F494840

General Info

Members Datasets Scaffolds Average Seq Length
1573 709 1181 317

Family's Representative Sequence

Representative Sequence 3300031733|Ga0316577_10016824|Ga0316577_100168244
Length 340
Sequence MHRGLRRTDRMSGLGYTAVMKREVGVIMDPIGSINIKKDSTFAMMLAAQRRGWTLRYMEPADLFLADGLVQGRMRTVGVADDPAGWYRLDEPELRPLSALDAVLMRKDPPFDMEYVYTTYLLELARNEGLLVVNDPQALRDANEKVFAAHFPDCCPPLAVTRRADVLRAFLAEHGDIVLKPLDAMGGRSIFRVRDGDANTAVIIETLTGGSAGRETRFCMAQRYLPEIVDGDKRVLLVDGEPVPYMLARIPGAGDFRGNLAAGASSEVRAIGERERWIAARVAPVLRARGILFAGLDVIGDWLTEINITSPTCIREIDRDRGTDIAGDLMDAIEAHLDAR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
6 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
7 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
8 2511231004 Pseudomonas sp. GM102 Isolate Nodule
9 2511231006 Pseudomonas sp. GM17 Isolate Nodule
10 2511231007 Pseudomonas sp. GM18 Isolate Nodule
11 2511231008 Pseudomonas sp. GM21 Isolate Nodule
12 2511231010 Pseudomonas sp. GM25 Isolate Nodule
13 2511231011 Pseudomonas sp. GM30 Isolate Nodule
14 2511231012 Pseudomonas sp. GM33 Isolate Nodule
15 2511231014 Pseudomonas sp. GM48 Isolate Nodule
16 2511231015 Pseudomonas sp. GM49 Isolate Nodule
17 2511231016 Pseudomonas sp. GM50 Isolate Nodule
18 2511231017 Pseudomonas sp. GM55 Isolate Nodule
19 2511231018 Pseudomonas sp. GM60 Isolate Nodule
20 2511231019 Pseudomonas sp. GM67 Isolate Nodule
21 2511231020 Pseudomonas sp. GM74 Isolate Nodule
22 2511231021 Pseudomonas sp. GM78 Isolate Nodule
23 2511231022 Pseudomonas sp. GM79 Isolate Nodule
24 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
25 2511231031 Pseudomonas sp. GM16 Isolate Nodule
26 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
27 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
28 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
29 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
30 2547132181 Kosakonia sacchari SP1 Isolate Stem
31 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
32 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
33 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
34 2561511199 Enterobacter sp. R4-368 Isolate Nodule
35 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
36 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
37 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
38 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
39 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
40 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
41 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
42 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
43 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
44 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
45 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
46 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
47 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
48 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
49 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
50 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
51 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
52 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
53 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
54 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
55 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
56 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
57 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
58 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
59 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
60 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
61 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
62 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
63 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
64 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
65 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
66 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
67 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
68 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
69 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
70 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
71 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
72 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
73 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
74 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
75 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
76 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
77 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
78 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
79 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
80 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
81 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
82 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
83 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
84 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
85 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
86 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
87 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
88 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
89 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
90 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
91 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
92 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
93 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
94 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
95 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
96 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
97 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
98 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
99 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
100 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
101 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
102 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
103 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
104 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
105 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
106 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
107 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
108 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
109 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
110 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
111 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
112 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
113 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
114 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
115 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
116 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
117 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
118 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
119 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
120 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
121 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
122 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
123 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
124 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
125 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
126 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
127 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
128 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
129 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
130 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
131 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
132 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
133 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
134 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
135 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
136 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
137 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
138 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
139 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
140 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
141 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
142 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
143 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
144 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
145 2636415599 Klebsiella variicola DX120E Isolate Unclassified
146 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
147 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
148 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
149 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
150 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
151 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
152 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
153 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
154 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
155 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
156 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
157 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
158 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
159 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
160 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
161 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
162 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
163 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
164 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
165 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
166 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
167 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
168 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
169 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
170 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
171 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
172 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
173 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
174 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
175 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
176 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
177 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
178 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
179 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
180 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
181 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
182 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
183 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
184 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
185 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
186 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
187 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
188 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
189 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
190 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
191 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
192 2751185917 Enterobacter sp. HK169 Isolate Unclassified
193 2765235841 Pseudomonas putida AA7 Isolate Unclassified
194 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
195 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
196 2773857670 Pseudomonas sp. 478 Isolate Unclassified
197 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
198 2773857673 Pseudomonas sp. 443 Isolate Unclassified
199 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
200 2775507074 Klebsiella sp. D5A Isolate Unclassified
201 2784132063 Pseudomonas sp. 424 Isolate Unclassified
202 2784132072 Pseudomonas sp. 460 Isolate Unclassified
203 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
204 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
205 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
206 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
207 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
208 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
209 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
210 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
211 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
212 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
213 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
214 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
215 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
216 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
217 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
218 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
219 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
220 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
221 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
222 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
223 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
224 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
225 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
226 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
227 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
228 2821118458 Enterobacter asburiae 609 Isolate Unclassified
229 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
230 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
231 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
232 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
233 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
234 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
235 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
236 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
237 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
238 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
239 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
240 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
241 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
242 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
243 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
244 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
245 2847085930 Erwinia persicina B64 Isolate Bulb
246 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
247 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
248 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
249 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
250 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
251 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
252 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
253 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
254 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
255 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
256 2865014394 Pantoea sp. R-71966 Isolate Unclassified
257 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
258 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
259 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
260 2876601092 Pantoea endophytica 596 Isolate Unclassified
261 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
262 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
263 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
264 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
265 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
266 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
267 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
268 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
269 2904504865 Serratia marcescens 1822 Isolate Unclassified
270 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
271 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
272 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
273 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
274 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
275 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
276 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
277 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
278 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
279 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
280 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
281 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
282 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
283 2919150387 Rahnella aceris 1817 Isolate Unclassified
284 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
285 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
286 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
287 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
288 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
289 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
290 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
291 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
292 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
293 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
294 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
295 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
296 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
297 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
298 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
299 2927143783 Rahnella sp. 2050 Isolate Unclassified
300 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
301 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
302 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
303 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
304 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
305 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
306 2932406140 Serratia sp. 2723 Isolate Rhizosphere
307 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
308 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
309 2937539931 Pantoea sp. LS15 Isolate Unclassified
310 2937967321 Serratia sp. YC16 Isolate Unclassified
311 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
312 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
313 2939577877 Serratia sp. 509 Isolate Rhizosphere
314 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
315 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
316 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
317 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
318 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
319 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
320 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
321 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
322 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
323 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
324 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
325 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
326 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
327 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
328 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
329 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
330 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
331 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
332 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
333 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
334 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
335 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
336 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
337 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
338 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
339 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
340 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
341 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
342 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
343 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
344 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
345 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
346 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
347 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
348 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
349 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
350 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
351 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
352 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
353 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
354 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
355 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
356 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
357 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
358 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
359 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
360 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
361 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
362 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
363 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
364 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
365 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
366 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
367 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
368 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
369 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
370 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
371 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
372 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
373 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
374 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
375 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
376 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
377 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
378 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
379 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
380 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
381 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
382 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
383 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
384 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
385 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
386 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
387 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
388 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
389 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
390 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
391 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
392 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
393 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
394 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
395 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
396 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
397 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
398 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
399 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
400 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
401 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
402 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
403 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
404 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
405 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
406 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
407 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
408 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
409 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
410 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
411 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
412 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
413 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
414 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
415 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
416 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
417 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
418 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
419 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
420 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
421 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
422 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
423 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
424 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
425 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
426 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
427 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
428 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
429 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
430 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
431 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
432 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
433 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
434 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
435 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
436 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
437 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
438 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
439 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
440 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
441 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
442 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
443 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
444 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
445 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
446 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
447 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
448 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
449 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
450 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
451 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
452 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
453 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
456 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
457 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
458 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
460 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
461 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
462 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
463 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
464 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
465 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
466 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
467 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
468 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
469 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
470 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
471 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
472 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
473 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
474 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
475 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
476 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
477 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
478 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
479 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
480 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
481 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
482 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
483 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
484 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
485 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
486 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
487 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
488 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
489 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
490 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
491 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
492 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
493 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
494 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
495 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
496 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
497 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
498 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
499 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
500 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
501 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
502 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
503 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
504 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
505 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
506 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
507 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
508 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
509 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
510 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
511 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
512 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
513 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
514 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
515 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
516 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
517 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
518 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
519 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
520 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
521 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
522 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
523 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
524 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
525 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
526 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
527 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
528 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
529 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
530 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
531 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
532 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
533 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
534 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
535 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
536 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
537 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
538 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
539 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
540 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
541 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
542 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
543 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
544 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
545 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
546 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
547 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
548 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
549 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
550 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
551 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
552 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
553 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
554 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
555 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
556 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
557 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
558 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
559 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
560 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
561 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
562 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
563 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
564 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
565 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
566 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
567 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
568 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
569 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
570 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
571 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
572 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
573 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
574 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
575 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
576 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
577 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
578 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
579 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
580 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
581 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
582 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
583 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
584 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
585 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
586 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
587 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
588 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
589 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
590 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
591 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
592 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
593 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
594 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
595 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
596 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
597 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
598 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
599 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
600 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
601 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
602 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
603 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
604 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
605 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
606 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
607 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
608 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
609 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
610 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
611 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
612 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
613 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
614 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
615 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
616 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
617 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
618 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
619 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
620 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
621 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
622 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
623 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
624 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
625 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
626 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
627 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
628 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
629 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
630 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
631 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
632 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
633 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
634 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
635 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
636 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
637 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
638 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
639 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
640 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
641 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
642 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
643 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
644 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
645 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
646 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
647 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
648 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
649 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
650 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
651 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
652 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
653 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
654 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
655 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
656 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
657 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
658 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
659 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
660 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
661 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
662 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
663 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
664 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
665 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
666 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
667 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
668 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
669 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
670 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
671 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
672 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
673 640753048 Serratia proteamaculans 568 Isolate Endosphere
674 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
675 8004592986 Serratia sp. S119 Isolate Unclassified
676 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
677 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
678 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
679 8018221730 Enterobacter sp. CM29 Isolate Unclassified
680 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
681 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
682 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
683 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
684 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
685 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
686 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
687 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
688 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
689 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
690 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
691 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
692 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
693 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
694 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
695 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
696 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
697 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
698 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
699 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
700 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
701 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
702 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
703 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
704 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
705 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
706 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
707 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
708 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere
709 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.63
Metatranscriptomes 0.45
Isolates 24.92

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0.06
Endosphere 5.53
Nodule 2.99
Rhizoplane 7.95
Rhizosphere 64.46
Stem 0.06
Stem Tuber 0.38
Unclassified 18.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_318845 2162886007 Bacteria 2723
2 SwRhRL2b_contig_552537 2162886007 Bacteria 4861
3 JGI24739J22299_10000262 3300001989 Bacteria 17753
4 JGI25162J39368_1000003 3300002737 Bacteria 575218
5 JGI25162J39368_1000159 3300002737 Bacteria 74427
6 JGI25162J39368_1000193 3300002737 Bacteria 63991
7 JGI25163J39215_1000012 3300002771 Bacteria 86410
8 JGI25163J39215_1000242 3300002771 Bacteria 20003
9 JGI25163J39215_1001170 3300002771 Bacteria 5085
10 JGI25164J39214_1000009 3300002772 Bacteria 303437
11 JGI25164J39214_1000124 3300002772 Bacteria 74427
12 JGI25164J39214_1000219 3300002772 Bacteria 46282
13 JGI25152J39213_1001017 3300002773 Bacteria 13481
14 JGI25165J46597_1000243 3300003214 Bacteria 74427
15 JGI25165J46597_1000288 3300003214 Bacteria 63991
16 JGI25165J46597_1009840 3300003214 Bacteria 1419
17 Ga0055538_1000005 3300003751 Bacteria 575218
18 Ga0055538_1000032 3300003751 Bacteria 199718
19 Ga0055539_1000007 3300003752 Bacteria 575218
20 Ga0055539_1000043 3300003752 Bacteria 199718
21 Ga0055533_1000009 3300003756 Bacteria 575218
22 Ga0055533_1000052 3300003756 Bacteria 199718
23 Ga0055532_1000047 3300003758 Bacteria 179201
24 Ga0055525_1000010 3300003759 Bacteria 575218
25 Ga0055525_1000062 3300003759 Bacteria 199718
26 Ga0055535_1008192 3300003761 Bacteria 1910
27 Ga0055526_1008841 3300003771 Bacteria 4949
28 Ga0055536_1000688 3300003781 Bacteria 22741
29 Ga0055536_1000826 3300003781 Bacteria 20426
30 Ga0055536_1000963 3300003781 Bacteria 18443
31 Ga0055530_10000242 3300003791 Bacteria 49162
32 Ga0055530_10000266 3300003791 Bacteria 47362
33 Ga0055530_10000906 3300003791 Bacteria 24337
34 Ga0055540_1000178 3300003792 Bacteria 62401
35 Ga0055540_1000250 3300003792 Bacteria 49162
36 Ga0055540_1000732 3300003792 Bacteria 22350
37 Ga0055531_10003658 3300003794 Bacteria 9696
38 Ga0055541_1000005 3300003841 Bacteria 575218
39 Ga0055541_1000030 3300003841 Bacteria 199616
40 Ga0058692_1000088 3300003856 Bacteria 64251
41 Ga0058692_1000408 3300003856 Bacteria 20288
42 Ga0058692_1001118 3300003856 Bacteria 10390
43 Ga0058692_1001221 3300003856 Bacteria 9841
44 Ga0058692_1006862 3300003856 Bacteria 3075
45 Ga0058692_1010712 3300003856 Bacteria 2255
46 Ga0058692_1011570 3300003856 Bacteria 2126
47 Ga0065714_10002750 3300005288 Bacteria 15192
48 Ga0065714_10003864 3300005288 Bacteria 6059
49 Ga0065714_10009345 3300005288 Bacteria 2513
50 Ga0065714_10065783 3300005288 Bacteria 8510
51 Ga0065714_10065831 3300005288 Bacteria 8346
52 Ga0065714_10072956 3300005288 Bacteria 3263
53 Ga0065714_10085451 3300005288 Bacteria 2148
54 Ga0065704_10000019 3300005289 Bacteria 22188
55 Ga0065704_10000213 3300005289 Bacteria 105655
56 Ga0065704_10018562 3300005289 Bacteria 2232
57 Ga0065704_10075441 3300005289 Bacteria 5586
58 Ga0065704_10076130 3300005289 Bacteria 5253
59 Ga0065704_10076172 3300005289 Bacteria 5233
60 Ga0065704_10081619 3300005289 Bacteria 3714
61 Ga0065704_10161517 3300005289 Bacteria 1348
62 Ga0065704_10167273 3300005289 Bacteria 1314
63 Ga0065712_10007996 3300005290 Bacteria 7610
64 Ga0065712_10082114 3300005290 Bacteria 2947
65 Ga0070670_100014250 3300005331 Bacteria 6821
66 Ga0070670_100049381 3300005331 Bacteria 3617
67 Ga0070666_10019708 3300005335 Bacteria 4358
68 Ga0070668_100010130 3300005347 Bacteria 6988
69 Ga0070669_100000465 3300005353 Bacteria 30712
70 Ga0070669_100000755 3300005353 Bacteria 23573
71 Ga0070669_100002318 3300005353 Bacteria 13771
72 Ga0070669_100232005 3300005353 Bacteria 1463
73 Ga0070671_100000023 3300005355 Bacteria 123775
74 Ga0070659_100025113 3300005366 Bacteria 4574
75 Ga0070667_100000018 3300005367 Bacteria 226033
76 Ga0070662_100000621 3300005457 Bacteria 21537
77 Ga0070685_10000011 3300005466 Bacteria 137723
78 Ga0068853_100000448 3300005539 Bacteria 28021
79 Ga0070665_100000033 3300005548 Bacteria 332530
80 Ga0070665_100022586 3300005548 Bacteria 6332
81 Ga0070665_100367216 3300005548 Bacteria 1446
82 Ga0070664_100006498 3300005564 Bacteria 9421
83 Ga0068857_100000005 3300005577 Bacteria 170248
84 Ga0068857_100055971 3300005577 Bacteria 3499
85 Ga0068854_100001005 3300005578 Bacteria 16958
86 Ga0068864_100000003 3300005618 Bacteria 568775
87 Ga0068851_10000012 3300005834 Bacteria 175130
88 Ga0068851_10023602 3300005834 Bacteria 3008
89 Ga0068851_10028615 3300005834 Bacteria 2753
90 Ga0068858_100142996 3300005842 Bacteria 2246
91 Ga0068860_100001007 3300005843 Bacteria 31185
92 Ga0068862_100002195 3300005844 Bacteria 17518
93 Ga0075364_10000259 3300006051 Bacteria 25575
94 Ga0075364_10020351 3300006051 Bacteria 4173
95 Ga0075364_10118318 3300006051 Bacteria 1772
96 Ga0075364_10199907 3300006051 Bacteria 1355
97 Ga0075432_10000377 3300006058 Bacteria 12878
98 Ga0075432_10024921 3300006058 Bacteria 2052
99 Ga0075432_10026592 3300006058 Bacteria 1988
100 Ga0075432_10034118 3300006058 Bacteria 1766
101 Ga0075432_10109923 3300006058 Bacteria 1026
102 Ga0079104_1000133 3300006946 Bacteria 105452
103 Ga0079104_1000158 3300006946 Bacteria 96620
104 Ga0079104_1000287 3300006946 Bacteria 64429
105 Ga0079104_1000339 3300006946 Bacteria 56938
106 Ga0079104_1000404 3300006946 Bacteria 49928
107 Ga0079104_1000418 3300006946 Bacteria 48565
108 Ga0079104_1001127 3300006946 Bacteria 19540
109 Ga0079104_1002119 3300006946 Bacteria 11314
110 Ga0079104_1004138 3300006946 Bacteria 6351
111 Ga0079104_1009901 3300006946 Bacteria 3186
112 Ga0079104_1009944 3300006946 Bacteria 3176
113 Ga0099826_10000847 3300006948 Bacteria 16557
114 Ga0105251_10000024 3300009011 Bacteria 133058
115 Ga0105251_10000027 3300009011 Bacteria 128893
116 Ga0105251_10000723 3300009011 Bacteria 30454
117 Ga0105251_10000826 3300009011 Bacteria 27700
118 Ga0105251_10000934 3300009011 Bacteria 26158
119 Ga0105251_10001349 3300009011 Bacteria 21194
120 Ga0105251_10001376 3300009011 Bacteria 21035
121 Ga0105251_10002571 3300009011 Bacteria 14077
122 Ga0105251_10002624 3300009011 Bacteria 13878
123 Ga0105251_10002672 3300009011 Bacteria 13738
124 Ga0105251_10002985 3300009011 Bacteria 12661
125 Ga0105251_10004326 3300009011 Bacteria 9721
126 Ga0105251_10006115 3300009011 Bacteria 7753
127 Ga0105251_10007450 3300009011 Bacteria 6742
128 Ga0105251_10010275 3300009011 Bacteria 5445
129 Ga0105251_10014855 3300009011 Bacteria 4280
130 Ga0105251_10016113 3300009011 Bacteria 4052
131 Ga0105251_10021387 3300009011 Bacteria 3379
132 Ga0105251_10021812 3300009011 Bacteria 3337
133 Ga0105251_10022046 3300009011 Bacteria 3316
134 Ga0105251_10045046 3300009011 Bacteria 2128
135 Ga0105251_10046200 3300009011 Bacteria 2096
136 Ga0105244_10000019 3300009036 Bacteria 242333
137 Ga0105244_10000089 3300009036 Bacteria 100692
138 Ga0105244_10000125 3300009036 Bacteria 78586
139 Ga0105244_10000357 3300009036 Bacteria 42464
140 Ga0105244_10000381 3300009036 Bacteria 41254
141 Ga0105244_10000890 3300009036 Bacteria 25266
142 Ga0105244_10001125 3300009036 Bacteria 22231
143 Ga0105244_10002009 3300009036 Bacteria 15682
144 Ga0105244_10002039 3300009036 Bacteria 15561
145 Ga0105244_10004019 3300009036 Bacteria 10280
146 Ga0105244_10004961 3300009036 Bacteria 8989
147 Ga0105244_10004963 3300009036 Bacteria 8984
148 Ga0105244_10006600 3300009036 Bacteria 7478
149 Ga0105244_10014401 3300009036 Bacteria 4573
150 Ga0105244_10021727 3300009036 Bacteria 3544
151 Ga0105244_10026108 3300009036 Bacteria 3165
152 Ga0105244_10052764 3300009036 Bacteria 2069
153 Ga0105244_10062576 3300009036 Bacteria 1870
154 Ga0105244_10112458 3300009036 Bacteria 1323
155 Ga0105244_10114037 3300009036 Bacteria 1313
156 Ga0105250_10000046 3300009092 Bacteria 126280
157 Ga0105250_10000147 3300009092 Bacteria 62020
158 Ga0105250_10000227 3300009092 Bacteria 47048
159 Ga0105250_10000581 3300009092 Bacteria 24073
160 Ga0105250_10000654 3300009092 Bacteria 21965
161 Ga0105250_10001579 3300009092 Bacteria 12238
162 Ga0105250_10003361 3300009092 Bacteria 7599
163 Ga0105250_10003899 3300009092 Bacteria 6981
164 Ga0105250_10004657 3300009092 Bacteria 6276
165 Ga0105250_10008893 3300009092 Bacteria 4248
166 Ga0105250_10019351 3300009092 Bacteria 2753
167 Ga0105250_10027495 3300009092 Bacteria 2293
168 Ga0105250_10030519 3300009092 Bacteria 2166
169 Ga0105250_10031531 3300009092 Bacteria 2128
170 Ga0105250_10075246 3300009092 Bacteria 1366
171 Ga0105250_10103176 3300009092 Bacteria 1164
172 Ga0105247_10000997 3300009101 Bacteria 21402
173 Ga0105247_10030544 3300009101 Bacteria 3266
174 Ga0114129_10321125 3300009147 Bacteria 2058
175 Ga0105243_10000327 3300009148 Bacteria 52095
176 Ga0105243_10003638 3300009148 Bacteria 12406
177 Ga0105243_10015230 3300009148 Bacteria 5818
178 Ga0105243_10057301 3300009148 Bacteria 3102
179 Ga0105241_10000006 3300009174 Bacteria 373608
180 Ga0105242_10002370 3300009176 Bacteria 14871
181 Ga0105242_10034660 3300009176 Bacteria 4047
182 Ga0105248_10092512 3300009177 Bacteria 3406
183 Ga0105237_10000764 3300009545 Bacteria 44145
184 Ga0105237_10460897 3300009545 Bacteria 1277
185 Ga0105249_10013838 3300009553 Bacteria 7128
186 Ga0105249_10037442 3300009553 Bacteria 4403
187 Ga0105246_10000188 3300011119 Bacteria 30694
188 Ga0105246_10000752 3300011119 Bacteria 18486
189 Ga0105246_10013652 3300011119 Bacteria 5097
190 Ga0105246_10019666 3300011119 Bacteria 4320
191 Ga0105246_10026233 3300011119 Bacteria 3804
192 Ga0105246_10053909 3300011119 Bacteria 2769
193 Ga0157345_1000046 3300012498 Bacteria 28280
194 Ga0157373_10001750 3300013100 Bacteria 16508
195 Ga0157373_10002362 3300013100 Bacteria 14321
196 Ga0157373_10002614 3300013100 Bacteria 13674
197 Ga0157373_10004695 3300013100 Bacteria 10270
198 Ga0157373_10008680 3300013100 Bacteria 7542
199 Ga0157373_10030404 3300013100 Bacteria 3887
200 Ga0157373_10168243 3300013100 Bacteria 1543
201 Ga0157373_10281560 3300013100 Bacteria 1178
202 Ga0157371_10000045 3300013102 Bacteria 189065
203 Ga0157371_10000586 3300013102 Bacteria 43215
204 Ga0157371_10000870 3300013102 Bacteria 34253
205 Ga0157371_10001303 3300013102 Bacteria 26227
206 Ga0157371_10001542 3300013102 Bacteria 23689
207 Ga0157371_10002624 3300013102 Bacteria 17067
208 Ga0157371_10009160 3300013102 Bacteria 7818
209 Ga0157371_10024255 3300013102 Bacteria 4431
210 Ga0157371_10048020 3300013102 Bacteria 3035
211 Ga0157371_10286121 3300013102 Bacteria 1191
212 Ga0157370_10000086 3300013104 Bacteria 103729
213 Ga0157370_10000742 3300013104 Bacteria 40766
214 Ga0157370_10001990 3300013104 Bacteria 25131
215 Ga0157370_10008692 3300013104 Bacteria 10927
216 Ga0157370_10089987 3300013104 Bacteria 2882
217 Ga0157370_10098881 3300013104 Bacteria 2735
218 Ga0157369_10011042 3300013105 Bacteria 10276
219 Ga0157369_10070916 3300013105 Bacteria 3742
220 Ga0157369_10135811 3300013105 Bacteria 2604
221 Ga0163162_10000144 3300013306 Bacteria 65331
222 Ga0163162_10012274 3300013306 Bacteria 8363
223 Ga0157372_10000072 3300013307 Bacteria 108592
224 Ga0157372_10005090 3300013307 Bacteria 13978
225 Ga0157372_10015730 3300013307 Bacteria 8113
226 Ga0157372_10187360 3300013307 Bacteria 2396
227 Ga0157372_10331777 3300013307 Bacteria 1771
228 Ga0157372_10332006 3300013307 Bacteria 1771
229 Ga0157375_10836613 3300013308 Bacteria 1068
230 Ga0163163_10000132 3300014325 Bacteria 76574
231 Ga0182008_10000366 3300014497 Bacteria 35219
232 Ga0182008_10001816 3300014497 Bacteria 13907
233 Ga0182008_10007455 3300014497 Bacteria 6039
234 Ga0182008_10013582 3300014497 Bacteria 4281
235 Ga0182008_10062007 3300014497 Bacteria 1843
236 Ga0182008_10086517 3300014497 Bacteria 1543
237 Ga0182008_10123934 3300014497 Bacteria 1285
238 Ga0182006_1000045 3300015261 Bacteria 197248
239 Ga0182006_1000449 3300015261 Bacteria 32576
240 Ga0182006_1001281 3300015261 Bacteria 15494
241 Ga0182006_1002528 3300015261 Bacteria 9938
242 Ga0182006_1008019 3300015261 Bacteria 4799
243 Ga0182006_1014267 3300015261 Bacteria 3428
244 Ga0182006_1066698 3300015261 Bacteria 1344
245 Ga0182007_10001043 3300015262 Bacteria 15174
246 Ga0182005_1000905 3300015265 Bacteria 12976
247 Ga0182005_1002687 3300015265 Bacteria 6243
248 Ga0182005_1012663 3300015265 Bacteria 2379
249 Ga0183366_1002 3300015679 Bacteria 791639
250 Ga0183370_1002 3300015680 Bacteria 791639
251 Ga0183369_1002 3300015685 Bacteria 791621
252 Ga0183368_1005 3300015687 Bacteria 791621
253 Ga0163161_10000050 3300017792 Bacteria 125396
254 Ga0163161_10002786 3300017792 Bacteria 12393
255 Ga0163161_10010424 3300017792 Bacteria 6435
256 Ga0163161_10035524 3300017792 Bacteria 3568
257 Ga0163161_10171566 3300017792 Bacteria 1659
258 Ga0163161_10273242 3300017792 Bacteria 1323
259 Ga0163161_10282016 3300017792 Bacteria 1303
260 Ga0213876_10000013 3300021384 Bacteria 342052
261 Ga0209760_100029 3300025207 Bacteria 149076
262 Ga0209760_100115 3300025207 Bacteria 57436
263 Ga0209760_100209 3300025207 Bacteria 27234
264 Ga0209784_100001 3300025224 Bacteria 3600592
265 Ga0209784_100007 3300025224 Bacteria 747715
266 Ga0209566_100001 3300025225 Bacteria 3600765
267 Ga0209566_100009 3300025225 Bacteria 554018
268 Ga0209674_100002 3300025226 Bacteria 3600592
269 Ga0209674_100021 3300025226 Bacteria 629811
270 Ga0209147_100009 3300025229 Bacteria 747409
271 Ga0209563_100008 3300025230 Bacteria 1554545
272 Ga0209563_100018 3300025230 Bacteria 747850
273 Ga0209563_100490 3300025230 Bacteria 13405
274 Ga0207427_100002 3300025231 Bacteria 1355321
275 Ga0207427_100005 3300025231 Bacteria 797999
276 Ga0207427_100006 3300025231 Bacteria 785415
277 Ga0209437_100007 3300025233 Bacteria 938377
278 Ga0209437_100013 3300025233 Bacteria 785457
279 Ga0209437_100018 3300025233 Bacteria 694400
280 Ga0209437_100110 3300025233 Bacteria 215040
281 Ga0209258_100169 3300025242 Bacteria 145227
282 Ga0209646_1000289 3300025246 Bacteria 42854
283 Ga0209677_100004 3300025253 Bacteria 1554545
284 Ga0209677_100012 3300025253 Bacteria 554018
285 Ga0209129_1000010 3300025258 Bacteria 583357
286 Ga0209233_1000021 3300025261 Bacteria 798078
287 Ga0209233_1000022 3300025261 Bacteria 785415
288 Ga0209233_1005948 3300025261 Bacteria 3992
289 Ga0209676_1000015 3300025292 Bacteria 784458
290 Ga0209676_1000030 3300025292 Bacteria 506421
291 Ga0209676_1000041 3300025292 Bacteria 424583
292 Ga0209676_1001206 3300025292 Bacteria 27625
293 Ga0209676_1002127 3300025292 Bacteria 15140
294 Ga0209676_1005758 3300025292 Bacteria 6350
295 Ga0209050_1000024 3300025298 Bacteria 533389
296 Ga0209050_1000075 3300025298 Bacteria 286562
297 Ga0209050_1001646 3300025298 Bacteria 22793
298 Ga0209051_1000012 3300025303 Bacteria 595474
299 Ga0209051_1000023 3300025303 Bacteria 437371
300 Ga0209051_1000041 3300025303 Bacteria 311155
301 Ga0209257_1000069 3300025304 Bacteria 339826
302 Ga0209257_1003954 3300025304 Bacteria 12029
303 Ga0207656_10000006 3300025321 Bacteria 395044
304 Ga0207656_10010770 3300025321 Bacteria 3436
305 Ga0207696_1000008 3300025711 Bacteria 568181
306 Ga0207696_1000012 3300025711 Bacteria 527363
307 Ga0207696_1000014 3300025711 Bacteria 517939
308 Ga0207696_1000024 3300025711 Bacteria 420123
309 Ga0207696_1000031 3300025711 Bacteria 384169
310 Ga0207696_1000037 3300025711 Bacteria 334893
311 Ga0207696_1000074 3300025711 Bacteria 215333
312 Ga0207696_1000105 3300025711 Bacteria 163421
313 Ga0207696_1000156 3300025711 Bacteria 112840
314 Ga0207696_1000167 3300025711 Bacteria 103936
315 Ga0207696_1000232 3300025711 Bacteria 78423
316 Ga0207696_1000273 3300025711 Bacteria 61851
317 Ga0207696_1000361 3300025711 Bacteria 45553
318 Ga0207696_1001598 3300025711 Bacteria 11988
319 Ga0207696_1002787 3300025711 Bacteria 8302
320 Ga0207696_1003098 3300025711 Bacteria 7746
321 Ga0207696_1004315 3300025711 Bacteria 6153
322 Ga0207655_1000020 3300025728 Bacteria 524503
323 Ga0207655_1000025 3300025728 Bacteria 449261
324 Ga0207655_1000028 3300025728 Bacteria 437324
325 Ga0207655_1000047 3300025728 Bacteria 302548
326 Ga0207655_1000050 3300025728 Bacteria 294923
327 Ga0207655_1000068 3300025728 Bacteria 241705
328 Ga0207655_1000127 3300025728 Bacteria 150978
329 Ga0207655_1000160 3300025728 Bacteria 123265
330 Ga0207655_1000346 3300025728 Bacteria 67352
331 Ga0207655_1000412 3300025728 Bacteria 58943
332 Ga0207655_1001292 3300025728 Bacteria 23727
333 Ga0207655_1001308 3300025728 Bacteria 23537
334 Ga0207655_1001450 3300025728 Bacteria 21958
335 Ga0207655_1001824 3300025728 Bacteria 18431
336 Ga0207655_1003960 3300025728 Bacteria 10722
337 Ga0207655_1005735 3300025728 Bacteria 8377
338 Ga0207655_1005931 3300025728 Bacteria 8182
339 Ga0207655_1007527 3300025728 Bacteria 7051
340 Ga0207655_1011222 3300025728 Bacteria 5354
341 Ga0207655_1012358 3300025728 Bacteria 4995
342 Ga0207655_1013505 3300025728 Bacteria 4686
343 Ga0207655_1014203 3300025728 Bacteria 4517
344 Ga0207655_1016120 3300025728 Bacteria 4109
345 Ga0207655_1018579 3300025728 Bacteria 3678
346 Ga0207655_1025121 3300025728 Bacteria 2900
347 Ga0207655_1042289 3300025728 Bacteria 1942
348 Ga0207713_1000010 3300025735 Bacteria 528374
349 Ga0207713_1000028 3300025735 Bacteria 309074
350 Ga0207713_1000033 3300025735 Bacteria 273751
351 Ga0207713_1000077 3300025735 Bacteria 176517
352 Ga0207713_1000109 3300025735 Bacteria 137009
353 Ga0207713_1000134 3300025735 Bacteria 112419
354 Ga0207713_1000362 3300025735 Bacteria 49304
355 Ga0207713_1000438 3300025735 Bacteria 43784
356 Ga0207713_1000596 3300025735 Bacteria 35680
357 Ga0207713_1000915 3300025735 Bacteria 26542
358 Ga0207713_1001190 3300025735 Bacteria 21879
359 Ga0207713_1001727 3300025735 Bacteria 16849
360 Ga0207713_1002223 3300025735 Bacteria 14384
361 Ga0207713_1002743 3300025735 Bacteria 12518
362 Ga0207713_1003773 3300025735 Bacteria 10160
363 Ga0207713_1004050 3300025735 Bacteria 9679
364 Ga0207713_1004203 3300025735 Bacteria 9426
365 Ga0207713_1004948 3300025735 Bacteria 8519
366 Ga0207713_1005848 3300025735 Bacteria 7603
367 Ga0207713_1007434 3300025735 Bacteria 6467
368 Ga0207713_1011068 3300025735 Bacteria 4938
369 Ga0207713_1011833 3300025735 Bacteria 4711
370 Ga0207713_1012449 3300025735 Bacteria 4544
371 Ga0207713_1016743 3300025735 Bacteria 3710
372 Ga0207713_1017788 3300025735 Bacteria 3543
373 Ga0207713_1018246 3300025735 Bacteria 3480
374 Ga0207713_1021402 3300025735 Bacteria 3101
375 Ga0207713_1022345 3300025735 Bacteria 3005
376 Ga0207713_1059243 3300025735 Bacteria 1470
377 Ga0207710_10000007 3300025900 Bacteria 488292
378 Ga0207654_10000008 3300025911 Bacteria 375871
379 Ga0207695_10211266 3300025913 Bacteria 1851
380 Ga0207671_10000097 3300025914 Bacteria 135093
381 Ga0207649_10000012 3300025920 Bacteria 265674
382 Ga0207681_10000132 3300025923 Bacteria 60959
383 Ga0207681_10001682 3300025923 Bacteria 14229
384 Ga0207681_10004687 3300025923 Bacteria 8413
385 Ga0207650_10000003 3300025925 Bacteria 1123235
386 Ga0207650_10000140 3300025925 Bacteria 88140
387 Ga0207644_10000027 3300025931 Bacteria 143706
388 Ga0207690_10033529 3300025932 Bacteria 3302
389 Ga0207706_10001217 3300025933 Bacteria 26016
390 Ga0207706_10004311 3300025933 Bacteria 13366
391 Ga0207706_10013492 3300025933 Bacteria 7425
392 Ga0207686_10002456 3300025934 Bacteria 10066
393 Ga0207686_10071427 3300025934 Bacteria 2234
394 Ga0207709_10000071 3300025935 Bacteria 181156
395 Ga0207709_10000178 3300025935 Bacteria 85098
396 Ga0207709_10003503 3300025935 Bacteria 9290
397 Ga0207709_10009000 3300025935 Bacteria 5503
398 Ga0207709_10032019 3300025935 Bacteria 3076
399 Ga0207709_10049439 3300025935 Bacteria 2567
400 Ga0207669_10283396 3300025937 Bacteria 1251
401 Ga0207711_10002516 3300025941 Bacteria 16336
402 Ga0207679_10000015 3300025945 Bacteria 265674
403 Ga0207712_10008013 3300025961 Bacteria 6680
404 Ga0207668_10047537 3300025972 Bacteria 2938
405 Ga0207668_10095248 3300025972 Bacteria 2197
406 Ga0207658_10000004 3300025986 Bacteria 569357
407 Ga0207703_10077197 3300026035 Bacteria 2765
408 Ga0207639_10005479 3300026041 Bacteria 8580
409 Ga0207678_10033252 3300026067 Bacteria 4494
410 Ga0207641_10027419 3300026088 Bacteria 4703
411 Ga0207676_10000003 3300026095 Bacteria 1123235
412 Ga0207674_10000523 3300026116 Bacteria 50444
413 Ga0209281_1000016 3300027111 Bacteria 588107
414 Ga0209281_1000019 3300027111 Bacteria 576164
415 Ga0209281_1000025 3300027111 Bacteria 488275
416 Ga0209281_1000048 3300027111 Bacteria 322698
417 Ga0209281_1000058 3300027111 Bacteria 300244
418 Ga0209281_1000120 3300027111 Bacteria 206692
419 Ga0209281_1000243 3300027111 Bacteria 110012
420 Ga0209281_1000260 3300027111 Bacteria 101875
421 Ga0209281_1000289 3300027111 Bacteria 93101
422 Ga0209281_1000403 3300027111 Bacteria 66018
423 Ga0209281_1000422 3300027111 Bacteria 63149
424 Ga0209281_1001257 3300027111 Bacteria 16492
425 Ga0209281_1003906 3300027111 Bacteria 4661
426 Ga0209281_1006097 3300027111 Bacteria 3200
427 Ga0209281_1013603 3300027111 Bacteria 1750
428 Ga0209371_1000013 3300027312 Bacteria 691516
429 Ga0209371_1000019 3300027312 Bacteria 583561
430 Ga0209371_1000032 3300027312 Bacteria 392355
431 Ga0209371_1000049 3300027312 Bacteria 279132
432 Ga0209371_1000126 3300027312 Bacteria 127214
433 Ga0209371_1000137 3300027312 Bacteria 120900
434 Ga0209371_1000249 3300027312 Bacteria 66713
435 Ga0209371_1000250 3300027312 Bacteria 66392
436 Ga0209371_1000544 3300027312 Bacteria 35405
437 Ga0209371_1000641 3300027312 Bacteria 30869
438 Ga0209371_1001515 3300027312 Bacteria 15406
439 Ga0209371_1001741 3300027312 Bacteria 13713
440 Ga0209371_1003019 3300027312 Bacteria 8693
441 Ga0209371_1003354 3300027312 Bacteria 7863
442 Ga0209371_1004704 3300027312 Bacteria 5791
443 Ga0209371_1004782 3300027312 Bacteria 5705
444 Ga0209371_1006887 3300027312 Bacteria 4097
445 Ga0209371_1007819 3300027312 Bacteria 3651
446 Ga0209371_1009486 3300027312 Bacteria 3090
447 Ga0209970_1009996 3300027614 Bacteria 1550
448 Ga0209983_1000835 3300027665 Bacteria 6748
449 Ga0209282_1032381 3300027666 Bacteria 3198
450 Ga0209971_1001712 3300027682 Bacteria 5396
451 Ga0209974_10007350 3300027876 Bacteria 3794
452 Ga0207428_10024079 3300027907 Bacteria 5112
453 Ga0207428_10053707 3300027907 Bacteria 3212
454 Ga0207428_10079279 3300027907 Bacteria 2568
455 Ga0268266_10000041 3300028379 Bacteria 322311
456 Ga0268266_10027494 3300028379 Bacteria 4835
457 Ga0268266_10169192 3300028379 Bacteria 1982
458 Ga0268265_10001161 3300028380 Bacteria 23113
459 Ga0268264_10000016 3300028381 Bacteria 502537
460 Ga0307517_10104269 3300028786 Bacteria 2210
461 Ga0268256_1000014 3300030500 Bacteria 691435
462 Ga0268256_1000024 3300030500 Bacteria 488637
463 Ga0268256_1000031 3300030500 Bacteria 425730
464 Ga0268256_1000050 3300030500 Bacteria 300675
465 Ga0268256_1000062 3300030500 Bacteria 215802
466 Ga0268256_1000105 3300030500 Bacteria 126344
467 Ga0268256_1000462 3300030500 Bacteria 35405
468 Ga0268256_1000619 3300030500 Bacteria 27758
469 Ga0268256_1001048 3300030500 Bacteria 18533
470 Ga0268256_1001456 3300030500 Bacteria 14211
471 Ga0268256_1001608 3300030500 Bacteria 13109
472 Ga0268256_1002989 3300030500 Bacteria 7998
473 Ga0268256_1003051 3300030500 Bacteria 7863
474 Ga0268256_1004461 3300030500 Bacteria 5793
475 Ga0268256_1007007 3300030500 Bacteria 4097
476 Ga0268256_1008082 3300030500 Bacteria 3651
477 Ga0268256_1010057 3300030500 Bacteria 3090
478 Ga0268256_1018683 3300030500 Bacteria 1916
479 Ga0316177_1174538 3300030731 Bacteria 3357
480 Ga0314311_1051460 3300030733 Bacteria 2494
481 Ga0316178_1149415 3300030735 Bacteria 20170
482 Ga0316181_1260281 3300030744 Bacteria 2160
483 Ga0265331_10004743 3300031250 Bacteria 8400
484 Ga0265327_10000484 3300031251 Bacteria 70058
485 Ga0265327_10000598 3300031251 Bacteria 59988
486 Ga0265327_10002376 3300031251 Bacteria 20027
487 Ga0265327_10058938 3300031251 Bacteria 1969
488 Ga0265316_10000171 3300031344 Bacteria 73162
489 Ga0307408_100022414 3300031548 Bacteria 4290
490 Ga0316575_10001475 3300031665 Bacteria 7586
491 Ga0316579_10000050 3300031691 Bacteria 28151
492 Ga0316579_10016188 3300031691 Bacteria 3252
493 Ga0316579_10026705 3300031691 Bacteria 2616
494 Ga0316579_10086529 3300031691 Bacteria 1495
495 Ga0316576_10000011 3300031727 Bacteria 51505
496 Ga0316576_10000108 3300031727 Bacteria 30580
497 Ga0316576_10008053 3300031727 Bacteria 6685
498 Ga0316576_10027056 3300031727 Bacteria 4029
499 Ga0316576_10027397 3300031727 Bacteria 4007
500 Ga0316576_10035683 3300031727 Bacteria 3551
501 Ga0316576_10071721 3300031727 Bacteria 2555
502 Ga0316576_10075683 3300031727 Bacteria 2490
503 Ga0316576_10107878 3300031727 Bacteria 2086
504 Ga0316578_10000039 3300031728 Bacteria 26902
505 Ga0316578_10000526 3300031728 Bacteria 13041
506 Ga0316578_10005562 3300031728 Bacteria 6126
507 Ga0316578_10008699 3300031728 Bacteria 5182
508 Ga0316578_10015287 3300031728 Bacteria 4123
509 Ga0316578_10022643 3300031728 Bacteria 3507
510 Ga0316578_10034798 3300031728 Bacteria 2893
511 Ga0316578_10038328 3300031728 Bacteria 2764
512 Ga0316578_10096233 3300031728 Bacteria 1772
513 Ga0307405_10000573 3300031731 Bacteria 14049
514 Ga0307405_10061648 3300031731 Bacteria 2371
515 Ga0307405_10322494 3300031731 Bacteria 1180
516 Ga0316577_10000002 3300031733 Bacteria 69178
517 Ga0316577_10000244 3300031733 Bacteria 19045
518 Ga0316577_10016824 3300031733 Bacteria 4036
519 Ga0316577_10019144 3300031733 Bacteria 3787
520 Ga0316577_10175717 3300031733 Bacteria 1209
521 Ga0307413_10003695 3300031824 Bacteria 6504
522 Ga0307413_10210484 3300031824 Bacteria 1412
523 Ga0307406_10013873 3300031901 Bacteria 4625
524 Ga0307412_10038051 3300031911 Bacteria 3094
525 Ga0307409_100011298 3300031995 Bacteria 5618
526 Ga0307416_100103530 3300032002 Bacteria 2485
527 Ga0307414_10017416 3300032004 Bacteria 4395
528 Ga0307414_10098890 3300032004 Bacteria 2190
529 Ga0307411_10026552 3300032005 Bacteria 3488
530 Ga0307411_10359820 3300032005 Bacteria 1189
531 Ga0316583_10001965 3300032133 Bacteria 7021
532 Ga0316583_10005907 3300032133 Bacteria 4401
533 Ga0316585_10000300 3300032137 Bacteria 10983
534 Ga0316580_10000015 3300032139 Bacteria 26419
535 Ga0316580_10000353 3300032139 Bacteria 10153
536 Ga0316580_10003319 3300032139 Bacteria 4553
537 Ga0316580_10014222 3300032139 Bacteria 2431
538 Ga0316580_10031788 3300032139 Bacteria 1634
539 Ga0316593_10071874 3300032168 Bacteria 1198
540 Ga0307510_10006053 3300033180 Bacteria 14417
541 Ga0307510_10146524 3300033180 Bacteria 1991
542 Ga0316592_1001789 3300033524 Bacteria 3581
543 Ga0316588_1001226 3300033528 Bacteria 4117
544 Ga0316588_1026982 3300033528 Bacteria 1333
545 Ga0316588_1027247 3300033528 Bacteria 1327
546 Ga0316587_1018220 3300033529 Bacteria 1181
547 Ga0316596_1001309 3300033541 Bacteria 4953
548 Ga0373955_0132534 3300035172 Bacteria 1456
549 Ga0316574_0000015 3300035398 Bacteria 41741
550 Ga0316574_0014019 3300035398 Bacteria 4621
551 Ga0316574_0024017 3300035398 Bacteria 3644
552 Ga0316574_0029332 3300035398 Bacteria 3323
553 Ga0316574_0116183 3300035398 Bacteria 1716
554 Ga0316582_0000010 3300036647 Bacteria 42857
555 Ga0316582_0001823 3300036647 Bacteria 9638
556 Ga0316582_0003914 3300036647 Bacteria 7424
557 Ga0316582_0039054 3300036647 Bacteria 2954
558 Ga0316582_0047540 3300036647 Bacteria 2709
559 Ga0316582_0086503 3300036647 Bacteria 2056
560 Ga0316584_0000074 3300036712 Bacteria 39825
561 Ga0316584_0000272 3300036712 Bacteria 26243
562 Ga0316584_0003068 3300036712 Bacteria 10759
563 Ga0316584_0012978 3300036712 Bacteria 5885
564 Ga0316584_0055366 3300036712 Bacteria 2970
565 Ga0316584_0081029 3300036712 Bacteria 2431
566 Ga0316584_0125120 3300036712 Bacteria 1920
567 Ga0316584_0201330 3300036712 Bacteria 1469
568 Ga0400484_43206 3300038725 Bacteria 2150
569 Ga0400490_45650 3300038726 Bacteria 22284
570 Ga0400488_54405 3300038741 Bacteria 16776
571 Ga0400483_047239 3300039062 Bacteria 1641
572 Ga0400483_058765 3300039062 Bacteria 1328
573 Ga0400483_074396 3300039062 Bacteria 22101
574 Ga0400483_083724 3300039062 Bacteria 1389
575 Ga0400483_087057 3300039062 Bacteria 9185
576 Ga0400483_108317 3300039062 Bacteria 23825
577 Ga0400483_149198 3300039062 Bacteria 9360
578 Ga0400483_149653 3300039062 Bacteria 3009
579 Ga0400483_170940 3300039062 Bacteria 1446
580 Ga0400483_234085 3300039062 Bacteria 6686
581 Ga0400483_244751 3300039062 Bacteria 2874
582 Ga0400483_247943 3300039062 Bacteria 6137
583 Ga0400483_252643 3300039062 Bacteria 28101
584 Ga0400483_272222 3300039062 Bacteria 1127
585 Ga0400487_02859 3300039110 Bacteria 42897
586 Ga0400487_56999 3300039110 Bacteria 2103
587 Ga0436365_0097125 3300039437 Bacteria 3327
588 Ga0436365_0471682 3300039437 Bacteria 352256
589 Ga0439436_0006963 3300041404 Bacteria 3477
590 Ga0439438_000021 3300041405 Bacteria 109330
591 Ga0439438_000819 3300041405 Bacteria 13898
592 Ga0439438_001628 3300041405 Bacteria 9855
593 Ga0439438_002974 3300041405 Bacteria 7003
594 Ga0439438_009221 3300041405 Bacteria 3208
595 Ga0439438_012043 3300041405 Bacteria 2667
596 Ga0439438_015591 3300041405 Bacteria 2230
597 Ga0439438_015700 3300041405 Bacteria 2218
598 Ga0439438_022539 3300041405 Bacteria 1745
599 Ga0439447_003730 3300041407 Bacteria 5369
600 Ga0439447_003812 3300041407 Bacteria 5292
601 Ga0439447_035076 3300041407 Bacteria 1245
602 Ga0439466_0000004 3300041411 Bacteria 462654
603 Ga0439466_0000893 3300041411 Bacteria 11369
604 Ga0439466_0001103 3300041411 Bacteria 10496
605 Ga0439466_0002341 3300041411 Bacteria 7434
606 Ga0439466_0007637 3300041411 Bacteria 4084
607 Ga0439466_0017618 3300041411 Bacteria 2572
608 Ga0439466_0031371 3300041411 Bacteria 1818
609 Ga0439466_0046853 3300041411 Bacteria 1426
610 Ga0451853_2338999 3300041512 Bacteria 3336
611 Ga0439437_000863 3300042000 Bacteria 3151
612 Ga0439432_002311 3300042006 Bacteria 7185
613 Ga0439432_002853 3300042006 Bacteria 6444
614 Ga0439432_005353 3300042006 Bacteria 4627
615 Ga0439432_022172 3300042006 Bacteria 2098
616 Ga0439451_001077 3300042009 Bacteria 5329
617 Ga0439451_001134 3300042009 Bacteria 5213
618 Ga0439451_032432 3300042009 Bacteria 1050
619 Ga0439452_000006 3300042010 Bacteria 645083
620 Ga0439452_000007 3300042010 Bacteria 613625
621 Ga0439452_000009 3300042010 Bacteria 569493
622 Ga0439452_000070 3300042010 Bacteria 89632
623 Ga0439452_000119 3300042010 Bacteria 61556
624 Ga0439452_000170 3300042010 Bacteria 48261
625 Ga0439452_000285 3300042010 Bacteria 32823
626 Ga0439452_000356 3300042010 Bacteria 28107
627 Ga0439452_001960 3300042010 Bacteria 7875
628 Ga0439452_002482 3300042010 Bacteria 6785
629 Ga0439452_008236 3300042010 Bacteria 3150
630 Ga0439452_008384 3300042010 Bacteria 3114
631 Ga0439452_031167 3300042010 Bacteria 1309
632 Ga0439456_000110 3300042013 Bacteria 26585
633 Ga0439456_012606 3300042013 Bacteria 1753
634 Ga0439456_020136 3300042013 Bacteria 1406
635 Ga0439463_000062 3300042016 Bacteria 23272
636 Ga0439463_000275 3300042016 Bacteria 14217
637 Ga0439463_001595 3300042016 Bacteria 5981
638 Ga0450911_000052 3300042115 Bacteria 47858
639 Ga0450911_001814 3300042115 Bacteria 4577
640 Ga0450911_001919 3300042115 Bacteria 4362
641 Ga0450911_002093 3300042115 Bacteria 4092
642 Ga0450922_000587 3300042124 Bacteria 3807
643 Ga0450923_001388 3300042125 Bacteria 3187
644 Ga0450890_000598 3300042127 Bacteria 5267
645 Ga0450902_000213 3300042137 Bacteria 6795
646 Ga0450902_004648 3300042137 Bacteria 2047
647 Ga0450902_015721 3300042137 Bacteria 1229
648 Ga0450903_000945 3300042138 Bacteria 5575
649 Ga0450906_003096 3300042145 Bacteria 3599
650 Ga0450907_000014 3300042146 Bacteria 87405
651 Ga0450907_000717 3300042146 Bacteria 8530
652 Ga0450907_001240 3300042146 Bacteria 5742
653 Ga0450910_007417 3300042147 Bacteria 1528
654 Ga0439446_0000546 3300042156 Bacteria 7590
655 Ga0439446_0003398 3300042156 Bacteria 3947
656 Ga0450909_001468 3300042185 Bacteria 3288
657 Ga0450909_008387 3300042185 Bacteria 1502
658 Ga0439434_0003401 3300042435 Bacteria 4657
659 Ga0439434_0003478 3300042435 Bacteria 4595
660 Ga0439459_0002242 3300042438 Bacteria 2963
661 Ga0439460_0003987 3300042461 Bacteria 3587
662 Ga0439460_0004836 3300042461 Bacteria 3292
663 Ga0450916_000446 3300042530 Bacteria 3548
664 Ga0450918_007000 3300042531 Bacteria 2004
665 Ga0450893_0007169 3300042532 Bacteria 1810
666 Ga0451577_0000100 3300042876 Bacteria 191528
667 Ga0466981_0000001 3300044669 Bacteria 367980
668 Ga0453684_0001269 3300044712 Bacteria 75684
669 Ga0453684_0225110 3300044712 Bacteria 2170
670 Ga0495617_000714 3300046452 Bacteria 16449
671 Ga0495617_005155 3300046452 Bacteria 4666
672 Ga0495617_006431 3300046452 Bacteria 4117
673 Ga0495617_007794 3300046452 Bacteria 3705
674 Ga0495617_013389 3300046452 Bacteria 2790
675 Ga0495617_023706 3300046452 Bacteria 2072
676 Ga0495627_000017 3300046453 Bacteria 317280
677 Ga0495627_000073 3300046453 Bacteria 123319
678 Ga0495627_000192 3300046453 Bacteria 67494
679 Ga0495627_002301 3300046453 Bacteria 9416
680 Ga0495627_003678 3300046453 Bacteria 6652
681 Ga0495627_008256 3300046453 Bacteria 3918
682 Ga0495627_038625 3300046453 Bacteria 1474
683 Ga0495603_0021544 3300046455 Bacteria 3903
684 Ga0495590_0000836 3300046457 Bacteria 13914
685 Ga0495590_0007288 3300046457 Bacteria 4274
686 Ga0495590_0043927 3300046457 Bacteria 1558
687 Ga0495591_000004 3300046458 Bacteria 410200
688 Ga0495591_000027 3300046458 Bacteria 186086
689 Ga0495591_000030 3300046458 Bacteria 177995
690 Ga0495591_000345 3300046458 Bacteria 41167
691 Ga0495591_000366 3300046458 Bacteria 38823
692 Ga0495591_000973 3300046458 Bacteria 19547
693 Ga0495591_003233 3300046458 Bacteria 8569
694 Ga0495591_004684 3300046458 Bacteria 6572
695 Ga0495591_007652 3300046458 Bacteria 4554
696 Ga0495591_014675 3300046458 Bacteria 2801
697 Ga0495591_020323 3300046458 Bacteria 2196
698 Ga0495629_0011752 3300046459 Bacteria 6354
699 Ga0495638_0020161 3300046460 Bacteria 4405
700 Ga0495638_0109454 3300046460 Bacteria 1642
701 Ga0495653_0002460 3300046463 Bacteria 14721
702 Ga0495653_0019295 3300046463 Bacteria 5528
703 Ga0495653_0028981 3300046463 Bacteria 4425
704 Ga0495653_0051244 3300046463 Bacteria 3170
705 Ga0495650_0000004 3300046471 Bacteria 779487
706 Ga0495650_0000008 3300046471 Bacteria 688246
707 Ga0495650_0000040 3300046471 Bacteria 366254
708 Ga0495650_0001638 3300046471 Bacteria 20791
709 Ga0495650_0015974 3300046471 Bacteria 3824
710 Ga0495582_0002853 3300046473 Bacteria 9669
711 Ga0495605_0000134 3300046474 Bacteria 95894
712 Ga0495605_0000255 3300046474 Bacteria 62826
713 Ga0495605_0000874 3300046474 Bacteria 20830
714 Ga0495605_0001787 3300046474 Bacteria 13804
715 Ga0495605_0009689 3300046474 Bacteria 5413
716 Ga0495605_0014069 3300046474 Bacteria 4389
717 Ga0495605_0019107 3300046474 Bacteria 3666
718 Ga0495639_0000205 3300046475 Bacteria 30780
719 Ga0495639_0018234 3300046475 Bacteria 3054
720 Ga0495584_0012588 3300046491 Bacteria 4319
721 Ga0495584_0023755 3300046491 Bacteria 3107
722 Ga0495584_0040706 3300046491 Bacteria 2346
723 Ga0495585_0001073 3300046492 Bacteria 22573
724 Ga0495585_0001638 3300046492 Bacteria 17127
725 Ga0495585_0053251 3300046492 Bacteria 2240
726 Ga0495594_0002717 3300046499 Bacteria 9179
727 Ga0495596_0001206 3300046500 Bacteria 15121
728 Ga0495596_0002071 3300046500 Bacteria 11022
729 Ga0495596_0002846 3300046500 Bacteria 9034
730 Ga0495607_0000103 3300046501 Bacteria 90192
731 Ga0495607_0000176 3300046501 Bacteria 67863
732 Ga0495607_0000565 3300046501 Bacteria 36127
733 Ga0495607_0003578 3300046501 Bacteria 11824
734 Ga0495607_0008015 3300046501 Bacteria 7256
735 Ga0495607_0008669 3300046501 Bacteria 6933
736 Ga0495607_0013571 3300046501 Bacteria 5333
737 Ga0495607_0031004 3300046501 Bacteria 3276
738 Ga0495607_0031122 3300046501 Bacteria 3268
739 Ga0495607_0031255 3300046501 Bacteria 3260
740 Ga0495607_0032999 3300046501 Bacteria 3153
741 Ga0495607_0051515 3300046501 Bacteria 2390
742 Ga0495607_0059836 3300046501 Bacteria 2170
743 Ga0495607_0065579 3300046501 Bacteria 2047
744 Ga0495607_0070887 3300046501 Bacteria 1945
745 Ga0495583_0000015 3300046506 Bacteria 316392
746 Ga0495583_0000670 3300046506 Bacteria 44793
747 Ga0495583_0000920 3300046506 Bacteria 34707
748 Ga0495583_0001931 3300046506 Bacteria 19162
749 Ga0495583_0002408 3300046506 Bacteria 16077
750 Ga0495583_0002833 3300046506 Bacteria 14156
751 Ga0495583_0005282 3300046506 Bacteria 8843
752 Ga0495583_0016288 3300046506 Bacteria 4005
753 Ga0495606_0000536 3300046507 Bacteria 61022
754 Ga0495606_0000836 3300046507 Bacteria 46402
755 Ga0495606_0000890 3300046507 Bacteria 44577
756 Ga0495606_0001619 3300046507 Bacteria 29382
757 Ga0495606_0002173 3300046507 Bacteria 23592
758 Ga0495606_0018395 3300046507 Bacteria 5239
759 Ga0495606_0025266 3300046507 Bacteria 4257
760 Ga0495606_0029684 3300046507 Bacteria 3833
761 Ga0495606_0079117 3300046507 Bacteria 2048
762 Ga0495610_0009570 3300046512 Bacteria 6111
763 Ga0495610_0019335 3300046512 Bacteria 3816
764 Ga0495610_0024193 3300046512 Bacteria 3283
765 Ga0495610_0025867 3300046512 Bacteria 3141
766 Ga0495616_0010967 3300046513 Bacteria 5217
767 Ga0495616_0011064 3300046513 Bacteria 5184
768 Ga0495616_0014601 3300046513 Bacteria 4391
769 Ga0495616_0040745 3300046513 Bacteria 2371
770 Ga0495620_0000301 3300046515 Bacteria 35173
771 Ga0495620_0000430 3300046515 Bacteria 27989
772 Ga0495620_0001884 3300046515 Bacteria 12330
773 Ga0495620_0003026 3300046515 Bacteria 9664
774 Ga0495620_0011100 3300046515 Bacteria 4717
775 Ga0495620_0018893 3300046515 Bacteria 3404
776 Ga0495630_0015993 3300046517 Bacteria 5482
777 Ga0495631_0000258 3300046518 Bacteria 36872
778 Ga0495631_0000797 3300046518 Bacteria 20112
779 Ga0495631_0023803 3300046518 Bacteria 2834
780 Ga0495632_0001246 3300046519 Bacteria 21583
781 Ga0495632_0001732 3300046519 Bacteria 17714
782 Ga0495632_0001988 3300046519 Bacteria 16230
783 Ga0495632_0002334 3300046519 Bacteria 14565
784 Ga0495632_0004333 3300046519 Bacteria 9674
785 Ga0495632_0006860 3300046519 Bacteria 7255
786 Ga0495632_0009474 3300046519 Bacteria 5870
787 Ga0495632_0009723 3300046519 Bacteria 5766
788 Ga0495632_0057620 3300046519 Bacteria 1896
789 Ga0495637_0000052 3300046520 Bacteria 99761
790 Ga0495637_0000559 3300046520 Bacteria 26705
791 Ga0495637_0000658 3300046520 Bacteria 24086
792 Ga0495637_0008840 3300046520 Bacteria 4932
793 Ga0495637_0017996 3300046520 Bacteria 3282
794 Ga0495637_0018627 3300046520 Bacteria 3218
795 Ga0495637_0020245 3300046520 Bacteria 3063
796 Ga0495637_0020829 3300046520 Bacteria 3010
797 Ga0495637_0035966 3300046520 Bacteria 2161
798 Ga0495637_0059333 3300046520 Bacteria 1574
799 Ga0495637_0062701 3300046520 Bacteria 1521
800 Ga0495643_0000084 3300046522 Bacteria 158427
801 Ga0495643_0001047 3300046522 Bacteria 27947
802 Ga0495643_0032136 3300046522 Bacteria 2916
803 Ga0495643_0035040 3300046522 Bacteria 2765
804 Ga0495643_0045488 3300046522 Bacteria 2382
805 Ga0495643_0070805 3300046522 Bacteria 1830
806 Ga0495643_0132240 3300046522 Bacteria 1251
807 Ga0495644_0005862 3300046523 Bacteria 4800
808 Ga0495644_0013201 3300046523 Bacteria 3173
809 Ga0495648_0003188 3300046524 Bacteria 14589
810 Ga0495648_0003354 3300046524 Bacteria 14112
811 Ga0495648_0003627 3300046524 Bacteria 13503
812 Ga0495648_0004882 3300046524 Bacteria 11296
813 Ga0495648_0010347 3300046524 Bacteria 7109
814 Ga0495648_0040235 3300046524 Bacteria 2966
815 Ga0495648_0046124 3300046524 Bacteria 2704
816 Ga0495648_0050464 3300046524 Bacteria 2541
817 Ga0495648_0151076 3300046524 Bacteria 1211
818 Ga0495648_0181750 3300046524 Bacteria 1068
819 Ga0495666_0005198 3300046526 Bacteria 6570
820 Ga0495666_0045258 3300046526 Bacteria 2123
821 Ga0495666_0083425 3300046526 Bacteria 1510
822 Ga0495642_0000134 3300046528 Bacteria 42945
823 Ga0495642_0003182 3300046528 Bacteria 6511
824 Ga0495654_0000057 3300046530 Bacteria 140176
825 Ga0495654_0000467 3300046530 Bacteria 33780
826 Ga0495654_0000973 3300046530 Bacteria 21069
827 Ga0495654_0001208 3300046530 Bacteria 18401
828 Ga0495654_0004159 3300046530 Bacteria 8671
829 Ga0495654_0008696 3300046530 Bacteria 5597
830 Ga0495654_0015295 3300046530 Bacteria 4075
831 Ga0495654_0015503 3300046530 Bacteria 4045
832 Ga0495654_0015709 3300046530 Bacteria 4017
833 Ga0495654_0016558 3300046530 Bacteria 3892
834 Ga0495654_0022849 3300046530 Bacteria 3243
835 Ga0495654_0031107 3300046530 Bacteria 2710
836 Ga0495654_0038641 3300046530 Bacteria 2385
837 Ga0495654_0078782 3300046530 Bacteria 1548
838 Ga0495587_0028278 3300046536 Bacteria 3409
839 Ga0495587_0072078 3300046536 Bacteria 2008
840 Ga0495609_0000076 3300046538 Bacteria 120170
841 Ga0495609_0000192 3300046538 Bacteria 61042
842 Ga0495609_0000267 3300046538 Bacteria 48889
843 Ga0495609_0014977 3300046538 Bacteria 3636
844 Ga0495609_0143833 3300046538 Bacteria 1016
845 Ga0495597_0000089 3300046542 Bacteria 80769
846 Ga0495597_0002161 3300046542 Bacteria 12923
847 Ga0495597_0002925 3300046542 Bacteria 10374
848 Ga0495597_0012116 3300046542 Bacteria 4167
849 Ga0495597_0025648 3300046542 Bacteria 2712
850 Ga0495597_0041254 3300046542 Bacteria 2062
851 Ga0495622_0000829 3300046557 Bacteria 17100
852 Ga0495622_0002041 3300046557 Bacteria 9864
853 Ga0495622_0005554 3300046557 Bacteria 5845
854 Ga0495622_0020584 3300046557 Bacteria 3072
855 Ga0495633_0000373 3300046558 Bacteria 47781
856 Ga0495633_0033821 3300046558 Bacteria 2462
857 Ga0495656_0004483 3300046615 Bacteria 4784
858 Ga0495668_0006952 3300046616 Bacteria 7322
859 Ga0495668_0012229 3300046616 Bacteria 5099
860 Ga0495668_0016230 3300046616 Bacteria 4330
861 Ga0495668_0082454 3300046616 Bacteria 1764
862 Ga0495634_0002032 3300046642 Bacteria 17181
863 Ga0495611_0000418 3300046648 Bacteria 26364
864 Ga0495611_0000425 3300046648 Bacteria 26209
865 Ga0495611_0002573 3300046648 Bacteria 8220
866 Ga0495625_0000027 3300046660 Bacteria 258545
867 Ga0495625_0004942 3300046660 Bacteria 12390
868 Ga0495625_0011814 3300046660 Bacteria 7093
869 Ga0495625_0044690 3300046660 Bacteria 3205
870 Ga0495625_0069928 3300046660 Bacteria 2465
871 Ga0495625_0075543 3300046660 Bacteria 2357
872 Ga0495635_0010463 3300046663 Bacteria 6488
873 Ga0495659_0001810 3300046664 Bacteria 7096
874 Ga0495659_0018082 3300046664 Bacteria 2344
875 Ga0495661_0000097 3300046665 Bacteria 107784
876 Ga0495661_0000137 3300046665 Bacteria 86360
877 Ga0495661_0000159 3300046665 Bacteria 79198
878 Ga0495661_0000200 3300046665 Bacteria 69488
879 Ga0495661_0009705 3300046665 Bacteria 6593
880 Ga0495661_0021929 3300046665 Bacteria 4156
881 Ga0495661_0034837 3300046665 Bacteria 3164
882 Ga0495588_0035586 3300046674 Bacteria 2524
883 Ga0495588_0117976 3300046674 Bacteria 1398
884 Ga0495623_0013126 3300046679 Bacteria 5370
885 Ga0495623_0061480 3300046679 Bacteria 2355
886 Ga0495646_0035848 3300046680 Bacteria 3074
887 Ga0495670_0002411 3300046691 Bacteria 9221
888 Ga0495670_0007971 3300046691 Bacteria 5208
889 Ga0495670_0012402 3300046691 Bacteria 4190
890 Ga0495670_0103743 3300046691 Bacteria 1466
891 Ga0495671_0001590 3300046692 Bacteria 14999
892 Ga0495671_0003706 3300046692 Bacteria 9293
893 Ga0495671_0007295 3300046692 Bacteria 6311
894 Ga0495671_0015095 3300046692 Bacteria 4146
895 Ga0495671_0028779 3300046692 Bacteria 2858
896 Ga0495671_0029461 3300046692 Bacteria 2818
897 Ga0495671_0055803 3300046692 Bacteria 1956
898 Ga0495671_0077053 3300046692 Bacteria 1634
899 Ga0495649_0001664 3300046694 Bacteria 16525
900 Ga0495649_0002112 3300046694 Bacteria 14264
901 Ga0495649_0003999 3300046694 Bacteria 9717
902 Ga0495649_0008917 3300046694 Bacteria 6001
903 Ga0495649_0009902 3300046694 Bacteria 5638
904 Ga0495649_0014708 3300046694 Bacteria 4474
905 Ga0495649_0016978 3300046694 Bacteria 4118
906 Ga0495649_0030563 3300046694 Bacteria 2975
907 Ga0495649_0089885 3300046694 Bacteria 1637
908 Ga0495589_0000028 3300046794 Bacteria 179523
909 Ga0495589_0006165 3300046794 Bacteria 6331
910 Ga0495589_0006596 3300046794 Bacteria 6116
911 Ga0495589_0028117 3300046794 Bacteria 2839
912 Ga0495589_0029506 3300046794 Bacteria 2765
913 Ga0495600_0025684 3300046809 Bacteria 3795
914 Ga0495660_0000019 3300046810 Bacteria 311047
915 Ga0495660_0000062 3300046810 Bacteria 129883
916 Ga0495660_0003501 3300046810 Bacteria 9684
917 Ga0495660_0004532 3300046810 Bacteria 8399
918 Ga0495660_0006410 3300046810 Bacteria 6961
919 Ga0495660_0012593 3300046810 Bacteria 4908
920 Ga0495660_0039939 3300046810 Bacteria 2602
921 Ga0495660_0043020 3300046810 Bacteria 2493
922 Ga0495660_0067071 3300046810 Bacteria 1912
923 Ga0495581_0044270 3300047315 Bacteria 2574
924 Ga0495604_0013021 3300047317 Bacteria 6627
925 Ga0495604_0030394 3300047317 Bacteria 4289
926 Ga0495636_0003439 3300047318 Bacteria 6141
927 Ga0495674_0031957 3300047319 Bacteria 4777
928 Ga0495672_0000003 3300047320 Bacteria 728845
929 Ga0495672_0000025 3300047320 Bacteria 365425
930 Ga0495672_0000051 3300047320 Bacteria 237883
931 Ga0495672_0001057 3300047320 Bacteria 28116
932 Ga0495672_0003270 3300047320 Bacteria 14024
933 Ga0495672_0003509 3300047320 Bacteria 13368
934 Ga0495672_0011334 3300047320 Bacteria 6297
935 Ga0495672_0014981 3300047320 Bacteria 5282
936 Ga0495672_0018816 3300047320 Bacteria 4574
937 Ga0495672_0019149 3300047320 Bacteria 4525
938 Ga0495672_0021796 3300047320 Bacteria 4173
939 Ga0495672_0041648 3300047320 Bacteria 2775
940 Ga0495672_0107937 3300047320 Bacteria 1498
941 Ga0495672_0183556 3300047320 Bacteria 1057
942 Ga0495676_0000012 3300047321 Bacteria 230043
943 Ga0495676_0037535 3300047321 Bacteria 4031
944 Ga0495680_0065444 3300047322 Bacteria 2783
945 Ga0495680_0364630 3300047322 Bacteria 1003
946 Ga0495683_0000106 3300047323 Bacteria 86579
947 Ga0495683_0000372 3300047323 Bacteria 36700
948 Ga0495683_0000410 3300047323 Bacteria 34329
949 Ga0495683_0001801 3300047323 Bacteria 13510
950 Ga0495683_0060038 3300047323 Bacteria 1885
951 Ga0495687_003428 3300047443 Bacteria 11504
952 Ga0495687_009564 3300047443 Bacteria 5405
953 Ga0495687_014186 3300047443 Bacteria 4117
954 Ga0495675_0003455 3300047444 Bacteria 9519
955 Ga0495675_0025858 3300047444 Bacteria 3741
956 Ga0495679_000014 3300047446 Bacteria 292767
957 Ga0495679_000072 3300047446 Bacteria 97319
958 Ga0495679_000371 3300047446 Bacteria 34489
959 Ga0495679_002287 3300047446 Bacteria 9883
960 Ga0495685_076877 3300047447 Bacteria 1114
961 Ga0495673_0000011 3300047469 Bacteria 674140
962 Ga0495673_0000055 3300047469 Bacteria 247894
963 Ga0495673_0001722 3300047469 Bacteria 16724
964 Ga0495673_0003201 3300047469 Bacteria 10930
965 Ga0495673_0013260 3300047469 Bacteria 4337
966 Ga0495673_0015103 3300047469 Bacteria 3990
967 Ga0495673_0024387 3300047469 Bacteria 2923
968 Ga0495673_0025516 3300047469 Bacteria 2835
969 Ga0495673_0101192 3300047469 Bacteria 1164
970 Ga0495681_0004289 3300047470 Bacteria 9767
971 Ga0495681_0008809 3300047470 Bacteria 6281
972 Ga0495681_0012009 3300047470 Bacteria 5112
973 Ga0495681_0014531 3300047470 Bacteria 4505
974 Ga0495681_0018167 3300047470 Bacteria 3881
975 Ga0495681_0023497 3300047470 Bacteria 3273
976 Ga0495681_0029651 3300047470 Bacteria 2797
977 Ga0495681_0036545 3300047470 Bacteria 2427
978 Ga0495681_0038310 3300047470 Bacteria 2350
979 Ga0495684_0016717 3300047471 Bacteria 5653
980 Ga0495593_0037595 3300047673 Bacteria 2617
981 Ga0495602_0073171 3300048088 Bacteria 2918
982 Ga0495626_0000136 3300048091 Bacteria 92951
983 Ga0495626_0001152 3300048091 Bacteria 22079
984 Ga0495626_0002140 3300048091 Bacteria 14295
985 Ga0495626_0002447 3300048091 Bacteria 12891
986 Ga0495626_0005692 3300048091 Bacteria 7209
987 Ga0495626_0022790 3300048091 Bacteria 3090
988 Ga0495626_0023265 3300048091 Bacteria 3053
989 Ga0495626_0030129 3300048091 Bacteria 2618
990 Ga0496100_0001584 3300048903 Bacteria 11211
991 Ga0496101_0000152 3300048904 Bacteria 59477
992 Ga0496102_0007113 3300048905 Bacteria 9556
993 Ga0496102_0033352 3300048905 Bacteria 4626
994 Ga0496103_0035070 3300048906 Bacteria 3070
995 Ga0496103_0064839 3300048906 Bacteria 2278
996 Ga0496104_0001969 3300048907 Bacteria 17794
997 Ga0496104_0005676 3300048907 Bacteria 10927
998 Ga0496105_0013609 3300048908 Bacteria 6459
999 Ga0496105_0110732 3300048908 Bacteria 2266
1000 Ga0496110_0006481 3300048913 Bacteria 9279
1001 Ga0496116_0000009 3300048919 Bacteria 716119
1002 Ga0496116_0000016 3300048919 Bacteria 555146
1003 Ga0496116_0000065 3300048919 Bacteria 265193
1004 Ga0496116_0000076 3300048919 Bacteria 229670
1005 Ga0496116_0000330 3300048919 Bacteria 76562
1006 Ga0496116_0003184 3300048919 Bacteria 16437
1007 Ga0496116_0003257 3300048919 Bacteria 16176
1008 Ga0496116_0004313 3300048919 Bacteria 13604
1009 Ga0496116_0006337 3300048919 Bacteria 10761
1010 Ga0496116_0010371 3300048919 Bacteria 7822
1011 Ga0496116_0014872 3300048919 Bacteria 6181
1012 Ga0496116_0016070 3300048919 Bacteria 5878
1013 Ga0496116_0017116 3300048919 Bacteria 5644
1014 Ga0496116_0022442 3300048919 Bacteria 4728
1015 Ga0496116_0129223 3300048919 Bacteria 1444
1016 Ga0496116_0210325 3300048919 Bacteria 1008
1017 Ga0496116_0210336 3300048919 Bacteria 1008
1018 Ga0496117_0000043 3300048920 Bacteria 309583
1019 Ga0496117_0000143 3300048920 Bacteria 156096
1020 Ga0496117_0000385 3300048920 Bacteria 75873
1021 Ga0496117_0000527 3300048920 Bacteria 62825
1022 Ga0496117_0001362 3300048920 Bacteria 35647
1023 Ga0496117_0001595 3300048920 Bacteria 32069
1024 Ga0496117_0001832 3300048920 Bacteria 28796
1025 Ga0496117_0002140 3300048920 Bacteria 25795
1026 Ga0496117_0006134 3300048920 Bacteria 12291
1027 Ga0496117_0007952 3300048920 Bacteria 10186
1028 Ga0496117_0025436 3300048920 Bacteria 4655
1029 Ga0496117_0029065 3300048920 Bacteria 4267
1030 Ga0496117_0038637 3300048920 Bacteria 3534
1031 Ga0496117_0114453 3300048920 Bacteria 1672
1032 Ga0496117_0133776 3300048920 Bacteria 1497
1033 Ga0496117_0139543 3300048920 Bacteria 1454
1034 Ga0496118_0000075 3300048921 Bacteria 196228
1035 Ga0496118_0000735 3300048921 Bacteria 52853
1036 Ga0496118_0000996 3300048921 Bacteria 44151
1037 Ga0496118_0001512 3300048921 Bacteria 34625
1038 Ga0496118_0002875 3300048921 Bacteria 22452
1039 Ga0496118_0003031 3300048921 Bacteria 21679
1040 Ga0496118_0004414 3300048921 Bacteria 16698
1041 Ga0496118_0009229 3300048921 Bacteria 10016
1042 Ga0496118_0010004 3300048921 Bacteria 9461
1043 Ga0496118_0025321 3300048921 Bacteria 5093
1044 Ga0496118_0034144 3300048921 Bacteria 4156
1045 Ga0496118_0037468 3300048921 Bacteria 3901
1046 Ga0496118_0068027 3300048921 Bacteria 2589
1047 Ga0496118_0082282 3300048921 Bacteria 2256
1048 Ga0496118_0085415 3300048921 Bacteria 2197
1049 Ga0496119_0000009 3300048922 Bacteria 443128
1050 Ga0496119_0000044 3300048922 Bacteria 191820
1051 Ga0496119_0000059 3300048922 Bacteria 173056
1052 Ga0496119_0001021 3300048922 Bacteria 35860
1053 Ga0496119_0002154 3300048922 Bacteria 22126
1054 Ga0496119_0002157 3300048922 Bacteria 22108
1055 Ga0496119_0005307 3300048922 Bacteria 12398
1056 Ga0496119_0006644 3300048922 Bacteria 10639
1057 Ga0496119_0024583 3300048922 Bacteria 4232
1058 Ga0496119_0045873 3300048922 Bacteria 2735
1059 Ga0496119_0046522 3300048922 Bacteria 2708
1060 Ga0496119_0059429 3300048922 Bacteria 2296
1061 Ga0496119_0067164 3300048922 Bacteria 2116
1062 Ga0496120_0000044 3300048923 Bacteria 192292
1063 Ga0496120_0000049 3300048923 Bacteria 187654
1064 Ga0496120_0000073 3300048923 Bacteria 164280
1065 Ga0496120_0000160 3300048923 Bacteria 112419
1066 Ga0496120_0000201 3300048923 Bacteria 102775
1067 Ga0496120_0000225 3300048923 Bacteria 96798
1068 Ga0496120_0000363 3300048923 Bacteria 73708
1069 Ga0496120_0001098 3300048923 Bacteria 35326
1070 Ga0496120_0003294 3300048923 Bacteria 14866
1071 Ga0496120_0006065 3300048923 Bacteria 9390
1072 Ga0496120_0007160 3300048923 Bacteria 8362
1073 Ga0496120_0013017 3300048923 Bacteria 5626
1074 Ga0496120_0023510 3300048923 Bacteria 3858
1075 Ga0496120_0024770 3300048923 Bacteria 3735
1076 Ga0496121_0000057 3300048924 Bacteria 294291
1077 Ga0496121_0001040 3300048924 Bacteria 49445
1078 Ga0496121_0001212 3300048924 Bacteria 44964
1079 Ga0496121_0004283 3300048924 Bacteria 19355
1080 Ga0496121_0006547 3300048924 Bacteria 14392
1081 Ga0496121_0016843 3300048924 Bacteria 7516
1082 Ga0496121_0017833 3300048924 Bacteria 7210
1083 Ga0496121_0059124 3300048924 Bacteria 3162
1084 Ga0496121_0190004 3300048924 Bacteria 1473
1085 Ga0496122_0000016 3300048925 Bacteria 443353
1086 Ga0496122_0000056 3300048925 Bacteria 258019
1087 Ga0496122_0000413 3300048925 Bacteria 90857
1088 Ga0496122_0001852 3300048925 Bacteria 32241
1089 Ga0496122_0003483 3300048925 Bacteria 20697
1090 Ga0496122_0004610 3300048925 Bacteria 16965
1091 Ga0496122_0005198 3300048925 Bacteria 15636
1092 Ga0496122_0013637 3300048925 Bacteria 7932
1093 Ga0496122_0020363 3300048925 Bacteria 5997
1094 Ga0496122_0023434 3300048925 Bacteria 5442
1095 Ga0496122_0030949 3300048925 Bacteria 4469
1096 Ga0496122_0034507 3300048925 Bacteria 4138
1097 Ga0496122_0106604 3300048925 Bacteria 1854
1098 Ga0496122_0249638 3300048925 Bacteria 993
1099 Ga0496123_0000017 3300048926 Bacteria 415261
1100 Ga0496123_0000041 3300048926 Bacteria 258019
1101 Ga0496123_0001069 3300048926 Bacteria 41388
1102 Ga0496123_0001508 3300048926 Bacteria 32265
1103 Ga0496123_0003138 3300048926 Bacteria 18954
1104 Ga0496123_0005426 3300048926 Bacteria 12840
1105 Ga0496123_0006325 3300048926 Bacteria 11506
1106 Ga0496123_0007484 3300048926 Bacteria 10265
1107 Ga0496123_0009549 3300048926 Bacteria 8723
1108 Ga0496123_0025029 3300048926 Bacteria 4513
1109 Ga0496123_0026823 3300048926 Bacteria 4306
1110 Ga0496123_0047307 3300048926 Bacteria 2908
1111 Ga0496124_0000010 3300048927 Bacteria 595157
1112 Ga0496124_0000096 3300048927 Bacteria 183847
1113 Ga0496124_0000144 3300048927 Bacteria 146921
1114 Ga0496124_0000154 3300048927 Bacteria 139412
1115 Ga0496124_0001686 3300048927 Bacteria 31291
1116 Ga0496124_0002210 3300048927 Bacteria 25904
1117 Ga0496124_0005336 3300048927 Bacteria 14511
1118 Ga0496124_0011412 3300048927 Bacteria 8882
1119 Ga0496124_0013833 3300048927 Bacteria 7848
1120 Ga0496124_0022682 3300048927 Bacteria 5748
1121 Ga0496124_0029661 3300048927 Bacteria 4868
1122 Ga0496124_0030976 3300048927 Bacteria 4738
1123 Ga0496124_0031640 3300048927 Bacteria 4681
1124 Ga0496124_0038437 3300048927 Bacteria 4156
1125 Ga0496124_0040008 3300048927 Bacteria 4058
1126 Ga0496124_0046373 3300048927 Bacteria 3722
1127 Ga0496124_0076101 3300048927 Bacteria 2772
1128 Ga0496124_0099776 3300048927 Bacteria 2354
1129 Ga0496124_0132226 3300048927 Bacteria 1981
1130 Ga0496124_0143854 3300048927 Bacteria 1878
1131 Ga0496124_0310732 3300048927 Bacteria 1133
1132 Ga0496125_0000113 3300048928 Bacteria 187290
1133 Ga0496125_0000418 3300048928 Bacteria 79070
1134 Ga0496125_0001556 3300048928 Bacteria 32734
1135 Ga0496125_0001937 3300048928 Bacteria 28287
1136 Ga0496125_0003408 3300048928 Bacteria 19326
1137 Ga0496125_0008599 3300048928 Bacteria 10656
1138 Ga0496125_0010679 3300048928 Bacteria 9269
1139 Ga0496125_0019206 3300048928 Bacteria 6456
1140 Ga0496125_0032817 3300048928 Bacteria 4606
1141 Ga0496125_0062994 3300048928 Bacteria 2960
1142 Ga0496126_0001638 3300048929 Bacteria 33860
1143 Ga0496126_0007584 3300048929 Bacteria 11857
1144 Ga0496126_0011007 3300048929 Bacteria 9410
1145 Ga0496126_0018422 3300048929 Bacteria 6918
1146 Ga0496126_0029528 3300048929 Bacteria 5208
1147 Ga0496126_0050008 3300048929 Bacteria 3812
1148 Ga0496126_0091782 3300048929 Bacteria 2669
1149 Ga0496126_0111902 3300048929 Bacteria 2377
1150 Ga0496126_0121784 3300048929 Bacteria 2261
1151 Ga0496126_0180477 3300048929 Bacteria 1793
1152 Ga0495678_000236 3300049459 Bacteria 62303
1153 Ga0495678_000479 3300049459 Bacteria 39762
1154 Ga0495678_000977 3300049459 Bacteria 24594
1155 Ga0495678_010085 3300049459 Bacteria 4611
1156 Ga0495678_035963 3300049459 Bacteria 2025
1157 Ga0495682_0000006 3300049460 Bacteria 316373
1158 Ga0495682_0000102 3300049460 Bacteria 75726
1159 Ga0495682_0000288 3300049460 Bacteria 38984
1160 Ga0495682_0048540 3300049460 Bacteria 1547
1161 Ga0501031_0000922 3300049568 Bacteria 17740
1162 Ga0501032_0002898 3300049569 Bacteria 13336
1163 Ga0501033_0000799 3300049570 Bacteria 28871
1164 Ga0501034_0029494 3300049571 Bacteria 5576
1165 Ga0501036_0003774 3300049572 Bacteria 12143
1166 Ga0501037_0001206 3300049573 Bacteria 19108
1167 Ga0501038_0002007 3300049574 Bacteria 18789
1168 Ga0501047_0004732 3300049581 Bacteria 12798
1169 Ga0501047_0427227 3300049581 Bacteria 1156
1170 Ga0501070_0032634 3300049586 Bacteria 4358
1171 Ga0501079_0334354 3300049741 Bacteria 1186
1172 Ga0501080_0044383 3300049742 Bacteria 4138
1173 Ga0501035_0001246 3300049822 Bacteria 26448
1174 Ga0501044_0020678 3300049823 Bacteria 7027
1175 Ga0501226_000001 3300049853 Bacteria 432595
1176 nmdc:mga00v17_38697_c1 3300050491 Bacteria 2853
1177 nmdc:mga00v17_8884_c1 3300050491 Bacteria 5419
1178 nmdc:mga0yw44_39414_c1 3300050492 Bacteria 2801
1179 nmdc:mga0a205_334705_c1 3300050515 Bacteria 1383
1180 Ga0500621_000004 3300053126 Bacteria 485792
1181 Ga0500661_002511 3300055283 Bacteria 3464

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046492 Ga0495585_0053251 Ga0495585_0053251_1337_2212 291
2 3300039062 Ga0400483_058765 Ga0400483_058765_27_905 292
3 3300046501 Ga0495607_0059836 Ga0495607_0059836_35_916 292
4 3300046524 Ga0495648_0181750 Ga0495648_0181750_140_1021 292
5 3300046538 Ga0495609_0143833 Ga0495609_0143833_19_918 292
6 3300046694 Ga0495649_0030563 Ga0495649_0030563_2086_2964 292
7 3300047322 Ga0495680_0364630 Ga0495680_0364630_90_971 292
8 3300048925 Ga0496122_0249638 Ga0496122_0249638_11_892 292
9 3300048928 Ga0496125_0062994 Ga0496125_0062994_11_889 292
10 3300013100 Ga0157373_10002362 Ga0157373_100023628 307
11 3300013102 Ga0157371_10001303 Ga0157371_1000130315 307
12 3300041405 Ga0439438_000021 Ga0439438_000021_52644_53567 307
13 3300009011 Ga0105251_10000027 Ga0105251_1000002786 308
14 3300009036 Ga0105244_10000125 Ga0105244_1000012528 308
15 3300009036 Ga0105244_10021727 Ga0105244_100217271 308
16 3300009148 Ga0105243_10015230 Ga0105243_100152302 308
17 3300009177 Ga0105248_10092512 Ga0105248_100925125 308
18 3300009553 Ga0105249_10037442 Ga0105249_100374425 308
19 3300011119 Ga0105246_10019666 Ga0105246_100196664 308
20 3300031691 Ga0316579_10026705 Ga0316579_100267054 308
21 3300031727 Ga0316576_10027397 Ga0316576_100273973 308
22 3300031728 Ga0316578_10034798 Ga0316578_100347983 308
23 3300032133 Ga0316583_10001965 Ga0316583_100019653 308
24 3300032139 Ga0316580_10000353 Ga0316580_100003536 308
25 3300032139 Ga0316580_10003319 Ga0316580_100033193 308
26 3300033528 Ga0316588_1001226 Ga0316588_10012265 308
27 3300039062 Ga0400483_272222 Ga0400483_272222_102_1028 308
28 3300041411 Ga0439466_0017618 Ga0439466_0017618_1342_2271 308
29 3300041411 Ga0439466_0031371 Ga0439466_0031371_755_1684 308
30 3300042013 Ga0439456_020136 Ga0439456_020136_457_1386 308
31 3300042115 Ga0450911_002093 Ga0450911_002093_11_958 308
32 3300042137 Ga0450902_015721 Ga0450902_015721_17_964 308
33 3300042138 Ga0450903_000945 Ga0450903_000945_3087_4016 308
34 3300046453 Ga0495627_000073 Ga0495627_000073_110501_111430 308
35 3300046453 Ga0495627_008256 Ga0495627_008256_1214_2143 308
36 3300046453 Ga0495627_038625 Ga0495627_038625_414_1361 308
37 3300046457 Ga0495590_0043927 Ga0495590_0043927_13_960 308
38 3300046458 Ga0495591_000027 Ga0495591_000027_73951_74880 308
39 3300046458 Ga0495591_000973 Ga0495591_000973_8065_8997 308
40 3300046474 Ga0495605_0000134 Ga0495605_0000134_40049_40981 308
41 3300046474 Ga0495605_0000255 Ga0495605_0000255_29781_30713 308
42 3300046492 Ga0495585_0001073 Ga0495585_0001073_11761_12690 308
43 3300046499 Ga0495594_0002717 Ga0495594_0002717_6422_7354 308
44 3300046501 Ga0495607_0000103 Ga0495607_0000103_25605_26534 308
45 3300046501 Ga0495607_0000176 Ga0495607_0000176_35468_36397 308
46 3300046506 Ga0495583_0000015 Ga0495583_0000015_1883_2815 308
47 3300046506 Ga0495583_0002408 Ga0495583_0002408_11765_12694 308
48 3300046507 Ga0495606_0000536 Ga0495606_0000536_23746_24675 308
49 3300046507 Ga0495606_0079117 Ga0495606_0079117_12_959 308
50 3300046515 Ga0495620_0000301 Ga0495620_0000301_31398_32330 308
51 3300046515 Ga0495620_0011100 Ga0495620_0011100_3462_4394 308
52 3300046520 Ga0495637_0008840 Ga0495637_0008840_3502_4431 308
53 3300046520 Ga0495637_0035966 Ga0495637_0035966_104_1036 308
54 3300046530 Ga0495654_0004159 Ga0495654_0004159_3732_4664 308
55 3300046530 Ga0495654_0022849 Ga0495654_0022849_1300_2229 308
56 3300046538 Ga0495609_0000192 Ga0495609_0000192_28573_29505 308
57 3300046542 Ga0495597_0000089 Ga0495597_0000089_13264_14193 308
58 3300046542 Ga0495597_0002925 Ga0495597_0002925_9383_10315 308
59 3300046558 Ga0495633_0000373 Ga0495633_0000373_14737_15669 308
60 3300046648 Ga0495611_0002573 Ga0495611_0002573_5571_6503 308
61 3300046665 Ga0495661_0000097 Ga0495661_0000097_74733_75665 308
62 3300046665 Ga0495661_0000159 Ga0495661_0000159_5269_6198 308
63 3300046665 Ga0495661_0034837 Ga0495661_0034837_868_1797 308
64 3300046691 Ga0495670_0007971 Ga0495670_0007971_1771_2700 308
65 3300046694 Ga0495649_0016978 Ga0495649_0016978_3005_3934 308
66 3300046810 Ga0495660_0006410 Ga0495660_0006410_1825_2757 308
67 3300046810 Ga0495660_0012593 Ga0495660_0012593_99_1028 308
68 3300046810 Ga0495660_0043020 Ga0495660_0043020_500_1429 308
69 3300047320 Ga0495672_0019149 Ga0495672_0019149_3094_4023 308
70 3300047321 Ga0495676_0037535 Ga0495676_0037535_2107_3036 308
71 3300047323 Ga0495683_0000106 Ga0495683_0000106_83339_84271 308
72 3300047323 Ga0495683_0000372 Ga0495683_0000372_27759_28688 308
73 3300047446 Ga0495679_000371 Ga0495679_000371_2144_3076 308
74 3300047469 Ga0495673_0015103 Ga0495673_0015103_2162_3094 308
75 3300048919 Ga0496116_0000330 Ga0496116_0000330_43624_44553 308
76 3300048920 Ga0496117_0000527 Ga0496117_0000527_29568_30497 308
77 3300048920 Ga0496117_0139543 Ga0496117_0139543_439_1386 308
78 3300048921 Ga0496118_0010004 Ga0496118_0010004_3145_4074 308
79 3300048924 Ga0496121_0017833 Ga0496121_0017833_6193_7122 308
80 3300048925 Ga0496122_0000413 Ga0496122_0000413_32476_33405 308
81 3300048925 Ga0496122_0020363 Ga0496122_0020363_3325_4254 308
82 3300048925 Ga0496122_0034507 Ga0496122_0034507_1457_2389 308
83 3300048926 Ga0496123_0001069 Ga0496123_0001069_32368_33297 308
84 3300048926 Ga0496123_0005426 Ga0496123_0005426_3082_4011 308
85 3300048926 Ga0496123_0026823 Ga0496123_0026823_1767_2699 308
86 3300048927 Ga0496124_0099776 Ga0496124_0099776_1254_2204 308
87 3300049459 Ga0495678_000236 Ga0495678_000236_29672_30604 308
88 3300049460 Ga0495682_0000102 Ga0495682_0000102_45565_46494 308
89 3300049581 Ga0501047_0427227 Ga0501047_0427227_60_992 308
90 3300055283 Ga0500661_002511 Ga0500661_002511_1421_2356 308
91 iso_pu_bacteria 2511231025 2511381127 310
92 iso_pu_bacteria 2511231035 2511435868 310
93 iso_pu_bacteria 2599185299 2599928734 310
94 iso_pu_bacteria 2608642108 2608671064 310
95 iso_pu_bacteria 2648501693 2650898306 310
96 iso_pu_bacteria 2684622997 2686355045 310
97 iso_pu_bacteria 2808606414 2809126245 310
98 iso_pu_bacteria 2826581358 2826582444 310
99 iso_pu_bacteria 2844528606 2844530229 310
100 iso_pu_bacteria 2847085930 2847090632 310
101 iso_pu_bacteria 2847797336 2847798405 310
102 iso_pu_bacteria 2865014394 2865016415 310
103 iso_pu_bacteria 2876601092 2876605428 310
104 iso_pu_bacteria 2908669403 2908672018 310
105 iso_pu_bacteria 2939602548 2939604661 310
106 iso_pu_bacteria 2945951305 2945951652 310
107 iso_pu_bacteria 2978975091 2978978196 310
108 iso_pu_bacteria 2984494565 2984495220 310
109 iso_pu_bacteria 2990261002 2990263298 310
110 iso_pu_bacteria 8016733728 8016734543 310
111 iso_pu_bacteria 8019499862 8019503987 310
112 iso_pu_bacteria 2506520007 2506580326 311
113 iso_pu_bacteria 2506520008 2506585465 311
114 iso_pu_bacteria 2508501071 2508854111 311
115 iso_pu_bacteria 2537561728 2538426984 311
116 iso_pu_bacteria 2547132181 2547696246 311
117 iso_pu_bacteria 2547132416 2548649195 311
118 iso_pu_bacteria 2554235234 2555258682 311
119 iso_pu_bacteria 2561511199 2562464329 311
120 iso_pu_bacteria 2565956521 2566038680 311
121 iso_pu_bacteria 2585427591 2585829324 311
122 iso_pu_bacteria 2585427592 2585834584 311
123 iso_pu_bacteria 2599185169 2599410090 311
124 iso_pu_bacteria 2600255254 2601523285 311
125 iso_pu_bacteria 2600255255 2601528444 311
126 iso_pu_bacteria 2600255280 2601615277 311
127 iso_pu_bacteria 2600255281 2601619797 311
128 iso_pu_bacteria 2600255287 2601643796 311
129 iso_pu_bacteria 2600255288 2601648202 311
130 iso_pu_bacteria 2600255289 2601653329 311
131 iso_pu_bacteria 2600255290 2601658550 311
132 iso_pu_bacteria 2600255291 2601663621 311
133 iso_pu_bacteria 2600255298 2601696498 311
134 iso_pu_bacteria 2600255299 2601701253 311
135 iso_pu_bacteria 2600255300 2601705984 311
136 iso_pu_bacteria 2600255301 2601711569 311
137 iso_pu_bacteria 2600255302 2601716587 311
138 iso_pu_bacteria 2600255303 2601721522 311
139 iso_pu_bacteria 2600255304 2601726993 311
140 iso_pu_bacteria 2600255305 2601731533 311
141 iso_pu_bacteria 2600255306 2601736545 311
142 iso_pu_bacteria 2600255307 2601740472 311
143 iso_pu_bacteria 2600255309 2601751409 311
144 iso_pu_bacteria 2600255392 2602018731 311
145 iso_pu_bacteria 2602042047 2603644083 311
146 iso_pu_bacteria 2602042052 2603661008 311
147 iso_pu_bacteria 2602042053 2603666283 311
148 iso_pu_bacteria 2602042066 2603701366 311
149 iso_pu_bacteria 2602042067 2603704608 311
150 iso_pu_bacteria 2602042103 2603838927 311
151 iso_pu_bacteria 2602042104 2603843813 311
152 iso_pu_bacteria 2602042105 2603849084 311
153 iso_pu_bacteria 2602042106 2603854154 311
154 iso_pu_bacteria 2602042109 2603865464 311
155 iso_pu_bacteria 2602042110 2603872209 311
156 iso_pu_bacteria 2602042111 2603877095 311
157 iso_pu_bacteria 2603880178 2606049390 311
158 iso_pu_bacteria 2603880184 2606070715 311
159 iso_pu_bacteria 2603880202 2606147073 311
160 iso_pu_bacteria 2603880211 2606176799 311
161 iso_pu_bacteria 2636415599 2637223361 311
162 iso_pu_bacteria 2648501241 2649121306 311
163 iso_pu_bacteria 2651869818 2652974577 311
164 iso_pu_bacteria 2654587920 2656278905 311
165 iso_pu_bacteria 2667528172 2671104417 311
166 iso_pu_bacteria 2667528173 2671106207 311
167 iso_pu_bacteria 2671180115 2671588483 311
168 iso_pu_bacteria 2675903046 2676408460 311
169 iso_pu_bacteria 2681812866 2681997863 311
170 iso_pu_bacteria 2681812869 2682007977 311
171 iso_pu_bacteria 2687453601 2689446859 311
172 iso_pu_bacteria 2706794495 2707098408 311
173 iso_pu_bacteria 2751185917 2753857496 311
174 iso_pu_bacteria 2765235842 2765590603 311
175 iso_pu_bacteria 2772190666 2772440762 311
176 iso_pu_bacteria 2775506706 2775540131 311
177 iso_pu_bacteria 2775507074 2777019676 311
178 iso_pu_bacteria 2791354903 2791925711 311
179 iso_pu_bacteria 2791355010 2792312805 311
180 iso_pu_bacteria 2791355275 2793406877 311
181 iso_pu_bacteria 2806310673 2807178751 311
182 iso_pu_bacteria 2821118458 2821120417 311
183 iso_pu_bacteria 2823373977 2823376268 311
184 iso_pu_bacteria 2844425489 2844428944 311
185 iso_pu_bacteria 2846540461 2846541101 311
186 iso_pu_bacteria 2852103415 2852106914 311
187 iso_pu_bacteria 2854601825 2854601914 311
188 iso_pu_bacteria 2855195626 2855200001 311
189 iso_pu_bacteria 2858466076 2858469511 311
190 iso_pu_bacteria 2869551831 2869556236 311
191 iso_pu_bacteria 2871272651 2871274026 311
192 iso_pu_bacteria 2871282230 2871284423 311
193 iso_pu_bacteria 2884086401 2884087233 311
194 iso_pu_bacteria 2888366609 2888370861 311
195 iso_pu_bacteria 2888373701 2888376686 311
196 iso_pu_bacteria 2891670763 2891674669 311
197 iso_pu_bacteria 2900051742 2900053774 311
198 iso_pu_bacteria 2904474040 2904474654 311
199 iso_pu_bacteria 2904513164 2904517258 311
200 iso_pu_bacteria 2919108558 2919110566 311
201 iso_pu_bacteria 2919150387 2919151000 311
202 iso_pu_bacteria 2919497567 2919497922 311
203 iso_pu_bacteria 2919688452 2919690948 311
204 iso_pu_bacteria 2923634449 2923636487 311
205 iso_pu_bacteria 2927143783 2927145874 311
206 iso_pu_bacteria 2927833300 2927837053 311
207 iso_pu_bacteria 2932406140 2932406887 311
208 iso_pu_bacteria 2935625433 2935628269 311
209 iso_pu_bacteria 2937539931 2937540997 311
210 iso_pu_bacteria 2937967321 2937969304 311
211 iso_pu_bacteria 2939568625 2939571239 311
212 iso_pu_bacteria 2939573065 2939576333 311
213 iso_pu_bacteria 2939577877 2939579705 311
214 iso_pu_bacteria 2939607340 2939610289 311
215 iso_pu_bacteria 2939617950 2939620357 311
216 iso_pu_bacteria 2939642701 2939645341 311
217 iso_pu_bacteria 2945874760 2945876119 311
218 iso_pu_bacteria 2969079654 2969080389 311
219 iso_pu_bacteria 2971820967 2971821746 311
220 iso_pu_bacteria 2974310843 2974315181 311
221 iso_pu_bacteria 2984559226 2984562829 311
222 iso_pu_bacteria 2984595703 2984600885 311
223 iso_pu_bacteria 2989392574 2989393211 311
224 iso_pu_bacteria 3000376612 3000377709 311
225 iso_pu_bacteria 640753048 640939586 311
226 iso_pu_bacteria 8001522603 8001524357 311
227 iso_pu_bacteria 8004592986 8004593660 311
228 iso_pu_bacteria 8015394850 8015398835 311
229 iso_pu_bacteria 8018221730 8018224162 311
230 iso_pu_bacteria 8018405270 8018406130 311
231 iso_pu_bacteria 8019504834 8019507686 311
232 iso_pu_bacteria 8054844752 8054847971 311
233 iso_pu_bacteria 8054849141 8054853328 311
234 iso_pu_bacteria 8055087960 8055089793 311
235 iso_pu_bacteria 8055092621 8055097253 311
236 iso_pu_bacteria 8055097453 8055098110 311
237 iso_pu_bacteria 8055693939 8055694388 311
238 iso_pu_bacteria 8057304971 8057308222 311
239 3300039062 Ga0400483_247943 Ga0400483_247943_3523_4461 312
240 iso_pu_bacteria 2510065053 2510284700 312
241 iso_pu_bacteria 2510065055 2510295588 312
242 iso_pu_bacteria 2510065058 2510312078 312
243 iso_pu_bacteria 2511231004 2511254132 312
244 iso_pu_bacteria 2511231006 2511267720 312
245 iso_pu_bacteria 2511231007 2511272533 312
246 iso_pu_bacteria 2511231008 2511277552 312
247 iso_pu_bacteria 2511231010 2511289300 312
248 iso_pu_bacteria 2511231011 2511295478 312
249 iso_pu_bacteria 2511231012 2511302229 312
250 iso_pu_bacteria 2511231014 2511314464 312
251 iso_pu_bacteria 2511231015 2511318629 312
252 iso_pu_bacteria 2511231016 2511324938 312
253 iso_pu_bacteria 2511231017 2511333574 312
254 iso_pu_bacteria 2511231018 2511336933 312
255 iso_pu_bacteria 2511231019 2511347612 312
256 iso_pu_bacteria 2511231020 2511350645 312
257 iso_pu_bacteria 2511231021 2511358611 312
258 iso_pu_bacteria 2511231022 2511360999 312
259 iso_pu_bacteria 2511231031 2511413390 312
260 iso_pu_bacteria 2511231156 2511827530 312
261 iso_pu_bacteria 2512047018 2512326744 312
262 iso_pu_bacteria 2554235341 2555672727 312
263 iso_pu_bacteria 2582580891 2583795291 312
264 iso_pu_bacteria 2597489887 2597860780 312
265 iso_pu_bacteria 2597489888 2597866529 312
266 iso_pu_bacteria 2597489889 2597872381 312
267 iso_pu_bacteria 2599185155 2599327368 312
268 iso_pu_bacteria 2599185160 2599356070 312
269 iso_pu_bacteria 2599185161 2599362530 312
270 iso_pu_bacteria 2599185162 2599369164 312
271 iso_pu_bacteria 2599185163 2599375639 312
272 iso_pu_bacteria 2599185164 2599381176 312
273 iso_pu_bacteria 2599185165 2599387308 312
274 iso_pu_bacteria 2599185166 2599394497 312
275 iso_pu_bacteria 2599185167 2599400641 312
276 iso_pu_bacteria 2599185168 2599406262 312
277 iso_pu_bacteria 2599185179 2599449967 312
278 iso_pu_bacteria 2599185181 2599462904 312
279 iso_pu_bacteria 2599185182 2599467675 312
280 iso_pu_bacteria 2599185185 2599485984 312
281 iso_pu_bacteria 2599185186 2599491921 312
282 iso_pu_bacteria 2599185188 2599500185 312
283 iso_pu_bacteria 2599185189 2599505650 312
284 iso_pu_bacteria 2599185190 2599512041 312
285 iso_pu_bacteria 2599185191 2599517023 312
286 iso_pu_bacteria 2599185212 2599616209 312
287 iso_pu_bacteria 2599185248 2599768267 312
288 iso_pu_bacteria 2599185257 2599804767 312
289 iso_pu_bacteria 2599185288 2599878935 312
290 iso_pu_bacteria 2599185289 2599885696 312
291 iso_pu_bacteria 2599185290 2599892597 312
292 iso_pu_bacteria 2599185291 2599897410 312
293 iso_pu_bacteria 2599185300 2599930817 312
294 iso_pu_bacteria 2599185302 2599942423 312
295 iso_pu_bacteria 2599185303 2599950856 312
296 iso_pu_bacteria 2599185304 2599954164 312
297 iso_pu_bacteria 2599185305 2599961802 312
298 iso_pu_bacteria 2599185306 2599967658 312
299 iso_pu_bacteria 2599185307 2599973529 312
300 iso_pu_bacteria 2599185308 2599979972 312
301 iso_pu_bacteria 2599185309 2599982993 312
302 iso_pu_bacteria 2599185310 2599988257 312
303 iso_pu_bacteria 2599185311 2599993912 312
304 iso_pu_bacteria 2599185312 2599999051 312
305 iso_pu_bacteria 2599185313 2600004427 312
306 iso_pu_bacteria 2599185314 2600013732 312
307 iso_pu_bacteria 2599185315 2600020968 312
308 iso_pu_bacteria 2599185316 2600024399 312
309 iso_pu_bacteria 2599185317 2600030429 312
310 iso_pu_bacteria 2599185318 2600038517 312
311 iso_pu_bacteria 2599185319 2600042261 312
312 iso_pu_bacteria 2599185320 2600046582 312
313 iso_pu_bacteria 2599185321 2600055848 312
314 iso_pu_bacteria 2599185322 2600062504 312
315 iso_pu_bacteria 2599185323 2600066445 312
316 iso_pu_bacteria 2599185324 2600072819 312
317 iso_pu_bacteria 2599185325 2600076648 312
318 iso_pu_bacteria 2599185356 2600215530 312
319 iso_pu_bacteria 2600254930 2600359100 312
320 iso_pu_bacteria 2600254931 2600363648 312
321 iso_pu_bacteria 2600255283 2601628366 312
322 iso_pu_bacteria 2600255296 2601693545 312
323 iso_pu_bacteria 2600255313 2601775696 312
324 iso_pu_bacteria 2600255318 2601798667 312
325 iso_pu_bacteria 2603880185 2606077561 312
326 iso_pu_bacteria 2603880199 2606129193 312
327 iso_pu_bacteria 2619619299 2621296946 312
328 iso_pu_bacteria 2623620443 2624483306 312
329 iso_pu_bacteria 2623620446 2624494829 312
330 iso_pu_bacteria 2643221565 2643842861 312
331 iso_pu_bacteria 2643221571 2643872161 312
332 iso_pu_bacteria 2643221589 2643955741 312
333 iso_pu_bacteria 2643221602 2644020535 312
334 iso_pu_bacteria 2643221633 2644184594 312
335 iso_pu_bacteria 2643221650 2644283306 312
336 iso_pu_bacteria 2643221713 2644620064 312
337 iso_pu_bacteria 2651869719 2652547143 312
338 iso_pu_bacteria 2667528170 2671089440 312
339 iso_pu_bacteria 2667528171 2671099169 312
340 iso_pu_bacteria 2667528176 2671128692 312
341 iso_pu_bacteria 2671180172 2671771774 312
342 iso_pu_bacteria 2675903420 2677897026 312
343 iso_pu_bacteria 2675903515 2678266041 312
344 iso_pu_bacteria 2713897148 2715749936 312
345 iso_pu_bacteria 2713897149 2715756328 312
346 iso_pu_bacteria 2718217725 2718636508 312
347 iso_pu_bacteria 2721755607 2723251268 312
348 iso_pu_bacteria 2738541265 2738671767 312
349 iso_pu_bacteria 2738541271 2738690153 312
350 iso_pu_bacteria 2738541282 2738750161 312
351 iso_pu_bacteria 2738541294 2738807151 312
352 iso_pu_bacteria 2738541303 2738859201 312
353 iso_pu_bacteria 2738541309 2738894511 312
354 iso_pu_bacteria 2738543004 2739198951 312
355 iso_pu_bacteria 2738543015 2739258894 312
356 iso_pu_bacteria 2738543016 2739265927 312
357 iso_pu_bacteria 2738543020 2739285701 312
358 iso_pu_bacteria 2738543021 2739291014 312
359 iso_pu_bacteria 2738543025 2739312614 312
360 iso_pu_bacteria 2740892503 2743740322 312
361 iso_pu_bacteria 2744054620 2745007273 312
362 iso_pu_bacteria 2765235841 2765581601 312
363 iso_pu_bacteria 2773857670 2774118487 312
364 iso_pu_bacteria 2773857672 2774130622 312
365 iso_pu_bacteria 2773857673 2774135677 312
366 iso_pu_bacteria 2784132063 2784261926 312
367 iso_pu_bacteria 2784132072 2784313160 312
368 iso_pu_bacteria 2791355520 2794593915 312
369 iso_pu_bacteria 2806310737 2807406229 312
370 iso_pu_bacteria 2806310745 2807454581 312
371 iso_pu_bacteria 2808606361 2808855396 312
372 iso_pu_bacteria 2808606373 2808905628 312
373 iso_pu_bacteria 2808606376 2808925394 312
374 iso_pu_bacteria 2808606377 2808928550 312
375 iso_pu_bacteria 2808606378 2808935293 312
376 iso_pu_bacteria 2808606380 2808947514 312
377 iso_pu_bacteria 2808606381 2808950267 312
378 iso_pu_bacteria 2808606382 2808958878 312
379 iso_pu_bacteria 2808606383 2808963901 312
380 iso_pu_bacteria 2808606385 2808976044 312
381 iso_pu_bacteria 2808606388 2808993151 312
382 iso_pu_bacteria 2808606389 2808998789 312
383 iso_pu_bacteria 2808606445 2809217077 312
384 iso_pu_bacteria 2811994881 2812369376 312
385 iso_pu_bacteria 2816332298 2817493940 312
386 iso_pu_bacteria 2818991456 2819655026 312
387 iso_pu_bacteria 2818991464 2819704291 312
388 iso_pu_bacteria 2825651385 2825655204 312
389 iso_pu_bacteria 2834028612 2834030849 312
390 iso_pu_bacteria 2842805378 2842807343 312
391 iso_pu_bacteria 2842815866 2842817743 312
392 iso_pu_bacteria 2842826826 2842831463 312
393 iso_pu_bacteria 2842832357 2842833360 312
394 iso_pu_bacteria 2842837860 2842842976 312
395 iso_pu_bacteria 2842843487 2842845588 312
396 iso_pu_bacteria 2842849001 2842851694 312
397 iso_pu_bacteria 2842854478 2842855513 312
398 iso_pu_bacteria 2844665904 2844666911 312
399 iso_pu_bacteria 2852612431 2852616250 312
400 iso_pu_bacteria 2852657418 2852661854 312
401 iso_pu_bacteria 2852667396 2852671218 312
402 iso_pu_bacteria 2860339153 2860341609 312
403 iso_pu_bacteria 2860867994 2860872926 312
404 iso_pu_bacteria 2878029506 2878035246 312
405 iso_pu_bacteria 2880230671 2880235890 312
406 iso_pu_bacteria 2904504865 2904506084 312
407 iso_pu_bacteria 2904518522 2904519062 312
408 iso_pu_bacteria 2904550169 2904551258 312
409 iso_pu_bacteria 2908446538 2908452472 312
410 iso_pu_bacteria 2912963787 2912964170 312
411 iso_pu_bacteria 2913036834 2913042451 312
412 iso_pu_bacteria 2916178963 2916180872 312
413 iso_pu_bacteria 2917070673 2917076621 312
414 iso_pu_bacteria 2917832318 2917834321 312
415 iso_pu_bacteria 2919063839 2919065625 312
416 iso_pu_bacteria 2919125081 2919127877 312
417 iso_pu_bacteria 2919385768 2919389294 312
418 iso_pu_bacteria 2919456309 2919457444 312
419 iso_pu_bacteria 2919481497 2919485576 312
420 iso_pu_bacteria 2919487758 2919488268 312
421 iso_pu_bacteria 2919493220 2919494021 312
422 iso_pu_bacteria 2919543075 2919543647 312
423 iso_pu_bacteria 2919697872 2919700678 312
424 iso_pu_bacteria 2923153595 2923159415 312
425 iso_pu_bacteria 2923519811 2923523463 312
426 iso_pu_bacteria 2923525760 2923527606 312
427 iso_pu_bacteria 2923586266 2923588922 312
428 iso_pu_bacteria 2929144301 2929149845 312
429 iso_pu_bacteria 2929189879 2929195050 312
430 iso_pu_bacteria 2931369376 2931372748 312
431 iso_pu_bacteria 2931390751 2931396312 312
432 iso_pu_bacteria 2931396565 2931397970 312
433 iso_pu_bacteria 2935353572 2935358412 312
434 iso_pu_bacteria 2939636861 2939640911 312
435 iso_pu_bacteria 2939651529 2939655288 312
436 iso_pu_bacteria 2945928738 2945931016 312
437 iso_pu_bacteria 2945961074 2945966745 312
438 iso_pu_bacteria 2946006987 2946007032 312
439 iso_pu_bacteria 2946027586 2946027805 312
440 iso_pu_bacteria 2947233263 2947234319 312
441 iso_pu_bacteria 2969304461 2969310069 312
442 iso_pu_bacteria 2974289157 2974294182 312
443 iso_pu_bacteria 2974298342 2974298528 312
444 iso_pu_bacteria 2984286254 2984286706 312
445 iso_pu_bacteria 2984499530 2984504095 312
446 iso_pu_bacteria 2984504281 2984505790 312
447 iso_pu_bacteria 2988728565 2988731384 312
448 iso_pu_bacteria 2990196909 2990197609 312
449 iso_pu_bacteria 2998139840 2998145294 312
450 iso_pu_bacteria 3007419365 3007425632 312
451 iso_pu_bacteria 3007511990 3007517076 312
452 iso_pu_bacteria 3007614139 3007618824 312
453 iso_pu_bacteria 3007619802 3007624240 312
454 iso_pu_bacteria 3007718800 3007720589 312
455 iso_pu_bacteria 3007803356 3007806177 312
456 iso_pu_bacteria 3007855910 3007858220 312
457 iso_pu_bacteria 3007861166 3007865203 312
458 iso_pu_bacteria 3007866637 3007866856 312
459 iso_pu_bacteria 3007872151 3007873074 312
460 iso_pu_bacteria 637000220 637323163 312
461 iso_pu_bacteria 8015687852 8015693512 312
462 iso_pu_bacteria 8019769354 8019769879 312
463 iso_pu_bacteria 8019775933 8019777785 312
464 iso_pu_bacteria 8029995093 8029995607 312
465 iso_pu_bacteria 8054285046 8054288037 312
466 iso_pu_bacteria 8054347763 8054349682 312
467 iso_pu_bacteria 8054503363 8054508833 312
468 iso_pu_bacteria 8055770955 8055776759 312
469 iso_pu_bacteria 8055817908 8055823795 312
470 iso_pu_bacteria 8055878733 8055879984 312
471 iso_pu_bacteria 8056115690 8056116721 312
472 iso_pu_bacteria 8056120720 8056125478 312
473 iso_pu_bacteria 8056125926 8056131498 312
474 iso_pu_bacteria 8056131705 8056137212 312
475 iso_pu_bacteria 8056148874 8056151599 312
476 iso_pu_bacteria 8056155041 8056160748 312
477 iso_pu_bacteria 8056161164 8056163527 312
478 iso_pu_bacteria 8056172158 8056177515 312
479 iso_pu_bacteria 8056177738 8056181898 312
480 iso_pu_bacteria 8056569372 8056570359 312
481 iso_pu_bacteria 8057798959 8057801828 312
482 3300009147 Ga0114129_10321125 Ga0114129_103211251 313
483 3300035172 Ga0373955_0132534 Ga0373955_0132534_480_1421 313
484 3300050515 nmdc:mga0a205_334705_c1 nmdc:mga0a205_334705_c1_145_1086 313
485 3300001989 JGI24739J22299_10000262 JGI24739J22299_1000026217 314
486 3300003856 Ga0058692_1000088 Ga0058692_100008821 314
487 3300003856 Ga0058692_1000408 Ga0058692_10004086 314
488 3300003856 Ga0058692_1001118 Ga0058692_10011188 314
489 3300003856 Ga0058692_1001221 Ga0058692_100122110 314
490 3300003856 Ga0058692_1006862 Ga0058692_10068624 314
491 3300003856 Ga0058692_1010712 Ga0058692_10107122 314
492 3300005347 Ga0070668_100010130 Ga0070668_1000101303 314
493 3300005353 Ga0070669_100232005 Ga0070669_1002320052 314
494 3300005834 Ga0068851_10028615 Ga0068851_100286152 314
495 3300006051 Ga0075364_10199907 Ga0075364_101999072 314
496 3300009011 Ga0105251_10000826 Ga0105251_1000082616 314
497 3300009011 Ga0105251_10006115 Ga0105251_100061158 314
498 3300009011 Ga0105251_10021812 Ga0105251_100218121 314
499 3300009036 Ga0105244_10000381 Ga0105244_1000038121 314
500 3300009036 Ga0105244_10014401 Ga0105244_100144012 314
501 3300009036 Ga0105244_10052764 Ga0105244_100527642 314
502 3300009092 Ga0105250_10008893 Ga0105250_100088933 314
503 3300009092 Ga0105250_10030519 Ga0105250_100305192 314
504 3300011119 Ga0105246_10026233 Ga0105246_100262335 314
505 3300013100 Ga0157373_10004695 Ga0157373_100046957 314
506 3300013100 Ga0157373_10008680 Ga0157373_100086805 314
507 3300013100 Ga0157373_10168243 Ga0157373_101682431 314
508 3300013102 Ga0157371_10000586 Ga0157371_100005868 314
509 3300013102 Ga0157371_10009160 Ga0157371_100091605 314
510 3300013104 Ga0157370_10001990 Ga0157370_100019906 314
511 3300013306 Ga0163162_10012274 Ga0163162_1001227411 314
512 3300013307 Ga0157372_10331777 Ga0157372_103317772 314
513 3300013307 Ga0157372_10332006 Ga0157372_103320062 314
514 3300014497 Ga0182008_10007455 Ga0182008_100074556 314
515 3300015261 Ga0182006_1002528 Ga0182006_10025286 314
516 3300017792 Ga0163161_10002786 Ga0163161_100027869 314
517 3300025233 Ga0209437_100110 Ga0209437_100110167 314
518 3300025711 Ga0207696_1000232 Ga0207696_100023268 314
519 3300025711 Ga0207696_1000361 Ga0207696_100036133 314
520 3300025728 Ga0207655_1000047 Ga0207655_1000047166 314
521 3300025728 Ga0207655_1001308 Ga0207655_100130816 314
522 3300025728 Ga0207655_1012358 Ga0207655_10123582 314
523 3300025728 Ga0207655_1025121 Ga0207655_10251212 314
524 3300025728 Ga0207655_1042289 Ga0207655_10422891 314
525 3300025735 Ga0207713_1000028 Ga0207713_1000028124 314
526 3300025735 Ga0207713_1017788 Ga0207713_10177884 314
527 3300025735 Ga0207713_1059243 Ga0207713_10592431 314
528 3300025933 Ga0207706_10013492 Ga0207706_100134927 314
529 3300025972 Ga0207668_10047537 Ga0207668_100475374 314
530 3300026067 Ga0207678_10033252 Ga0207678_100332522 314
531 3300027312 Ga0209371_1000049 Ga0209371_1000049127 314
532 3300027312 Ga0209371_1000126 Ga0209371_100012611 314
533 3300027312 Ga0209371_1000137 Ga0209371_100013757 314
534 3300027312 Ga0209371_1000249 Ga0209371_10002496 314
535 3300027312 Ga0209371_1000641 Ga0209371_100064113 314
536 3300027312 Ga0209371_1003019 Ga0209371_100301911 314
537 3300027312 Ga0209371_1003354 Ga0209371_10033547 314
538 3300027312 Ga0209371_1004782 Ga0209371_10047825 314
539 3300030500 Ga0268256_1000031 Ga0268256_1000031258 314
540 3300030500 Ga0268256_1000062 Ga0268256_1000062129 314
541 3300030500 Ga0268256_1000105 Ga0268256_100010510 314
542 3300030500 Ga0268256_1001048 Ga0268256_100104811 314
543 3300030500 Ga0268256_1001456 Ga0268256_10014562 314
544 3300030500 Ga0268256_1002989 Ga0268256_10029892 314
545 3300030500 Ga0268256_1003051 Ga0268256_10030514 314
546 3300030500 Ga0268256_1018683 Ga0268256_10186831 314
547 3300041405 Ga0439438_002974 Ga0439438_002974_1350_2294 314
548 3300041405 Ga0439438_015591 Ga0439438_015591_1131_2075 314
549 3300041411 Ga0439466_0000004 Ga0439466_0000004_179058_180002 314
550 3300042006 Ga0439432_022172 Ga0439432_022172_487_1431 314
551 3300042010 Ga0439452_000009 Ga0439452_000009_178752_179696 314
552 3300042010 Ga0439452_008236 Ga0439452_008236_959_1903 314
553 3300042016 Ga0439463_001595 Ga0439463_001595_1250_2194 314
554 3300042146 Ga0450907_000014 Ga0450907_000014_7279_8223 314
555 3300046458 Ga0495591_000004 Ga0495591_000004_32473_33417 314
556 3300046458 Ga0495591_003233 Ga0495591_003233_3570_4514 314
557 3300046458 Ga0495591_020323 Ga0495591_020323_66_1010 314
558 3300046471 Ga0495650_0000008 Ga0495650_0000008_447478_448422 314
559 3300046500 Ga0495596_0002846 Ga0495596_0002846_4891_5835 314
560 3300046501 Ga0495607_0008669 Ga0495607_0008669_1187_2131 314
561 3300046507 Ga0495606_0001619 Ga0495606_0001619_4555_5499 314
562 3300046513 Ga0495616_0010967 Ga0495616_0010967_1367_2311 314
563 3300046520 Ga0495637_0062701 Ga0495637_0062701_260_1204 314
564 3300046522 Ga0495643_0032136 Ga0495643_0032136_131_1075 314
565 3300046522 Ga0495643_0035040 Ga0495643_0035040_486_1430 314
566 3300046524 Ga0495648_0004882 Ga0495648_0004882_4953_5897 314
567 3300046530 Ga0495654_0000057 Ga0495654_0000057_91212_92156 314
568 3300046530 Ga0495654_0000467 Ga0495654_0000467_24002_24946 314
569 3300046616 Ga0495668_0006952 Ga0495668_0006952_2268_3212 314
570 3300046692 Ga0495671_0003706 Ga0495671_0003706_2941_3885 314
571 3300046694 Ga0495649_0009902 Ga0495649_0009902_970_1914 314
572 3300046794 Ga0495589_0029506 Ga0495589_0029506_92_1036 314
573 3300046810 Ga0495660_0000019 Ga0495660_0000019_71154_72098 314
574 3300046810 Ga0495660_0004532 Ga0495660_0004532_3897_4841 314
575 3300047320 Ga0495672_0000003 Ga0495672_0000003_271758_272702 314
576 3300047320 Ga0495672_0000025 Ga0495672_0000025_184572_185516 314
577 3300047469 Ga0495673_0000011 Ga0495673_0000011_433515_434459 314
578 3300048903 Ga0496100_0001584 Ga0496100_0001584_5296_6240 314
579 3300048904 Ga0496101_0000152 Ga0496101_0000152_45725_46669 314
580 3300048905 Ga0496102_0007113 Ga0496102_0007113_6137_7081 314
581 3300048908 Ga0496105_0013609 Ga0496105_0013609_3447_4391 314
582 3300048919 Ga0496116_0000065 Ga0496116_0000065_184142_185086 314
583 3300048919 Ga0496116_0000076 Ga0496116_0000076_138824_139768 314
584 3300048919 Ga0496116_0006337 Ga0496116_0006337_5074_6018 314
585 3300048919 Ga0496116_0010371 Ga0496116_0010371_4028_4972 314
586 3300048919 Ga0496116_0014872 Ga0496116_0014872_1965_2909 314
587 3300048920 Ga0496117_0000043 Ga0496117_0000043_178292_179236 314
588 3300048920 Ga0496117_0000143 Ga0496117_0000143_92316_93260 314
589 3300048920 Ga0496117_0001832 Ga0496117_0001832_17471_18415 314
590 3300048921 Ga0496118_0000075 Ga0496118_0000075_178292_179236 314
591 3300048921 Ga0496118_0000735 Ga0496118_0000735_30095_31039 314
592 3300048921 Ga0496118_0000996 Ga0496118_0000996_40226_41170 314
593 3300048921 Ga0496118_0025321 Ga0496118_0025321_2080_3024 314
594 3300048922 Ga0496119_0000044 Ga0496119_0000044_161977_162921 314
595 3300048922 Ga0496119_0000059 Ga0496119_0000059_78479_79423 314
596 3300048922 Ga0496119_0001021 Ga0496119_0001021_32257_33201 314
597 3300048922 Ga0496119_0045873 Ga0496119_0045873_958_1902 314
598 3300048922 Ga0496119_0059429 Ga0496119_0059429_802_1746 314
599 3300048923 Ga0496120_0000044 Ga0496120_0000044_28900_29844 314
600 3300048923 Ga0496120_0000049 Ga0496120_0000049_108232_109176 314
601 3300048923 Ga0496120_0000073 Ga0496120_0000073_4581_5525 314
602 3300048923 Ga0496120_0000160 Ga0496120_0000160_24077_25021 314
603 3300048923 Ga0496120_0000363 Ga0496120_0000363_42766_43710 314
604 3300048923 Ga0496120_0001098 Ga0496120_0001098_29887_30831 314
605 3300048924 Ga0496121_0000057 Ga0496121_0000057_134379_135323 314
606 3300048925 Ga0496122_0005198 Ga0496122_0005198_8396_9340 314
607 3300048925 Ga0496122_0013637 Ga0496122_0013637_1210_2154 314
608 3300048926 Ga0496123_0007484 Ga0496123_0007484_3327_4271 314
609 3300048926 Ga0496123_0009549 Ga0496123_0009549_5285_6229 314
610 3300048927 Ga0496124_0002210 Ga0496124_0002210_2186_3130 314
611 3300048927 Ga0496124_0013833 Ga0496124_0013833_2863_3807 314
612 3300048927 Ga0496124_0029661 Ga0496124_0029661_992_1936 314
613 3300048927 Ga0496124_0030976 Ga0496124_0030976_2228_3172 314
614 3300048928 Ga0496125_0019206 Ga0496125_0019206_2015_2959 314
615 3300048929 Ga0496126_0018422 Ga0496126_0018422_3341_4285 314
616 3300048929 Ga0496126_0050008 Ga0496126_0050008_1482_2426 314
617 3300049459 Ga0495678_000479 Ga0495678_000479_34054_34998 314
618 3300049460 Ga0495682_0000006 Ga0495682_0000006_6530_7474 314
619 3300050491 nmdc:mga00v17_38697_c1 nmdc:mga00v17_38697_c1_1566_2510 314
620 3300050492 nmdc:mga0yw44_39414_c1 nmdc:mga0yw44_39414_c1_349_1293 314
621 3300053126 Ga0500621_000004 Ga0500621_000004_226883_227827 314
622 iso_pu_bacteria 2690315857 2691330401 314
623 iso_pu_bacteria 2919534386 2919535457 314
624 3300002737 JGI25162J39368_1000003 JGI25162J39368_100000330 315
625 3300002771 JGI25163J39215_1000012 JGI25163J39215_100001230 315
626 3300002772 JGI25164J39214_1000009 JGI25164J39214_1000009262 315
627 3300002773 JGI25152J39213_1001017 JGI25152J39213_10010175 315
628 3300003214 JGI25165J46597_1009840 JGI25165J46597_10098402 315
629 3300003751 Ga0055538_1000005 Ga0055538_100000530 315
630 3300003752 Ga0055539_1000007 Ga0055539_100000730 315
631 3300003756 Ga0055533_1000009 Ga0055533_100000930 315
632 3300003759 Ga0055525_1000010 Ga0055525_100001030 315
633 3300003841 Ga0055541_1000005 Ga0055541_1000005535 315
634 3300003856 Ga0058692_1011570 Ga0058692_10115702 315
635 3300005288 Ga0065714_10065783 Ga0065714_100657834 315
636 3300005289 Ga0065704_10000019 Ga0065704_1000001920 315
637 3300005289 Ga0065704_10000213 Ga0065704_1000021328 315
638 3300005289 Ga0065704_10075441 Ga0065704_100754415 315
639 3300005289 Ga0065704_10076172 Ga0065704_100761725 315
640 3300005289 Ga0065704_10167273 Ga0065704_101672731 315
641 3300005366 Ga0070659_100025113 Ga0070659_1000251132 315
642 3300005548 Ga0070665_100000033 Ga0070665_100000033238 315
643 3300005548 Ga0070665_100367216 Ga0070665_1003672161 315
644 3300005577 Ga0068857_100000005 Ga0068857_100000005117 315
645 3300005834 Ga0068851_10023602 Ga0068851_100236022 315
646 3300006051 Ga0075364_10000259 Ga0075364_1000025919 315
647 3300006051 Ga0075364_10020351 Ga0075364_100203515 315
648 3300006946 Ga0079104_1000287 Ga0079104_100028722 315
649 3300006946 Ga0079104_1000339 Ga0079104_100033936 315
650 3300006946 Ga0079104_1000404 Ga0079104_100040444 315
651 3300006946 Ga0079104_1000418 Ga0079104_100041810 315
652 3300006946 Ga0079104_1001127 Ga0079104_100112715 315
653 3300006946 Ga0079104_1002119 Ga0079104_10021199 315
654 3300006946 Ga0079104_1004138 Ga0079104_10041385 315
655 3300006946 Ga0079104_1009901 Ga0079104_10099012 315
656 3300006946 Ga0079104_1009944 Ga0079104_10099442 315
657 3300009011 Ga0105251_10000723 Ga0105251_1000072317 315
658 3300009011 Ga0105251_10000934 Ga0105251_100009342 315
659 3300009011 Ga0105251_10001349 Ga0105251_1000134910 315
660 3300009011 Ga0105251_10001376 Ga0105251_1000137615 315
661 3300009011 Ga0105251_10002672 Ga0105251_100026726 315
662 3300009011 Ga0105251_10002985 Ga0105251_1000298516 315
663 3300009011 Ga0105251_10021387 Ga0105251_100213872 315
664 3300009011 Ga0105251_10046200 Ga0105251_100462001 315
665 3300009036 Ga0105244_10000019 Ga0105244_10000019122 315
666 3300009036 Ga0105244_10000089 Ga0105244_1000008923 315
667 3300009036 Ga0105244_10000357 Ga0105244_1000035733 315
668 3300009036 Ga0105244_10000890 Ga0105244_1000089015 315
669 3300009036 Ga0105244_10001125 Ga0105244_100011255 315
670 3300009036 Ga0105244_10002009 Ga0105244_1000200916 315
671 3300009036 Ga0105244_10004019 Ga0105244_100040194 315
672 3300009036 Ga0105244_10004961 Ga0105244_100049614 315
673 3300009036 Ga0105244_10004963 Ga0105244_100049635 315
674 3300009092 Ga0105250_10000147 Ga0105250_1000014731 315
675 3300009092 Ga0105250_10000581 Ga0105250_1000058117 315
676 3300009092 Ga0105250_10000654 Ga0105250_100006546 315
677 3300009092 Ga0105250_10001579 Ga0105250_100015799 315
678 3300009092 Ga0105250_10004657 Ga0105250_100046573 315
679 3300009101 Ga0105247_10000997 Ga0105247_100009976 315
680 3300009148 Ga0105243_10003638 Ga0105243_100036388 315
681 3300009174 Ga0105241_10000006 Ga0105241_10000006289 315
682 3300011119 Ga0105246_10053909 Ga0105246_100539093 315
683 3300013102 Ga0157371_10001542 Ga0157371_100015428 315
684 3300013102 Ga0157371_10024255 Ga0157371_100242555 315
685 3300013104 Ga0157370_10000742 Ga0157370_1000074212 315
686 3300013307 Ga0157372_10000072 Ga0157372_1000007285 315
687 3300013307 Ga0157372_10187360 Ga0157372_101873601 315
688 3300014497 Ga0182008_10001816 Ga0182008_1000181612 315
689 3300015261 Ga0182006_1000045 Ga0182006_1000045151 315
690 3300015679 Ga0183366_1002 Ga0183366_1002366 315
691 3300015680 Ga0183370_1002 Ga0183370_1002366 315
692 3300015685 Ga0183369_1002 Ga0183369_1002366 315
693 3300015687 Ga0183368_1005 Ga0183368_1005366 315
694 3300017792 Ga0163161_10000050 Ga0163161_1000005050 315
695 3300017792 Ga0163161_10010424 Ga0163161_100104248 315
696 3300017792 Ga0163161_10171566 Ga0163161_101715661 315
697 3300021384 Ga0213876_10000013 Ga0213876_1000001320 315
698 3300025207 Ga0209760_100029 Ga0209760_10002945 315
699 3300025224 Ga0209784_100001 Ga0209784_100001575 315
700 3300025225 Ga0209566_100001 Ga0209566_100001575 315
701 3300025226 Ga0209674_100002 Ga0209674_100002575 315
702 3300025230 Ga0209563_100008 Ga0209563_100008578 315
703 3300025231 Ga0207427_100002 Ga0207427_100002702 315
704 3300025233 Ga0209437_100007 Ga0209437_10000730 315
705 3300025253 Ga0209677_100004 Ga0209677_100004578 315
706 3300025258 Ga0209129_1000010 Ga0209129_1000010280 315
707 3300025261 Ga0209233_1005948 Ga0209233_10059482 315
708 3300025321 Ga0207656_10010770 Ga0207656_100107702 315
709 3300025711 Ga0207696_1000008 Ga0207696_1000008425 315
710 3300025711 Ga0207696_1000012 Ga0207696_1000012113 315
711 3300025711 Ga0207696_1000014 Ga0207696_100001472 315
712 3300025711 Ga0207696_1000024 Ga0207696_100002439 315
713 3300025711 Ga0207696_1000037 Ga0207696_100003710 315
714 3300025711 Ga0207696_1000273 Ga0207696_100027322 315
715 3300025711 Ga0207696_1001598 Ga0207696_10015983 315
716 3300025711 Ga0207696_1002787 Ga0207696_10027872 315
717 3300025711 Ga0207696_1003098 Ga0207696_10030985 315
718 3300025728 Ga0207655_1000020 Ga0207655_1000020145 315
719 3300025728 Ga0207655_1000025 Ga0207655_1000025230 315
720 3300025728 Ga0207655_1000028 Ga0207655_1000028322 315
721 3300025728 Ga0207655_1000050 Ga0207655_1000050194 315
722 3300025728 Ga0207655_1000127 Ga0207655_100012711 315
723 3300025728 Ga0207655_1000160 Ga0207655_100016079 315
724 3300025728 Ga0207655_1001292 Ga0207655_10012928 315
725 3300025728 Ga0207655_1001824 Ga0207655_10018246 315
726 3300025728 Ga0207655_1011222 Ga0207655_10112225 315
727 3300025728 Ga0207655_1016120 Ga0207655_10161202 315
728 3300025735 Ga0207713_1000033 Ga0207713_100003335 315
729 3300025735 Ga0207713_1000109 Ga0207713_100010917 315
730 3300025735 Ga0207713_1000134 Ga0207713_100013465 315
731 3300025735 Ga0207713_1000362 Ga0207713_100036211 315
732 3300025735 Ga0207713_1000915 Ga0207713_100091526 315
733 3300025735 Ga0207713_1002743 Ga0207713_10027436 315
734 3300025735 Ga0207713_1005848 Ga0207713_10058483 315
735 3300025735 Ga0207713_1007434 Ga0207713_10074346 315
736 3300025735 Ga0207713_1011068 Ga0207713_10110682 315
737 3300025735 Ga0207713_1011833 Ga0207713_10118331 315
738 3300025735 Ga0207713_1021402 Ga0207713_10214021 315
739 3300025900 Ga0207710_10000007 Ga0207710_10000007365 315
740 3300025911 Ga0207654_10000008 Ga0207654_10000008292 315
741 3300025913 Ga0207695_10211266 Ga0207695_102112661 315
742 3300025932 Ga0207690_10033529 Ga0207690_100335292 315
743 3300025935 Ga0207709_10003503 Ga0207709_100035031 315
744 3300026116 Ga0207674_10000523 Ga0207674_1000052349 315
745 3300027111 Ga0209281_1000025 Ga0209281_1000025328 315
746 3300027111 Ga0209281_1000048 Ga0209281_100004845 315
747 3300027111 Ga0209281_1000058 Ga0209281_100005822 315
748 3300027111 Ga0209281_1000120 Ga0209281_1000120154 315
749 3300027111 Ga0209281_1000243 Ga0209281_10002435 315
750 3300027111 Ga0209281_1000260 Ga0209281_100026026 315
751 3300027111 Ga0209281_1000289 Ga0209281_100028942 315
752 3300027111 Ga0209281_1000403 Ga0209281_100040339 315
753 3300027111 Ga0209281_1000422 Ga0209281_100042244 315
754 3300027111 Ga0209281_1001257 Ga0209281_100125712 315
755 3300027111 Ga0209281_1006097 Ga0209281_10060972 315
756 3300027111 Ga0209281_1013603 Ga0209281_10136031 315
757 3300027312 Ga0209371_1000013 Ga0209371_1000013323 315
758 3300027312 Ga0209371_1000019 Ga0209371_1000019221 315
759 3300027312 Ga0209371_1000250 Ga0209371_100025012 315
760 3300027312 Ga0209371_1000544 Ga0209371_100054425 315
761 3300027312 Ga0209371_1001515 Ga0209371_100151518 315
762 3300027312 Ga0209371_1001741 Ga0209371_10017416 315
763 3300027312 Ga0209371_1004704 Ga0209371_10047047 315
764 3300027312 Ga0209371_1006887 Ga0209371_10068873 315
765 3300027312 Ga0209371_1007819 Ga0209371_10078193 315
766 3300028379 Ga0268266_10000041 Ga0268266_10000041134 315
767 3300030500 Ga0268256_1000014 Ga0268256_1000014355 315
768 3300030500 Ga0268256_1000024 Ga0268256_1000024304 315
769 3300030500 Ga0268256_1000462 Ga0268256_100046212 315
770 3300030500 Ga0268256_1000619 Ga0268256_100061912 315
771 3300030500 Ga0268256_1001608 Ga0268256_100160813 315
772 3300030500 Ga0268256_1004461 Ga0268256_10044617 315
773 3300030500 Ga0268256_1007007 Ga0268256_10070075 315
774 3300030500 Ga0268256_1008082 Ga0268256_10080823 315
775 3300039062 Ga0400483_074396 Ga0400483_074396_14583_15530 315
776 3300039062 Ga0400483_252643 Ga0400483_252643_9223_10170 315
777 3300039437 Ga0436365_0471682 Ga0436365_0471682_326912_327859 315
778 3300041405 Ga0439438_001628 Ga0439438_001628_7086_8033 315
779 3300041405 Ga0439438_009221 Ga0439438_009221_1244_2191 315
780 3300042006 Ga0439432_002311 Ga0439432_002311_661_1611 315
781 3300042010 Ga0439452_000006 Ga0439452_000006_256038_256985 315
782 3300042010 Ga0439452_000007 Ga0439452_000007_174157_175104 315
783 3300042010 Ga0439452_000119 Ga0439452_000119_6113_7060 315
784 3300042010 Ga0439452_000285 Ga0439452_000285_23060_24007 315
785 3300042137 Ga0450902_004648 Ga0450902_004648_729_1676 315
786 3300044669 Ga0466981_0000001 Ga0466981_0000001_149779_150726 315
787 3300044712 Ga0453684_0225110 Ga0453684_0225110_514_1461 315
788 3300046453 Ga0495627_000017 Ga0495627_000017_290805_291755 315
789 3300046458 Ga0495591_000030 Ga0495591_000030_165652_166599 315
790 3300046471 Ga0495650_0000004 Ga0495650_0000004_680472_681422 315
791 3300046515 Ga0495620_0001884 Ga0495620_0001884_2247_3194 315
792 3300046530 Ga0495654_0000973 Ga0495654_0000973_19982_20932 315
793 3300046530 Ga0495654_0015503 Ga0495654_0015503_126_1073 315
794 3300046542 Ga0495597_0002161 Ga0495597_0002161_7236_8183 315
795 3300046660 Ga0495625_0004942 Ga0495625_0004942_10193_11140 315
796 3300046674 Ga0495588_0035586 Ga0495588_0035586_291_1238 315
797 3300046694 Ga0495649_0008917 Ga0495649_0008917_4374_5321 315
798 3300046794 Ga0495589_0000028 Ga0495589_0000028_91922_92872 315
799 3300046810 Ga0495660_0000062 Ga0495660_0000062_28609_29559 315
800 3300047320 Ga0495672_0000051 Ga0495672_0000051_70681_71628 315
801 3300047446 Ga0495679_000014 Ga0495679_000014_206858_207805 315
802 3300047446 Ga0495679_002287 Ga0495679_002287_894_1841 315
803 3300047469 Ga0495673_0000055 Ga0495673_0000055_238761_239708 315
804 3300048906 Ga0496103_0064839 Ga0496103_0064839_1154_2104 315
805 3300048907 Ga0496104_0005676 Ga0496104_0005676_6017_6967 315
806 3300048919 Ga0496116_0000009 Ga0496116_0000009_281026_281976 315
807 3300048919 Ga0496116_0000016 Ga0496116_0000016_549000_549950 315
808 3300048919 Ga0496116_0017116 Ga0496116_0017116_1595_2542 315
809 3300048919 Ga0496116_0129223 Ga0496116_0129223_474_1421 315
810 3300048919 Ga0496116_0210325 Ga0496116_0210325_44_991 315
811 3300048919 Ga0496116_0210336 Ga0496116_0210336_44_991 315
812 3300048920 Ga0496117_0006134 Ga0496117_0006134_6596_7543 315
813 3300048920 Ga0496117_0007952 Ga0496117_0007952_6744_7691 315
814 3300048920 Ga0496117_0029065 Ga0496117_0029065_1739_2689 315
815 3300048920 Ga0496117_0114453 Ga0496117_0114453_699_1649 315
816 3300048920 Ga0496117_0133776 Ga0496117_0133776_11_961 315
817 3300048921 Ga0496118_0003031 Ga0496118_0003031_8248_9198 315
818 3300048921 Ga0496118_0004414 Ga0496118_0004414_14864_15814 315
819 3300048921 Ga0496118_0009229 Ga0496118_0009229_785_1732 315
820 3300048921 Ga0496118_0034144 Ga0496118_0034144_2341_3288 315
821 3300048922 Ga0496119_0000009 Ga0496119_0000009_188133_189080 315
822 3300048922 Ga0496119_0002154 Ga0496119_0002154_8950_9900 315
823 3300048922 Ga0496119_0002157 Ga0496119_0002157_12244_13194 315
824 3300048922 Ga0496119_0005307 Ga0496119_0005307_11435_12382 315
825 3300048922 Ga0496119_0046522 Ga0496119_0046522_537_1487 315
826 3300048922 Ga0496119_0067164 Ga0496119_0067164_806_1756 315
827 3300048923 Ga0496120_0000201 Ga0496120_0000201_88730_89680 315
828 3300048923 Ga0496120_0000225 Ga0496120_0000225_19614_20564 315
829 3300048923 Ga0496120_0003294 Ga0496120_0003294_162_1112 315
830 3300048923 Ga0496120_0006065 Ga0496120_0006065_2321_3268 315
831 3300048923 Ga0496120_0013017 Ga0496120_0013017_1848_2795 315
832 3300048924 Ga0496121_0006547 Ga0496121_0006547_9155_10102 315
833 3300048924 Ga0496121_0059124 Ga0496121_0059124_144_1091 315
834 3300048925 Ga0496122_0000016 Ga0496122_0000016_145665_146612 315
835 3300048925 Ga0496122_0000056 Ga0496122_0000056_148724_149674 315
836 3300048925 Ga0496122_0001852 Ga0496122_0001852_20998_21945 315
837 3300048925 Ga0496122_0003483 Ga0496122_0003483_3341_4288 315
838 3300048925 Ga0496122_0106604 Ga0496122_0106604_18_965 315
839 3300048926 Ga0496123_0000017 Ga0496123_0000017_342866_343813 315
840 3300048926 Ga0496123_0000041 Ga0496123_0000041_148724_149674 315
841 3300048926 Ga0496123_0001508 Ga0496123_0001508_21023_21970 315
842 3300048926 Ga0496123_0006325 Ga0496123_0006325_242_1189 315
843 3300048926 Ga0496123_0025029 Ga0496123_0025029_1944_2891 315
844 3300048927 Ga0496124_0000010 Ga0496124_0000010_421977_422927 315
845 3300048927 Ga0496124_0000096 Ga0496124_0000096_105896_106846 315
846 3300048927 Ga0496124_0000154 Ga0496124_0000154_10487_11434 315
847 3300048927 Ga0496124_0001686 Ga0496124_0001686_25426_26373 315
848 3300048927 Ga0496124_0046373 Ga0496124_0046373_2529_3476 315
849 3300048928 Ga0496125_0000113 Ga0496125_0000113_149083_150033 315
850 3300048928 Ga0496125_0000418 Ga0496125_0000418_66938_67885 315
851 3300048928 Ga0496125_0003408 Ga0496125_0003408_16104_17051 315
852 3300048929 Ga0496126_0001638 Ga0496126_0001638_28260_29210 315
853 3300048929 Ga0496126_0007584 Ga0496126_0007584_6750_7697 315
854 3300048929 Ga0496126_0029528 Ga0496126_0029528_2765_3712 315
855 3300050491 nmdc:mga00v17_8884_c1 nmdc:mga00v17_8884_c1_2085_3032 315
856 3300002737 JGI25162J39368_1000159 JGI25162J39368_100015947 316
857 3300002737 JGI25162J39368_1000193 JGI25162J39368_100019335 316
858 3300002771 JGI25163J39215_1000242 JGI25163J39215_10002422 316
859 3300002771 JGI25163J39215_1001170 JGI25163J39215_10011706 316
860 3300002772 JGI25164J39214_1000124 JGI25164J39214_100012447 316
861 3300002772 JGI25164J39214_1000219 JGI25164J39214_100021935 316
862 3300003214 JGI25165J46597_1000243 JGI25165J46597_100024332 316
863 3300003214 JGI25165J46597_1000288 JGI25165J46597_100028830 316
864 3300003751 Ga0055538_1000032 Ga0055538_100003238 316
865 3300003752 Ga0055539_1000043 Ga0055539_100004338 316
866 3300003756 Ga0055533_1000052 Ga0055533_100005238 316
867 3300003758 Ga0055532_1000047 Ga0055532_100004718 316
868 3300003759 Ga0055525_1000062 Ga0055525_100006238 316
869 3300003761 Ga0055535_1008192 Ga0055535_10081921 316
870 3300003771 Ga0055526_1008841 Ga0055526_10088412 316
871 3300003781 Ga0055536_1000688 Ga0055536_100068815 316
872 3300003781 Ga0055536_1000826 Ga0055536_10008263 316
873 3300003781 Ga0055536_1000963 Ga0055536_10009632 316
874 3300003791 Ga0055530_10000242 Ga0055530_1000024234 316
875 3300003791 Ga0055530_10000266 Ga0055530_1000026613 316
876 3300003791 Ga0055530_10000906 Ga0055530_1000090615 316
877 3300003792 Ga0055540_1000178 Ga0055540_100017815 316
878 3300003792 Ga0055540_1000250 Ga0055540_100025034 316
879 3300003792 Ga0055540_1000732 Ga0055540_100073212 316
880 3300003794 Ga0055531_10003658 Ga0055531_1000365810 316
881 3300003841 Ga0055541_1000030 Ga0055541_100003038 316
882 3300005288 Ga0065714_10002750 Ga0065714_100027507 316
883 3300005288 Ga0065714_10003864 Ga0065714_100038645 316
884 3300005288 Ga0065714_10009345 Ga0065714_100093452 316
885 3300005288 Ga0065714_10065831 Ga0065714_100658311 316
886 3300005288 Ga0065714_10072956 Ga0065714_100729564 316
887 3300005288 Ga0065714_10085451 Ga0065714_100854511 316
888 3300005289 Ga0065704_10018562 Ga0065704_100185623 316
889 3300005289 Ga0065704_10076130 Ga0065704_100761305 316
890 3300005289 Ga0065704_10081619 Ga0065704_100816192 316
891 3300005289 Ga0065704_10161517 Ga0065704_101615171 316
892 3300005290 Ga0065712_10007996 Ga0065712_100079965 316
893 3300005290 Ga0065712_10082114 Ga0065712_100821144 316
894 3300005331 Ga0070670_100014250 Ga0070670_1000142508 316
895 3300005331 Ga0070670_100049381 Ga0070670_1000493811 316
896 3300005335 Ga0070666_10019708 Ga0070666_100197084 316
897 3300005353 Ga0070669_100000465 Ga0070669_1000004656 316
898 3300005353 Ga0070669_100000755 Ga0070669_10000075522 316
899 3300005353 Ga0070669_100002318 Ga0070669_1000023187 316
900 3300005355 Ga0070671_100000023 Ga0070671_10000002395 316
901 3300005367 Ga0070667_100000018 Ga0070667_100000018186 316
902 3300005457 Ga0070662_100000621 Ga0070662_10000062110 316
903 3300005466 Ga0070685_10000011 Ga0070685_1000001180 316
904 3300005539 Ga0068853_100000448 Ga0068853_1000004487 316
905 3300005548 Ga0070665_100022586 Ga0070665_1000225865 316
906 3300005564 Ga0070664_100006498 Ga0070664_1000064988 316
907 3300005577 Ga0068857_100055971 Ga0068857_1000559715 316
908 3300005578 Ga0068854_100001005 Ga0068854_1000010057 316
909 3300005618 Ga0068864_100000003 Ga0068864_100000003189 316
910 3300005834 Ga0068851_10000012 Ga0068851_10000012152 316
911 3300005842 Ga0068858_100142996 Ga0068858_1001429963 316
912 3300005843 Ga0068860_100001007 Ga0068860_1000010079 316
913 3300005844 Ga0068862_100002195 Ga0068862_10000219512 316
914 3300006051 Ga0075364_10118318 Ga0075364_101183182 316
915 3300006058 Ga0075432_10000377 Ga0075432_100003773 316
916 3300006058 Ga0075432_10024921 Ga0075432_100249213 316
917 3300006058 Ga0075432_10026592 Ga0075432_100265922 316
918 3300006058 Ga0075432_10034118 Ga0075432_100341182 316
919 3300006058 Ga0075432_10109923 Ga0075432_101099231 316
920 3300006946 Ga0079104_1000133 Ga0079104_100013363 316
921 3300006946 Ga0079104_1000158 Ga0079104_100015845 316
922 3300006948 Ga0099826_10000847 Ga0099826_100008476 316
923 3300009011 Ga0105251_10000024 Ga0105251_1000002490 316
924 3300009011 Ga0105251_10002571 Ga0105251_100025716 316
925 3300009011 Ga0105251_10002624 Ga0105251_1000262412 316
926 3300009011 Ga0105251_10004326 Ga0105251_100043266 316
927 3300009011 Ga0105251_10007450 Ga0105251_100074508 316
928 3300009011 Ga0105251_10010275 Ga0105251_100102758 316
929 3300009011 Ga0105251_10016113 Ga0105251_100161136 316
930 3300009011 Ga0105251_10022046 Ga0105251_100220463 316
931 3300009011 Ga0105251_10045046 Ga0105251_100450463 316
932 3300009036 Ga0105244_10002039 Ga0105244_100020392 316
933 3300009036 Ga0105244_10006600 Ga0105244_100066006 316
934 3300009036 Ga0105244_10026108 Ga0105244_100261084 316
935 3300009036 Ga0105244_10062576 Ga0105244_100625761 316
936 3300009036 Ga0105244_10114037 Ga0105244_101140371 316
937 3300009092 Ga0105250_10000046 Ga0105250_10000046109 316
938 3300009092 Ga0105250_10000227 Ga0105250_1000022729 316
939 3300009092 Ga0105250_10003361 Ga0105250_100033616 316
940 3300009092 Ga0105250_10003899 Ga0105250_100038995 316
941 3300009092 Ga0105250_10019351 Ga0105250_100193512 316
942 3300009092 Ga0105250_10027495 Ga0105250_100274952 316
943 3300009092 Ga0105250_10031531 Ga0105250_100315313 316
944 3300009092 Ga0105250_10075246 Ga0105250_100752461 316
945 3300009092 Ga0105250_10103176 Ga0105250_101031762 316
946 3300009101 Ga0105247_10030544 Ga0105247_100305443 316
947 3300009148 Ga0105243_10000327 Ga0105243_1000032715 316
948 3300009148 Ga0105243_10057301 Ga0105243_100573013 316
949 3300009176 Ga0105242_10002370 Ga0105242_100023702 316
950 3300009545 Ga0105237_10000764 Ga0105237_1000076437 316
951 3300009545 Ga0105237_10460897 Ga0105237_104608972 316
952 3300009553 Ga0105249_10013838 Ga0105249_100138382 316
953 3300011119 Ga0105246_10000188 Ga0105246_100001889 316
954 3300011119 Ga0105246_10000752 Ga0105246_100007527 316
955 3300011119 Ga0105246_10013652 Ga0105246_100136525 316
956 3300012498 Ga0157345_1000046 Ga0157345_10000469 316
957 3300013100 Ga0157373_10001750 Ga0157373_100017505 316
958 3300013100 Ga0157373_10002614 Ga0157373_1000261411 316
959 3300013100 Ga0157373_10281560 Ga0157373_102815601 316
960 3300013102 Ga0157371_10000045 Ga0157371_10000045173 316
961 3300013102 Ga0157371_10000870 Ga0157371_1000087028 316
962 3300013102 Ga0157371_10002624 Ga0157371_100026242 316
963 3300013102 Ga0157371_10048020 Ga0157371_100480205 316
964 3300013104 Ga0157370_10000086 Ga0157370_1000008682 316
965 3300013104 Ga0157370_10089987 Ga0157370_100899872 316
966 3300013104 Ga0157370_10098881 Ga0157370_100988812 316
967 3300013105 Ga0157369_10011042 Ga0157369_100110427 316
968 3300013105 Ga0157369_10070916 Ga0157369_100709165 316
969 3300013105 Ga0157369_10135811 Ga0157369_101358112 316
970 3300013306 Ga0163162_10000144 Ga0163162_1000014460 316
971 3300013307 Ga0157372_10005090 Ga0157372_100050906 316
972 3300013308 Ga0157375_10836613 Ga0157375_108366131 316
973 3300014325 Ga0163163_10000132 Ga0163163_100001327 316
974 3300014497 Ga0182008_10000366 Ga0182008_1000036629 316
975 3300014497 Ga0182008_10013582 Ga0182008_100135823 316
976 3300014497 Ga0182008_10062007 Ga0182008_100620072 316
977 3300014497 Ga0182008_10086517 Ga0182008_100865172 316
978 3300014497 Ga0182008_10123934 Ga0182008_101239342 316
979 3300015261 Ga0182006_1000449 Ga0182006_100044929 316
980 3300015261 Ga0182006_1001281 Ga0182006_10012819 316
981 3300015261 Ga0182006_1008019 Ga0182006_10080195 316
982 3300015261 Ga0182006_1014267 Ga0182006_10142672 316
983 3300015262 Ga0182007_10001043 Ga0182007_100010435 316
984 3300015265 Ga0182005_1000905 Ga0182005_10009057 316
985 3300015265 Ga0182005_1002687 Ga0182005_10026876 316
986 3300015265 Ga0182005_1012663 Ga0182005_10126632 316
987 3300017792 Ga0163161_10035524 Ga0163161_100355244 316
988 3300017792 Ga0163161_10273242 Ga0163161_102732422 316
989 3300017792 Ga0163161_10282016 Ga0163161_102820162 316
990 3300025207 Ga0209760_100115 Ga0209760_1001159 316
991 3300025207 Ga0209760_100209 Ga0209760_1002092 316
992 3300025224 Ga0209784_100007 Ga0209784_100007478 316
993 3300025225 Ga0209566_100009 Ga0209566_100009478 316
994 3300025226 Ga0209674_100021 Ga0209674_100021478 316
995 3300025229 Ga0209147_100009 Ga0209147_100009478 316
996 3300025230 Ga0209563_100018 Ga0209563_100018478 316
997 3300025230 Ga0209563_100490 Ga0209563_10049010 316
998 3300025231 Ga0207427_100005 Ga0207427_100005223 316
999 3300025231 Ga0207427_100006 Ga0207427_100006552 316
1000 3300025233 Ga0209437_100013 Ga0209437_100013552 316
1001 3300025233 Ga0209437_100018 Ga0209437_100018133 316
1002 3300025242 Ga0209258_100169 Ga0209258_1001696 316
1003 3300025246 Ga0209646_1000289 Ga0209646_10002895 316
1004 3300025253 Ga0209677_100012 Ga0209677_100012478 316
1005 3300025261 Ga0209233_1000021 Ga0209233_1000021223 316
1006 3300025261 Ga0209233_1000022 Ga0209233_1000022552 316
1007 3300025292 Ga0209676_1000015 Ga0209676_1000015515 316
1008 3300025292 Ga0209676_1000030 Ga0209676_1000030165 316
1009 3300025292 Ga0209676_1000041 Ga0209676_1000041273 316
1010 3300025292 Ga0209676_1001206 Ga0209676_100120622 316
1011 3300025292 Ga0209676_1002127 Ga0209676_100212712 316
1012 3300025292 Ga0209676_1005758 Ga0209676_10057586 316
1013 3300025298 Ga0209050_1000024 Ga0209050_1000024282 316
1014 3300025298 Ga0209050_1000075 Ga0209050_1000075178 316
1015 3300025298 Ga0209050_1001646 Ga0209050_10016467 316
1016 3300025303 Ga0209051_1000012 Ga0209051_1000012165 316
1017 3300025303 Ga0209051_1000023 Ga0209051_1000023198 316
1018 3300025303 Ga0209051_1000041 Ga0209051_1000041211 316
1019 3300025304 Ga0209257_1000069 Ga0209257_100006998 316
1020 3300025304 Ga0209257_1003954 Ga0209257_10039546 316
1021 3300025321 Ga0207656_10000006 Ga0207656_10000006167 316
1022 3300025711 Ga0207696_1000031 Ga0207696_1000031130 316
1023 3300025711 Ga0207696_1000074 Ga0207696_100007459 316
1024 3300025711 Ga0207696_1000105 Ga0207696_100010596 316
1025 3300025711 Ga0207696_1000156 Ga0207696_100015621 316
1026 3300025711 Ga0207696_1000167 Ga0207696_100016737 316
1027 3300025711 Ga0207696_1004315 Ga0207696_10043153 316
1028 3300025728 Ga0207655_1000068 Ga0207655_100006846 316
1029 3300025728 Ga0207655_1000346 Ga0207655_100034649 316
1030 3300025728 Ga0207655_1000412 Ga0207655_100041232 316
1031 3300025728 Ga0207655_1001450 Ga0207655_100145018 316
1032 3300025728 Ga0207655_1003960 Ga0207655_10039606 316
1033 3300025728 Ga0207655_1005735 Ga0207655_10057356 316
1034 3300025728 Ga0207655_1005931 Ga0207655_10059316 316
1035 3300025728 Ga0207655_1007527 Ga0207655_10075276 316
1036 3300025728 Ga0207655_1013505 Ga0207655_10135053 316
1037 3300025728 Ga0207655_1014203 Ga0207655_10142035 316
1038 3300025728 Ga0207655_1018579 Ga0207655_10185795 316
1039 3300025735 Ga0207713_1000010 Ga0207713_1000010215 316
1040 3300025735 Ga0207713_1000077 Ga0207713_1000077130 316
1041 3300025735 Ga0207713_1000438 Ga0207713_100043810 316
1042 3300025735 Ga0207713_1000596 Ga0207713_100059624 316
1043 3300025735 Ga0207713_1001190 Ga0207713_100119010 316
1044 3300025735 Ga0207713_1001727 Ga0207713_100172711 316
1045 3300025735 Ga0207713_1002223 Ga0207713_10022237 316
1046 3300025735 Ga0207713_1003773 Ga0207713_10037736 316
1047 3300025735 Ga0207713_1004050 Ga0207713_10040509 316
1048 3300025735 Ga0207713_1004203 Ga0207713_10042035 316
1049 3300025735 Ga0207713_1004948 Ga0207713_10049486 316
1050 3300025735 Ga0207713_1012449 Ga0207713_10124494 316
1051 3300025735 Ga0207713_1016743 Ga0207713_10167435 316
1052 3300025735 Ga0207713_1018246 Ga0207713_10182462 316
1053 3300025735 Ga0207713_1022345 Ga0207713_10223454 316
1054 3300025914 Ga0207671_10000097 Ga0207671_1000009772 316
1055 3300025920 Ga0207649_10000012 Ga0207649_100000127 316
1056 3300025923 Ga0207681_10000132 Ga0207681_1000013234 316
1057 3300025923 Ga0207681_10001682 Ga0207681_100016827 316
1058 3300025923 Ga0207681_10004687 Ga0207681_100046876 316
1059 3300025925 Ga0207650_10000003 Ga0207650_10000003740 316
1060 3300025925 Ga0207650_10000140 Ga0207650_1000014029 316
1061 3300025931 Ga0207644_10000027 Ga0207644_10000027113 316
1062 3300025933 Ga0207706_10001217 Ga0207706_1000121729 316
1063 3300025933 Ga0207706_10004311 Ga0207706_100043112 316
1064 3300025934 Ga0207686_10002456 Ga0207686_100024565 316
1065 3300025934 Ga0207686_10071427 Ga0207686_100714272 316
1066 3300025935 Ga0207709_10000071 Ga0207709_10000071128 316
1067 3300025935 Ga0207709_10000178 Ga0207709_1000017841 316
1068 3300025935 Ga0207709_10009000 Ga0207709_100090004 316
1069 3300025935 Ga0207709_10032019 Ga0207709_100320193 316
1070 3300025935 Ga0207709_10049439 Ga0207709_100494392 316
1071 3300025937 Ga0207669_10283396 Ga0207669_102833961 316
1072 3300025941 Ga0207711_10002516 Ga0207711_1000251611 316
1073 3300025945 Ga0207679_10000015 Ga0207679_100000157 316
1074 3300025961 Ga0207712_10008013 Ga0207712_100080136 316
1075 3300025972 Ga0207668_10095248 Ga0207668_100952482 316
1076 3300025986 Ga0207658_10000004 Ga0207658_10000004187 316
1077 3300026035 Ga0207703_10077197 Ga0207703_100771973 316
1078 3300026041 Ga0207639_10005479 Ga0207639_100054795 316
1079 3300026088 Ga0207641_10027419 Ga0207641_100274193 316
1080 3300026095 Ga0207676_10000003 Ga0207676_10000003355 316
1081 3300027111 Ga0209281_1000016 Ga0209281_1000016209 316
1082 3300027111 Ga0209281_1000019 Ga0209281_1000019329 316
1083 3300027111 Ga0209281_1003906 Ga0209281_10039063 316
1084 3300027312 Ga0209371_1000032 Ga0209371_1000032241 316
1085 3300027312 Ga0209371_1009486 Ga0209371_10094863 316
1086 3300027614 Ga0209970_1009996 Ga0209970_10099962 316
1087 3300027665 Ga0209983_1000835 Ga0209983_10008355 316
1088 3300027666 Ga0209282_1032381 Ga0209282_10323813 316
1089 3300027682 Ga0209971_1001712 Ga0209971_10017121 316
1090 3300027876 Ga0209974_10007350 Ga0209974_100073501 316
1091 3300027907 Ga0207428_10024079 Ga0207428_100240796 316
1092 3300027907 Ga0207428_10053707 Ga0207428_100537073 316
1093 3300027907 Ga0207428_10079279 Ga0207428_100792792 316
1094 3300028379 Ga0268266_10027494 Ga0268266_100274944 316
1095 3300028379 Ga0268266_10169192 Ga0268266_101691922 316
1096 3300028380 Ga0268265_10001161 Ga0268265_1000116111 316
1097 3300028381 Ga0268264_10000016 Ga0268264_10000016237 316
1098 3300028786 Ga0307517_10104269 Ga0307517_101042693 316
1099 3300030500 Ga0268256_1000050 Ga0268256_1000050163 316
1100 3300030500 Ga0268256_1010057 Ga0268256_10100572 316
1101 3300030731 Ga0316177_1174538 Ga0316177_11745381 316
1102 3300030733 Ga0314311_1051460 Ga0314311_10514603 316
1103 3300030735 Ga0316178_1149415 Ga0316178_11494158 316
1104 3300030744 Ga0316181_1260281 Ga0316181_12602813 316
1105 3300031250 Ga0265331_10004743 Ga0265331_100047439 316
1106 3300031251 Ga0265327_10000484 Ga0265327_1000048448 316
1107 3300031251 Ga0265327_10000598 Ga0265327_1000059852 316
1108 3300031251 Ga0265327_10002376 Ga0265327_1000237610 316
1109 3300031251 Ga0265327_10058938 Ga0265327_100589383 316
1110 3300031344 Ga0265316_10000171 Ga0265316_1000017116 316
1111 3300031548 Ga0307408_100022414 Ga0307408_1000224144 316
1112 3300031691 Ga0316579_10016188 Ga0316579_100161882 316
1113 3300031691 Ga0316579_10086529 Ga0316579_100865292 316
1114 3300031727 Ga0316576_10000108 Ga0316576_1000010823 316
1115 3300031727 Ga0316576_10008053 Ga0316576_100080535 316
1116 3300031727 Ga0316576_10035683 Ga0316576_100356832 316
1117 3300031727 Ga0316576_10071721 Ga0316576_100717212 316
1118 3300031727 Ga0316576_10075683 Ga0316576_100756832 316
1119 3300031727 Ga0316576_10107878 Ga0316576_101078783 316
1120 3300031728 Ga0316578_10000526 Ga0316578_100005266 316
1121 3300031728 Ga0316578_10005562 Ga0316578_100055625 316
1122 3300031728 Ga0316578_10008699 Ga0316578_100086992 316
1123 3300031728 Ga0316578_10015287 Ga0316578_100152872 316
1124 3300031728 Ga0316578_10022643 Ga0316578_100226433 316
1125 3300031728 Ga0316578_10038328 Ga0316578_100383283 316
1126 3300031728 Ga0316578_10096233 Ga0316578_100962331 316
1127 3300031731 Ga0307405_10000573 Ga0307405_100005734 316
1128 3300031731 Ga0307405_10061648 Ga0307405_100616483 316
1129 3300031731 Ga0307405_10322494 Ga0307405_103224941 316
1130 3300031733 Ga0316577_10000244 Ga0316577_1000024415 316
1131 3300031733 Ga0316577_10019144 Ga0316577_100191445 316
1132 3300031733 Ga0316577_10175717 Ga0316577_101757172 316
1133 3300031824 Ga0307413_10003695 Ga0307413_100036956 316
1134 3300031824 Ga0307413_10210484 Ga0307413_102104842 316
1135 3300031901 Ga0307406_10013873 Ga0307406_100138735 316
1136 3300031911 Ga0307412_10038051 Ga0307412_100380512 316
1137 3300031995 Ga0307409_100011298 Ga0307409_1000112982 316
1138 3300032002 Ga0307416_100103530 Ga0307416_1001035303 316
1139 3300032004 Ga0307414_10017416 Ga0307414_100174164 316
1140 3300032004 Ga0307414_10098890 Ga0307414_100988901 316
1141 3300032005 Ga0307411_10026552 Ga0307411_100265524 316
1142 3300032005 Ga0307411_10359820 Ga0307411_103598201 316
1143 3300032133 Ga0316583_10005907 Ga0316583_100059074 316
1144 3300032139 Ga0316580_10014222 Ga0316580_100142222 316
1145 3300032139 Ga0316580_10031788 Ga0316580_100317881 316
1146 3300032168 Ga0316593_10071874 Ga0316593_100718741 316
1147 3300033180 Ga0307510_10006053 Ga0307510_100060537 316
1148 3300033180 Ga0307510_10146524 Ga0307510_101465243 316
1149 3300033524 Ga0316592_1001789 Ga0316592_10017893 316
1150 3300033528 Ga0316588_1026982 Ga0316588_10269821 316
1151 3300033529 Ga0316587_1018220 Ga0316587_10182201 316
1152 3300033541 Ga0316596_1001309 Ga0316596_10013096 316
1153 3300035398 Ga0316574_0014019 Ga0316574_0014019_1288_2238 316
1154 3300035398 Ga0316574_0024017 Ga0316574_0024017_220_1170 316
1155 3300035398 Ga0316574_0029332 Ga0316574_0029332_381_1331 316
1156 3300035398 Ga0316574_0116183 Ga0316574_0116183_492_1445 316
1157 3300036647 Ga0316582_0001823 Ga0316582_0001823_230_1180 316
1158 3300036647 Ga0316582_0003914 Ga0316582_0003914_5573_6523 316
1159 3300036647 Ga0316582_0039054 Ga0316582_0039054_1956_2909 316
1160 3300036647 Ga0316582_0047540 Ga0316582_0047540_472_1422 316
1161 3300036647 Ga0316582_0086503 Ga0316582_0086503_28_978 316
1162 3300036712 Ga0316584_0000272 Ga0316584_0000272_20871_21827 316
1163 3300036712 Ga0316584_0003068 Ga0316584_0003068_5011_5961 316
1164 3300036712 Ga0316584_0012978 Ga0316584_0012978_1091_2041 316
1165 3300036712 Ga0316584_0055366 Ga0316584_0055366_1487_2440 316
1166 3300036712 Ga0316584_0081029 Ga0316584_0081029_1016_1969 316
1167 3300036712 Ga0316584_0125120 Ga0316584_0125120_617_1570 316
1168 3300036712 Ga0316584_0201330 Ga0316584_0201330_259_1212 316
1169 3300038725 Ga0400484_43206 Ga0400484_43206_114_1064 316
1170 3300038726 Ga0400490_45650 Ga0400490_45650_195_1145 316
1171 3300038741 Ga0400488_54405 Ga0400488_54405_695_1645 316
1172 3300039062 Ga0400483_047239 Ga0400483_047239_566_1516 316
1173 3300039062 Ga0400483_083724 Ga0400483_083724_168_1118 316
1174 3300039062 Ga0400483_087057 Ga0400483_087057_5901_6851 316
1175 3300039062 Ga0400483_149198 Ga0400483_149198_7373_8338 316
1176 3300039062 Ga0400483_170940 Ga0400483_170940_97_1047 316
1177 3300039062 Ga0400483_234085 Ga0400483_234085_669_1619 316
1178 3300039062 Ga0400483_244751 Ga0400483_244751_1152_2102 316
1179 3300039110 Ga0400487_02859 Ga0400487_02859_14252_15202 316
1180 3300039110 Ga0400487_56999 Ga0400487_56999_483_1433 316
1181 3300039437 Ga0436365_0097125 Ga0436365_0097125_1371_2327 316
1182 3300041404 Ga0439436_0006963 Ga0439436_0006963_1207_2178 316
1183 3300041405 Ga0439438_000819 Ga0439438_000819_3164_4135 316
1184 3300041405 Ga0439438_012043 Ga0439438_012043_1447_2400 316
1185 3300041405 Ga0439438_015700 Ga0439438_015700_925_1878 316
1186 3300041405 Ga0439438_022539 Ga0439438_022539_741_1694 316
1187 3300041407 Ga0439447_003730 Ga0439447_003730_2506_3459 316
1188 3300041407 Ga0439447_003812 Ga0439447_003812_1565_2536 316
1189 3300041407 Ga0439447_035076 Ga0439447_035076_256_1227 316
1190 3300041411 Ga0439466_0000893 Ga0439466_0000893_3374_4345 316
1191 3300041411 Ga0439466_0001103 Ga0439466_0001103_3009_3962 316
1192 3300041411 Ga0439466_0002341 Ga0439466_0002341_3003_3959 316
1193 3300041411 Ga0439466_0007637 Ga0439466_0007637_2502_3455 316
1194 3300041411 Ga0439466_0046853 Ga0439466_0046853_379_1350 316
1195 3300042000 Ga0439437_000863 Ga0439437_000863_1674_2633 316
1196 3300042006 Ga0439432_002853 Ga0439432_002853_2533_3486 316
1197 3300042006 Ga0439432_005353 Ga0439432_005353_532_1503 316
1198 3300042009 Ga0439451_001077 Ga0439451_001077_33_986 316
1199 3300042009 Ga0439451_001134 Ga0439451_001134_3171_4124 316
1200 3300042009 Ga0439451_032432 Ga0439451_032432_20_973 316
1201 3300042010 Ga0439452_000170 Ga0439452_000170_32028_32981 316
1202 3300042010 Ga0439452_000356 Ga0439452_000356_3259_4212 316
1203 3300042010 Ga0439452_001960 Ga0439452_001960_3717_4688 316
1204 3300042010 Ga0439452_002482 Ga0439452_002482_2109_3080 316
1205 3300042010 Ga0439452_008384 Ga0439452_008384_1685_2638 316
1206 3300042010 Ga0439452_031167 Ga0439452_031167_268_1221 316
1207 3300042013 Ga0439456_000110 Ga0439456_000110_21522_22475 316
1208 3300042013 Ga0439456_012606 Ga0439456_012606_506_1477 316
1209 3300042016 Ga0439463_000062 Ga0439463_000062_12129_13082 316
1210 3300042115 Ga0450911_000052 Ga0450911_000052_24740_25699 316
1211 3300042115 Ga0450911_001814 Ga0450911_001814_2163_3116 316
1212 3300042125 Ga0450923_001388 Ga0450923_001388_844_1815 316
1213 3300042137 Ga0450902_000213 Ga0450902_000213_2823_3776 316
1214 3300042146 Ga0450907_000717 Ga0450907_000717_2836_3789 316
1215 3300042146 Ga0450907_001240 Ga0450907_001240_585_1538 316
1216 3300042147 Ga0450910_007417 Ga0450910_007417_336_1289 316
1217 3300042156 Ga0439446_0000546 Ga0439446_0000546_4226_5197 316
1218 3300042156 Ga0439446_0003398 Ga0439446_0003398_2616_3575 316
1219 3300042185 Ga0450909_008387 Ga0450909_008387_121_1074 316
1220 3300042435 Ga0439434_0003401 Ga0439434_0003401_894_1847 316
1221 3300042435 Ga0439434_0003478 Ga0439434_0003478_2144_3115 316
1222 3300042438 Ga0439459_0002242 Ga0439459_0002242_36_995 316
1223 3300042461 Ga0439460_0004836 Ga0439460_0004836_145_1098 316
1224 3300042530 Ga0450916_000446 Ga0450916_000446_215_1174 316
1225 3300042531 Ga0450918_007000 Ga0450918_007000_491_1462 316
1226 3300042532 Ga0450893_0007169 Ga0450893_0007169_298_1257 316
1227 3300042876 Ga0451577_0000100 Ga0451577_0000100_102235_103185 316
1228 3300044712 Ga0453684_0001269 Ga0453684_0001269_51983_52933 316
1229 3300046452 Ga0495617_000714 Ga0495617_000714_12682_13635 316
1230 3300046452 Ga0495617_005155 Ga0495617_005155_2888_3859 316
1231 3300046452 Ga0495617_006431 Ga0495617_006431_283_1236 316
1232 3300046452 Ga0495617_007794 Ga0495617_007794_1700_2653 316
1233 3300046452 Ga0495617_013389 Ga0495617_013389_1046_1999 316
1234 3300046452 Ga0495617_023706 Ga0495617_023706_327_1280 316
1235 3300046453 Ga0495627_000192 Ga0495627_000192_28552_29505 316
1236 3300046453 Ga0495627_002301 Ga0495627_002301_2854_3825 316
1237 3300046453 Ga0495627_003678 Ga0495627_003678_2660_3613 316
1238 3300046455 Ga0495603_0021544 Ga0495603_0021544_2755_3708 316
1239 3300046457 Ga0495590_0000836 Ga0495590_0000836_2789_3742 316
1240 3300046457 Ga0495590_0007288 Ga0495590_0007288_636_1589 316
1241 3300046458 Ga0495591_000345 Ga0495591_000345_12392_13345 316
1242 3300046458 Ga0495591_000366 Ga0495591_000366_7958_8911 316
1243 3300046458 Ga0495591_004684 Ga0495591_004684_2979_3932 316
1244 3300046458 Ga0495591_007652 Ga0495591_007652_735_1706 316
1245 3300046458 Ga0495591_014675 Ga0495591_014675_1221_2174 316
1246 3300046460 Ga0495638_0020161 Ga0495638_0020161_2610_3563 316
1247 3300046460 Ga0495638_0109454 Ga0495638_0109454_627_1580 316
1248 3300046463 Ga0495653_0002460 Ga0495653_0002460_10804_11757 316
1249 3300046463 Ga0495653_0028981 Ga0495653_0028981_2958_3929 316
1250 3300046463 Ga0495653_0051244 Ga0495653_0051244_971_1924 316
1251 3300046471 Ga0495650_0001638 Ga0495650_0001638_5510_6463 316
1252 3300046471 Ga0495650_0015974 Ga0495650_0015974_1773_2726 316
1253 3300046474 Ga0495605_0000874 Ga0495605_0000874_197_1150 316
1254 3300046474 Ga0495605_0001787 Ga0495605_0001787_3109_4062 316
1255 3300046474 Ga0495605_0009689 Ga0495605_0009689_1917_2870 316
1256 3300046474 Ga0495605_0014069 Ga0495605_0014069_2837_3808 316
1257 3300046474 Ga0495605_0019107 Ga0495605_0019107_1083_2036 316
1258 3300046475 Ga0495639_0000205 Ga0495639_0000205_29211_30164 316
1259 3300046491 Ga0495584_0012588 Ga0495584_0012588_3007_3960 316
1260 3300046491 Ga0495584_0023755 Ga0495584_0023755_1342_2295 316
1261 3300046491 Ga0495584_0040706 Ga0495584_0040706_148_1101 316
1262 3300046492 Ga0495585_0001638 Ga0495585_0001638_12241_13194 316
1263 3300046500 Ga0495596_0001206 Ga0495596_0001206_2781_3734 316
1264 3300046500 Ga0495596_0002071 Ga0495596_0002071_1646_2599 316
1265 3300046501 Ga0495607_0000565 Ga0495607_0000565_19202_20155 316
1266 3300046501 Ga0495607_0003578 Ga0495607_0003578_978_1931 316
1267 3300046501 Ga0495607_0008015 Ga0495607_0008015_3155_4108 316
1268 3300046501 Ga0495607_0013571 Ga0495607_0013571_3154_4107 316
1269 3300046501 Ga0495607_0031004 Ga0495607_0031004_941_1912 316
1270 3300046501 Ga0495607_0031122 Ga0495607_0031122_1773_2726 316
1271 3300046501 Ga0495607_0031255 Ga0495607_0031255_1379_2335 316
1272 3300046501 Ga0495607_0032999 Ga0495607_0032999_1018_1971 316
1273 3300046501 Ga0495607_0051515 Ga0495607_0051515_1401_2354 316
1274 3300046501 Ga0495607_0065579 Ga0495607_0065579_270_1223 316
1275 3300046506 Ga0495583_0000920 Ga0495583_0000920_32349_33302 316
1276 3300046506 Ga0495583_0001931 Ga0495583_0001931_3068_4021 316
1277 3300046506 Ga0495583_0002833 Ga0495583_0002833_1279_2235 316
1278 3300046506 Ga0495583_0005282 Ga0495583_0005282_5155_6108 316
1279 3300046506 Ga0495583_0016288 Ga0495583_0016288_162_1115 316
1280 3300046507 Ga0495606_0000836 Ga0495606_0000836_36059_37012 316
1281 3300046507 Ga0495606_0000890 Ga0495606_0000890_3078_4031 316
1282 3300046507 Ga0495606_0002173 Ga0495606_0002173_15601_16554 316
1283 3300046507 Ga0495606_0018395 Ga0495606_0018395_71_1024 316
1284 3300046507 Ga0495606_0025266 Ga0495606_0025266_2809_3762 316
1285 3300046507 Ga0495606_0029684 Ga0495606_0029684_2622_3575 316
1286 3300046512 Ga0495610_0009570 Ga0495610_0009570_1897_2850 316
1287 3300046512 Ga0495610_0019335 Ga0495610_0019335_200_1153 316
1288 3300046512 Ga0495610_0024193 Ga0495610_0024193_24_995 316
1289 3300046512 Ga0495610_0025867 Ga0495610_0025867_474_1445 316
1290 3300046513 Ga0495616_0011064 Ga0495616_0011064_2790_3743 316
1291 3300046513 Ga0495616_0014601 Ga0495616_0014601_65_1018 316
1292 3300046513 Ga0495616_0040745 Ga0495616_0040745_1173_2144 316
1293 3300046515 Ga0495620_0000430 Ga0495620_0000430_3103_4056 316
1294 3300046515 Ga0495620_0003026 Ga0495620_0003026_8691_9644 316
1295 3300046515 Ga0495620_0018893 Ga0495620_0018893_1224_2177 316
1296 3300046518 Ga0495631_0000258 Ga0495631_0000258_33177_34130 316
1297 3300046518 Ga0495631_0000797 Ga0495631_0000797_2910_3863 316
1298 3300046518 Ga0495631_0023803 Ga0495631_0023803_761_1714 316
1299 3300046519 Ga0495632_0001732 Ga0495632_0001732_7864_8817 316
1300 3300046519 Ga0495632_0001988 Ga0495632_0001988_12393_13346 316
1301 3300046519 Ga0495632_0002334 Ga0495632_0002334_10694_11647 316
1302 3300046519 Ga0495632_0004333 Ga0495632_0004333_5782_6735 316
1303 3300046519 Ga0495632_0006860 Ga0495632_0006860_3721_4677 316
1304 3300046519 Ga0495632_0009474 Ga0495632_0009474_2550_3503 316
1305 3300046519 Ga0495632_0009723 Ga0495632_0009723_2733_3686 316
1306 3300046519 Ga0495632_0057620 Ga0495632_0057620_421_1392 316
1307 3300046520 Ga0495637_0000052 Ga0495637_0000052_52236_53189 316
1308 3300046520 Ga0495637_0000559 Ga0495637_0000559_1035_1988 316
1309 3300046520 Ga0495637_0000658 Ga0495637_0000658_5343_6296 316
1310 3300046520 Ga0495637_0017996 Ga0495637_0017996_361_1314 316
1311 3300046520 Ga0495637_0018627 Ga0495637_0018627_1815_2768 316
1312 3300046520 Ga0495637_0020245 Ga0495637_0020245_723_1676 316
1313 3300046520 Ga0495637_0020829 Ga0495637_0020829_1190_2143 316
1314 3300046520 Ga0495637_0059333 Ga0495637_0059333_363_1316 316
1315 3300046522 Ga0495643_0000084 Ga0495643_0000084_156351_157304 316
1316 3300046522 Ga0495643_0001047 Ga0495643_0001047_23900_24853 316
1317 3300046522 Ga0495643_0045488 Ga0495643_0045488_307_1260 316
1318 3300046522 Ga0495643_0070805 Ga0495643_0070805_278_1249 316
1319 3300046522 Ga0495643_0132240 Ga0495643_0132240_90_1043 316
1320 3300046523 Ga0495644_0005862 Ga0495644_0005862_2235_3188 316
1321 3300046523 Ga0495644_0013201 Ga0495644_0013201_1617_2570 316
1322 3300046524 Ga0495648_0003188 Ga0495648_0003188_2936_3889 316
1323 3300046524 Ga0495648_0003354 Ga0495648_0003354_1658_2611 316
1324 3300046524 Ga0495648_0003627 Ga0495648_0003627_1243_2196 316
1325 3300046524 Ga0495648_0010347 Ga0495648_0010347_4925_5878 316
1326 3300046524 Ga0495648_0040235 Ga0495648_0040235_1547_2503 316
1327 3300046524 Ga0495648_0046124 Ga0495648_0046124_1635_2588 316
1328 3300046524 Ga0495648_0050464 Ga0495648_0050464_490_1443 316
1329 3300046524 Ga0495648_0151076 Ga0495648_0151076_126_1097 316
1330 3300046526 Ga0495666_0005198 Ga0495666_0005198_3306_4259 316
1331 3300046526 Ga0495666_0083425 Ga0495666_0083425_66_1019 316
1332 3300046528 Ga0495642_0000134 Ga0495642_0000134_11342_12295 316
1333 3300046528 Ga0495642_0003182 Ga0495642_0003182_2781_3734 316
1334 3300046530 Ga0495654_0001208 Ga0495654_0001208_16471_17424 316
1335 3300046530 Ga0495654_0008696 Ga0495654_0008696_4595_5551 316
1336 3300046530 Ga0495654_0015295 Ga0495654_0015295_2849_3820 316
1337 3300046530 Ga0495654_0015709 Ga0495654_0015709_163_1116 316
1338 3300046530 Ga0495654_0016558 Ga0495654_0016558_829_1800 316
1339 3300046530 Ga0495654_0031107 Ga0495654_0031107_1332_2285 316
1340 3300046530 Ga0495654_0038641 Ga0495654_0038641_1165_2118 316
1341 3300046530 Ga0495654_0078782 Ga0495654_0078782_140_1111 316
1342 3300046536 Ga0495587_0028278 Ga0495587_0028278_358_1311 316
1343 3300046538 Ga0495609_0000267 Ga0495609_0000267_7884_8837 316
1344 3300046538 Ga0495609_0014977 Ga0495609_0014977_1998_2951 316
1345 3300046542 Ga0495597_0012116 Ga0495597_0012116_1584_2537 316
1346 3300046542 Ga0495597_0025648 Ga0495597_0025648_1014_1967 316
1347 3300046542 Ga0495597_0041254 Ga0495597_0041254_766_1737 316
1348 3300046557 Ga0495622_0000829 Ga0495622_0000829_5756_6709 316
1349 3300046557 Ga0495622_0002041 Ga0495622_0002041_2937_3890 316
1350 3300046557 Ga0495622_0005554 Ga0495622_0005554_4442_5395 316
1351 3300046557 Ga0495622_0020584 Ga0495622_0020584_54_1007 316
1352 3300046558 Ga0495633_0033821 Ga0495633_0033821_1362_2315 316
1353 3300046615 Ga0495656_0004483 Ga0495656_0004483_2120_3073 316
1354 3300046616 Ga0495668_0012229 Ga0495668_0012229_4043_4999 316
1355 3300046616 Ga0495668_0016230 Ga0495668_0016230_2319_3272 316
1356 3300046616 Ga0495668_0082454 Ga0495668_0082454_791_1744 316
1357 3300046642 Ga0495634_0002032 Ga0495634_0002032_2766_3719 316
1358 3300046648 Ga0495611_0000418 Ga0495611_0000418_2859_3830 316
1359 3300046648 Ga0495611_0000425 Ga0495611_0000425_20956_21909 316
1360 3300046660 Ga0495625_0000027 Ga0495625_0000027_52143_53096 316
1361 3300046660 Ga0495625_0011814 Ga0495625_0011814_2745_3716 316
1362 3300046660 Ga0495625_0044690 Ga0495625_0044690_802_1755 316
1363 3300046660 Ga0495625_0069928 Ga0495625_0069928_667_1638 316
1364 3300046660 Ga0495625_0075543 Ga0495625_0075543_1288_2241 316
1365 3300046664 Ga0495659_0001810 Ga0495659_0001810_3304_4257 316
1366 3300046664 Ga0495659_0018082 Ga0495659_0018082_471_1424 316
1367 3300046665 Ga0495661_0000137 Ga0495661_0000137_53069_54022 316
1368 3300046665 Ga0495661_0009705 Ga0495661_0009705_2657_3610 316
1369 3300046665 Ga0495661_0021929 Ga0495661_0021929_653_1624 316
1370 3300046674 Ga0495588_0117976 Ga0495588_0117976_18_971 316
1371 3300046679 Ga0495623_0013126 Ga0495623_0013126_2306_3259 316
1372 3300046679 Ga0495623_0061480 Ga0495623_0061480_780_1733 316
1373 3300046691 Ga0495670_0002411 Ga0495670_0002411_527_1498 316
1374 3300046691 Ga0495670_0103743 Ga0495670_0103743_90_1043 316
1375 3300046692 Ga0495671_0001590 Ga0495671_0001590_11886_12842 316
1376 3300046692 Ga0495671_0015095 Ga0495671_0015095_245_1198 316
1377 3300046692 Ga0495671_0028779 Ga0495671_0028779_1129_2082 316
1378 3300046692 Ga0495671_0029461 Ga0495671_0029461_1842_2795 316
1379 3300046692 Ga0495671_0055803 Ga0495671_0055803_840_1811 316
1380 3300046692 Ga0495671_0077053 Ga0495671_0077053_455_1408 316
1381 3300046694 Ga0495649_0001664 Ga0495649_0001664_12662_13615 316
1382 3300046694 Ga0495649_0002112 Ga0495649_0002112_1881_2834 316
1383 3300046694 Ga0495649_0003999 Ga0495649_0003999_1144_2097 316
1384 3300046694 Ga0495649_0014708 Ga0495649_0014708_331_1284 316
1385 3300046694 Ga0495649_0089885 Ga0495649_0089885_552_1523 316
1386 3300046794 Ga0495589_0006165 Ga0495589_0006165_1397_2368 316
1387 3300046794 Ga0495589_0006596 Ga0495589_0006596_1998_2951 316
1388 3300046794 Ga0495589_0028117 Ga0495589_0028117_1800_2771 316
1389 3300046810 Ga0495660_0003501 Ga0495660_0003501_5737_6690 316
1390 3300046810 Ga0495660_0039939 Ga0495660_0039939_777_1730 316
1391 3300046810 Ga0495660_0067071 Ga0495660_0067071_158_1114 316
1392 3300047315 Ga0495581_0044270 Ga0495581_0044270_1277_2248 316
1393 3300047317 Ga0495604_0030394 Ga0495604_0030394_524_1477 316
1394 3300047318 Ga0495636_0003439 Ga0495636_0003439_2665_3618 316
1395 3300047319 Ga0495674_0031957 Ga0495674_0031957_2522_3475 316
1396 3300047320 Ga0495672_0001057 Ga0495672_0001057_1496_2449 316
1397 3300047320 Ga0495672_0003270 Ga0495672_0003270_3236_4189 316
1398 3300047320 Ga0495672_0003509 Ga0495672_0003509_1246_2202 316
1399 3300047320 Ga0495672_0011334 Ga0495672_0011334_5274_6227 316
1400 3300047320 Ga0495672_0014981 Ga0495672_0014981_3562_4533 316
1401 3300047320 Ga0495672_0018816 Ga0495672_0018816_2366_3319 316
1402 3300047320 Ga0495672_0021796 Ga0495672_0021796_71_1024 316
1403 3300047320 Ga0495672_0041648 Ga0495672_0041648_993_1946 316
1404 3300047320 Ga0495672_0183556 Ga0495672_0183556_15_968 316
1405 3300047321 Ga0495676_0000012 Ga0495676_0000012_52282_53235 316
1406 3300047323 Ga0495683_0000410 Ga0495683_0000410_2706_3659 316
1407 3300047323 Ga0495683_0001801 Ga0495683_0001801_2841_3794 316
1408 3300047323 Ga0495683_0060038 Ga0495683_0060038_122_1075 316
1409 3300047443 Ga0495687_003428 Ga0495687_003428_10462_11415 316
1410 3300047443 Ga0495687_009564 Ga0495687_009564_3282_4235 316
1411 3300047443 Ga0495687_014186 Ga0495687_014186_1288_2259 316
1412 3300047444 Ga0495675_0025858 Ga0495675_0025858_973_1926 316
1413 3300047446 Ga0495679_000072 Ga0495679_000072_51189_52142 316
1414 3300047447 Ga0495685_076877 Ga0495685_076877_82_1053 316
1415 3300047469 Ga0495673_0001722 Ga0495673_0001722_13010_13963 316
1416 3300047469 Ga0495673_0003201 Ga0495673_0003201_1547_2503 316
1417 3300047469 Ga0495673_0013260 Ga0495673_0013260_2800_3771 316
1418 3300047469 Ga0495673_0024387 Ga0495673_0024387_1747_2718 316
1419 3300047469 Ga0495673_0025516 Ga0495673_0025516_1459_2412 316
1420 3300047469 Ga0495673_0101192 Ga0495673_0101192_128_1081 316
1421 3300047470 Ga0495681_0004289 Ga0495681_0004289_2780_3733 316
1422 3300047470 Ga0495681_0008809 Ga0495681_0008809_2815_3768 316
1423 3300047470 Ga0495681_0012009 Ga0495681_0012009_2534_3487 316
1424 3300047470 Ga0495681_0014531 Ga0495681_0014531_720_1691 316
1425 3300047470 Ga0495681_0018167 Ga0495681_0018167_2090_3043 316
1426 3300047470 Ga0495681_0023497 Ga0495681_0023497_2122_3093 316
1427 3300047470 Ga0495681_0029651 Ga0495681_0029651_716_1669 316
1428 3300047470 Ga0495681_0036545 Ga0495681_0036545_926_1897 316
1429 3300047470 Ga0495681_0038310 Ga0495681_0038310_18_989 316
1430 3300047471 Ga0495684_0016717 Ga0495684_0016717_1528_2481 316
1431 3300047673 Ga0495593_0037595 Ga0495593_0037595_1117_2070 316
1432 3300048088 Ga0495602_0073171 Ga0495602_0073171_1343_2314 316
1433 3300048091 Ga0495626_0000136 Ga0495626_0000136_51688_52641 316
1434 3300048091 Ga0495626_0001152 Ga0495626_0001152_18415_19368 316
1435 3300048091 Ga0495626_0002447 Ga0495626_0002447_1562_2515 316
1436 3300048091 Ga0495626_0005692 Ga0495626_0005692_2777_3730 316
1437 3300048091 Ga0495626_0022790 Ga0495626_0022790_1230_2201 316
1438 3300048091 Ga0495626_0023265 Ga0495626_0023265_1023_1976 316
1439 3300048091 Ga0495626_0030129 Ga0495626_0030129_662_1615 316
1440 3300048905 Ga0496102_0033352 Ga0496102_0033352_792_1763 316
1441 3300048906 Ga0496103_0035070 Ga0496103_0035070_492_1463 316
1442 3300048913 Ga0496110_0006481 Ga0496110_0006481_6467_7420 316
1443 3300048919 Ga0496116_0003184 Ga0496116_0003184_2906_3877 316
1444 3300048919 Ga0496116_0004313 Ga0496116_0004313_851_1804 316
1445 3300048919 Ga0496116_0016070 Ga0496116_0016070_2097_3068 316
1446 3300048920 Ga0496117_0001362 Ga0496117_0001362_3182_4135 316
1447 3300048920 Ga0496117_0025436 Ga0496117_0025436_44_997 316
1448 3300048921 Ga0496118_0068027 Ga0496118_0068027_611_1564 316
1449 3300048921 Ga0496118_0082282 Ga0496118_0082282_528_1499 316
1450 3300048921 Ga0496118_0085415 Ga0496118_0085415_236_1189 316
1451 3300048923 Ga0496120_0023510 Ga0496120_0023510_2876_3829 316
1452 3300048924 Ga0496121_0001040 Ga0496121_0001040_32196_33149 316
1453 3300048924 Ga0496121_0001212 Ga0496121_0001212_11591_12544 316
1454 3300048924 Ga0496121_0016843 Ga0496121_0016843_3791_4744 316
1455 3300048924 Ga0496121_0190004 Ga0496121_0190004_18_971 316
1456 3300048925 Ga0496122_0030949 Ga0496122_0030949_790_1743 316
1457 3300048927 Ga0496124_0000144 Ga0496124_0000144_94816_95772 316
1458 3300048927 Ga0496124_0005336 Ga0496124_0005336_12001_12954 316
1459 3300048927 Ga0496124_0022682 Ga0496124_0022682_1908_2861 316
1460 3300048927 Ga0496124_0031640 Ga0496124_0031640_1048_2001 316
1461 3300048927 Ga0496124_0038437 Ga0496124_0038437_2969_3922 316
1462 3300048927 Ga0496124_0076101 Ga0496124_0076101_1331_2284 316
1463 3300048927 Ga0496124_0310732 Ga0496124_0310732_144_1121 316
1464 3300048928 Ga0496125_0001556 Ga0496125_0001556_1255_2208 316
1465 3300048928 Ga0496125_0032817 Ga0496125_0032817_2618_3571 316
1466 3300048929 Ga0496126_0011007 Ga0496126_0011007_1936_2889 316
1467 3300048929 Ga0496126_0121784 Ga0496126_0121784_68_1039 316
1468 3300048929 Ga0496126_0180477 Ga0496126_0180477_730_1683 316
1469 3300049459 Ga0495678_000977 Ga0495678_000977_23246_24199 316
1470 3300049459 Ga0495678_035963 Ga0495678_035963_994_1947 316
1471 3300049460 Ga0495682_0000288 Ga0495682_0000288_19312_20265 316
1472 3300049460 Ga0495682_0048540 Ga0495682_0048540_278_1231 316
1473 3300049568 Ga0501031_0000922 Ga0501031_0000922_14228_15178 316
1474 3300049569 Ga0501032_0002898 Ga0501032_0002898_9136_10086 316
1475 3300049571 Ga0501034_0029494 Ga0501034_0029494_2762_3712 316
1476 3300049572 Ga0501036_0003774 Ga0501036_0003774_9724_10674 316
1477 3300049573 Ga0501037_0001206 Ga0501037_0001206_2466_3416 316
1478 3300049574 Ga0501038_0002007 Ga0501038_0002007_9373_10323 316
1479 3300049581 Ga0501047_0004732 Ga0501047_0004732_3111_4061 316
1480 3300049586 Ga0501070_0032634 Ga0501070_0032634_2408_3358 316
1481 3300049741 Ga0501079_0334354 Ga0501079_0334354_168_1118 316
1482 3300049742 Ga0501080_0044383 Ga0501080_0044383_1992_2942 316
1483 3300049822 Ga0501035_0001246 Ga0501035_0001246_8826_9776 316
1484 3300049823 Ga0501044_0020678 Ga0501044_0020678_2818_3768 316
1485 3300049853 Ga0501226_000001 Ga0501226_000001_160447_161406 316
1486 2162886007 SwRhRL2b_contig_552537 SwRhRL2b_0326.00000110 317
1487 3300009011 Ga0105251_10014855 Ga0105251_100148553 317
1488 3300009036 Ga0105244_10112458 Ga0105244_101124582 317
1489 3300009176 Ga0105242_10034660 Ga0105242_100346603 317
1490 3300013100 Ga0157373_10030404 Ga0157373_100304044 317
1491 3300013102 Ga0157371_10286121 Ga0157371_102861211 317
1492 3300013104 Ga0157370_10008692 Ga0157370_100086924 317
1493 3300041512 Ga0451853_2338999 Ga0451853_2338999_1340_2293 317
1494 3300042010 Ga0439452_000070 Ga0439452_000070_59294_60247 317
1495 3300042016 Ga0439463_000275 Ga0439463_000275_1166_2197 317
1496 3300042115 Ga0450911_001919 Ga0450911_001919_972_2003 317
1497 3300042124 Ga0450922_000587 Ga0450922_000587_2391_3422 317
1498 3300042127 Ga0450890_000598 Ga0450890_000598_1284_2315 317
1499 3300042145 Ga0450906_003096 Ga0450906_003096_209_1240 317
1500 3300042185 Ga0450909_001468 Ga0450909_001468_848_1879 317
1501 3300042461 Ga0439460_0003987 Ga0439460_0003987_1391_2422 317
1502 3300046459 Ga0495629_0011752 Ga0495629_0011752_2861_3946 317
1503 3300046463 Ga0495653_0019295 Ga0495653_0019295_4036_5121 317
1504 3300046471 Ga0495650_0000040 Ga0495650_0000040_335607_336560 317
1505 3300046473 Ga0495582_0002853 Ga0495582_0002853_5980_7065 317
1506 3300046475 Ga0495639_0018234 Ga0495639_0018234_452_1537 317
1507 3300046517 Ga0495630_0015993 Ga0495630_0015993_1502_2587 317
1508 3300046526 Ga0495666_0045258 Ga0495666_0045258_831_1916 317
1509 3300046536 Ga0495587_0072078 Ga0495587_0072078_408_1493 317
1510 3300046663 Ga0495635_0010463 Ga0495635_0010463_3033_4118 317
1511 3300046680 Ga0495646_0035848 Ga0495646_0035848_1523_2608 317
1512 3300046691 Ga0495670_0012402 Ga0495670_0012402_394_1425 317
1513 3300046692 Ga0495671_0007295 Ga0495671_0007295_181_1212 317
1514 3300046809 Ga0495600_0025684 Ga0495600_0025684_340_1425 317
1515 3300047317 Ga0495604_0013021 Ga0495604_0013021_2683_3768 317
1516 3300047320 Ga0495672_0107937 Ga0495672_0107937_90_1160 317
1517 3300047322 Ga0495680_0065444 Ga0495680_0065444_1153_2238 317
1518 3300047444 Ga0495675_0003455 Ga0495675_0003455_2243_3328 317
1519 3300048091 Ga0495626_0002140 Ga0495626_0002140_10403_11473 317
1520 3300048919 Ga0496116_0003257 Ga0496116_0003257_7488_8441 317
1521 3300048920 Ga0496117_0001595 Ga0496117_0001595_5172_6125 317
1522 3300048921 Ga0496118_0001512 Ga0496118_0001512_7728_8681 317
1523 3300048922 Ga0496119_0006644 Ga0496119_0006644_406_1359 317
1524 3300048923 Ga0496120_0024770 Ga0496120_0024770_2653_3606 317
1525 3300048924 Ga0496121_0004283 Ga0496121_0004283_10675_11628 317
1526 3300048925 Ga0496122_0004610 Ga0496122_0004610_5320_6273 317
1527 3300048926 Ga0496123_0003138 Ga0496123_0003138_6017_6970 317
1528 3300048927 Ga0496124_0040008 Ga0496124_0040008_2619_3572 317
1529 3300048927 Ga0496124_0132226 Ga0496124_0132226_252_1322 317
1530 3300048929 Ga0496126_0091782 Ga0496126_0091782_1274_2227 317
1531 3300049459 Ga0495678_010085 Ga0495678_010085_798_1868 317
1532 3300013307 Ga0157372_10015730 Ga0157372_100157309 318
1533 2162886007 SwRhRL2b_contig_318845 SwRhRL2b_0240.00006940 319
1534 3300015261 Ga0182006_1066698 Ga0182006_10666981 319
1535 3300031665 Ga0316575_10001475 Ga0316575_100014757 319
1536 3300031691 Ga0316579_10000050 Ga0316579_1000005019 319
1537 3300031727 Ga0316576_10000011 Ga0316576_1000001118 319
1538 3300031727 Ga0316576_10027056 Ga0316576_100270564 319
1539 3300031728 Ga0316578_10000039 Ga0316578_100000398 319
1540 3300031733 Ga0316577_10000002 Ga0316577_1000000216 319
1541 3300031733 Ga0316577_10016824 Ga0316577_100168244 319
1542 3300032137 Ga0316585_10000300 Ga0316585_100003004 319
1543 3300032139 Ga0316580_10000015 Ga0316580_1000001522 319
1544 3300033528 Ga0316588_1027247 Ga0316588_10272472 319
1545 3300035398 Ga0316574_0000015 Ga0316574_0000015_21338_22315 319
1546 3300036647 Ga0316582_0000010 Ga0316582_0000010_21345_22322 319
1547 3300036712 Ga0316584_0000074 Ga0316584_0000074_18948_19925 319
1548 3300039062 Ga0400483_108317 Ga0400483_108317_11269_12237 319
1549 3300039062 Ga0400483_149653 Ga0400483_149653_485_1525 319
1550 3300046501 Ga0495607_0070887 Ga0495607_0070887_18_1061 319
1551 3300046506 Ga0495583_0000670 Ga0495583_0000670_31035_32075 319
1552 3300046519 Ga0495632_0001246 Ga0495632_0001246_10362_11402 319
1553 3300046538 Ga0495609_0000076 Ga0495609_0000076_90919_91959 319
1554 3300046665 Ga0495661_0000200 Ga0495661_0000200_39913_40956 319
1555 3300048907 Ga0496104_0001969 Ga0496104_0001969_3205_4188 319
1556 3300048908 Ga0496105_0110732 Ga0496105_0110732_1201_2184 319
1557 3300048919 Ga0496116_0022442 Ga0496116_0022442_3695_4678 319
1558 3300048920 Ga0496117_0000385 Ga0496117_0000385_56586_57623 319
1559 3300048920 Ga0496117_0002140 Ga0496117_0002140_22067_23104 319
1560 3300048920 Ga0496117_0038637 Ga0496117_0038637_767_1750 319
1561 3300048921 Ga0496118_0002875 Ga0496118_0002875_15795_16832 319
1562 3300048921 Ga0496118_0037468 Ga0496118_0037468_767_1750 319
1563 3300048922 Ga0496119_0024583 Ga0496119_0024583_51_1034 319
1564 3300048923 Ga0496120_0007160 Ga0496120_0007160_6002_6985 319
1565 3300048925 Ga0496122_0023434 Ga0496122_0023434_3630_4613 319
1566 3300048926 Ga0496123_0047307 Ga0496123_0047307_150_1133 319
1567 3300048927 Ga0496124_0011412 Ga0496124_0011412_5620_6603 319
1568 3300048927 Ga0496124_0143854 Ga0496124_0143854_39_1076 319
1569 3300048928 Ga0496125_0001937 Ga0496125_0001937_5312_6349 319
1570 3300048928 Ga0496125_0008599 Ga0496125_0008599_833_1816 319
1571 3300048928 Ga0496125_0010679 Ga0496125_0010679_4938_5921 319
1572 3300048929 Ga0496126_0111902 Ga0496126_0111902_753_1736 319
1573 3300049570 Ga0501033_0000799 Ga0501033_0000799_25203_26165 319

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02951

GSH-S_N

Prokaryotic glutathione synthetase, N-terminal domain

22

140

0.99

PF02955

GSH-S_ATP

Prokaryotic glutathione synthetase, ATP-grasp domain

144

322

0.96

PF08443

RimK

RimK-like ATP-grasp domain

156

333

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2glt-assembly1.cif.gz_A structure of escherichia coli glutathione synthetase at ph 6.0. 0.9952 5 319
2glt-assembly1.cif.gz_A structure of escherichia coli glutathione synthetase at ph 6.0. 0.9885 5 319
1glv-assembly1.cif.gz_A three-dimensional structure of the glutathione synthetase from escherichia coli b at 2.0 angstroms resolution 0.9882 5 319
1gsa-assembly1.cif.gz_A structure of glutathione synthetase complexed with adp and glutathione 0.9844 5 317
1glv-assembly1.cif.gz_A three-dimensional structure of the glutathione synthetase from escherichia coli b at 2.0 angstroms resolution 0.9817 5 319
ID Description Score Start End Superfamily
af_P04425_1_111_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 1.004 5 115 3.40.50.20
2gltA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9954 119 304 3.30.470.20
af_P04425_1_111_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9951 5 115 3.40.50.20
2gltA03 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.9876 141 205 3.30.1490.20
2gltA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.986 119 304 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A4Z0PEU2-F1-model_v4 Glutathione synthase (EC 6.3.2.3) 0.9992 5 118 GO:0004363
AF-A0A4P0YGA4-F1-model_v4 Glutathione synthetase (EC 6.3.2.3) 0.9992 5 112 GO:0004363
AF-A0A381GFU9-F1-model_v4 deleted 0.9991 5 140
AF-A0A377C0T9-F1-model_v4 Glutathione synthetase (EC 6.3.2.3) (GSH synthetase) (GSH-S) (GSHase) (Glutathione synthase) 0.9955 5 168 GO:0004363
GO:0005524
GO:0005737
GO:0046872
AF-A0A7Z7KM29-F1-model_v4 deleted 0.9953 5 157

Feature Viewer

pLDDT pTM Quality
93.02 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map