195832 223
875 3300025299 Ga0209256_1036607 Ga0209256_10366072 223
876 3300025302 Ga0207426_1000016 Ga0207426_100001642 223
877 3300025302 Ga0207426_1000122 Ga0207426_1000122228 223
878 3300025302 Ga0207426_1000146 Ga0207426_1000146217 223
879 3300025302 Ga0207426_1002469 Ga0207426_10024692 223
880 3300025303 Ga0209051_1000127 Ga0209051_10001274 223
881 3300025303 Ga0209051_1000918 Ga0209051_100091820 223
882 3300025304 Ga0209257_1009728 Ga0209257_10097286 223
883 3300025304 Ga0209257_1010230 Ga0209257_10102302 223
884 3300025913 Ga0207695_10000024 Ga0207695_10000024339 223
885 3300025914 Ga0207671_10000986 Ga0207671_100009868 223
886 3300025981 Ga0207640_10068650 Ga0207640_100686501 223
887 3300025986 Ga0207658_10996918 Ga0207658_109969181 223
888 3300026067 Ga0207678_10228681 Ga0207678_102286812 223
889 3300026078 Ga0207702_10052450 Ga0207702_100524502 223
890 3300026142 Ga0207698_10014957 Ga0207698_100149576 223
891 3300027111 Ga0209281_1000164 Ga0209281_100016485 223
892 3300027111 Ga0209281_1000377 Ga0209281_100037737 223
893 3300027312 Ga0209371_1014508 Ga0209371_10145082 223
894 3300027666 Ga0209282_1000007 Ga0209282_100000771 223
895 3300028379 Ga0268266_10390124 Ga0268266_103901242 223
896 3300028380 Ga0268265_10302973 Ga0268265_103029733 223
897 3300030500 Ga0268256_1015067 Ga0268256_10150672 223
898 3300031235 Ga0265330_10011955 Ga0265330_100119555 223
899 3300031241 Ga0265325_10031233 Ga0265325_100312333 223
900 3300031247 Ga0265340_10015433 Ga0265340_100154332 223
901 3300031249 Ga0265339_10027818 Ga0265339_100278184 223
902 3300031456 Ga0307513_10268414 Ga0307513_102684142 223
903 3300031548 Ga0307408_100174691 Ga0307408_1001746912 223
904 3300031595 Ga0265313_10041199 Ga0265313_100411992 223
905 3300031595 Ga0265313_10225566 Ga0265313_102255661 223
906 3300031691 Ga0316579_10111102 Ga0316579_101111021 223
907 3300031712 Ga0265342_10038038 Ga0265342_100380384 223
908 3300031731 Ga0307405_10008210 Ga0307405_100082104 223
909 3300031911 Ga0307412_10000890 Ga0307412_1000089023 223
910 3300031911 Ga0307412_10406726 Ga0307412_104067262 223
911 3300031967 Ga0315914_1000006 Ga0315914_1000006171 223
912 3300032133 Ga0316583_10040575 Ga0316583_100405752 223
913 3300033430 Ga0315913_1000002 Ga0315913_100000271 223
914 3300033464 Ga0315915_1000001 Ga0315915_1000001415 223
915 3300036647 Ga0316582_0160070 Ga0316582_0160070_478_1149 223
916 3300039062 Ga0400483_016484 Ga0400483_016484_5234_5905 223
917 3300039062 Ga0400483_289717 Ga0400483_289717_5440_6111 223
918 3300041413 Ga0439465_0015180 Ga0439465_0015180_1407_2078 223
919 3300041491 Ga0451833_1133924 Ga0451833_1133924_248_919 223
920 3300041494 Ga0451837_1280992 Ga0451837_1280992_781_1452 223
921 3300041497 Ga0451840_02168 Ga0451840_02168_492_1163 223
922 3300041501 Ga0451845_0021827 Ga0451845_0021827_125_796 223
923 3300041506 Ga0451850_35509 Ga0451850_35509_529_1200 223
924 3300041507 Ga0451851_0808634 Ga0451851_0808634_520_1191 223
925 3300041512 Ga0451853_3113601 Ga0451853_3113601_1256_1927 223
926 3300041916 Ga0452271_33868 Ga0452271_33868_560_1231 223
927 3300042007 Ga0439449_0028934 Ga0439449_0028934_1113_1784 223
928 3300042007 Ga0439449_0083622 Ga0439449_0083622_416_1087 223
929 3300045051 Ga0451576_0027253 Ga0451576_0027253_2968_3666 223
930 3300046460 Ga0495638_0067952 Ga0495638_0067952_770_1441 223
931 3300046492 Ga0495585_0011394 Ga0495585_0011394_2799_3470 223
932 3300046500 Ga0495596_0037661 Ga0495596_0037661_793_1464 223
933 3300046501 Ga0495607_0108792 Ga0495607_0108792_365_1036 223
934 3300046506 Ga0495583_0002390 Ga0495583_0002390_8586_9257 223
935 3300046506 Ga0495583_0030249 Ga0495583_0030249_1634_2305 223
936 3300046507 Ga0495606_0094062 Ga0495606_0094062_515_1186 223
937 3300046512 Ga0495610_0020171 Ga0495610_0020171_1861_2532 223
938 3300046515 Ga0495620_0026506 Ga0495620_0026506_1333_2004 223
939 3300046519 Ga0495632_0001060 Ga0495632_0001060_19461_20132 223
940 3300046522 Ga0495643_0024185 Ga0495643_0024185_217_888 223
941 3300046525 Ga0495663_0071992 Ga0495663_0071992_82_753 223
942 3300046528 Ga0495642_0104967 Ga0495642_0104967_187_858 223
943 3300046558 Ga0495633_0043700 Ga0495633_0043700_1390_2061 223
944 3300046558 Ga0495633_0089964 Ga0495633_0089964_284_955 223
945 3300046616 Ga0495668_0002121 Ga0495668_0002121_9226_9897 223
946 3300046616 Ga0495668_0038640 Ga0495668_0038640_1386_2057 223
947 3300046648 Ga0495611_0036306 Ga0495611_0036306_1424_2095 223
948 3300046660 Ga0495625_0013176 Ga0495625_0013176_310_981 223
949 3300046660 Ga0495625_0032622 Ga0495625_0032622_2226_2897 223
950 3300046660 Ga0495625_0096310 Ga0495625_0096310_631_1302 223
951 3300046674 Ga0495588_0048496 Ga0495588_0048496_792_1463 223
952 3300046691 Ga0495670_0018044 Ga0495670_0018044_558_1229 223
953 3300046810 Ga0495660_0024138 Ga0495660_0024138_1049_1720 223
954 3300047443 Ga0495687_041977 Ga0495687_041977_269_940 223
955 3300048905 Ga0496102_0277264 Ga0496102_0277264_97_768 223
956 3300048906 Ga0496103_0021567 Ga0496103_0021567_3106_3777 223
957 3300048919 Ga0496116_0002518 Ga0496116_0002518_12685_13356 223
958 3300048920 Ga0496117_0000337 Ga0496117_0000337_829_1500 223
959 3300048920 Ga0496117_0294232 Ga0496117_0294232_33_704 223
960 3300048921 Ga0496118_0000396 Ga0496118_0000396_51548_52219 223
961 3300048922 Ga0496119_0061593 Ga0496119_0061593_1344_2015 223
962 3300048924 Ga0496121_0001010 Ga0496121_0001010_43417_44088 223
963 3300048924 Ga0496121_0026660 Ga0496121_0026660_27_698 223
964 3300048924 Ga0496121_0070712 Ga0496121_0070712_1756_2427 223
965 3300048925 Ga0496122_0000009 Ga0496122_0000009_89589_90260 223
966 3300048925 Ga0496122_0005649 Ga0496122_0005649_12681_13352 223
967 3300048926 Ga0496123_0000245 Ga0496123_0000245_105280_105951 223
968 3300048926 Ga0496123_0007453 Ga0496123_0007453_3823_4494 223
969 3300048927 Ga0496124_0011797 Ga0496124_0011797_7654_8325 223
970 3300048927 Ga0496124_0040261 Ga0496124_0040261_1469_2140 223
971 3300048927 Ga0496124_0055241 Ga0496124_0055241_1717_2388 223
972 3300048927 Ga0496124_0113923 Ga0496124_0113923_662_1333 223
973 3300048928 Ga0496125_0001996 Ga0496125_0001996_23820_24491 223
974 3300048928 Ga0496125_0007816 Ga0496125_0007816_8605_9276 223
975 3300048929 Ga0496126_0013802 Ga0496126_0013802_3323_3994 223
976 3300048929 Ga0496126_0197395 Ga0496126_0197395_498_1169 223
977 3300049573 Ga0501037_0471594 Ga0501037_0471594_49_720 223
978 3300049574 Ga0501038_0022976 Ga0501038_0022976_3378_4049 223
979 3300049575 Ga0501039_0224841 Ga0501039_0224841_111_782 223
980 3300049581 Ga0501047_0080832 Ga0501047_0080832_2019_2690 223
981 3300049581 Ga0501047_0146204 Ga0501047_0146204_414_1085 223
982 3300049581 Ga0501047_0222714 Ga0501047_0222714_944_1615 223
983 3300049581 Ga0501047_0400812 Ga0501047_0400812_508_1179 223
984 3300049583 Ga0501067_0014029 Ga0501067_0014029_1593_2264 223
985 3300049583 Ga0501067_0029877 Ga0501067_0029877_845_1516 223
986 3300049583 Ga0501067_0244660 Ga0501067_0244660_305_976 223
987 3300049586 Ga0501070_0221657 Ga0501070_0221657_136_807 223
988 3300049589 Ga0501073_0165071 Ga0501073_0165071_405_1076 223
989 3300049589 Ga0501073_0174266 Ga0501073_0174266_399_1070 223
990 3300049589 Ga0501073_0246483 Ga0501073_0246483_64_735 223
991 3300049593 Ga0501077_0063681 Ga0501077_0063681_1379_2050 223
992 3300049593 Ga0501077_0139432 Ga0501077_0139432_600_1271 223
993 3300049741 Ga0501079_0323647 Ga0501079_0323647_21_692 223
994 3300049742 Ga0501080_0131735 Ga0501080_0131735_1630_2301 223
995 3300049742 Ga0501080_0431164 Ga0501080_0431164_51_722 223
996 3300049744 Ga0501083_0006881 Ga0501083_0006881_519_1190 223
997 3300049744 Ga0501083_0012398 Ga0501083_0012398_4938_5609 223
998 3300049744 Ga0501083_0024080 Ga0501083_0024080_509_1180 223
999 3300049823 Ga0501044_0363319 Ga0501044_0363319_239_910 223
1000 3300050489 nmdc:mga03683_103920_c1 nmdc:mga03683_103920_c1_132_803 223
1001 3300050493 nmdc:mga0k408_63022_c1 nmdc:mga0k408_63022_c1_284_955 223
1002 3300050494 nmdc:mga06z11_59422_c1 nmdc:mga06z11_59422_c1_1071_1742 223
1003 3300050516 nmdc:mga0sz30_38904_c1 nmdc:mga0sz30_38904_c1_501_1172 223
1004 3300053079 Ga0500610_0066416 Ga0500610_0066416_513_1184 223
1005 3300053105 Ga0500557_000411 Ga0500557_000411_3511_4182 223
1006 3300053109 Ga0500569_023101 Ga0500569_023101_554_1225 223
1007 3300053122 Ga0500608_061413 Ga0500608_061413_223_894 223
1008 3300053125 Ga0500618_021027 Ga0500618_021027_611_1282 223
1009 3300053139 Ga0500568_0001385 Ga0500568_0001385_4503_5174 223
1010 3300053153 Ga0500616_0000328 Ga0500616_0000328_34764_35435 223
1011 3300053153 Ga0500616_0062840 Ga0500616_0062840_833_1504 223
1012 3300053158 Ga0500627_0045604 Ga0500627_0045604_756_1427 223
1013 3300054114 Ga0501084_0187301 Ga0501084_0187301_908_1579 223
1014 3300054114 Ga0501084_0431811 Ga0501084_0431811_193_864 223
1015 3300054114 Ga0501084_0495700 Ga0501084_0495700_23_694 223
1016 3300059508 Ga0587088_021284 Ga0587088_021284_179_850 223
1017 3300060353 Ga0501082_0037576 Ga0501082_0037576_223_894 223
1018 3300060353 Ga0501082_0090410 Ga0501082_0090410_198_869 223
1019 3300060353 Ga0501082_0185409 Ga0501082_0185409_656_1327 223
1020 3300060353 Ga0501082_0249184 Ga0501082_0249184_110_781 223
1021 3300060353 Ga0501082_0521709 Ga0501082_0521709_315_986 223
1022 3300005341 Ga0070691_10281054 Ga0070691_102810541 224
1023 3300005366 Ga0070659_100095870 Ga0070659_1000958704 224
1024 3300005439 Ga0070711_100902852 Ga0070711_1009028521 224
1025 3300005458 Ga0070681_10075303 Ga0070681_100753032 224
1026 3300005466 Ga0070685_10338153 Ga0070685_103381532 224
1027 3300005563 Ga0068855_100031230 Ga0068855_1000312307 224
1028 3300013104 Ga0157370_10035120 Ga0157370_100351206 224
1029 3300014325 Ga0163163_10315573 Ga0163163_103155732 224
1030 3300025912 Ga0207707_10091118 Ga0207707_100911182 224
1031 3300025915 Ga0207693_10179371 Ga0207693_101793712 224
1032 3300025916 Ga0207663_10134602 Ga0207663_101346022 224
1033 3300025916 Ga0207663_10187840 Ga0207663_101878402 224
1034 3300025932 Ga0207690_10019088 Ga0207690_100190883 224
1035 3300025944 Ga0207661_10767387 Ga0207661_107673871 224
1036 3300025949 Ga0207667_10370050 Ga0207667_103700502 224
1037 3300028556 Ga0265337_1001060 Ga0265337_100106013 224
1038 3300028573 Ga0265334_10014042 Ga0265334_100140423 224
1039 3300028800 Ga0265338_10024220 Ga0265338_1002422012 224
1040 3300031595 Ga0265313_10020505 Ga0265313_100205053 224
1041 3300031712 Ga0265342_10054586 Ga0265342_100545862 224
1042 3300035112 Ga0373932_0080639 Ga0373932_0080639_234_914 224
1043 3300035118 Ga0373954_0223526 Ga0373954_0223526_28_708 224
1044 3300035120 Ga0373957_0127707 Ga0373957_0127707_207_887 224
1045 3300035410 Ga0373924_0028183 Ga0373924_0028183_599_1279 224
1046 3300036401 Ga0373937_0006384 Ga0373937_0006384_2216_2896 224
1047 3300036401 Ga0373937_0096417 Ga0373937_0096417_203_883 224
1048 3300037068 Ga0373925_0262366 Ga0373925_0262366_556_1236 224
1049 3300038443 Ga0395901_0244720 Ga0395901_0244720_1066_1743 224
1050 3300046459 Ga0495629_0330228 Ga0495629_0330228_84_764 224
1051 3300046472 Ga0495580_0050627 Ga0495580_0050627_2035_2715 224
1052 3300046473 Ga0495582_0061724 Ga0495582_0061724_639_1319 224
1053 3300046477 Ga0495664_0242269 Ga0495664_0242269_337_1017 224
1054 3300049568 Ga0501031_0001004 Ga0501031_0001004_8702_9379 224
1055 3300049569 Ga0501032_0006719 Ga0501032_0006719_1525_2202 224
1056 3300049571 Ga0501034_0025228 Ga0501034_0025228_321_998 224
1057 3300049571 Ga0501034_0432178 Ga0501034_0432178_189_866 224
1058 3300049572 Ga0501036_0021174 Ga0501036_0021174_1703_2380 224
1059 3300049573 Ga0501037_0012313 Ga0501037_0012313_226_903 224
1060 3300049574 Ga0501038_0011034 Ga0501038_0011034_321_998 224
1061 3300049575 Ga0501039_0001645 Ga0501039_0001645_1873_2550 224
1062 3300049579 Ga0501043_0038989 Ga0501043_0038989_291_968 224
1063 3300049580 Ga0501046_0074500 Ga0501046_0074500_321_998 224
1064 3300049581 Ga0501047_0040985 Ga0501047_0040985_2800_3477 224
1065 3300049581 Ga0501047_0070746 Ga0501047_0070746_981_1658 224
1066 3300049581 Ga0501047_0243564 Ga0501047_0243564_320_1000 224
1067 3300049582 Ga0501048_0000472 Ga0501048_0000472_10034_10711 224
1068 3300049583 Ga0501067_0000670 Ga0501067_0000670_15337_16014 224
1069 3300049584 Ga0501068_0005529 Ga0501068_0005529_3848_4525 224
1070 3300049585 Ga0501069_0009734 Ga0501069_0009734_2792_3469 224
1071 3300049586 Ga0501070_0031086 Ga0501070_0031086_1298_1975 224
1072 3300049588 Ga0501072_0037555 Ga0501072_0037555_2073_2750 224
1073 3300049589 Ga0501073_0035965 Ga0501073_0035965_163_840 224
1074 3300049590 Ga0501074_0011675 Ga0501074_0011675_2234_2911 224
1075 3300049741 Ga0501079_0002380 Ga0501079_0002380_5264_5941 224
1076 3300049742 Ga0501080_0063381 Ga0501080_0063381_1764_2441 224
1077 3300049742 Ga0501080_0230141 Ga0501080_0230141_939_1616 224
1078 3300049744 Ga0501083_0014089 Ga0501083_0014089_1872_2549 224
1079 3300049822 Ga0501035_0042979 Ga0501035_0042979_604_1281 224
1080 3300049822 Ga0501035_0057766 Ga0501035_0057766_1459_2136 224
1081 3300049823 Ga0501044_0098850 Ga0501044_0098850_1764_2441 224
1082 3300049823 Ga0501044_0165279 Ga0501044_0165279_68_745 224
1083 3300049823 Ga0501044_0453188 Ga0501044_0453188_82_759 224
1084 3300049824 Ga0501045_0022366 Ga0501045_0022366_891_1568 224
1085 3300054114 Ga0501084_0002711 Ga0501084_0002711_10966_11643 224
1086 3300060353 Ga0501082_0004451 Ga0501082_0004451_5281_5958 224
1087 3300005327 Ga0070658_10075769 Ga0070658_100757693 225
1088 3300009177 Ga0105248_10000001 Ga0105248_10000001983 225
1089 3300025284 Ga0209130_1006639 Ga0209130_10066394 225
1090 3300025294 Ga0209025_1027419 Ga0209025_10274194 225
1091 3300025297 Ga0209758_1050100 Ga0209758_10501002 225
1092 3300025909 Ga0207705_10456138 Ga0207705_104561382 225
1093 3300025941 Ga0207711_10000001 Ga0207711_10000001888 225
1094 3300028577 Ga0265318_10000017 Ga0265318_1000001768 225
1095 3300028794 Ga0307515_10002710 Ga0307515_1000271030 225
1096 3300028794 Ga0307515_10004674 Ga0307515_1000467417 225
1097 3300031235 Ga0265330_10050437 Ga0265330_100504372 225
1098 3300031247 Ga0265340_10000034 Ga0265340_1000003422 225
1099 3300031247 Ga0265340_10005311 Ga0265340_100053113 225
1100 3300031247 Ga0265340_10021397 Ga0265340_100213975 225
1101 3300031250 Ga0265331_10046236 Ga0265331_100462362 225
1102 3300031344 Ga0265316_10003849 Ga0265316_1000384911 225
1103 3300031344 Ga0265316_10004511 Ga0265316_100045118 225
1104 3300031456 Ga0307513_10333325 Ga0307513_103333252 225
1105 3300031548 Ga0307408_100082301 Ga0307408_1000823012 225
1106 3300031595 Ga0265313_10021178 Ga0265313_100211784 225
1107 3300031711 Ga0265314_10026379 Ga0265314_100263797 225
1108 3300031712 Ga0265342_10008913 Ga0265342_100089132 225
1109 3300031911 Ga0307412_10190210 Ga0307412_101902102 225
1110 3300042015 Ga0439462_0030871 Ga0439462_0030871_505_1191 225
1111 3300042145 Ga0450906_003427 Ga0450906_003427_1445_2131 225
1112 3300042531 Ga0450918_010433 Ga0450918_010433_612_1298 225
1113 3300049570 Ga0501033_0078329 Ga0501033_0078329_561_1238 225
1114 3300049580 Ga0501046_0196199 Ga0501046_0196199_91_768 225
1115 3300049581 Ga0501047_0038567 Ga0501047_0038567_1003_1680 225
1116 3300049581 Ga0501047_0348346 Ga0501047_0348346_413_1138 225
1117 3300049586 Ga0501070_0026046 Ga0501070_0026046_1591_2274 225
1118 3300049588 Ga0501072_0064402 Ga0501072_0064402_2064_2744 225
1119 3300049822 Ga0501035_0039706 Ga0501035_0039706_1286_1963 225
1120 3300049822 Ga0501035_0154005 Ga0501035_0154005_1125_1802 225
1121 3300049823 Ga0501044_0003131 Ga0501044_0003131_12506_13183 225
1122 3300049823 Ga0501044_0013067 Ga0501044_0013067_4570_5256 225
1123 3300049823 Ga0501044_0020172 Ga0501044_0020172_701_1378 225
1124 3300001915 JGI24741J21665_1001068 JGI24741J21665_10010683 226
1125 3300001979 JGI24740J21852_10011169 JGI24740J21852_100111692 226
1126 3300001989 JGI24739J22299_10014633 JGI24739J22299_100146334 226
1127 3300001990 JGI24737J22298_10010599 JGI24737J22298_100105992 226
1128 3300001990 JGI24737J22298_10018602 JGI24737J22298_100186024 226
1129 3300003214 JGI25165J46597_1000017 JGI25165J46597_100001775 226
1130 3300003215 JGI25153J46596_10000021 JGI25153J46596_10000021103 226
1131 3300003215 JGI25153J46596_10000755 JGI25153J46596_100007558 226
1132 3300003759 Ga0055525_1000070 Ga0055525_100007040 226
1133 3300003762 Ga0055542_1000102 Ga0055542_100010214 226
1134 3300003763 Ga0055529_1000136 Ga0055529_10001362 226
1135 3300005262 Ga0065165_1045465 Ga0065165_10454652 226
1136 3300005327 Ga0070658_10010959 Ga0070658_100109592 226
1137 3300005327 Ga0070658_10053726 Ga0070658_100537263 226
1138 3300005328 Ga0070676_10005044 Ga0070676_100050443 226
1139 3300005330 Ga0070690_100400562 Ga0070690_1004005622 226
1140 3300005331 Ga0070670_100091084 Ga0070670_1000910843 226
1141 3300005331 Ga0070670_100098407 Ga0070670_1000984074 226
1142 3300005334 Ga0068869_100003248 Ga0068869_1000032485 226
1143 3300005335 Ga0070666_10005936 Ga0070666_100059363 226
1144 3300005336 Ga0070680_100000100 Ga0070680_10000010065 226
1145 3300005336 Ga0070680_100096703 Ga0070680_1000967032 226
1146 3300005338 Ga0068868_100156958 Ga0068868_1001569581 226
1147 3300005338 Ga0068868_100468459 Ga0068868_1004684591 226
1148 3300005339 Ga0070660_100004214 Ga0070660_1000042147 226
1149 3300005339 Ga0070660_100017038 Ga0070660_1000170384 226
1150 3300005339 Ga0070660_100058836 Ga0070660_1000588362 226
1151 3300005339 Ga0070660_100579161 Ga0070660_1005791612 226
1152 3300005340 Ga0070689_100219546 Ga0070689_1002195462 226
1153 3300005341 Ga0070691_10001507 Ga0070691_100015075 226
1154 3300005344 Ga0070661_100000160 Ga0070661_10000016015 226
1155 3300005344 Ga0070661_100010954 Ga0070661_1000109542 226
1156 3300005344 Ga0070661_100034466 Ga0070661_1000344662 226
1157 3300005344 Ga0070661_100302359 Ga0070661_1003023592 226
1158 3300005347 Ga0070668_100146586 Ga0070668_1001465862 226
1159 3300005354 Ga0070675_100274295 Ga0070675_1002742952 226
1160 3300005356 Ga0070674_100101869 Ga0070674_1001018692 226
1161 3300005364 Ga0070673_100031659 Ga0070673_1000316592 226
1162 3300005365 Ga0070688_100203110 Ga0070688_1002031102 226
1163 3300005366 Ga0070659_100028368 Ga0070659_1000283682 226
1164 3300005367 Ga0070667_100122040 Ga0070667_1001220402 226
1165 3300005435 Ga0070714_100022269 Ga0070714_1000222694 226
1166 3300005436 Ga0070713_100061009 Ga0070713_1000610092 226
1167 3300005437 Ga0070710_10334401 Ga0070710_103344012 226
1168 3300005439 Ga0070711_100635050 Ga0070711_1006350502 226
1169 3300005456 Ga0070678_100000139 Ga0070678_10000013916 226
1170 3300005456 Ga0070678_100262262 Ga0070678_1002622622 226
1171 3300005456 Ga0070678_100837028 Ga0070678_1008370281 226
1172 3300005458 Ga0070681_10000003 Ga0070681_10000003112 226
1173 3300005458 Ga0070681_10040066 Ga0070681_100400662 226
1174 3300005459 Ga0068867_100018286 Ga0068867_1000182864 226
1175 3300005459 Ga0068867_100100775 Ga0068867_1001007752 226
1176 3300005459 Ga0068867_100412646 Ga0068867_1004126461 226
1177 3300005530 Ga0070679_100001255 Ga0070679_1000012558 226
1178 3300005530 Ga0070679_100015724 Ga0070679_1000157247 226
1179 3300005530 Ga0070679_100353154 Ga0070679_1003531542 226
1180 3300005535 Ga0070684_100245317 Ga0070684_1002453172 226
1181 3300005539 Ga0068853_100029148 Ga0068853_1000291482 226
1182 3300005539 Ga0068853_100063732 Ga0068853_1000637324 226
1183 3300005539 Ga0068853_100147644 Ga0068853_1001476441 226
1184 3300005539 Ga0068853_100203524 Ga0068853_1002035242 226
1185 3300005543 Ga0070672_100054920 Ga0070672_1000549203 226
1186 3300005544 Ga0070686_100642102 Ga0070686_1006421021 226
1187 3300005547 Ga0070693_100187440 Ga0070693_1001874402 226
1188 3300005548 Ga0070665_100001553 Ga0070665_10000155326 226
1189 3300005548 Ga0070665_100316226 Ga0070665_1003162262 226
1190 3300005563 Ga0068855_100000374 Ga0068855_10000037455 226
1191 3300005563 Ga0068855_100025478 Ga0068855_1000254784 226
1192 3300005563 Ga0068855_100716604 Ga0068855_1007166041 226
1193 3300005564 Ga0070664_100248465 Ga0070664_1002484651 226
1194 3300005577 Ga0068857_100066779 Ga0068857_1000667795 226
1195 3300005719 Ga0068861_100038208 Ga0068861_1000382083 226
1196 3300005719 Ga0068861_100078905 Ga0068861_1000789052 226
1197 3300005841 Ga0068863_100171572 Ga0068863_1001715722 226
1198 3300005842 Ga0068858_100122719 Ga0068858_1001227193 226
1199 3300005842 Ga0068858_100404699 Ga0068858_1004046992 226
1200 3300005843 Ga0068860_100152944 Ga0068860_1001529442 226
1201 3300005844 Ga0068862_100046983 Ga0068862_1000469833 226
1202 3300006195 Ga0075366_10012273 Ga0075366_100122735 226
1203 3300006237 Ga0097621_100073785 Ga0097621_1000737853 226
1204 3300006358 Ga0068871_100026285 Ga0068871_1000262855 226
1205 3300006358 Ga0068871_100165022 Ga0068871_1001650221 226
1206 3300009093 Ga0105240_10002036 Ga0105240_1000203627 226
1207 3300009093 Ga0105240_10410921 Ga0105240_104109212 226
1208 3300009093 Ga0105240_10434757 Ga0105240_104347573 226
1209 3300009093 Ga0105240_10488377 Ga0105240_104883772 226
1210 3300009098 Ga0105245_10072143 Ga0105245_100721432 226
1211 3300009098 Ga0105245_10952398 Ga0105245_109523981 226
1212 3300009101 Ga0105247_10080264 Ga0105247_100802643 226
1213 3300009101 Ga0105247_10102920 Ga0105247_101029202 226
1214 3300009101 Ga0105247_10417463 Ga0105247_104174632 226
1215 3300009148 Ga0105243_10000367 Ga0105243_1000036721 226
1216 3300009148 Ga0105243_10007689 Ga0105243_100076894 226
1217 3300009174 Ga0105241_10044755 Ga0105241_100447553 226
1218 3300009174 Ga0105241_10051327 Ga0105241_100513273 226
1219 3300009174 Ga0105241_10077387 Ga0105241_100773873 226
1220 3300009174 Ga0105241_10078979 Ga0105241_100789792 226
1221 3300009176 Ga0105242_10012664 Ga0105242_100126643 226
1222 3300009176 Ga0105242_10043250 Ga0105242_100432503 226
1223 3300009176 Ga0105242_10048929 Ga0105242_100489293 226
1224 3300009177 Ga0105248_10091837 Ga0105248_100918373 226
1225 3300009545 Ga0105237_10139538 Ga0105237_101395382 226
1226 3300009545 Ga0105237_10162691 Ga0105237_101626912 226
1227 3300009545 Ga0105237_10175205 Ga0105237_101752052 226
1228 3300009545 Ga0105237_10315632 Ga0105237_103156322 226
1229 3300009545 Ga0105237_10320520 Ga0105237_103205201 226
1230 3300009551 Ga0105238_10007661 Ga0105238_100076616 226
1231 3300009551 Ga0105238_10009150 Ga0105238_100091505 226
1232 3300009551 Ga0105238_10019021 Ga0105238_100190213 226
1233 3300009551 Ga0105238_10051343 Ga0105238_100513434 226
1234 3300009553 Ga0105249_10219821 Ga0105249_102198212 226
1235 3300010375 Ga0105239_10047501 Ga0105239_100475013 226
1236 3300011119 Ga0105246_10089264 Ga0105246_100892642 226
1237 3300011119 Ga0105246_10186534 Ga0105246_101865342 226
1238 3300013100 Ga0157373_10037466 Ga0157373_100374665 226
1239 3300013100 Ga0157373_10071232 Ga0157373_100712322 226
1240 3300013102 Ga0157371_10000066 Ga0157371_100000665 226
1241 3300013104 Ga0157370_10001228 Ga0157370_100012287 226
1242 3300013104 Ga0157370_10061333 Ga0157370_100613333 226
1243 3300013105 Ga0157369_10237916 Ga0157369_102379162 226
1244 3300013105 Ga0157369_10495606 Ga0157369_104956062 226
1245 3300013296 Ga0157374_10097921 Ga0157374_100979212 226
1246 3300013297 Ga0157378_10013145 Ga0157378_100131453 226
1247 3300013297 Ga0157378_10327659 Ga0157378_103276592 226
1248 3300013307 Ga0157372_10004646 Ga0157372_1000464610 226
1249 3300013307 Ga0157372_10011401 Ga0157372_100114018 226
1250 3300013307 Ga0157372_10049388 Ga0157372_100493883 226
1251 3300013307 Ga0157372_10116365 Ga0157372_101163653 226
1252 3300013308 Ga0157375_10034969 Ga0157375_100349692 226
1253 3300013308 Ga0157375_10367931 Ga0157375_103679312 226
1254 3300014325 Ga0163163_10000004 Ga0163163_10000004308 226
1255 3300014968 Ga0157379_10299080 Ga0157379_102990802 226
1256 3300014969 Ga0157376_10009191 Ga0157376_100091915 226
1257 3300014969 Ga0157376_10194471 Ga0157376_101944712 226
1258 3300017792 Ga0163161_10040297 Ga0163161_100402971 226
1259 3300017792 Ga0163161_10059986 Ga0163161_100599862 226
1260 3300021377 Ga0213874_10025338 Ga0213874_100253382 226
1261 3300021384 Ga0213876_10000498 Ga0213876_1000049835 226
1262 3300025226 Ga0209674_108574 Ga0209674_1085742 226
1263 3300025230 Ga0209563_100053 Ga0209563_100053157 226
1264 3300025231 Ga0207427_107239 Ga0207427_1072392 226
1265 3300025253 Ga0209677_107461 Ga0209677_1074612 226
1266 3300025254 Ga0209148_1000159 Ga0209148_100015934 226
1267 3300025261 Ga0209233_1000006 Ga0209233_1000006265 226
1268 3300025261 Ga0209233_1015113 Ga0209233_10151132 226
1269 3300025272 Ga0209455_1000045 Ga0209455_1000045109 226
1270 3300025272 Ga0209455_1005227 Ga0209455_10052277 226
1271 3300025297 Ga0209758_1000008 Ga0209758_1000008754 226
1272 3300025297 Ga0209758_1000023 Ga0209758_1000023180 226
1273 3300025315 Ga0207697_10170076 Ga0207697_101700762 226
1274 3300025893 Ga0207682_10089646 Ga0207682_100896462 226
1275 3300025900 Ga0207710_10073682 Ga0207710_100736822 226
1276 3300025901 Ga0207688_10008993 Ga0207688_100089932 226
1277 3300025901 Ga0207688_10106656 Ga0207688_101066563 226
1278 3300025903 Ga0207680_10012613 Ga0207680_100126134 226
1279 3300025903 Ga0207680_10106423 Ga0207680_101064232 226
1280 3300025904 Ga0207647_10042328 Ga0207647_100423283 226
1281 3300025907 Ga0207645_10025706 Ga0207645_100257065 226
1282 3300025907 Ga0207645_10025773 Ga0207645_100257733 226
1283 3300025907 Ga0207645_10122587 Ga0207645_101225872 226
1284 3300025908 Ga0207643_10076875 Ga0207643_100768752 226
1285 3300025909 Ga0207705_10001090 Ga0207705_1000109016 226
1286 3300025909 Ga0207705_10002561 Ga0207705_1000256113 226
1287 3300025909 Ga0207705_10030747 Ga0207705_100307472 226
1288 3300025909 Ga0207705_10187404 Ga0207705_101874042 226
1289 3300025911 Ga0207654_10000436 Ga0207654_1000043620 226
1290 3300025911 Ga0207654_10023858 Ga0207654_100238581 226
1291 3300025911 Ga0207654_10158876 Ga0207654_101588762 226
1292 3300025911 Ga0207654_10325064 Ga0207654_103250642 226
1293 3300025912 Ga0207707_10000001 Ga0207707_10000001939 226
1294 3300025912 Ga0207707_10000849 Ga0207707_100008496 226
1295 3300025913 Ga0207695_10000004 Ga0207695_10000004497 226
1296 3300025913 Ga0207695_10134158 Ga0207695_101341582 226
1297 3300025913 Ga0207695_10323551 Ga0207695_103235512 226
1298 3300025914 Ga0207671_10165169 Ga0207671_101651692 226
1299 3300025915 Ga0207693_10479473 Ga0207693_104794732 226
1300 3300025916 Ga0207663_10487650 Ga0207663_104876502 226
1301 3300025917 Ga0207660_10000081 Ga0207660_1000008130 226
1302 3300025917 Ga0207660_10000597 Ga0207660_100005976 226
1303 3300025919 Ga0207657_10000129 Ga0207657_1000012970 226
1304 3300025919 Ga0207657_10029697 Ga0207657_100296973 226
1305 3300025919 Ga0207657_10063239 Ga0207657_100632393 226
1306 3300025920 Ga0207649_10000029 Ga0207649_1000002979 226
1307 3300025920 Ga0207649_10002212 Ga0207649_100022125 226
1308 3300025920 Ga0207649_10191186 Ga0207649_101911862 226
1309 3300025921 Ga0207652_10000413 Ga0207652_1000041311 226
1310 3300025921 Ga0207652_10001120 Ga0207652_1000112019 226
1311 3300025921 Ga0207652_10040972 Ga0207652_100409722 226
1312 3300025924 Ga0207694_10000044 Ga0207694_10000044153 226
1313 3300025924 Ga0207694_10007860 Ga0207694_100078603 226
1314 3300025924 Ga0207694_10010063 Ga0207694_100100634 226
1315 3300025924 Ga0207694_10139800 Ga0207694_101398002 226
1316 3300025924 Ga0207694_10147588 Ga0207694_101475881 226
1317 3300025924 Ga0207694_10358826 Ga0207694_103588262 226
1318 3300025925 Ga0207650_10075462 Ga0207650_100754622 226
1319 3300025926 Ga0207659_10211292 Ga0207659_102112922 226
1320 3300025927 Ga0207687_10040805 Ga0207687_100408052 226
1321 3300025927 Ga0207687_10201009 Ga0207687_102010092 226
1322 3300025929 Ga0207664_10028363 Ga0207664_100283632 226
1323 3300025933 Ga0207706_10087732 Ga0207706_100877323 226
1324 3300025934 Ga0207686_10027757 Ga0207686_100277573 226
1325 3300025934 Ga0207686_10076356 Ga0207686_100763562 226
1326 3300025934 Ga0207686_10109017 Ga0207686_101090173 226
1327 3300025934 Ga0207686_10134106 Ga0207686_101341062 226
1328 3300025935 Ga0207709_10000047 Ga0207709_1000004791 226
1329 3300025935 Ga0207709_10006691 Ga0207709_100066915 226
1330 3300025937 Ga0207669_10000361 Ga0207669_100003615 226
1331 3300025937 Ga0207669_10002871 Ga0207669_100028715 226
1332 3300025938 Ga0207704_10252729 Ga0207704_102527292 226
1333 3300025938 Ga0207704_10602279 Ga0207704_106022792 226
1334 3300025939 Ga0207665_10257339 Ga0207665_102573392 226
1335 3300025940 Ga0207691_10089139 Ga0207691_100891392 226
1336 3300025941 Ga0207711_10066517 Ga0207711_100665171 226
1337 3300025942 Ga0207689_10002603 Ga0207689_100026033 226
1338 3300025942 Ga0207689_10140017 Ga0207689_101400171 226
1339 3300025945 Ga0207679_10519475 Ga0207679_105194752 226
1340 3300025949 Ga0207667_10000001 Ga0207667_1000000140 226
1341 3300025949 Ga0207667_10000012 Ga0207667_10000012316 226
1342 3300025949 Ga0207667_10062277 Ga0207667_100622775 226
1343 3300025949 Ga0207667_10465960 Ga0207667_104659601 226
1344 3300025961 Ga0207712_10020572 Ga0207712_100205722 226
1345 3300025981 Ga0207640_10001051 Ga0207640_100010518 226
1346 3300025986 Ga0207658_10015385 Ga0207658_100153854 226
1347 3300025986 Ga0207658_10042984 Ga0207658_100429842 226
1348 3300026023 Ga0207677_10057690 Ga0207677_100576902 226
1349 3300026023 Ga0207677_10108335 Ga0207677_101083352 226
1350 3300026023 Ga0207677_10582686 Ga0207677_105826862 226
1351 3300026035 Ga0207703_10160826 Ga0207703_101608262 226
1352 3300026035 Ga0207703_10729714 Ga0207703_107297141 226
1353 3300026041 Ga0207639_10003115 Ga0207639_100031153 226
1354 3300026041 Ga0207639_10020962 Ga0207639_100209624 226
1355 3300026041 Ga0207639_10062536 Ga0207639_100625362 226
1356 3300026041 Ga0207639_10255781 Ga0207639_102557812 226
1357 3300026078 Ga0207702_10004975 Ga0207702_1000497511 226
1358 3300026078 Ga0207702_10365173 Ga0207702_103651732 226
1359 3300026088 Ga0207641_10024349 Ga0207641_100243493 226
1360 3300026088 Ga0207641_10179019 Ga0207641_101790193 226
1361 3300026089 Ga0207648_10060368 Ga0207648_100603684 226
1362 3300026095 Ga0207676_10562852 Ga0207676_105628522 226
1363 3300026116 Ga0207674_10089492 Ga0207674_100894921 226
1364 3300026116 Ga0207674_10100136 Ga0207674_101001362 226
1365 3300026116 Ga0207674_10110585 Ga0207674_101105853 226
1366 3300026118 Ga0207675_100119035 Ga0207675_1001190353 226
1367 3300026118 Ga0207675_100181377 Ga0207675_1001813772 226
1368 3300026121 Ga0207683_10001314 Ga0207683_1000131417 226
1369 3300026121 Ga0207683_10002290 Ga0207683_1000229011 226
1370 3300026121 Ga0207683_10048501 Ga0207683_100485012 226
1371 3300026121 Ga0207683_10226751 Ga0207683_102267512 226
1372 3300026121 Ga0207683_11029538 Ga0207683_110295381 226
1373 3300026142 Ga0207698_10005731 Ga0207698_100057314 226
1374 3300026142 Ga0207698_10025036 Ga0207698_100250362 226
1375 3300028379 Ga0268266_10000930 Ga0268266_1000093034 226
1376 3300028379 Ga0268266_10017542 Ga0268266_100175425 226
1377 3300028380 Ga0268265_10338674 Ga0268265_103386742 226
1378 3300028380 Ga0268265_10574150 Ga0268265_105741502 226
1379 3300028381 Ga0268264_10155553 Ga0268264_101555532 226
1380 3300028381 Ga0268264_10227463 Ga0268264_102274632 226
1381 3300028573 Ga0265334_10022394 Ga0265334_100223944 226
1382 3300028800 Ga0265338_10000006 Ga0265338_10000006589 226
1383 3300028800 Ga0265338_10005866 Ga0265338_1000586619 226
1384 3300028800 Ga0265338_10030101 Ga0265338_100301014 226
1385 3300028800 Ga0265338_10127248 Ga0265338_101272482 226
1386 3300031235 Ga0265330_10009666 Ga0265330_100096665 226
1387 3300031238 Ga0265332_10011135 Ga0265332_100111353 226
1388 3300031238 Ga0265332_10027800 Ga0265332_100278003 226
1389 3300031241 Ga0265325_10000003 Ga0265325_10000003233 226
1390 3300031247 Ga0265340_10016049 Ga0265340_100160497 226
1391 3300031247 Ga0265340_10017168 Ga0265340_100171683 226
1392 3300031247 Ga0265340_10123992 Ga0265340_101239922 226
1393 3300031249 Ga0265339_10002825 Ga0265339_100028252 226
1394 3300031249 Ga0265339_10033057 Ga0265339_100330575 226
1395 3300031250 Ga0265331_10000006 Ga0265331_10000006279 226
1396 3300031250 Ga0265331_10001232 Ga0265331_100012324 226
1397 3300031250 Ga0265331_10002603 Ga0265331_100026032 226
1398 3300031250 Ga0265331_10094698 Ga0265331_100946982 226
1399 3300031251 Ga0265327_10000808 Ga0265327_1000080835 226
1400 3300031456 Ga0307513_10248145 Ga0307513_102481452 226
1401 3300031595 Ga0265313_10001127 Ga0265313_1000112712 226
1402 3300031595 Ga0265313_10006358 Ga0265313_100063587 226
1403 3300031595 Ga0265313_10029615 Ga0265313_100296152 226
1404 3300031665 Ga0316575_10121046 Ga0316575_101210462 226
1405 3300031711 Ga0265314_10017444 Ga0265314_100174444 226
1406 3300031711 Ga0265314_10018730 Ga0265314_100187304 226
1407 3300031711 Ga0265314_10068284 Ga0265314_100682844 226
1408 3300031711 Ga0265314_10076877 Ga0265314_100768772 226
1409 3300031712 Ga0265342_10074115 Ga0265342_100741152 226
1410 3300031730 Ga0307516_10010120 Ga0307516_100101204 226
1411 3300031730 Ga0307516_10037175 Ga0307516_100371752 226
1412 3300031730 Ga0307516_10260199 Ga0307516_102601992 226
1413 3300032126 Ga0307415_100474320 Ga0307415_1004743202 226
1414 3300033180 Ga0307510_10197499 Ga0307510_101974992 226
1415 3300036401 Ga0373937_0400258 Ga0373937_0400258_554_1243 226
1416 3300036647 Ga0316582_0113749 Ga0316582_0113749_767_1450 226
1417 3300036712 Ga0316584_0410610 Ga0316584_0410610_24_707 226
1418 3300037312 Ga0395899_0121668 Ga0395899_0121668_99_785 226
1419 3300037312 Ga0395899_0185078 Ga0395899_0185078_352_1032 226
1420 3300037418 Ga0395900_0006457 Ga0395900_0006457_10699_11385 226
1421 3300037466 Ga0395898_0050299 Ga0395898_0050299_3189_3875 226
1422 3300038443 Ga0395901_0085316 Ga0395901_0085316_592_1278 226
1423 3300039437 Ga0436365_0605749 Ga0436365_0605749_282_968 226
1424 3300039437 Ga0436365_0817918 Ga0436365_0817918_4427_5116 226
1425 3300039438 Ga0436360_0879069 Ga0436360_0879069_1439_2203 226
1426 3300039450 Ga0436363_1603152 Ga0436363_1603152_860_1549 226
1427 3300041452 Ga0451793_1440556 Ga0451793_1440556_25_711 226
1428 3300044694 Ga0466963_0114634 Ga0466963_0114634_1101_1787 226
1429 3300044842 Ga0466957_0026460 Ga0466957_0026460_873_1559 226
1430 3300046454 Ga0495592_0149599 Ga0495592_0149599_523_1212 226
1431 3300046459 Ga0495629_0048637 Ga0495629_0048637_788_1480 226
1432 3300046471 Ga0495650_0000644 Ga0495650_0000644_29141_29821 226
1433 3300046472 Ga0495580_0006620 Ga0495580_0006620_5493_6185 226
1434 3300046473 Ga0495582_0017413 Ga0495582_0017413_2207_2899 226
1435 3300046491 Ga0495584_0162093 Ga0495584_0162093_113_793 226
1436 3300046500 Ga0495596_0049562 Ga0495596_0049562_358_1038 226
1437 3300046506 Ga0495583_0008443 Ga0495583_0008443_790_1470 226
1438 3300046506 Ga0495583_0011239 Ga0495583_0011239_2058_2738 226
1439 3300046507 Ga0495606_0003115 Ga0495606_0003115_13794_14474 226
1440 3300046513 Ga0495616_0131817 Ga0495616_0131817_249_935 226
1441 3300046516 Ga0495628_0361359 Ga0495628_0361359_178_867 226
1442 3300046518 Ga0495631_0075521 Ga0495631_0075521_71_751 226
1443 3300046520 Ga0495637_0160131 Ga0495637_0160131_83_763 226
1444 3300046522 Ga0495643_0001349 Ga0495643_0001349_14171_14851 226
1445 3300046522 Ga0495643_0001424 Ga0495643_0001424_9597_10277 226
1446 3300046522 Ga0495643_0021448 Ga0495643_0021448_2333_3013 226
1447 3300046524 Ga0495648_0000122 Ga0495648_0000122_51563_52243 226
1448 3300046525 Ga0495663_0005658 Ga0495663_0005658_666_1346 226
1449 3300046528 Ga0495642_0008427 Ga0495642_0008427_1190_1870 226
1450 3300046529 Ga0495652_0113615 Ga0495652_0113615_1316_2005 226
1451 3300046529 Ga0495652_0529904 Ga0495652_0529904_95_781 226
1452 3300046530 Ga0495654_0190001 Ga0495654_0190001_188_874 226
1453 3300046538 Ga0495609_0019743 Ga0495609_0019743_1605_2291 226
1454 3300046543 Ga0495645_0039649 Ga0495645_0039649_1583_2272 226
1455 3300046557 Ga0495622_0001189 Ga0495622_0001189_9522_10208 226
1456 3300046558 Ga0495633_0005483 Ga0495633_0005483_725_1405 226
1457 3300046616 Ga0495668_0000377 Ga0495668_0000377_31625_32305 226
1458 3300046648 Ga0495611_0015937 Ga0495611_0015937_985_1665 226
1459 3300046660 Ga0495625_0001416 Ga0495625_0001416_12078_12758 226
1460 3300046660 Ga0495625_0008470 Ga0495625_0008470_1797_2477 226
1461 3300046660 Ga0495625_0040459 Ga0495625_0040459_1973_2653 226
1462 3300046665 Ga0495661_0078481 Ga0495661_0078481_56_736 226
1463 3300046683 Ga0495658_0002459 Ga0495658_0002459_5877_6569 226
1464 3300046684 Ga0495669_0000773 Ga0495669_0000773_6682_7362 226
1465 3300046691 Ga0495670_0092919 Ga0495670_0092919_356_1042 226
1466 3300046809 Ga0495600_0004633 Ga0495600_0004633_1348_2028 226
1467 3300046809 Ga0495600_0177057 Ga0495600_0177057_203_895 226
1468 3300047315 Ga0495581_0038894 Ga0495581_0038894_435_1127 226
1469 3300047323 Ga0495683_0008061 Ga0495683_0008061_3205_3885 226
1470 3300047443 Ga0495687_000392 Ga0495687_000392_22736_23416 226
1471 3300047443 Ga0495687_005666 Ga0495687_005666_725_1405 226
1472 3300047444 Ga0495675_0161026 Ga0495675_0161026_326_1018 226
1473 3300047470 Ga0495681_0133831 Ga0495681_0133831_160_858 226
1474 3300048906 Ga0496103_0000165 Ga0496103_0000165_41880_42560 226
1475 3300048908 Ga0496105_0000467 Ga0496105_0000467_13279_13959 226
1476 3300048912 Ga0496109_0053887 Ga0496109_0053887_1419_2099 226
1477 3300048917 Ga0496114_0007452 Ga0496114_0007452_4262_4942 226
1478 3300048918 Ga0496115_0000202 Ga0496115_0000202_25542_26222 226
1479 3300048918 Ga0496115_0110634 Ga0496115_0110634_78_764 226
1480 3300048918 Ga0496115_0285674 Ga0496115_0285674_161_847 226
1481 3300048919 Ga0496116_0011379 Ga0496116_0011379_2197_2877 226
1482 3300048920 Ga0496117_0000616 Ga0496117_0000616_27027_27707 226
1483 3300048921 Ga0496118_0000425 Ga0496118_0000425_41868_42548 226
1484 3300048922 Ga0496119_0006225 Ga0496119_0006225_1865_2545 226
1485 3300048924 Ga0496121_0000796 Ga0496121_0000796_27107_27787 226
1486 3300048924 Ga0496121_0002450 Ga0496121_0002450_22817_23503 226
1487 3300048925 Ga0496122_0003726 Ga0496122_0003726_5716_6396 226
1488 3300048927 Ga0496124_0000468 Ga0496124_0000468_41892_42572 226
1489 3300048928 Ga0496125_0000704 Ga0496125_0000704_29869_30549 226
1490 3300048929 Ga0496126_0000563 Ga0496126_0000563_27005_27685 226
1491 3300049460 Ga0495682_0002267 Ga0495682_0002267_8009_8698 226
1492 3300049568 Ga0501031_0369430 Ga0501031_0369430_230_913 226
1493 3300049569 Ga0501032_0282253 Ga0501032_0282253_175_864 226
1494 3300049570 Ga0501033_0007260 Ga0501033_0007260_751_1434 226
1495 3300049570 Ga0501033_0038110 Ga0501033_0038110_598_1290 226
1496 3300049570 Ga0501033_0058328 Ga0501033_0058328_952_1638 226
1497 3300049570 Ga0501033_0193801 Ga0501033_0193801_528_1217 226
1498 3300049571 Ga0501034_0007556 Ga0501034_0007556_7475_8179 226
1499 3300049571 Ga0501034_0040458 Ga0501034_0040458_1868_2554 226
1500 3300049571 Ga0501034_0043919 Ga0501034_0043919_239_931 226
1501 3300049571 Ga0501034_0106710 Ga0501034_0106710_1655_2359 226
1502 3300049572 Ga0501036_0083022 Ga0501036_0083022_581_1273 226
1503 3300049573 Ga0501037_0070110 Ga0501037_0070110_108_797 226
1504 3300049574 Ga0501038_0017603 Ga0501038_0017603_5464_6156 226
1505 3300049574 Ga0501038_0172537 Ga0501038_0172537_738_1427 226
1506 3300049575 Ga0501039_0133607 Ga0501039_0133607_1040_1729 226
1507 3300049579 Ga0501043_0014535 Ga0501043_0014535_4803_5495 226
1508 3300049579 Ga0501043_0123343 Ga0501043_0123343_285_974 226
1509 3300049579 Ga0501043_0188567 Ga0501043_0188567_306_989 226
1510 3300049580 Ga0501046_0083008 Ga0501046_0083008_1673_2365 226
1511 3300049580 Ga0501046_0125819 Ga0501046_0125819_1105_1842 226
1512 3300049580 Ga0501046_0147624 Ga0501046_0147624_117_803 226
1513 3300049581 Ga0501047_0004801 Ga0501047_0004801_8247_8933 226
1514 3300049581 Ga0501047_0006325 Ga0501047_0006325_3030_3713 226
1515 3300049581 Ga0501047_0007771 Ga0501047_0007771_1020_1724 226
1516 3300049581 Ga0501047_0010400 Ga0501047_0010400_295_1032 226
1517 3300049581 Ga0501047_0014769 Ga0501047_0014769_5096_5788 226
1518 3300049581 Ga0501047_0081339 Ga0501047_0081339_1297_1983 226
1519 3300049581 Ga0501047_0095776 Ga0501047_0095776_1455_2141 226
1520 3300049581 Ga0501047_0259535 Ga0501047_0259535_513_1217 226
1521 3300049581 Ga0501047_0359305 Ga0501047_0359305_307_996 226
1522 3300049583 Ga0501067_0024138 Ga0501067_0024138_277_981 226
1523 3300049583 Ga0501067_0071790 Ga0501067_0071790_1013_1717 226
1524 3300049584 Ga0501068_0027170 Ga0501068_0027170_661_1353 226
1525 3300049585 Ga0501069_0063092 Ga0501069_0063092_905_1609 226
1526 3300049586 Ga0501070_0000110 Ga0501070_0000110_38293_38982 226
1527 3300049586 Ga0501070_0344607 Ga0501070_0344607_114_803 226
1528 3300049588 Ga0501072_0032281 Ga0501072_0032281_1448_2152 226
1529 3300049589 Ga0501073_0017929 Ga0501073_0017929_911_1615 226
1530 3300049589 Ga0501073_0039911 Ga0501073_0039911_46_738 226
1531 3300049589 Ga0501073_0052570 Ga0501073_0052570_1084_1770 226
1532 3300049589 Ga0501073_0122980 Ga0501073_0122980_854_1558 226
1533 3300049589 Ga0501073_0254286 Ga0501073_0254286_97_786 226
1534 3300049589 Ga0501073_0327609 Ga0501073_0327609_12_704 226
1535 3300049590 Ga0501074_0032456 Ga0501074_0032456_882_1586 226
1536 3300049590 Ga0501074_0083783 Ga0501074_0083783_292_996 226
1537 3300049741 Ga0501079_0005104 Ga0501079_0005104_8975_9679 226
1538 3300049741 Ga0501079_0147634 Ga0501079_0147634_193_897 226
1539 3300049742 Ga0501080_0002037 Ga0501080_0002037_4534_5223 226
1540 3300049742 Ga0501080_0005758 Ga0501080_0005758_1378_2067 226
1541 3300049742 Ga0501080_0035760 Ga0501080_0035760_1385_2089 226
1542 3300049742 Ga0501080_0056611 Ga0501080_0056611_2193_2897 226
1543 3300049742 Ga0501080_0141800 Ga0501080_0141800_414_1106 226
1544 3300049744 Ga0501083_0049301 Ga0501083_0049301_45_731 226
1545 3300049744 Ga0501083_0100260 Ga0501083_0100260_907_1599 226
1546 3300049822 Ga0501035_0000879 Ga0501035_0000879_2069_2758 226
1547 3300049822 Ga0501035_0066142 Ga0501035_0066142_2276_2959 226
1548 3300049822 Ga0501035_0099534 Ga0501035_0099534_467_1171 226
1549 3300049822 Ga0501035_0114585 Ga0501035_0114585_1458_2141 226
1550 3300049822 Ga0501035_0311576 Ga0501035_0311576_378_1115 226
1551 3300049823 Ga0501044_0004520 Ga0501044_0004520_7876_8562 226
1552 3300049823 Ga0501044_0006575 Ga0501044_0006575_1932_2621 226
1553 3300049823 Ga0501044_0064414 Ga0501044_0064414_1208_1891 226
1554 3300049823 Ga0501044_0302658 Ga0501044_0302658_455_1159 226
1555 3300053079 Ga0500610_0000074 Ga0500610_0000074_27056_27736 226
1556 3300053087 Ga0500643_000006 Ga0500643_000006_416576_417262 226
1557 3300053090 Ga0500646_0009128 Ga0500646_0009128_32_718 226
1558 3300053119 Ga0500595_002621 Ga0500595_002621_3895_4581 226
1559 3300053119 Ga0500595_003650 Ga0500595_003650_470_1150 226
1560 3300053130 Ga0500642_0140493 Ga0500642_0140493_370_1056 226
1561 3300053130 Ga0500642_0241815 Ga0500642_0241815_116_802 226
1562 3300053133 Ga0500655_021771 Ga0500655_021771_128_817 226
1563 3300053139 Ga0500568_0020966 Ga0500568_0020966_1823_2509 226
1564 3300053140 Ga0500573_0000006 Ga0500573_0000006_264670_265356 226
1565 3300053154 Ga0500619_003933 Ga0500619_003933_1029_1709 226
1566 3300053163 Ga0500639_023212 Ga0500639_023212_2066_2752 226
1567 3300053730 Ga0500645_000034 Ga0500645_000034_38951_39631 226
1568 3300053735 Ga0500596_002112 Ga0500596_002112_2930_3610 226
1569 3300054114 Ga0501084_0000081 Ga0501084_0000081_41550_42239 226
1570 3300054114 Ga0501084_0048031 Ga0501084_0048031_781_1485 226
1571 3300054114 Ga0501084_0208640 Ga0501084_0208640_583_1269 226
1572 3300060353 Ga0501082_0165419 Ga0501082_0165419_82_771 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

29

139

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

171

242

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cqg-assembly1.cif.gz_A yycf effector domain structure without dna bound 0.934 128 218
1mvo-assembly1.cif.gz_A-2 crystal structure of the phop receiver domain from bacillus subtilis 0.9293 2 118
5x5j-assembly1.cif.gz_A crystal structure of response regulator ader receiver domain 0.929 2 118
7cci-assembly1.cif.gz_A acinetobacter baumannii response regulator ader with disordered n terminus 0.9262 2 119
6is2-assembly1.cif.gz_A crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg 0.9258 1 118
ID Description Score Start End Superfamily
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9902 1 80 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9875 1 83 3.40.50.2300
af_P76340_1_79_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9869 1 80 3.40.50.2300
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.985 2 80 3.40.50.2300
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9826 1 80 3.40.50.2300
ID Description Score Start End GO Terms
AF-D6LNY5-F1-model_v4 deleted 0.9187 23 221
AF-A0A318H352-F1-model_v4 deleted 0.8829 1 218
AF-D6LNY5-F1-model_v4 deleted 0.8685 23 221
AF-A0A318H352-F1-model_v4 deleted 0.8506 1 218
AF-Q2IUG0-F1-model_v4 Two component transcriptional regulator, winged helix family 0.7923 1 220 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Feature Viewer

pLDDT pTM Quality
83.97 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map