F494847

General Info

Members Datasets Scaffolds Average Seq Length
1574 555 1504 496

Family's Representative Sequence

Representative Sequence 3300026035|Ga0207703_10078482|Ga0207703_100784823
Length 553
Sequence MRSQQVEALHLMRLGKKDRILVNWGFAEGFGAGHMGARNPPPKPSCQEKDHLSMTDALKLGFSSFATPTKGVLVVFCDDGLNFGAATKKAIGSAVDVVMRVAKAERFTGKKNSTLDLTVPPGLEVSRLAVIGLGKIAELKPNDFLRLGGLAIGRLPNATSDATVFAEVPGGAMRPEQAASLAQGARLRAYAFDRYKTKRKEDEKSPKVRNVTIAVGDVAAVRTAFNPRSAITDGVLLARDLVNEPANVLYPEEFARRTLALKKLRVAVEVLDVRAMKKLGMNALIGVGQGSSHQSRVVVMRWNGGRAGEAPVAFIGKGVCFDTGGISIKPAASMEDMKGDMAGAACVVGLMHALAARKARVNAVGVIGLVENMPDGNAQRPGDIVKSMSGQTIEIINTDAEGRLVLADVIWYAAQRFKPKFMIDLATLTGAIIVALGQEYAGMFCNNDQLAERLNKAGIETGELVWRMPLAPEYDKMIDSKFADMKNTGGSRWGGAITAAQFIKRFVDDKVPWAHLDIAGTGFDSRQTDINKSWGSGWGVRLLNRLVEDHYER

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
4 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
5 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
6 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
7 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
8 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
9 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
10 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
11 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
12 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
13 2643221618 Ensifer sp. Root231 Isolate Unclassified
14 2643221626 Ensifer sp. Root31 Isolate Unclassified
15 2643221655 Ensifer sp. Root1252 Isolate Unclassified
16 2643221659 Ensifer sp. Root127 Isolate Unclassified
17 2643221698 Ensifer sp. Root142 Isolate Unclassified
18 2643221712 Ensifer sp. Root258 Isolate Unclassified
19 2643221723 Ensifer sp. Root278 Isolate Unclassified
20 2643221733 Bosea sp. Root381 Isolate Unclassified
21 2643221736 Bosea sp. Root483D1 Isolate Unclassified
22 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
23 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
24 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
25 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
26 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
27 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
28 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
29 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
30 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
31 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
32 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
33 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
34 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
35 2841760612 Bosea sp. Tri-49 Isolate Nodule
36 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
37 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
38 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
39 2844104063 Bosea sp. Tri-39 Isolate Nodule
40 2844163670 Ensifer sp. 1H6 Isolate Unclassified
41 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
42 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
43 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
44 2851246043 Bosea sp. Tri-54 Isolate Nodule
45 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
46 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
47 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
48 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
49 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
50 2902330777 Methylobacterium sp. 2A Isolate Unclassified
51 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
52 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
53 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
54 2909042592 Labrys sp. LIt4 Isolate Nodule
55 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
56 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
57 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
58 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
59 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
60 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
61 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
62 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
63 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
64 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
65 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
66 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
67 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
68 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
69 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
70 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
71 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
72 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
73 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
74 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
75 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
76 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
77 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
78 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
80 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
81 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
82 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
83 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
84 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
85 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
86 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
87 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
88 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
89 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
90 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
91 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
92 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
93 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
94 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
95 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
96 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
97 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
98 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
99 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
100 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
101 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
102 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
103 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
104 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
105 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
106 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
107 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
108 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
109 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
110 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
111 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
112 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
113 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
114 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
115 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
116 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
117 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
118 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
119 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
120 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
121 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
122 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
123 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
124 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
125 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
126 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
127 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
128 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
129 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
130 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
131 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
132 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
133 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
134 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
135 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
136 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
137 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
138 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
139 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
140 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
141 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
142 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
143 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
144 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
145 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
146 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
147 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
148 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
149 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
150 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
151 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
152 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
153 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
154 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
155 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
156 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
157 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
158 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
159 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
160 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
161 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
162 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
163 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
164 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
165 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
166 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
167 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
168 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
169 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
170 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
171 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
172 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
173 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
174 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
175 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
176 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
177 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
178 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
179 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
180 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
181 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
182 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
183 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
184 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
185 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
186 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
187 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
188 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
189 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
190 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
191 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
192 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
193 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
194 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
195 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
196 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
197 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
198 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
199 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
200 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
201 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
202 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
203 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
204 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
205 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
206 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
207 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
208 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
209 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
210 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
211 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
212 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
213 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
214 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
215 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
216 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
217 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
218 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
219 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
220 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
221 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
222 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
223 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
225 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
228 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
229 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
231 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
232 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
233 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
235 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
236 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
304 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
305 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
306 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
307 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
311 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
312 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
313 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
314 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
315 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
316 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
317 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
318 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
319 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
320 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
321 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
322 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
323 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
324 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
325 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
326 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
327 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
328 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
329 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
330 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
331 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
332 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
333 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
334 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
335 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
336 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
337 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
338 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
339 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
340 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
341 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
342 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
343 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
344 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
345 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
346 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
347 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
348 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
349 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
350 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
351 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
352 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
353 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
354 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
355 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
356 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
357 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
358 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
359 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
360 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
361 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
362 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
363 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
364 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
365 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
366 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
367 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
368 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
369 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
370 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
371 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
372 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
373 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
374 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
375 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
376 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
377 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
378 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
379 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
380 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
381 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
382 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
383 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
384 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
385 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
386 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
387 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
388 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
389 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
390 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
391 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
392 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
393 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
394 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
395 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
396 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
397 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
398 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
399 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
400 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
401 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
402 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
403 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
404 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
405 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
406 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
407 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
408 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
409 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
410 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
411 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
412 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
413 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
414 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
415 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
416 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
417 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
418 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
419 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
420 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
421 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
422 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
423 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
424 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
425 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
426 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
427 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
428 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
429 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
430 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
431 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
432 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
433 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
434 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
435 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
436 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
437 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
438 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
439 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
440 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
441 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
442 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
443 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
444 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
445 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
446 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
447 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
448 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
449 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
450 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
451 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
452 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
453 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
454 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
455 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
456 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
457 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
458 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
459 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
460 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
463 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
464 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
465 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
468 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
469 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
471 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
472 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
473 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
474 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
475 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
476 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
477 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
478 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
479 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
480 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
481 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
482 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
483 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
484 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
485 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
486 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
487 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
488 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
489 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
490 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
491 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
492 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
493 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
494 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
495 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
496 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
497 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
498 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
499 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
500 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
501 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
502 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
503 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
504 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
505 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
506 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
507 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
508 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
509 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
510 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
511 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
512 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
513 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
514 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
515 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
516 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
517 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
518 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
519 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
520 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
521 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
522 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
523 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
524 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
525 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
526 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
527 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
528 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
529 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
530 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
531 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
532 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
533 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
534 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
535 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
536 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
537 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
538 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
539 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
540 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
541 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
542 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
543 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
544 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
545 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
546 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
547 641522639 Methylobacterium sp. 4-46 Isolate Nodule
548 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
549 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
550 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
551 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
552 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
553 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
554 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
555 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.55
Metatranscriptomes 0
Isolates 4.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.8
Nodule 1.78
Rhizoplane 4.51
Rhizosphere 82.59
Stem 0
Stem Tuber 0
Unclassified 4.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c000070 3300000041 Bacteria 18799
2 ARSoilYngRDRAFT_c00050 3300000042 Bacteria 18800
3 ARcpr5yngRDRAFT_c000063 3300000043 Bacteria 17510
4 ARSoilOldRDRAFT_c000059 3300000044 Bacteria 22880
5 ARCol0yngRDRAFT_1000071 3300000652 Bacteria 18812
6 JGI24745J21846_1001768 3300002073 Bacteria 2131
7 JGI24035J26624_1001075 3300002126 Bacteria 2580
8 JGI24033J26618_1001583 3300002155 Bacteria 2265
9 JGI25162J39368_1001576 3300002737 Bacteria 11624
10 JGI25158J39367_1006135 3300002739 Bacteria 1735
11 JGI25159J45721_1000002 3300002987 Bacteria 289163
12 JGI25151J46595_10023935 3300003187 Bacteria 2506
13 JGI25165J46597_1000425 3300003214 Bacteria 43589
14 JGI25165J46597_1000630 3300003214 Bacteria 29232
15 JGI25165J46597_1000930 3300003214 Bacteria 20275
16 JGI25153J46596_10000066 3300003215 Bacteria 123268
17 JGI25153J46596_10000309 3300003215 Bacteria 36023
18 JGI25153J46596_10003084 3300003215 Bacteria 9400
19 JGI25160J50197_1000008 3300003354 Bacteria 289163
20 JGI25161J50226_1000861 3300003374 Bacteria 11229
21 JGI25404J52841_10003269 3300003659 Bacteria 3183
22 Ga0055526_1000909 3300003771 Bacteria 21991
23 Ga0055536_1000872 3300003781 Bacteria 19598
24 Ga0055536_1001764 3300003781 Bacteria 12750
25 Ga0055530_10010021 3300003791 Bacteria 3562
26 Ga0055531_10023230 3300003794 Bacteria 2333
27 Ga0055543_1000040 3300004625 Bacteria 122485
28 Ga0065165_1000015 3300005262 Bacteria 289201
29 Ga0065165_1000072 3300005262 Bacteria 165049
30 Ga0065717_1002103 3300005276 Bacteria 2921
31 Ga0065712_10078653 3300005290 Bacteria 3315
32 Ga0065712_10086256 3300005290 Bacteria 2615
33 Ga0065715_10009862 3300005293 Bacteria 2745
34 Ga0065715_10089271 3300005293 Bacteria 11699
35 Ga0070658_10003518 3300005327 Bacteria 12870
36 Ga0070658_10014122 3300005327 Bacteria 6412
37 Ga0070658_10016709 3300005327 Bacteria 5874
38 Ga0070658_10095937 3300005327 Bacteria 2448
39 Ga0070676_10039192 3300005328 Bacteria 2739
40 Ga0070683_100004375 3300005329 Bacteria 11625
41 Ga0070683_100013099 3300005329 Bacteria 7221
42 Ga0070690_100002133 3300005330 Bacteria 10570
43 Ga0070670_100006337 3300005331 Bacteria 10013
44 Ga0070677_10000122 3300005333 Bacteria 25891
45 Ga0070677_10014937 3300005333 Bacteria 2744
46 Ga0070666_10024298 3300005335 Bacteria 3946
47 Ga0070666_10034068 3300005335 Bacteria 3375
48 Ga0070680_100001355 3300005336 Bacteria 17727
49 Ga0070680_100012982 3300005336 Bacteria 6480
50 Ga0070680_100016186 3300005336 Bacteria 5864
51 Ga0070680_100033651 3300005336 Bacteria 4133
52 Ga0070680_100034071 3300005336 Bacteria 4106
53 Ga0070680_100071354 3300005336 Bacteria 2853
54 Ga0070682_100000298 3300005337 Bacteria 34576
55 Ga0070682_100001181 3300005337 Bacteria 14903
56 Ga0068868_100001837 3300005338 Bacteria 14599
57 Ga0070660_100000909 3300005339 Bacteria 19789
58 Ga0070660_100003495 3300005339 Bacteria 10826
59 Ga0070660_100016673 3300005339 Bacteria 5339
60 Ga0070660_100039223 3300005339 Bacteria 3599
61 Ga0070660_100183541 3300005339 Bacteria 1693
62 Ga0070689_100001033 3300005340 Bacteria 17461
63 Ga0070689_100030515 3300005340 Bacteria 4092
64 Ga0070689_100056156 3300005340 Bacteria 3052
65 Ga0070691_10001125 3300005341 Bacteria 11107
66 Ga0070691_10031055 3300005341 Bacteria 2505
67 Ga0070687_100000146 3300005343 Bacteria 24643
68 Ga0070661_100000946 3300005344 Bacteria 20688
69 Ga0070661_100009887 3300005344 Bacteria 6618
70 Ga0070692_10000593 3300005345 Bacteria 11362
71 Ga0070668_100014011 3300005347 Bacteria 5996
72 Ga0070668_100015941 3300005347 Bacteria 5622
73 Ga0070669_100001742 3300005353 Bacteria 15687
74 Ga0070669_100034061 3300005353 Bacteria 3687
75 Ga0070669_100067516 3300005353 Bacteria 2638
76 Ga0070675_100008491 3300005354 Bacteria 7974
77 Ga0070675_100061539 3300005354 Bacteria 3099
78 Ga0070675_100087735 3300005354 Bacteria 2602
79 Ga0070675_100200758 3300005354 Bacteria 1731
80 Ga0070671_100025848 3300005355 Bacteria 4821
81 Ga0070671_100059285 3300005355 Bacteria 3185
82 Ga0070674_100000451 3300005356 Bacteria 20734
83 Ga0070674_100063466 3300005356 Bacteria 2585
84 Ga0070673_100000092 3300005364 Bacteria 39660
85 Ga0070673_100061923 3300005364 Bacteria 2970
86 Ga0070688_100000411 3300005365 Bacteria 21747
87 Ga0070659_100000769 3300005366 Bacteria 23321
88 Ga0070659_100004309 3300005366 Bacteria 10158
89 Ga0070659_100031620 3300005366 Bacteria 4100
90 Ga0070659_100047637 3300005366 Bacteria 3363
91 Ga0070659_100129549 3300005366 Bacteria 2048
92 Ga0070667_100005702 3300005367 Bacteria 10400
93 Ga0070667_100086413 3300005367 Bacteria 2691
94 Ga0070667_100158921 3300005367 Bacteria 1989
95 Ga0070703_10002667 3300005406 Bacteria 5129
96 Ga0070709_10000210 3300005434 Bacteria 37886
97 Ga0070709_10011597 3300005434 Bacteria 4916
98 Ga0070709_10089141 3300005434 Bacteria 2030
99 Ga0070714_100003697 3300005435 Bacteria 11459
100 Ga0070714_100012995 3300005435 Bacteria 6660
101 Ga0070714_100019460 3300005435 Bacteria 5533
102 Ga0070714_100030497 3300005435 Bacteria 4489
103 Ga0070714_100030592 3300005435 Bacteria 4483
104 Ga0070714_100060923 3300005435 Bacteria 3240
105 Ga0070713_100000003 3300005436 Bacteria 245840
106 Ga0070713_100001980 3300005436 Bacteria 13222
107 Ga0070713_100009547 3300005436 Bacteria 6955
108 Ga0070713_100015039 3300005436 Bacteria 5765
109 Ga0070713_100055856 3300005436 Bacteria 3283
110 Ga0070713_100112481 3300005436 Bacteria 2376
111 Ga0070701_10000011 3300005438 Bacteria 47769
112 Ga0070711_100000872 3300005439 Bacteria 15859
113 Ga0070711_100011325 3300005439 Bacteria 5535
114 Ga0070711_100035513 3300005439 Bacteria 3334
115 Ga0070711_100066013 3300005439 Bacteria 2533
116 Ga0070711_100096352 3300005439 Bacteria 2143
117 Ga0070705_100000747 3300005440 Bacteria 18447
118 Ga0070700_100000306 3300005441 Bacteria 25573
119 Ga0070700_100002292 3300005441 Bacteria 9734
120 Ga0070694_100011937 3300005444 Bacteria 5391
121 Ga0070694_100061408 3300005444 Bacteria 2565
122 Ga0070694_100096449 3300005444 Bacteria 2084
123 Ga0070708_100133278 3300005445 Bacteria 2301
124 Ga0070663_100000398 3300005455 Bacteria 22835
125 Ga0070663_100106726 3300005455 Bacteria 2098
126 Ga0070678_100001144 3300005456 Bacteria 14006
127 Ga0070678_100083485 3300005456 Bacteria 2428
128 Ga0070662_100002806 3300005457 Bacteria 10794
129 Ga0070662_100083585 3300005457 Bacteria 2383
130 Ga0070662_100149404 3300005457 Bacteria 1817
131 Ga0070681_10000005 3300005458 Bacteria 183053
132 Ga0070681_10024804 3300005458 Bacteria 6033
133 Ga0070681_10063213 3300005458 Bacteria 3674
134 Ga0070681_10067938 3300005458 Bacteria 3532
135 Ga0070681_10144328 3300005458 Bacteria 2310
136 Ga0070681_10173866 3300005458 Bacteria 2075
137 Ga0068867_100003555 3300005459 Bacteria 10959
138 Ga0068867_100006275 3300005459 Bacteria 8405
139 Ga0068867_100015860 3300005459 Bacteria 5347
140 Ga0070685_10002153 3300005466 Bacteria 10147
141 Ga0070685_10034302 3300005466 Bacteria 2857
142 Ga0070707_100022272 3300005468 Bacteria 5990
143 Ga0070698_100003224 3300005471 Bacteria 17973
144 Ga0070699_100060009 3300005518 Bacteria 3295
145 Ga0070679_100001521 3300005530 Bacteria 20655
146 Ga0070679_100007820 3300005530 Bacteria 10023
147 Ga0070679_100017306 3300005530 Bacteria 6976
148 Ga0070679_100057286 3300005530 Bacteria 3884
149 Ga0070679_100063748 3300005530 Bacteria 3673
150 Ga0070679_100096466 3300005530 Bacteria 2944
151 Ga0070679_100195667 3300005530 Bacteria 1989
152 Ga0070684_100006821 3300005535 Bacteria 8858
153 Ga0070684_100008936 3300005535 Bacteria 7865
154 Ga0070684_100038834 3300005535 Bacteria 4092
155 Ga0070697_100001312 3300005536 Bacteria 18780
156 Ga0068853_100001137 3300005539 Bacteria 18848
157 Ga0068853_100005824 3300005539 Bacteria 9706
158 Ga0068853_100007182 3300005539 Bacteria 8916
159 Ga0068853_100043409 3300005539 Bacteria 3845
160 Ga0068853_100051703 3300005539 Bacteria 3537
161 Ga0070672_100006474 3300005543 Bacteria 7875
162 Ga0070686_100000182 3300005544 Bacteria 44391
163 Ga0070686_100004486 3300005544 Bacteria 7702
164 Ga0070695_100001057 3300005545 Bacteria 15044
165 Ga0070695_100015701 3300005545 Bacteria 4574
166 Ga0070696_100001388 3300005546 Bacteria 15839
167 Ga0070696_100007901 3300005546 Bacteria 7101
168 Ga0070696_100019297 3300005546 Bacteria 4617
169 Ga0070696_100021452 3300005546 Bacteria 4379
170 Ga0070693_100000315 3300005547 Bacteria 22324
171 Ga0070693_100011568 3300005547 Bacteria 4448
172 Ga0070665_100002027 3300005548 Bacteria 22781
173 Ga0070665_100003577 3300005548 Bacteria 16470
174 Ga0070665_100028055 3300005548 Bacteria 5670
175 Ga0070665_100028079 3300005548 Bacteria 5667
176 Ga0070665_100157648 3300005548 Bacteria 2271
177 Ga0070665_100188951 3300005548 Bacteria 2061
178 Ga0070665_100207570 3300005548 Bacteria 1959
179 Ga0070665_100235267 3300005548 Bacteria 1832
180 Ga0070704_100000151 3300005549 Bacteria 26787
181 Ga0070704_100052525 3300005549 Bacteria 2876
182 Ga0068855_100000750 3300005563 Bacteria 39826
183 Ga0068855_100007568 3300005563 Bacteria 13143
184 Ga0068855_100011163 3300005563 Bacteria 10845
185 Ga0068855_100011757 3300005563 Bacteria 10585
186 Ga0068855_100024634 3300005563 Bacteria 7198
187 Ga0068855_100034186 3300005563 Bacteria 6064
188 Ga0068855_100039579 3300005563 Bacteria 5597
189 Ga0068855_100050812 3300005563 Bacteria 4884
190 Ga0068855_100067239 3300005563 Bacteria 4176
191 Ga0068855_100257362 3300005563 Bacteria 1945
192 Ga0070664_100001627 3300005564 Bacteria 17965
193 Ga0070664_100020724 3300005564 Bacteria 5414
194 Ga0070664_100121220 3300005564 Bacteria 2290
195 Ga0068857_100004571 3300005577 Bacteria 11716
196 Ga0068857_100009284 3300005577 Bacteria 8534
197 Ga0068857_100088063 3300005577 Bacteria 2778
198 Ga0068856_100000205 3300005614 Bacteria 63226
199 Ga0068856_100001453 3300005614 Bacteria 24854
200 Ga0068856_100002843 3300005614 Bacteria 17721
201 Ga0068856_100031698 3300005614 Bacteria 5173
202 Ga0068856_100048175 3300005614 Bacteria 4198
203 Ga0068856_100060499 3300005614 Bacteria 3742
204 Ga0068856_100127283 3300005614 Bacteria 2551
205 Ga0068856_100197198 3300005614 Bacteria 2027
206 Ga0068852_100005650 3300005616 Bacteria 8971
207 Ga0068852_100107530 3300005616 Bacteria 2530
208 Ga0068859_100002474 3300005617 Bacteria 18790
209 Ga0068864_100001253 3300005618 Bacteria 21086
210 Ga0068864_100149797 3300005618 Bacteria 2112
211 Ga0068866_10000854 3300005718 Bacteria 13492
212 Ga0068861_100000542 3300005719 Bacteria 22198
213 Ga0068861_100032123 3300005719 Bacteria 3862
214 Ga0068870_10000081 3300005840 Bacteria 30938
215 Ga0068863_100000351 3300005841 Bacteria 46873
216 Ga0068863_100054264 3300005841 Bacteria 3797
217 Ga0068858_100001632 3300005842 Bacteria 22876
218 Ga0068858_100002317 3300005842 Bacteria 19231
219 Ga0068858_100071922 3300005842 Bacteria 3208
220 Ga0068858_100174269 3300005842 Bacteria 2029
221 Ga0068860_100003775 3300005843 Bacteria 15582
222 Ga0068860_100024484 3300005843 Bacteria 5832
223 Ga0068860_100060529 3300005843 Bacteria 3598
224 Ga0068860_100140410 3300005843 Bacteria 2321
225 Ga0068862_100001228 3300005844 Bacteria 24157
226 Ga0068862_100009918 3300005844 Bacteria 7866
227 Ga0068862_100011428 3300005844 Bacteria 7328
228 Ga0068862_100074022 3300005844 Bacteria 2944
229 Ga0068862_100074118 3300005844 Bacteria 2942
230 Ga0081455_10000009 3300005937 Bacteria 249885
231 Ga0081455_10000078 3300005937 Bacteria 105058
232 Ga0081455_10003751 3300005937 Bacteria 17357
233 Ga0081455_10022362 3300005937 Bacteria 5911
234 Ga0081455_10030203 3300005937 Bacteria 4927
235 Ga0081455_10033799 3300005937 Bacteria 4589
236 Ga0081538_10001364 3300005981 Bacteria 25135
237 Ga0081538_10002230 3300005981 Bacteria 19192
238 Ga0081538_10025168 3300005981 Bacteria 4208
239 Ga0081538_10039723 3300005981 Bacteria 3012
240 Ga0081540_1000015 3300005983 Bacteria 178704
241 Ga0081540_1023609 3300005983 Bacteria 3592
242 Ga0081540_1031024 3300005983 Bacteria 2948
243 Ga0081539_10027859 3300005985 Bacteria 3567
244 Ga0070717_10000822 3300006028 Bacteria 20471
245 Ga0070717_10036878 3300006028 Bacteria 3967
246 Ga0070717_10051394 3300006028 Bacteria 3392
247 Ga0075368_10009253 3300006042 Bacteria 3541
248 Ga0070715_10010165 3300006163 Bacteria 3345
249 Ga0070716_100007908 3300006173 Bacteria 5262
250 Ga0070716_100024679 3300006173 Bacteria 3202
251 Ga0070712_100000031 3300006175 Bacteria 72694
252 Ga0070712_100000220 3300006175 Bacteria 32247
253 Ga0070712_100004535 3300006175 Bacteria 8575
254 Ga0075362_10000210 3300006177 Bacteria 16291
255 Ga0075362_10001053 3300006177 Bacteria 8517
256 Ga0075367_10031616 3300006178 Bacteria 3040
257 Ga0075369_10016402 3300006186 Bacteria 2989
258 Ga0075366_10002325 3300006195 Bacteria 9717
259 Ga0097621_100000004 3300006237 Bacteria 144414
260 Ga0097621_100004126 3300006237 Bacteria 10073
261 Ga0097621_100017356 3300006237 Bacteria 5463
262 Ga0068871_100000159 3300006358 Bacteria 44727
263 Ga0068871_100000699 3300006358 Bacteria 22809
264 Ga0068871_100026008 3300006358 Bacteria 4561
265 Ga0068871_100094587 3300006358 Bacteria 2494
266 Ga0068871_100144629 3300006358 Bacteria 2023
267 Ga0075428_100182242 3300006844 Bacteria 2273
268 Ga0075430_100000124 3300006846 Bacteria 48138
269 Ga0075430_100000268 3300006846 Bacteria 36751
270 Ga0075430_100018540 3300006846 Bacteria 5922
271 Ga0075431_100001395 3300006847 Bacteria 22198
272 Ga0075431_100028692 3300006847 Bacteria 5722
273 Ga0075434_100002125 3300006871 Bacteria 17250
274 Ga0075434_100018136 3300006871 Bacteria 6793
275 Ga0075434_100047307 3300006871 Bacteria 4269
276 Ga0075434_100113683 3300006871 Bacteria 2719
277 Ga0075434_100127019 3300006871 Bacteria 2567
278 Ga0075434_100133804 3300006871 Bacteria 2499
279 Ga0075434_100299583 3300006871 Bacteria 1628
280 Ga0068865_100007876 3300006881 Bacteria 6575
281 Ga0075436_100000113 3300006914 Bacteria 47637
282 Ga0075436_100000880 3300006914 Bacteria 19925
283 Ga0075436_100015033 3300006914 Bacteria 5304
284 Ga0075436_100017449 3300006914 Bacteria 4914
285 Ga0075436_100058598 3300006914 Bacteria 2660
286 Ga0097620_100002474 3300006931 Bacteria 18790
287 Ga0079104_1006936 3300006946 Bacteria 4186
288 Ga0075435_100007213 3300007076 Bacteria 7906
289 Ga0075435_100027483 3300007076 Bacteria 4451
290 Ga0075435_100029649 3300007076 Bacteria 4296
291 Ga0075435_100064053 3300007076 Bacteria 2986
292 Ga0075435_100105871 3300007076 Bacteria 2335
293 Ga0075435_100140822 3300007076 Bacteria 2024
294 Ga0099795_10000202 3300007788 Bacteria 10146
295 Ga0105251_10028223 3300009011 Bacteria 2837
296 Ga0105240_10001534 3300009093 Bacteria 39195
297 Ga0105240_10005135 3300009093 Bacteria 19590
298 Ga0105240_10044333 3300009093 Bacteria 5652
299 Ga0105240_10057124 3300009093 Bacteria 4879
300 Ga0105240_10089167 3300009093 Bacteria 3773
301 Ga0105240_10097689 3300009093 Bacteria 3578
302 Ga0105240_10110008 3300009093 Bacteria 3336
303 Ga0105240_10110381 3300009093 Bacteria 3329
304 Ga0105240_10114997 3300009093 Bacteria 3249
305 Ga0105240_10172507 3300009093 Bacteria 2560
306 Ga0105240_10270366 3300009093 Bacteria 1957
307 Ga0105240_10273700 3300009093 Bacteria 1943
308 Ga0111539_10000173 3300009094 Bacteria 74781
309 Ga0111539_10000528 3300009094 Bacteria 48456
310 Ga0111539_10003065 3300009094 Bacteria 22143
311 Ga0111539_10034898 3300009094 Bacteria 6093
312 Ga0111539_10196411 3300009094 Bacteria 2353
313 Ga0105245_10000366 3300009098 Bacteria 42296
314 Ga0105245_10038080 3300009098 Bacteria 4277
315 Ga0105245_10047942 3300009098 Bacteria 3821
316 Ga0105245_10117376 3300009098 Bacteria 2482
317 Ga0105247_10002587 3300009101 Bacteria 12246
318 Ga0105247_10012973 3300009101 Bacteria 4996
319 Ga0114129_10005152 3300009147 Bacteria 18401
320 Ga0114129_10021902 3300009147 Bacteria 9072
321 Ga0114129_10023179 3300009147 Bacteria 8805
322 Ga0114129_10031529 3300009147 Bacteria 7492
323 Ga0114129_10097121 3300009147 Bacteria 4078
324 Ga0105243_10001845 3300009148 Bacteria 18126
325 Ga0105243_10001995 3300009148 Bacteria 17370
326 Ga0105243_10011314 3300009148 Bacteria 6750
327 Ga0105243_10017476 3300009148 Bacteria 5422
328 Ga0105243_10048915 3300009148 Bacteria 3335
329 Ga0105241_10001371 3300009174 Bacteria 18571
330 Ga0105241_10022849 3300009174 Bacteria 4636
331 Ga0105241_10066532 3300009174 Bacteria 2787
332 Ga0105241_10131569 3300009174 Bacteria 2026
333 Ga0105242_10000138 3300009176 Bacteria 53110
334 Ga0105242_10005119 3300009176 Bacteria 10111
335 Ga0105242_10013390 3300009176 Bacteria 6336
336 Ga0105242_10023064 3300009176 Bacteria 4905
337 Ga0105242_10058803 3300009176 Bacteria 3153
338 Ga0105242_10121562 3300009176 Bacteria 2242
339 Ga0105248_10000001 3300009177 Bacteria 1881304
340 Ga0105248_10000645 3300009177 Bacteria 39618
341 Ga0105248_10019512 3300009177 Bacteria 7502
342 Ga0105248_10165621 3300009177 Bacteria 2492
343 Ga0105237_10001366 3300009545 Bacteria 32234
344 Ga0105237_10003724 3300009545 Bacteria 17951
345 Ga0105237_10038994 3300009545 Bacteria 4796
346 Ga0105237_10045353 3300009545 Bacteria 4425
347 Ga0105237_10070300 3300009545 Bacteria 3496
348 Ga0105237_10104911 3300009545 Bacteria 2818
349 Ga0105238_10006280 3300009551 Bacteria 11809
350 Ga0105238_10045654 3300009551 Bacteria 4426
351 Ga0105238_10065759 3300009551 Bacteria 3627
352 Ga0105238_10067309 3300009551 Bacteria 3583
353 Ga0105238_10078427 3300009551 Bacteria 3293
354 Ga0105238_10079733 3300009551 Bacteria 3264
355 Ga0105238_10099033 3300009551 Bacteria 2899
356 Ga0105238_10177098 3300009551 Bacteria 2109
357 Ga0105249_10147215 3300009553 Bacteria 2264
358 Ga0099796_10000611 3300010159 Bacteria 6192
359 Ga0099796_10004793 3300010159 Bacteria 3310
360 Ga0105239_10001205 3300010375 Bacteria 35322
361 Ga0105239_10006723 3300010375 Bacteria 13285
362 Ga0105239_10007247 3300010375 Bacteria 12738
363 Ga0105239_10108559 3300010375 Bacteria 3075
364 Ga0105239_10203353 3300010375 Bacteria 2219
365 Ga0105246_10004807 3300011119 Bacteria 8228
366 Ga0105246_10059601 3300011119 Bacteria 2649
367 Ga0157373_10002797 3300013100 Bacteria 13201
368 Ga0157371_10030412 3300013102 Bacteria 3896
369 Ga0157370_10020556 3300013104 Bacteria 6591
370 Ga0157369_10002343 3300013105 Bacteria 22792
371 Ga0157369_10005656 3300013105 Bacteria 14523
372 Ga0157369_10022638 3300013105 Bacteria 7008
373 Ga0157369_10028852 3300013105 Bacteria 6138
374 Ga0171463_1001 3300013249 Bacteria 1406070
375 Ga0157374_10000406 3300013296 Bacteria 39155
376 Ga0157374_10259582 3300013296 Bacteria 1711
377 Ga0157378_10004538 3300013297 Bacteria 12182
378 Ga0157378_10008089 3300013297 Bacteria 9178
379 Ga0163162_10008420 3300013306 Bacteria 10058
380 Ga0157372_10001486 3300013307 Bacteria 25481
381 Ga0157372_10016858 3300013307 Bacteria 7842
382 Ga0157372_10018842 3300013307 Bacteria 7427
383 Ga0157375_10002105 3300013308 Bacteria 17176
384 Ga0157375_10035954 3300013308 Bacteria 4732
385 Ga0163163_10008915 3300014325 Bacteria 8935
386 Ga0163163_10020329 3300014325 Bacteria 6250
387 Ga0163163_10040741 3300014325 Bacteria 4538
388 Ga0163163_10087515 3300014325 Bacteria 3125
389 Ga0163163_10171418 3300014325 Bacteria 2217
390 Ga0157377_10000133 3300014745 Bacteria 47798
391 Ga0157377_10086005 3300014745 Bacteria 1847
392 Ga0157379_10005234 3300014968 Bacteria 11143
393 Ga0157379_10032776 3300014968 Bacteria 4633
394 Ga0157379_10058922 3300014968 Bacteria 3434
395 Ga0157376_10000324 3300014969 Bacteria 32091
396 Ga0183365_10002 3300015684 Bacteria 545891
397 Ga0183363_1245 3300015690 Bacteria 9392
398 Ga0163161_10001128 3300017792 Bacteria 20152
399 Ga0214544_1000017 3300021320 Bacteria 193638
400 Ga0214542_1000006 3300021321 Bacteria 345164
401 Ga0214542_1015154 3300021321 Bacteria 8205
402 Ga0214543_1000003 3300021327 Bacteria 692327
403 Ga0214543_1000014 3300021327 Bacteria 324986
404 Ga0213874_10000714 3300021377 Bacteria 6719
405 Ga0213876_10001486 3300021384 Bacteria 14588
406 Ga0213875_10000007 3300021388 Bacteria 562717
407 Ga0209436_100315 3300025208 Bacteria 22202
408 Ga0209437_100075 3300025233 Bacteria 297202
409 Ga0209437_100248 3300025233 Bacteria 86351
410 Ga0209148_1001405 3300025254 Bacteria 12374
411 Ga0209233_1000013 3300025261 Bacteria 1013785
412 Ga0209233_1000056 3300025261 Bacteria 438104
413 Ga0209233_1000241 3300025261 Bacteria 90643
414 Ga0209233_1004714 3300025261 Bacteria 4598
415 Ga0207666_1000006 3300025271 Bacteria 51882
416 Ga0207666_1000793 3300025271 Bacteria 3793
417 Ga0209455_1001393 3300025272 Bacteria 10984
418 Ga0209130_1000007 3300025284 Bacteria 591584
419 Ga0207673_1000119 3300025290 Bacteria 7368
420 Ga0209676_1000694 3300025292 Bacteria 47316
421 Ga0209676_1011507 3300025292 Bacteria 3560
422 Ga0209025_1000580 3300025294 Bacteria 66332
423 Ga0209025_1008833 3300025294 Bacteria 7156
424 Ga0209564_1001342 3300025295 Bacteria 26169
425 Ga0209758_1000005 3300025297 Bacteria 1368918
426 Ga0209758_1000028 3300025297 Bacteria 530102
427 Ga0209758_1000036 3300025297 Bacteria 441671
428 Ga0209758_1005859 3300025297 Bacteria 9176
429 Ga0209050_1001984 3300025298 Bacteria 19184
430 Ga0209050_1002469 3300025298 Bacteria 15756
431 Ga0209050_1017759 3300025298 Bacteria 2811
432 Ga0209256_1002495 3300025299 Bacteria 14875
433 Ga0207426_1000064 3300025302 Bacteria 358276
434 Ga0209051_1004942 3300025303 Bacteria 7972
435 Ga0209257_1000707 3300025304 Bacteria 51654
436 Ga0209257_1000941 3300025304 Bacteria 40201
437 Ga0209257_1002541 3300025304 Bacteria 17865
438 Ga0207697_10000504 3300025315 Bacteria 21962
439 Ga0207697_10005430 3300025315 Bacteria 5926
440 Ga0207653_10016724 3300025885 Bacteria 2304
441 Ga0207682_10000040 3300025893 Bacteria 52878
442 Ga0207692_10027262 3300025898 Bacteria 2690
443 Ga0207692_10053307 3300025898 Bacteria 2059
444 Ga0207642_10000511 3300025899 Bacteria 11875
445 Ga0207710_10008422 3300025900 Bacteria 4348
446 Ga0207710_10009959 3300025900 Bacteria 3997
447 Ga0207688_10000319 3300025901 Bacteria 22193
448 Ga0207688_10040095 3300025901 Bacteria 2602
449 Ga0207680_10043386 3300025903 Bacteria 2637
450 Ga0207647_10004170 3300025904 Bacteria 10718
451 Ga0207647_10048581 3300025904 Bacteria 2634
452 Ga0207699_10000159 3300025906 Bacteria 42165
453 Ga0207699_10063104 3300025906 Bacteria 2236
454 Ga0207645_10000460 3300025907 Bacteria 33703
455 Ga0207643_10000046 3300025908 Bacteria 80736
456 Ga0207705_10000461 3300025909 Bacteria 34817
457 Ga0207705_10006490 3300025909 Bacteria 8667
458 Ga0207705_10011631 3300025909 Bacteria 6360
459 Ga0207705_10019293 3300025909 Bacteria 4875
460 Ga0207705_10086576 3300025909 Bacteria 2290
461 Ga0207684_10079794 3300025910 Bacteria 2784
462 Ga0207654_10002187 3300025911 Bacteria 10000
463 Ga0207654_10002344 3300025911 Bacteria 9717
464 Ga0207707_10000005 3300025912 Bacteria 382024
465 Ga0207707_10001730 3300025912 Bacteria 20053
466 Ga0207707_10002657 3300025912 Bacteria 15988
467 Ga0207707_10013091 3300025912 Bacteria 7227
468 Ga0207707_10029809 3300025912 Bacteria 4773
469 Ga0207707_10051060 3300025912 Bacteria 3601
470 Ga0207707_10072537 3300025912 Bacteria 3001
471 Ga0207707_10183158 3300025912 Bacteria 1828
472 Ga0207707_10214911 3300025912 Bacteria 1674
473 Ga0207695_10000003 3300025913 Bacteria 1368691
474 Ga0207695_10015371 3300025913 Bacteria 9012
475 Ga0207695_10018732 3300025913 Bacteria 7993
476 Ga0207695_10039231 3300025913 Bacteria 5091
477 Ga0207695_10063089 3300025913 Bacteria 3821
478 Ga0207695_10131834 3300025913 Bacteria 2456
479 Ga0207695_10189468 3300025913 Bacteria 1974
480 Ga0207671_10000215 3300025914 Bacteria 87204
481 Ga0207671_10006907 3300025914 Bacteria 10011
482 Ga0207671_10017806 3300025914 Bacteria 5466
483 Ga0207671_10047927 3300025914 Bacteria 3162
484 Ga0207671_10145041 3300025914 Bacteria 1831
485 Ga0207693_10000336 3300025915 Bacteria 43208
486 Ga0207693_10001817 3300025915 Bacteria 18721
487 Ga0207693_10006057 3300025915 Bacteria 10017
488 Ga0207693_10008167 3300025915 Bacteria 8578
489 Ga0207693_10024739 3300025915 Bacteria 4762
490 Ga0207693_10025125 3300025915 Bacteria 4726
491 Ga0207693_10114151 3300025915 Bacteria 2119
492 Ga0207693_10131990 3300025915 Bacteria 1963
493 Ga0207663_10037951 3300025916 Bacteria 2908
494 Ga0207663_10046198 3300025916 Bacteria 2682
495 Ga0207663_10061304 3300025916 Bacteria 2386
496 Ga0207663_10106845 3300025916 Bacteria 1892
497 Ga0207663_10133618 3300025916 Bacteria 1718
498 Ga0207663_10138121 3300025916 Bacteria 1694
499 Ga0207660_10000540 3300025917 Bacteria 25362
500 Ga0207660_10026557 3300025917 Bacteria 3945
501 Ga0207660_10028530 3300025917 Bacteria 3818
502 Ga0207660_10033652 3300025917 Bacteria 3547
503 Ga0207662_10000504 3300025918 Bacteria 17439
504 Ga0207662_10001458 3300025918 Bacteria 11483
505 Ga0207662_10004991 3300025918 Bacteria 7023
506 Ga0207662_10095849 3300025918 Bacteria 1832
507 Ga0207657_10002447 3300025919 Bacteria 20063
508 Ga0207657_10002651 3300025919 Bacteria 19319
509 Ga0207657_10006802 3300025919 Bacteria 11803
510 Ga0207657_10019404 3300025919 Bacteria 6456
511 Ga0207657_10028528 3300025919 Bacteria 5090
512 Ga0207657_10037921 3300025919 Bacteria 4298
513 Ga0207657_10041776 3300025919 Bacteria 4052
514 Ga0207657_10047840 3300025919 Bacteria 3737
515 Ga0207657_10070939 3300025919 Bacteria 2951
516 Ga0207649_10000320 3300025920 Bacteria 36457
517 Ga0207649_10010115 3300025920 Bacteria 5175
518 Ga0207649_10060868 3300025920 Bacteria 2374
519 Ga0207652_10002047 3300025921 Bacteria 17346
520 Ga0207652_10002306 3300025921 Bacteria 16170
521 Ga0207652_10005589 3300025921 Bacteria 10192
522 Ga0207652_10021078 3300025921 Bacteria 5376
523 Ga0207652_10049274 3300025921 Bacteria 3605
524 Ga0207652_10095581 3300025921 Bacteria 2617
525 Ga0207646_10013891 3300025922 Bacteria 7679
526 Ga0207681_10000927 3300025923 Bacteria 19127
527 Ga0207681_10052282 3300025923 Bacteria 2770
528 Ga0207694_10000005 3300025924 Bacteria 823704
529 Ga0207694_10003938 3300025924 Bacteria 11712
530 Ga0207694_10006940 3300025924 Bacteria 8598
531 Ga0207694_10049049 3300025924 Bacteria 3268
532 Ga0207650_10009355 3300025925 Bacteria 6697
533 Ga0207650_10072819 3300025925 Bacteria 2586
534 Ga0207650_10076904 3300025925 Bacteria 2522
535 Ga0207659_10004048 3300025926 Bacteria 8846
536 Ga0207659_10058748 3300025926 Bacteria 2762
537 Ga0207687_10000788 3300025927 Bacteria 21357
538 Ga0207687_10035235 3300025927 Bacteria 3403
539 Ga0207700_10000010 3300025928 Bacteria 298473
540 Ga0207700_10008190 3300025928 Bacteria 6458
541 Ga0207700_10037981 3300025928 Bacteria 3492
542 Ga0207700_10086659 3300025928 Bacteria 2461
543 Ga0207664_10007747 3300025929 Bacteria 7456
544 Ga0207664_10044040 3300025929 Bacteria 3493
545 Ga0207664_10046857 3300025929 Bacteria 3394
546 Ga0207664_10061900 3300025929 Bacteria 2987
547 Ga0207644_10000843 3300025931 Bacteria 19425
548 Ga0207644_10002757 3300025931 Bacteria 11316
549 Ga0207644_10093717 3300025931 Bacteria 2242
550 Ga0207706_10000828 3300025933 Bacteria 32042
551 Ga0207706_10006202 3300025933 Bacteria 11110
552 Ga0207686_10000282 3300025934 Bacteria 37757
553 Ga0207686_10007716 3300025934 Bacteria 5799
554 Ga0207709_10002522 3300025935 Bacteria 11421
555 Ga0207670_10002531 3300025936 Bacteria 9603
556 Ga0207670_10034741 3300025936 Bacteria 3262
557 Ga0207704_10020825 3300025938 Bacteria 3478
558 Ga0207665_10000782 3300025939 Bacteria 21418
559 Ga0207665_10038662 3300025939 Bacteria 3178
560 Ga0207691_10005927 3300025940 Bacteria 11799
561 Ga0207691_10131298 3300025940 Bacteria 2213
562 Ga0207691_10135426 3300025940 Bacteria 2173
563 Ga0207711_10000002 3300025941 Bacteria 1228676
564 Ga0207711_10004603 3300025941 Bacteria 11727
565 Ga0207711_10011611 3300025941 Bacteria 7318
566 Ga0207711_10039772 3300025941 Bacteria 4000
567 Ga0207689_10001290 3300025942 Bacteria 24141
568 Ga0207689_10022240 3300025942 Bacteria 5331
569 Ga0207661_10000596 3300025944 Bacteria 23136
570 Ga0207661_10003325 3300025944 Bacteria 11155
571 Ga0207661_10032624 3300025944 Bacteria 4036
572 Ga0207679_10000299 3300025945 Bacteria 37176
573 Ga0207679_10119917 3300025945 Bacteria 2092
574 Ga0207667_10000183 3300025949 Bacteria 91183
575 Ga0207667_10011707 3300025949 Bacteria 10176
576 Ga0207667_10047626 3300025949 Bacteria 4537
577 Ga0207667_10087940 3300025949 Bacteria 3214
578 Ga0207667_10117456 3300025949 Bacteria 2741
579 Ga0207667_10120607 3300025949 Bacteria 2702
580 Ga0207667_10155385 3300025949 Bacteria 2354
581 Ga0207651_10019767 3300025960 Bacteria 4046
582 Ga0207651_10026369 3300025960 Bacteria 3629
583 Ga0207712_10002611 3300025961 Bacteria 11558
584 Ga0207712_10076133 3300025961 Bacteria 2428
585 Ga0207668_10004532 3300025972 Bacteria 8172
586 Ga0207668_10024874 3300025972 Bacteria 3870
587 Ga0207640_10071656 3300025981 Bacteria 2335
588 Ga0207658_10028866 3300025986 Bacteria 3910
589 Ga0207658_10030724 3300025986 Bacteria 3807
590 Ga0207677_10001672 3300026023 Bacteria 11750
591 Ga0207703_10007749 3300026035 Bacteria 8499
592 Ga0207703_10078482 3300026035 Bacteria 2743
593 Ga0207639_10003830 3300026041 Bacteria 10137
594 Ga0207639_10023458 3300026041 Bacteria 4455
595 Ga0207678_10000767 3300026067 Bacteria 29308
596 Ga0207678_10001473 3300026067 Bacteria 21588
597 Ga0207678_10004574 3300026067 Bacteria 12443
598 Ga0207708_10003349 3300026075 Bacteria 11816
599 Ga0207708_10022753 3300026075 Bacteria 4733
600 Ga0207708_10035304 3300026075 Bacteria 3805
601 Ga0207708_10173702 3300026075 Bacteria 1708
602 Ga0207702_10000013 3300026078 Bacteria 257468
603 Ga0207702_10000048 3300026078 Bacteria 143125
604 Ga0207702_10008671 3300026078 Bacteria 8576
605 Ga0207702_10104421 3300026078 Bacteria 2508
606 Ga0207641_10033747 3300026088 Bacteria 4252
607 Ga0207641_10149624 3300026088 Bacteria 2113
608 Ga0207641_10170058 3300026088 Bacteria 1988
609 Ga0207648_10003790 3300026089 Bacteria 15798
610 Ga0207648_10004006 3300026089 Bacteria 15291
611 Ga0207648_10009365 3300026089 Bacteria 9384
612 Ga0207648_10018230 3300026089 Bacteria 6359
613 Ga0207648_10065558 3300026089 Bacteria 3166
614 Ga0207676_10003931 3300026095 Bacteria 10493
615 Ga0207676_10029154 3300026095 Bacteria 4129
616 Ga0207674_10000450 3300026116 Bacteria 53632
617 Ga0207674_10000647 3300026116 Bacteria 45307
618 Ga0207674_10054132 3300026116 Bacteria 4087
619 Ga0207674_10086040 3300026116 Bacteria 3138
620 Ga0207675_100000322 3300026118 Bacteria 45568
621 Ga0207675_100113713 3300026118 Bacteria 2556
622 Ga0207683_10000203 3300026121 Bacteria 51320
623 Ga0207683_10006315 3300026121 Bacteria 10151
624 Ga0207683_10039303 3300026121 Bacteria 4128
625 Ga0207698_10001938 3300026142 Bacteria 12144
626 Ga0207698_10024345 3300026142 Bacteria 4248
627 Ga0207698_10131448 3300026142 Bacteria 2140
628 Ga0209179_1000972 3300027512 Bacteria 3262
629 Ga0209966_1001424 3300027695 Bacteria 4164
630 Ga0209998_10002620 3300027717 Bacteria 4078
631 Ga0209974_10028113 3300027876 Bacteria 1862
632 Ga0207428_10000096 3300027907 Bacteria 123081
633 Ga0207428_10000291 3300027907 Bacteria 67245
634 Ga0207428_10000303 3300027907 Bacteria 65124
635 Ga0207428_10149949 3300027907 Bacteria 1775
636 Ga0268266_10000255 3300028379 Bacteria 89930
637 Ga0268266_10011836 3300028379 Bacteria 7559
638 Ga0268266_10029389 3300028379 Bacteria 4673
639 Ga0268266_10029914 3300028379 Bacteria 4628
640 Ga0268266_10043108 3300028379 Bacteria 3855
641 Ga0268266_10067420 3300028379 Bacteria 3097
642 Ga0268266_10101178 3300028379 Bacteria 2540
643 Ga0268265_10001714 3300028380 Bacteria 17774
644 Ga0268265_10083324 3300028380 Bacteria 2531
645 Ga0268264_10034762 3300028381 Bacteria 4147
646 Ga0268264_10118411 3300028381 Bacteria 2331
647 Ga0265334_10027094 3300028573 Bacteria 2310
648 Ga0265318_10000659 3300028577 Bacteria 23565
649 Ga0265318_10007145 3300028577 Bacteria 5076
650 Ga0265318_10010340 3300028577 Bacteria 4068
651 Ga0265338_10000005 3300028800 Bacteria 571137
652 Ga0265338_10011012 3300028800 Bacteria 10503
653 Ga0265338_10011268 3300028800 Bacteria 10352
654 Ga0265338_10033183 3300028800 Bacteria 5015
655 Ga0265338_10042414 3300028800 Bacteria 4237
656 Ga0265338_10127284 3300028800 Bacteria 2019
657 Ga0265338_10133730 3300028800 Bacteria 1954
658 Ga0307511_10006795 3300030521 Bacteria 11535
659 Ga0307511_10019719 3300030521 Bacteria 6403
660 Ga0265330_10030262 3300031235 Bacteria 2432
661 Ga0265330_10044664 3300031235 Bacteria 1955
662 Ga0265332_10017619 3300031238 Bacteria 3151
663 Ga0265328_10000006 3300031239 Bacteria 227698
664 Ga0265325_10000010 3300031241 Bacteria 172391
665 Ga0265325_10000029 3300031241 Bacteria 103942
666 Ga0265325_10000539 3300031241 Bacteria 27475
667 Ga0265325_10000981 3300031241 Bacteria 20465
668 Ga0265325_10001516 3300031241 Bacteria 16323
669 Ga0265325_10011331 3300031241 Bacteria 5124
670 Ga0265340_10000215 3300031247 Bacteria 29446
671 Ga0265340_10004212 3300031247 Bacteria 8062
672 Ga0265340_10012334 3300031247 Bacteria 4515
673 Ga0265340_10017734 3300031247 Bacteria 3682
674 Ga0265340_10021121 3300031247 Bacteria 3339
675 Ga0265340_10023065 3300031247 Bacteria 3175
676 Ga0265340_10028029 3300031247 Bacteria 2835
677 Ga0265340_10036288 3300031247 Bacteria 2443
678 Ga0265340_10048393 3300031247 Bacteria 2067
679 Ga0265339_10000373 3300031249 Bacteria 35286
680 Ga0265339_10000668 3300031249 Bacteria 26494
681 Ga0265339_10000761 3300031249 Bacteria 24928
682 Ga0265339_10008171 3300031249 Bacteria 6677
683 Ga0265339_10010922 3300031249 Bacteria 5613
684 Ga0265331_10000015 3300031250 Bacteria 289934
685 Ga0265331_10001272 3300031250 Bacteria 18858
686 Ga0265331_10007691 3300031250 Bacteria 6202
687 Ga0265331_10010025 3300031250 Bacteria 5268
688 Ga0265331_10011041 3300031250 Bacteria 4956
689 Ga0265331_10049555 3300031250 Bacteria 2017
690 Ga0265327_10000297 3300031251 Bacteria 96213
691 Ga0265327_10010378 3300031251 Bacteria 6558
692 Ga0265327_10050275 3300031251 Bacteria 2182
693 Ga0265316_10001712 3300031344 Bacteria 23280
694 Ga0265316_10008166 3300031344 Bacteria 9740
695 Ga0265316_10024421 3300031344 Bacteria 5065
696 Ga0265316_10029603 3300031344 Bacteria 4499
697 Ga0265316_10064482 3300031344 Bacteria 2838
698 Ga0307513_10027203 3300031456 Bacteria 6572
699 Ga0307513_10037455 3300031456 Bacteria 5398
700 Ga0307513_10090299 3300031456 Bacteria 3125
701 Ga0265313_10000183 3300031595 Bacteria 66629
702 Ga0265313_10000828 3300031595 Bacteria 31267
703 Ga0265313_10002260 3300031595 Bacteria 16927
704 Ga0265313_10002513 3300031595 Bacteria 15770
705 Ga0265313_10002827 3300031595 Bacteria 14612
706 Ga0265313_10003078 3300031595 Bacteria 13839
707 Ga0265313_10004082 3300031595 Bacteria 11375
708 Ga0265313_10005415 3300031595 Bacteria 9406
709 Ga0265313_10012072 3300031595 Bacteria 5320
710 Ga0265313_10013202 3300031595 Bacteria 4975
711 Ga0265313_10017361 3300031595 Bacteria 4093
712 Ga0265313_10019249 3300031595 Bacteria 3806
713 Ga0265313_10030716 3300031595 Bacteria 2761
714 Ga0265313_10034537 3300031595 Bacteria 2556
715 Ga0265313_10037238 3300031595 Bacteria 2434
716 Ga0307508_10155818 3300031616 Bacteria 1887
717 Ga0265314_10000590 3300031711 Bacteria 45642
718 Ga0265314_10004556 3300031711 Bacteria 12800
719 Ga0265314_10015685 3300031711 Bacteria 6005
720 Ga0265314_10022187 3300031711 Bacteria 4866
721 Ga0265314_10027588 3300031711 Bacteria 4251
722 Ga0265314_10028273 3300031711 Bacteria 4182
723 Ga0265314_10030040 3300031711 Bacteria 4028
724 Ga0265314_10033764 3300031711 Bacteria 3745
725 Ga0265314_10034264 3300031711 Bacteria 3713
726 Ga0265314_10038560 3300031711 Bacteria 3450
727 Ga0265314_10043256 3300031711 Bacteria 3204
728 Ga0265314_10105063 3300031711 Bacteria 1807
729 Ga0265342_10001412 3300031712 Bacteria 22425
730 Ga0265342_10004138 3300031712 Bacteria 11548
731 Ga0265342_10008991 3300031712 Bacteria 7095
732 Ga0265342_10011836 3300031712 Bacteria 5942
733 Ga0265342_10012431 3300031712 Bacteria 5768
734 Ga0265342_10012735 3300031712 Bacteria 5682
735 Ga0265342_10017183 3300031712 Bacteria 4711
736 Ga0265342_10019026 3300031712 Bacteria 4434
737 Ga0316576_10038495 3300031727 Bacteria 3429
738 Ga0316576_10126773 3300031727 Bacteria 1919
739 Ga0307516_10031151 3300031730 Bacteria 5378
740 Ga0307516_10119891 3300031730 Bacteria 2423
741 Ga0307413_10006096 3300031824 Bacteria 5467
742 Ga0307410_10010012 3300031852 Bacteria 5349
743 Ga0307407_10022461 3300031903 Bacteria 3274
744 Ga0307409_100013892 3300031995 Bacteria 5208
745 Ga0307409_100035374 3300031995 Bacteria 3660
746 Ga0307414_10003726 3300032004 Bacteria 8178
747 Ga0307414_10101421 3300032004 Bacteria 2167
748 Ga0307411_10036592 3300032005 Bacteria 3077
749 Ga0316583_10000001 3300032133 Bacteria 61432
750 Ga0373930_0000161 3300034816 Bacteria 7770
751 Ga0373948_0001179 3300034817 Bacteria 3545
752 Ga0373950_0000135 3300034818 Bacteria 12284
753 Ga0373958_0000166 3300034819 Bacteria 7574
754 Ga0373959_0000984 3300034820 Bacteria 4719
755 Ga0373938_0000011 3300034957 Bacteria 25364
756 Ga0373928_0000095 3300035084 Bacteria 15736
757 Ga0373929_0000078 3300035085 Bacteria 16196
758 Ga0373934_0005056 3300035086 Bacteria 4886
759 Ga0373934_0018956 3300035086 Bacteria 2637
760 Ga0373949_0001298 3300035090 Bacteria 7250
761 Ga0373951_0000554 3300035091 Bacteria 10444
762 Ga0373951_0002882 3300035091 Bacteria 4272
763 Ga0373952_0000091 3300035092 Bacteria 12229
764 Ga0373952_0002670 3300035092 Bacteria 3217
765 Ga0373923_0007548 3300035111 Bacteria 3830
766 Ga0373923_0007889 3300035111 Bacteria 3765
767 Ga0373932_0000075 3300035112 Bacteria 25180
768 Ga0373939_0000754 3300035114 Bacteria 7980
769 Ga0373939_0000796 3300035114 Bacteria 7781
770 Ga0373941_0000258 3300035115 Bacteria 10202
771 Ga0373941_0017738 3300035115 Bacteria 1956
772 Ga0373945_0012717 3300035116 Bacteria 2800
773 Ga0373953_0000324 3300035117 Bacteria 12878
774 Ga0373953_0038779 3300035117 Bacteria 1886
775 Ga0373954_0000154 3300035118 Bacteria 24448
776 Ga0373954_0010698 3300035118 Bacteria 4055
777 Ga0373954_0029726 3300035118 Bacteria 2518
778 Ga0373954_0038891 3300035118 Bacteria 2214
779 Ga0373956_0001735 3300035119 Bacteria 8973
780 Ga0373956_0002416 3300035119 Bacteria 7622
781 Ga0373956_0002730 3300035119 Bacteria 7138
782 Ga0373956_0009462 3300035119 Bacteria 3966
783 Ga0373957_0003031 3300035120 Bacteria 4883
784 Ga0373957_0020695 3300035120 Bacteria 2327
785 Ga0373943_0011440 3300035170 Bacteria 3993
786 Ga0373943_0013043 3300035170 Bacteria 3750
787 Ga0373943_0053194 3300035170 Bacteria 1998
788 Ga0373943_0064676 3300035170 Bacteria 1837
789 Ga0373946_0012973 3300035171 Bacteria 3126
790 Ga0373946_0060751 3300035171 Bacteria 1607
791 Ga0373955_0001215 3300035172 Bacteria 10930
792 Ga0373955_0004165 3300035172 Bacteria 6383
793 Ga0373955_0004667 3300035172 Bacteria 6082
794 Ga0373955_0018679 3300035172 Bacteria 3453
795 Ga0373955_0026452 3300035172 Bacteria 2989
796 Ga0373942_0000042 3300035207 Bacteria 24404
797 Ga0316574_0002185 3300035398 Bacteria 9704
798 Ga0373924_0004129 3300035410 Bacteria 5054
799 Ga0373924_0046937 3300035410 Bacteria 1781
800 Ga0373931_0000194 3300035691 Bacteria 25955
801 Ga0373931_0010791 3300035691 Bacteria 4398
802 Ga0373931_0013847 3300035691 Bacteria 3934
803 Ga0373931_0029742 3300035691 Bacteria 2807
804 Ga0373935_0062402 3300035692 Bacteria 2387
805 Ga0373935_0076232 3300035692 Bacteria 2171
806 Ga0373927_0016287 3300035695 Bacteria 4905
807 Ga0373927_0043384 3300035695 Bacteria 2912
808 Ga0373927_0048228 3300035695 Bacteria 2755
809 Ga0373927_0068974 3300035695 Bacteria 2288
810 Ga0373933_0000619 3300035724 Bacteria 22192
811 Ga0373933_0001240 3300035724 Bacteria 15068
812 Ga0373933_0002947 3300035724 Bacteria 9492
813 Ga0373933_0054417 3300035724 Bacteria 2398
814 Ga0373947_0014104 3300035725 Bacteria 4582
815 Ga0373947_0064241 3300035725 Bacteria 2238
816 Ga0373947_0157617 3300035725 Bacteria 1466
817 Ga0373947_0166420 3300035725 Bacteria 1428
818 Ga0373937_0001690 3300036401 Bacteria 18558
819 Ga0373937_0002270 3300036401 Bacteria 16048
820 Ga0373937_0002729 3300036401 Bacteria 14729
821 Ga0373937_0002872 3300036401 Bacteria 14382
822 Ga0373937_0003552 3300036401 Bacteria 13135
823 Ga0373937_0003641 3300036401 Bacteria 13000
824 Ga0373937_0006577 3300036401 Bacteria 10036
825 Ga0373937_0008265 3300036401 Bacteria 9034
826 Ga0373937_0014180 3300036401 Bacteria 7031
827 Ga0373937_0016262 3300036401 Bacteria 6603
828 Ga0373937_0017558 3300036401 Bacteria 6377
829 Ga0373937_0022446 3300036401 Bacteria 5674
830 Ga0373937_0044879 3300036401 Bacteria 4038
831 Ga0373937_0144278 3300036401 Bacteria 2228
832 Ga0373937_0214961 3300036401 Bacteria 1809
833 Ga0373925_0011859 3300037068 Bacteria 6307
834 Ga0373925_0019501 3300037068 Bacteria 4934
835 Ga0373925_0070825 3300037068 Bacteria 2636
836 Ga0395899_0002498 3300037312 Bacteria 14927
837 Ga0395899_0044238 3300037312 Bacteria 3319
838 Ga0395899_0079867 3300037312 Bacteria 2382
839 Ga0395900_0001761 3300037418 Bacteria 24849
840 Ga0395900_0011990 3300037418 Bacteria 8861
841 Ga0395900_0018259 3300037418 Bacteria 7154
842 Ga0395900_0021260 3300037418 Bacteria 6635
843 Ga0395900_0035244 3300037418 Bacteria 5155
844 Ga0395900_0055341 3300037418 Bacteria 4086
845 Ga0395900_0071113 3300037418 Bacteria 3576
846 Ga0395900_0179863 3300037418 Bacteria 2150
847 Ga0395898_0048738 3300037466 Bacteria 4153
848 Ga0395898_0068602 3300037466 Bacteria 3432
849 Ga0395898_0108109 3300037466 Bacteria 2667
850 Ga0395905_0007796 3300037471 Bacteria 10619
851 Ga0395905_0019814 3300037471 Bacteria 6376
852 Ga0436364_0349574 3300037853 Bacteria 5175
853 Ga0436364_0890378 3300037853 Bacteria 34627
854 Ga0436364_0896039 3300037853 Bacteria 2174
855 Ga0436364_1546193 3300037853 Bacteria 3419
856 Ga0395901_0000189 3300038443 Bacteria 78741
857 Ga0395901_0009211 3300038443 Bacteria 10002
858 Ga0395901_0042126 3300038443 Bacteria 4733
859 Ga0395901_0157471 3300038443 Bacteria 2385
860 Ga0400486_12350 3300038742 Bacteria 2800
861 Ga0400487_23952 3300039110 Bacteria 3691
862 Ga0436365_0179164 3300039437 Bacteria 7418
863 Ga0436365_0432451 3300039437 Bacteria 16796
864 Ga0436365_0500347 3300039437 Bacteria 15377
865 Ga0436365_1135929 3300039437 Bacteria 1988
866 Ga0436365_1190710 3300039437 Bacteria 19594
867 Ga0436365_1253031 3300039437 Bacteria 47093
868 Ga0436360_0154205 3300039438 Bacteria 3732
869 Ga0436360_0218419 3300039438 Bacteria 2678
870 Ga0436360_0525877 3300039438 Bacteria 2014
871 Ga0436361_0423103 3300039447 Bacteria 11499
872 Ga0436361_1075835 3300039447 Bacteria 3481
873 Ga0436363_1230015 3300039450 Bacteria 36424
874 Ga0436363_1330926 3300039450 Bacteria 7516
875 Ga0436363_1455042 3300039450 Bacteria 3501
876 Ga0436362_0207695 3300039453 Bacteria 5197
877 Ga0439453_0000317 3300041408 Bacteria 5039
878 Ga0439435_0002372 3300042436 Bacteria 3725
879 Ga0466957_0062799 3300044842 Bacteria 2282
880 Ga0466959_0024431 3300045049 Bacteria 4477
881 Ga0451576_0086350 3300045051 Bacteria 3263
882 Ga0466967_0055363 3300045976 Bacteria 3494
883 Ga0495592_0014946 3300046454 Bacteria 5894
884 Ga0495592_0029627 3300046454 Bacteria 4144
885 Ga0495592_0044543 3300046454 Bacteria 3314
886 Ga0495592_0047265 3300046454 Bacteria 3205
887 Ga0495592_0047672 3300046454 Bacteria 3190
888 Ga0495592_0098228 3300046454 Bacteria 2090
889 Ga0495603_0016469 3300046455 Bacteria 4472
890 Ga0495629_0000688 3300046459 Bacteria 27364
891 Ga0495629_0001324 3300046459 Bacteria 19480
892 Ga0495629_0007031 3300046459 Bacteria 8293
893 Ga0495629_0120887 3300046459 Bacteria 1824
894 Ga0495629_0124854 3300046459 Bacteria 1793
895 Ga0495629_0138572 3300046459 Bacteria 1693
896 Ga0495638_0055808 3300046460 Bacteria 2452
897 Ga0495641_0013090 3300046461 Bacteria 4586
898 Ga0495651_0001553 3300046462 Bacteria 17741
899 Ga0495651_0004731 3300046462 Bacteria 10421
900 Ga0495651_0026515 3300046462 Bacteria 4514
901 Ga0495651_0043233 3300046462 Bacteria 3496
902 Ga0495651_0071108 3300046462 Bacteria 2645
903 Ga0495651_0132798 3300046462 Bacteria 1815
904 Ga0495653_0002693 3300046463 Bacteria 14155
905 Ga0495653_0003335 3300046463 Bacteria 12901
906 Ga0495653_0006259 3300046463 Bacteria 9767
907 Ga0495580_0000623 3300046472 Bacteria 29999
908 Ga0495580_0083765 3300046472 Bacteria 2221
909 Ga0495582_0007412 3300046473 Bacteria 6074
910 Ga0495582_0019595 3300046473 Bacteria 3700
911 Ga0495639_0002480 3300046475 Bacteria 8050
912 Ga0495662_0079237 3300046476 Bacteria 1597
913 Ga0495664_0005333 3300046477 Bacteria 7055
914 Ga0495664_0010182 3300046477 Bacteria 5276
915 Ga0495664_0010669 3300046477 Bacteria 5158
916 Ga0495664_0028550 3300046477 Bacteria 3258
917 Ga0495664_0072787 3300046477 Bacteria 2054
918 Ga0495584_0006207 3300046491 Bacteria 6270
919 Ga0495585_0005098 3300046492 Bacteria 8358
920 Ga0495594_0007097 3300046499 Bacteria 5762
921 Ga0495607_0010029 3300046501 Bacteria 6382
922 Ga0495608_0001923 3300046511 Bacteria 14899
923 Ga0495608_0004458 3300046511 Bacteria 10016
924 Ga0495608_0006648 3300046511 Bacteria 8205
925 Ga0495608_0028033 3300046511 Bacteria 3828
926 Ga0495608_0047071 3300046511 Bacteria 2868
927 Ga0495616_0031798 3300046513 Bacteria 2761
928 Ga0495618_0004066 3300046514 Bacteria 9025
929 Ga0495618_0014780 3300046514 Bacteria 4762
930 Ga0495618_0016873 3300046514 Bacteria 4473
931 Ga0495628_0002774 3300046516 Bacteria 15699
932 Ga0495628_0019113 3300046516 Bacteria 5667
933 Ga0495628_0069823 3300046516 Bacteria 2740
934 Ga0495630_0049043 3300046517 Bacteria 3160
935 Ga0495630_0051922 3300046517 Bacteria 3069
936 Ga0495644_0005926 3300046523 Bacteria 4766
937 Ga0495666_0016359 3300046526 Bacteria 3694
938 Ga0495652_0000858 3300046529 Bacteria 35023
939 Ga0495652_0009916 3300046529 Bacteria 8638
940 Ga0495652_0012679 3300046529 Bacteria 7593
941 Ga0495652_0127258 3300046529 Bacteria 2022
942 Ga0495652_0147601 3300046529 Bacteria 1841
943 Ga0495652_0170328 3300046529 Bacteria 1681
944 Ga0495640_0013378 3300046533 Bacteria 6234
945 Ga0495586_0034415 3300046535 Bacteria 2721
946 Ga0495587_0002561 3300046536 Bacteria 12145
947 Ga0495587_0005522 3300046536 Bacteria 8249
948 Ga0495587_0033206 3300046536 Bacteria 3116
949 Ga0495587_0042451 3300046536 Bacteria 2712
950 Ga0495587_0064798 3300046536 Bacteria 2134
951 Ga0495645_0001608 3300046543 Bacteria 15300
952 Ga0495645_0003727 3300046543 Bacteria 10357
953 Ga0495645_0006861 3300046543 Bacteria 7917
954 Ga0495645_0029118 3300046543 Bacteria 4014
955 Ga0495645_0050050 3300046543 Bacteria 3042
956 Ga0495645_0102893 3300046543 Bacteria 2029
957 Ga0495622_0004155 3300046557 Bacteria 6753
958 Ga0495633_0002344 3300046558 Bacteria 13450
959 Ga0495667_0001365 3300046559 Bacteria 16044
960 Ga0495667_0002299 3300046559 Bacteria 12809
961 Ga0495667_0010546 3300046559 Bacteria 6252
962 Ga0495667_0021541 3300046559 Bacteria 4349
963 Ga0495656_0004917 3300046615 Bacteria 4602
964 Ga0495634_0015956 3300046642 Bacteria 5380
965 Ga0495634_0027772 3300046642 Bacteria 3936
966 Ga0495634_0034794 3300046642 Bacteria 3454
967 Ga0495634_0045061 3300046642 Bacteria 2983
968 Ga0495611_0003437 3300046648 Bacteria 6987
969 Ga0495635_0000644 3300046663 Bacteria 22418
970 Ga0495635_0004775 3300046663 Bacteria 9422
971 Ga0495635_0010048 3300046663 Bacteria 6617
972 Ga0495635_0012338 3300046663 Bacteria 5988
973 Ga0495635_0012477 3300046663 Bacteria 5953
974 Ga0495635_0020252 3300046663 Bacteria 4635
975 Ga0495657_0006210 3300046675 Bacteria 9371
976 Ga0495657_0018752 3300046675 Bacteria 5000
977 Ga0495657_0046426 3300046675 Bacteria 2941
978 Ga0495599_0005428 3300046678 Bacteria 7618
979 Ga0495599_0008623 3300046678 Bacteria 6205
980 Ga0495599_0024233 3300046678 Bacteria 3795
981 Ga0495599_0068235 3300046678 Bacteria 2220
982 Ga0495623_0006389 3300046679 Bacteria 7665
983 Ga0495623_0050787 3300046679 Bacteria 2626
984 Ga0495623_0093502 3300046679 Bacteria 1841
985 Ga0495646_0002648 3300046680 Bacteria 11062
986 Ga0495646_0022136 3300046680 Bacteria 4010
987 Ga0495646_0053266 3300046680 Bacteria 2440
988 Ga0495646_0063693 3300046680 Bacteria 2188
989 Ga0495646_0095316 3300046680 Bacteria 1713
990 Ga0495647_0035865 3300046681 Bacteria 1864
991 Ga0495658_0000246 3300046683 Bacteria 31009
992 Ga0495658_0016322 3300046683 Bacteria 3822
993 Ga0495613_0039160 3300046689 Bacteria 3514
994 Ga0495613_0089257 3300046689 Bacteria 2233
995 Ga0495670_0000200 3300046691 Bacteria 26865
996 Ga0495600_0000697 3300046809 Bacteria 17601
997 Ga0495600_0004321 3300046809 Bacteria 8496
998 Ga0495600_0016769 3300046809 Bacteria 4655
999 Ga0495600_0019067 3300046809 Bacteria 4378
1000 Ga0495600_0034134 3300046809 Bacteria 3303
1001 Ga0495600_0056652 3300046809 Bacteria 2561
1002 Ga0495600_0083245 3300046809 Bacteria 2088
1003 Ga0495581_0023234 3300047315 Bacteria 3593
1004 Ga0495581_0049534 3300047315 Bacteria 2426
1005 Ga0495604_0001090 3300047317 Bacteria 22540
1006 Ga0495604_0001700 3300047317 Bacteria 18097
1007 Ga0495604_0010041 3300047317 Bacteria 7495
1008 Ga0495604_0011347 3300047317 Bacteria 7069
1009 Ga0495604_0016150 3300047317 Bacteria 5965
1010 Ga0495604_0017616 3300047317 Bacteria 5718
1011 Ga0495674_0003125 3300047319 Bacteria 16088
1012 Ga0495674_0007161 3300047319 Bacteria 10666
1013 Ga0495674_0013845 3300047319 Bacteria 7570
1014 Ga0495674_0043386 3300047319 Bacteria 4003
1015 Ga0495674_0079578 3300047319 Bacteria 2814
1016 Ga0495674_0083519 3300047319 Bacteria 2737
1017 Ga0495680_0000795 3300047322 Bacteria 35314
1018 Ga0495680_0002127 3300047322 Bacteria 20560
1019 Ga0495680_0011668 3300047322 Bacteria 7760
1020 Ga0495680_0030587 3300047322 Bacteria 4395
1021 Ga0495680_0030787 3300047322 Bacteria 4375
1022 Ga0495680_0036127 3300047322 Bacteria 3971
1023 Ga0495675_0000357 3300047444 Bacteria 31839
1024 Ga0495675_0001422 3300047444 Bacteria 14504
1025 Ga0495675_0009342 3300047444 Bacteria 6099
1026 Ga0495675_0041740 3300047444 Bacteria 2923
1027 Ga0495684_0000380 3300047471 Bacteria 36351
1028 Ga0495684_0003417 3300047471 Bacteria 12440
1029 Ga0495684_0005001 3300047471 Bacteria 10343
1030 Ga0495684_0051341 3300047471 Bacteria 3147
1031 Ga0495593_0002795 3300047673 Bacteria 10512
1032 Ga0495593_0006204 3300047673 Bacteria 7030
1033 Ga0495593_0016384 3300047673 Bacteria 4182
1034 Ga0495602_0002276 3300048088 Bacteria 19431
1035 Ga0495602_0003279 3300048088 Bacteria 16719
1036 Ga0495602_0006702 3300048088 Bacteria 12074
1037 Ga0495602_0007195 3300048088 Bacteria 11663
1038 Ga0495602_0111594 3300048088 Bacteria 2220
1039 Ga0496100_0000777 3300048903 Bacteria 15210
1040 Ga0496100_0020436 3300048903 Bacteria 3969
1041 Ga0496102_0003434 3300048905 Bacteria 13428
1042 Ga0496102_0025598 3300048905 Bacteria 5255
1043 Ga0496102_0025652 3300048905 Bacteria 5250
1044 Ga0496102_0060605 3300048905 Bacteria 3461
1045 Ga0496103_0000880 3300048906 Bacteria 21763
1046 Ga0496103_0028250 3300048906 Bacteria 3402
1047 Ga0496103_0070690 3300048906 Bacteria 2183
1048 Ga0496104_0000035 3300048907 Bacteria 181792
1049 Ga0496104_0000145 3300048907 Bacteria 65454
1050 Ga0496104_0001371 3300048907 Bacteria 21073
1051 Ga0496104_0006667 3300048907 Bacteria 10161
1052 Ga0496104_0014192 3300048907 Bacteria 7188
1053 Ga0496104_0031344 3300048907 Bacteria 4943
1054 Ga0496104_0051998 3300048907 Bacteria 3868
1055 Ga0496104_0053997 3300048907 Bacteria 3797
1056 Ga0496104_0122751 3300048907 Bacteria 2494
1057 Ga0496104_0173063 3300048907 Bacteria 2070
1058 Ga0496105_0000029 3300048908 Bacteria 139338
1059 Ga0496105_0000279 3300048908 Bacteria 33711
1060 Ga0496105_0000761 3300048908 Bacteria 21916
1061 Ga0496105_0010018 3300048908 Bacteria 7436
1062 Ga0496105_0014134 3300048908 Bacteria 6351
1063 Ga0496106_0000423 3300048909 Bacteria 30107
1064 Ga0496106_0004190 3300048909 Bacteria 10751
1065 Ga0496106_0025043 3300048909 Bacteria 4439
1066 Ga0496106_0084751 3300048909 Bacteria 2438
1067 Ga0496106_0172238 3300048909 Bacteria 1716
1068 Ga0496107_0000569 3300048910 Bacteria 20544
1069 Ga0496107_0002077 3300048910 Bacteria 12815
1070 Ga0496107_0011235 3300048910 Bacteria 6231
1071 Ga0496107_0025684 3300048910 Bacteria 4171
1072 Ga0496107_0026432 3300048910 Bacteria 4115
1073 Ga0496107_0026605 3300048910 Bacteria 4102
1074 Ga0496108_0001076 3300048911 Bacteria 21311
1075 Ga0496108_0009372 3300048911 Bacteria 7925
1076 Ga0496108_0018077 3300048911 Bacteria 5767
1077 Ga0496108_0150437 3300048911 Bacteria 2008
1078 Ga0496109_0000393 3300048912 Bacteria 39750
1079 Ga0496109_0000902 3300048912 Bacteria 24705
1080 Ga0496109_0002998 3300048912 Bacteria 14106
1081 Ga0496109_0004224 3300048912 Bacteria 11986
1082 Ga0496109_0046155 3300048912 Bacteria 3956
1083 Ga0496109_0049849 3300048912 Bacteria 3813
1084 Ga0496109_0074316 3300048912 Bacteria 3124
1085 Ga0496109_0094808 3300048912 Bacteria 2763
1086 Ga0496109_0175122 3300048912 Bacteria 2013
1087 Ga0496110_0023210 3300048913 Bacteria 5275
1088 Ga0496110_0046016 3300048913 Bacteria 3816
1089 Ga0496110_0085989 3300048913 Bacteria 2807
1090 Ga0496110_0097081 3300048913 Bacteria 2640
1091 Ga0496110_0107904 3300048913 Bacteria 2499
1092 Ga0496111_0001104 3300048914 Bacteria 14944
1093 Ga0496111_0027637 3300048914 Bacteria 4016
1094 Ga0496111_0044749 3300048914 Bacteria 3182
1095 Ga0496112_0004977 3300048915 Bacteria 11390
1096 Ga0496112_0061178 3300048915 Bacteria 3712
1097 Ga0496112_0072920 3300048915 Bacteria 3394
1098 Ga0496112_0110588 3300048915 Bacteria 2717
1099 Ga0496112_0322572 3300048915 Bacteria 1489
1100 Ga0496113_0000565 3300048916 Bacteria 18412
1101 Ga0496113_0001759 3300048916 Bacteria 12289
1102 Ga0496113_0006436 3300048916 Bacteria 7443
1103 Ga0496113_0128690 3300048916 Bacteria 1985
1104 Ga0496114_0010861 3300048917 Bacteria 7253
1105 Ga0496114_0020234 3300048917 Bacteria 5400
1106 Ga0496114_0132993 3300048917 Bacteria 2149
1107 Ga0496115_0002043 3300048918 Bacteria 14442
1108 Ga0496115_0020453 3300048918 Bacteria 5106
1109 Ga0496115_0056881 3300048918 Bacteria 3144
1110 Ga0496121_0001112 3300048924 Bacteria 47429
1111 Ga0496125_0127559 3300048928 Bacteria 1799
1112 Ga0495682_0006639 3300049460 Bacteria 4674
1113 Ga0501031_0000520 3300049568 Bacteria 22508
1114 Ga0501031_0006115 3300049568 Bacteria 7860
1115 Ga0501031_0010364 3300049568 Bacteria 6069
1116 Ga0501031_0038950 3300049568 Bacteria 3101
1117 Ga0501031_0042469 3300049568 Bacteria 2968
1118 Ga0501032_0000479 3300049569 Bacteria 32350
1119 Ga0501032_0012520 3300049569 Bacteria 6056
1120 Ga0501032_0027725 3300049569 Bacteria 3893
1121 Ga0501032_0146932 3300049569 Bacteria 1552
1122 Ga0501033_0000113 3300049570 Bacteria 78028
1123 Ga0501033_0000662 3300049570 Bacteria 31801
1124 Ga0501033_0008338 3300049570 Bacteria 8024
1125 Ga0501033_0008803 3300049570 Bacteria 7803
1126 Ga0501033_0017498 3300049570 Bacteria 5415
1127 Ga0501033_0024009 3300049570 Bacteria 4600
1128 Ga0501033_0025682 3300049570 Bacteria 4438
1129 Ga0501033_0042831 3300049570 Bacteria 3374
1130 Ga0501033_0149616 3300049570 Bacteria 1685
1131 Ga0501034_0000033 3300049571 Bacteria 243508
1132 Ga0501034_0000244 3300049571 Bacteria 100222
1133 Ga0501034_0001074 3300049571 Bacteria 38708
1134 Ga0501034_0001563 3300049571 Bacteria 29937
1135 Ga0501034_0006840 3300049571 Bacteria 12201
1136 Ga0501034_0026313 3300049571 Bacteria 5925
1137 Ga0501034_0033151 3300049571 Bacteria 5242
1138 Ga0501034_0034189 3300049571 Bacteria 5154
1139 Ga0501034_0034539 3300049571 Bacteria 5127
1140 Ga0501034_0051280 3300049571 Bacteria 4160
1141 Ga0501034_0057834 3300049571 Bacteria 3898
1142 Ga0501034_0077793 3300049571 Bacteria 3323
1143 Ga0501034_0098899 3300049571 Bacteria 2912
1144 Ga0501034_0109037 3300049571 Bacteria 2759
1145 Ga0501034_0125189 3300049571 Bacteria 2555
1146 Ga0501034_0174228 3300049571 Bacteria 2118
1147 Ga0501036_0000566 3300049572 Bacteria 26627
1148 Ga0501036_0002138 3300049572 Bacteria 15414
1149 Ga0501036_0003716 3300049572 Bacteria 12235
1150 Ga0501036_0006231 3300049572 Bacteria 9674
1151 Ga0501036_0017272 3300049572 Bacteria 6030
1152 Ga0501036_0021718 3300049572 Bacteria 5396
1153 Ga0501036_0024264 3300049572 Bacteria 5112
1154 Ga0501036_0167886 3300049572 Bacteria 1849
1155 Ga0501037_0000106 3300049573 Bacteria 79430
1156 Ga0501037_0003298 3300049573 Bacteria 11725
1157 Ga0501037_0004103 3300049573 Bacteria 10563
1158 Ga0501037_0005152 3300049573 Bacteria 9508
1159 Ga0501037_0011567 3300049573 Bacteria 6495
1160 Ga0501037_0020118 3300049573 Bacteria 4928
1161 Ga0501037_0031335 3300049573 Bacteria 3925
1162 Ga0501037_0049126 3300049573 Bacteria 3090
1163 Ga0501037_0071363 3300049573 Bacteria 2526
1164 Ga0501037_0074822 3300049573 Bacteria 2460
1165 Ga0501037_0079085 3300049573 Bacteria 2387
1166 Ga0501037_0083403 3300049573 Bacteria 2315
1167 Ga0501037_0090899 3300049573 Bacteria 2207
1168 Ga0501038_0000108 3300049574 Bacteria 70323
1169 Ga0501038_0000855 3300049574 Bacteria 27001
1170 Ga0501038_0006292 3300049574 Bacteria 10978
1171 Ga0501038_0015033 3300049574 Bacteria 7050
1172 Ga0501038_0020793 3300049574 Bacteria 5899
1173 Ga0501038_0042423 3300049574 Bacteria 3962
1174 Ga0501038_0045933 3300049574 Bacteria 3788
1175 Ga0501038_0052471 3300049574 Bacteria 3515
1176 Ga0501038_0084575 3300049574 Bacteria 2669
1177 Ga0501038_0096952 3300049574 Bacteria 2460
1178 Ga0501038_0151196 3300049574 Bacteria 1892
1179 Ga0501039_0001098 3300049575 Bacteria 19845
1180 Ga0501039_0004705 3300049575 Bacteria 10332
1181 Ga0501039_0007173 3300049575 Bacteria 8490
1182 Ga0501039_0009601 3300049575 Bacteria 7375
1183 Ga0501039_0034116 3300049575 Bacteria 3927
1184 Ga0501039_0034987 3300049575 Bacteria 3877
1185 Ga0501039_0038447 3300049575 Bacteria 3695
1186 Ga0501039_0042977 3300049575 Bacteria 3491
1187 Ga0501039_0078104 3300049575 Bacteria 2574
1188 Ga0501040_0012936 3300049576 Bacteria 5485
1189 Ga0501040_0022463 3300049576 Bacteria 4221
1190 Ga0501041_0060785 3300049577 Bacteria 2312
1191 Ga0501042_0048519 3300049578 Bacteria 3028
1192 Ga0501043_0000035 3300049579 Bacteria 133200
1193 Ga0501043_0001890 3300049579 Bacteria 17946
1194 Ga0501043_0006194 3300049579 Bacteria 9613
1195 Ga0501043_0014308 3300049579 Bacteria 6210
1196 Ga0501043_0015938 3300049579 Bacteria 5891
1197 Ga0501043_0024691 3300049579 Bacteria 4713
1198 Ga0501043_0027059 3300049579 Bacteria 4501
1199 Ga0501043_0035930 3300049579 Bacteria 3898
1200 Ga0501043_0045090 3300049579 Bacteria 3467
1201 Ga0501043_0045828 3300049579 Bacteria 3438
1202 Ga0501043_0049915 3300049579 Bacteria 3289
1203 Ga0501043_0105928 3300049579 Bacteria 2209
1204 Ga0501046_0000944 3300049580 Bacteria 28515
1205 Ga0501046_0001603 3300049580 Bacteria 21629
1206 Ga0501046_0001693 3300049580 Bacteria 21063
1207 Ga0501046_0010243 3300049580 Bacteria 8067
1208 Ga0501046_0014609 3300049580 Bacteria 6616
1209 Ga0501046_0023967 3300049580 Bacteria 5011
1210 Ga0501046_0027552 3300049580 Bacteria 4634
1211 Ga0501046_0032549 3300049580 Bacteria 4222
1212 Ga0501046_0046656 3300049580 Bacteria 3437
1213 Ga0501046_0047105 3300049580 Bacteria 3419
1214 Ga0501046_0067660 3300049580 Bacteria 2781
1215 Ga0501047_0000010 3300049581 Bacteria 429357
1216 Ga0501047_0000135 3300049581 Bacteria 89402
1217 Ga0501047_0001813 3300049581 Bacteria 20635
1218 Ga0501047_0002210 3300049581 Bacteria 18637
1219 Ga0501047_0002743 3300049581 Bacteria 16769
1220 Ga0501047_0005989 3300049581 Bacteria 11427
1221 Ga0501047_0012009 3300049581 Bacteria 8195
1222 Ga0501047_0014636 3300049581 Bacteria 7465
1223 Ga0501047_0015955 3300049581 Bacteria 7162
1224 Ga0501047_0018501 3300049581 Bacteria 6682
1225 Ga0501047_0023800 3300049581 Bacteria 5880
1226 Ga0501047_0043581 3300049581 Bacteria 4334
1227 Ga0501047_0048151 3300049581 Bacteria 4116
1228 Ga0501047_0049762 3300049581 Bacteria 4046
1229 Ga0501047_0098414 3300049581 Bacteria 2804
1230 Ga0501047_0136727 3300049581 Bacteria 2331
1231 Ga0501047_0137524 3300049581 Bacteria 2323
1232 Ga0501047_0214026 3300049581 Bacteria 1785
1233 Ga0501048_0000436 3300049582 Bacteria 29275
1234 Ga0501048_0002513 3300049582 Bacteria 14006
1235 Ga0501048_0007804 3300049582 Bacteria 8112
1236 Ga0501048_0011234 3300049582 Bacteria 6676
1237 Ga0501048_0091956 3300049582 Bacteria 2139
1238 Ga0501067_0000794 3300049583 Bacteria 17026
1239 Ga0501067_0007201 3300049583 Bacteria 6180
1240 Ga0501067_0007267 3300049583 Bacteria 6148
1241 Ga0501067_0008182 3300049583 Bacteria 5808
1242 Ga0501067_0011536 3300049583 Bacteria 4897
1243 Ga0501067_0012123 3300049583 Bacteria 4779
1244 Ga0501067_0015634 3300049583 Bacteria 4199
1245 Ga0501067_0016854 3300049583 Bacteria 4035
1246 Ga0501067_0017461 3300049583 Bacteria 3968
1247 Ga0501067_0017501 3300049583 Bacteria 3965
1248 Ga0501067_0020087 3300049583 Bacteria 3695
1249 Ga0501068_0001073 3300049584 Bacteria 14452
1250 Ga0501068_0002058 3300049584 Bacteria 10722
1251 Ga0501068_0017942 3300049584 Bacteria 4096
1252 Ga0501068_0022913 3300049584 Bacteria 3656
1253 Ga0501069_0000530 3300049585 Bacteria 17469
1254 Ga0501069_0003838 3300049585 Bacteria 7745
1255 Ga0501069_0008839 3300049585 Bacteria 5308
1256 Ga0501069_0015025 3300049585 Bacteria 4146
1257 Ga0501069_0019258 3300049585 Bacteria 3689
1258 Ga0501069_0038466 3300049585 Bacteria 2641
1259 Ga0501069_0040811 3300049585 Bacteria 2565
1260 Ga0501069_0045687 3300049585 Bacteria 2427
1261 Ga0501070_0000185 3300049586 Bacteria 58378
1262 Ga0501070_0001087 3300049586 Bacteria 24420
1263 Ga0501070_0004796 3300049586 Bacteria 11568
1264 Ga0501070_0010071 3300049586 Bacteria 7997
1265 Ga0501070_0012088 3300049586 Bacteria 7286
1266 Ga0501070_0034812 3300049586 Bacteria 4209
1267 Ga0501070_0053235 3300049586 Bacteria 3358
1268 Ga0501070_0060609 3300049586 Bacteria 3136
1269 Ga0501070_0060656 3300049586 Bacteria 3135
1270 Ga0501070_0066808 3300049586 Bacteria 2978
1271 Ga0501070_0081284 3300049586 Bacteria 2680
1272 Ga0501070_0089650 3300049586 Bacteria 2545
1273 Ga0501070_0114355 3300049586 Bacteria 2229
1274 Ga0501070_0159329 3300049586 Bacteria 1861
1275 Ga0501071_0118153 3300049587 Bacteria 1964
1276 Ga0501072_0000367 3300049588 Bacteria 32192
1277 Ga0501072_0001422 3300049588 Bacteria 17958
1278 Ga0501072_0064027 3300049588 Bacteria 2900
1279 Ga0501072_0072536 3300049588 Bacteria 2721
1280 Ga0501072_0080885 3300049588 Bacteria 2575
1281 Ga0501072_0091246 3300049588 Bacteria 2419
1282 Ga0501073_0005360 3300049589 Bacteria 9613
1283 Ga0501073_0005612 3300049589 Bacteria 9387
1284 Ga0501073_0009648 3300049589 Bacteria 7117
1285 Ga0501073_0013878 3300049589 Bacteria 5857
1286 Ga0501073_0017448 3300049589 Bacteria 5199
1287 Ga0501073_0026774 3300049589 Bacteria 4129
1288 Ga0501073_0041811 3300049589 Bacteria 3237
1289 Ga0501073_0066403 3300049589 Bacteria 2515
1290 Ga0501073_0066610 3300049589 Bacteria 2510
1291 Ga0501074_0001330 3300049590 Bacteria 16411
1292 Ga0501074_0002512 3300049590 Bacteria 12790
1293 Ga0501074_0007496 3300049590 Bacteria 7893
1294 Ga0501074_0010361 3300049590 Bacteria 6764
1295 Ga0501074_0040151 3300049590 Bacteria 3390
1296 Ga0501074_0069547 3300049590 Bacteria 2531
1297 Ga0501075_0014665 3300049591 Bacteria 5616
1298 Ga0501076_0016577 3300049592 Bacteria 5585
1299 Ga0501076_0059001 3300049592 Bacteria 3052
1300 Ga0501076_0085799 3300049592 Bacteria 2530
1301 Ga0501077_0003973 3300049593 Bacteria 8921
1302 Ga0501077_0043243 3300049593 Bacteria 2864
1303 Ga0501077_0102922 3300049593 Bacteria 1809
1304 Ga0501079_0005097 3300049741 Bacteria 9759
1305 Ga0501079_0007511 3300049741 Bacteria 8246
1306 Ga0501079_0053143 3300049741 Bacteria 3126
1307 Ga0501080_0000002 3300049742 Bacteria 218492
1308 Ga0501080_0000148 3300049742 Bacteria 50074
1309 Ga0501080_0000329 3300049742 Bacteria 36305
1310 Ga0501080_0003197 3300049742 Bacteria 14444
1311 Ga0501080_0005539 3300049742 Bacteria 11274
1312 Ga0501080_0011215 3300049742 Bacteria 8205
1313 Ga0501080_0011341 3300049742 Bacteria 8160
1314 Ga0501080_0017229 3300049742 Bacteria 6675
1315 Ga0501080_0020142 3300049742 Bacteria 6173
1316 Ga0501080_0029572 3300049742 Bacteria 5101
1317 Ga0501080_0061011 3300049742 Bacteria 3511
1318 Ga0501080_0065077 3300049742 Bacteria 3391
1319 Ga0501080_0112923 3300049742 Bacteria 2518
1320 Ga0501080_0182097 3300049742 Bacteria 1933
1321 Ga0501081_0009650 3300049743 Bacteria 6292
1322 Ga0501081_0038528 3300049743 Bacteria 3266
1323 Ga0501081_0083565 3300049743 Bacteria 2238
1324 Ga0501081_0118450 3300049743 Bacteria 1884
1325 Ga0501083_0000335 3300049744 Bacteria 29800
1326 Ga0501083_0007566 3300049744 Bacteria 7696
1327 Ga0501083_0008168 3300049744 Bacteria 7404
1328 Ga0501083_0011666 3300049744 Bacteria 6163
1329 Ga0501083_0029267 3300049744 Bacteria 3790
1330 Ga0501083_0045658 3300049744 Bacteria 2963
1331 Ga0501083_0086245 3300049744 Bacteria 2076
1332 Ga0501035_0000089 3300049822 Bacteria 112536
1333 Ga0501035_0000615 3300049822 Bacteria 39227
1334 Ga0501035_0000632 3300049822 Bacteria 38776
1335 Ga0501035_0003056 3300049822 Bacteria 16047
1336 Ga0501035_0008955 3300049822 Bacteria 9313
1337 Ga0501035_0017934 3300049822 Bacteria 6528
1338 Ga0501035_0027062 3300049822 Bacteria 5243
1339 Ga0501035_0035245 3300049822 Bacteria 4542
1340 Ga0501035_0035672 3300049822 Bacteria 4512
1341 Ga0501035_0052242 3300049822 Bacteria 3657
1342 Ga0501035_0055825 3300049822 Bacteria 3526
1343 Ga0501035_0056946 3300049822 Bacteria 3486
1344 Ga0501035_0101804 3300049822 Bacteria 2520
1345 Ga0501044_0000019 3300049823 Bacteria 223724
1346 Ga0501044_0000051 3300049823 Bacteria 143658
1347 Ga0501044_0001173 3300049823 Bacteria 31079
1348 Ga0501044_0001984 3300049823 Bacteria 23655
1349 Ga0501044_0003192 3300049823 Bacteria 18501
1350 Ga0501044_0004630 3300049823 Bacteria 15398
1351 Ga0501044_0010411 3300049823 Bacteria 10091
1352 Ga0501044_0010413 3300049823 Bacteria 10090
1353 Ga0501044_0021386 3300049823 Bacteria 6903
1354 Ga0501044_0026573 3300049823 Bacteria 6127
1355 Ga0501044_0026677 3300049823 Bacteria 6114
1356 Ga0501044_0032998 3300049823 Bacteria 5441
1357 Ga0501044_0040506 3300049823 Bacteria 4855
1358 Ga0501044_0050805 3300049823 Bacteria 4277
1359 Ga0501044_0052538 3300049823 Bacteria 4198
1360 Ga0501044_0068347 3300049823 Bacteria 3619
1361 Ga0501044_0078057 3300049823 Bacteria 3356
1362 Ga0501044_0078256 3300049823 Bacteria 3351
1363 Ga0501044_0078974 3300049823 Bacteria 3335
1364 Ga0501044_0130308 3300049823 Bacteria 2509
1365 Ga0501044_0130808 3300049823 Bacteria 2504
1366 Ga0501044_0173049 3300049823 Bacteria 2129
1367 Ga0501045_0006937 3300049824 Bacteria 7852
1368 Ga0501045_0011179 3300049824 Bacteria 6293
1369 nmdc:mga03683_855_c1 3300050489 Bacteria 8777
1370 nmdc:mga00v17_39324_c1 3300050491 Bacteria 2832
1371 nmdc:mga00v17_556_c1 3300050491 Bacteria 20858
1372 nmdc:mga0k408_27139_c1 3300050493 Bacteria 3251
1373 nmdc:mga04h51_2625_c1 3300050495 Bacteria 4279
1374 nmdc:mga05p37_262_c1 3300050507 Bacteria 49144
1375 nmdc:mga05p37_69110_c1 3300050507 Bacteria 4344
1376 nmdc:mga09592_159435_c1 3300050508 Bacteria 1948
1377 nmdc:mga09592_870_c1 3300050508 Bacteria 23632
1378 nmdc:mga0qj67_53_c1 3300050509 Bacteria 83612
1379 nmdc:mga0qj67_662_c1 3300050509 Bacteria 23643
1380 nmdc:mga0qj67_8287_c1 3300050509 Bacteria 7705
1381 nmdc:mga06r32_116209_c1 3300050510 Bacteria 2636
1382 nmdc:mga06r32_4844_c1 3300050510 Bacteria 12121
1383 nmdc:mga06r32_8735_c1 3300050510 Bacteria 9128
1384 nmdc:mga08y16_172_c1 3300050511 Bacteria 56716
1385 nmdc:mga08y16_38066_c1 3300050511 Bacteria 5050
1386 nmdc:mga08y16_419_c1 3300050511 Bacteria 39080
1387 nmdc:mga08y16_58119_c1 3300050511 Bacteria 4041
1388 nmdc:mga08y16_98740_c1 3300050511 Bacteria 3040
1389 nmdc:mga0n895_106_c1 3300050512 Bacteria 49191
1390 nmdc:mga0n895_1285_c1 3300050512 Bacteria 18558
1391 nmdc:mga0n895_166505_c1 3300050512 Bacteria 2236
1392 nmdc:mga0n895_43445_c1 3300050512 Bacteria 4379
1393 nmdc:mga0n895_4616_c1 3300050512 Bacteria 11356
1394 nmdc:mga0n895_80225_c1 3300050512 Bacteria 3251
1395 nmdc:mga0rr50_12977_c1 3300050513 Bacteria 5406
1396 nmdc:mga0rr50_1679_c1 3300050513 Bacteria 12206
1397 nmdc:mga0rr50_2926_c1 3300050513 Bacteria 9751
1398 nmdc:mga0rr50_37098_c1 3300050513 Bacteria 3516
1399 nmdc:mga0rr50_62011_c1 3300050513 Bacteria 2819
1400 nmdc:mga0rr50_6359_c1 3300050513 Bacteria 7180
1401 nmdc:mga08x19_11956_c1 3300050514 Bacteria 5224
1402 nmdc:mga08x19_140_c1 3300050514 Bacteria 64178
1403 nmdc:mga08x19_39731_c1 3300050514 Bacteria 2991
1404 nmdc:mga08x19_43241_c1 3300050514 Bacteria 2874
1405 nmdc:mga08x19_4_c2 3300050514 Bacteria 202063
1406 nmdc:mga08x19_53313_c1 3300050514 Bacteria 2602
1407 nmdc:mga0a205_3731_c1 3300050515 Bacteria 13637
1408 nmdc:mga0a205_46815_c1 3300050515 Bacteria 4172
1409 Ga0495601_0002252 3300053077 Bacteria 10876
1410 Ga0495601_0004018 3300053077 Bacteria 8472
1411 Ga0495601_0004636 3300053077 Bacteria 7957
1412 Ga0495601_0005999 3300053077 Bacteria 7090
1413 Ga0495601_0024497 3300053077 Bacteria 3716
1414 Ga0495601_0026740 3300053077 Bacteria 3565
1415 Ga0495601_0098529 3300053077 Bacteria 1887
1416 Ga0495612_0000188 3300053078 Bacteria 26257
1417 Ga0495612_0000735 3300053078 Bacteria 13297
1418 Ga0495612_0005933 3300053078 Bacteria 5034
1419 Ga0495612_0006851 3300053078 Bacteria 4665
1420 Ga0495612_0011475 3300053078 Bacteria 3573
1421 Ga0495612_0022397 3300053078 Bacteria 2532
1422 Ga0495612_0024623 3300053078 Bacteria 2416
1423 Ga0495612_0049281 3300053078 Bacteria 1728
1424 Ga0500635_0002116 3300053080 Bacteria 4872
1425 Ga0495595_0000656 3300053084 Bacteria 13144
1426 Ga0495595_0001067 3300053084 Bacteria 10612
1427 Ga0495595_0001391 3300053084 Bacteria 9383
1428 Ga0495595_0002496 3300053084 Bacteria 7209
1429 Ga0495595_0007222 3300053084 Bacteria 4541
1430 Ga0495595_0015878 3300053084 Bacteria 3215
1431 Ga0495619_0000149 3300053085 Bacteria 51751
1432 Ga0495619_0000355 3300053085 Bacteria 32054
1433 Ga0495619_0000818 3300053085 Bacteria 20381
1434 Ga0495619_0005759 3300053085 Bacteria 7852
1435 Ga0495619_0031008 3300053085 Bacteria 3462
1436 Ga0495619_0052442 3300053085 Bacteria 2696
1437 Ga0495619_0056118 3300053085 Bacteria 2611
1438 Ga0495619_0061825 3300053085 Bacteria 2493
1439 Ga0495619_0079370 3300053085 Bacteria 2207
1440 Ga0500643_003007 3300053087 Bacteria 8347
1441 Ga0500643_004111 3300053087 Bacteria 6701
1442 Ga0500647_0034444 3300053091 Bacteria 2418
1443 Ga0500566_0000026 3300053094 Bacteria 77138
1444 Ga0500640_000375 3300053095 Bacteria 10534
1445 Ga0500641_0002459 3300053096 Bacteria 6548
1446 Ga0500555_003351 3300053103 Bacteria 4567
1447 Ga0500556_0000138 3300053104 Bacteria 60796
1448 Ga0500562_000199 3300053108 Bacteria 16293
1449 Ga0500572_000596 3300053111 Bacteria 12198
1450 Ga0500593_000023 3300053117 Bacteria 52110
1451 Ga0500594_0028149 3300053118 Bacteria 1460
1452 Ga0500595_000002 3300053119 Bacteria 1074388
1453 Ga0500595_000264 3300053119 Bacteria 34740
1454 Ga0500595_000709 3300053119 Bacteria 19862
1455 Ga0500595_001923 3300053119 Bacteria 10684
1456 Ga0500595_009318 3300053119 Bacteria 3967
1457 Ga0500608_000295 3300053122 Bacteria 19338
1458 Ga0500614_001603 3300053123 Bacteria 5335
1459 Ga0500642_0001557 3300053130 Bacteria 6597
1460 Ga0500642_0004544 3300053130 Bacteria 4360
1461 Ga0500642_0018321 3300053130 Bacteria 2705
1462 Ga0500658_0003055 3300053134 Bacteria 6406
1463 Ga0500559_0000227 3300053136 Bacteria 44722
1464 Ga0500559_0009631 3300053136 Bacteria 4172
1465 Ga0500568_0000001 3300053139 Bacteria 988705
1466 Ga0500577_0021075 3300053142 Bacteria 2143
1467 Ga0500588_0001370 3300053146 Bacteria 4619
1468 Ga0500588_0011898 3300053146 Bacteria 2143
1469 Ga0500590_057935 3300053148 Bacteria 1953
1470 Ga0500603_000327 3300053150 Bacteria 12434
1471 Ga0500604_0001027 3300053151 Bacteria 7803
1472 Ga0500604_0001669 3300053151 Bacteria 6231
1473 Ga0500604_0007067 3300053151 Bacteria 2971
1474 Ga0500616_0000002 3300053153 Bacteria 1611257
1475 Ga0500616_0000815 3300053153 Bacteria 35444
1476 Ga0500616_0001405 3300053153 Bacteria 23210
1477 Ga0500619_000410 3300053154 Bacteria 7784
1478 Ga0500630_000530 3300053159 Bacteria 17155
1479 Ga0500638_000051 3300053162 Bacteria 27566
1480 Ga0500639_000673 3300053163 Bacteria 17246
1481 Ga0500636_0029697 3300053177 Bacteria 3231
1482 Ga0500636_0099994 3300053177 Bacteria 1650
1483 Ga0500637_0000122 3300053178 Bacteria 28103
1484 Ga0500609_000409 3300053731 Bacteria 6344
1485 Ga0500596_000598 3300053735 Bacteria 6932
1486 Ga0500599_000031 3300053736 Bacteria 33007
1487 Ga0501084_0000916 3300054114 Bacteria 22809
1488 Ga0501084_0005391 3300054114 Bacteria 10485
1489 Ga0501084_0018383 3300054114 Bacteria 5821
1490 Ga0501084_0026851 3300054114 Bacteria 4809
1491 Ga0501084_0038494 3300054114 Bacteria 3998
1492 Ga0501084_0066370 3300054114 Bacteria 3019
1493 Ga0501084_0071817 3300054114 Bacteria 2899
1494 Ga0501082_0000396 3300060353 Bacteria 38652
1495 Ga0501082_0002987 3300060353 Bacteria 14768
1496 Ga0501082_0005893 3300060353 Bacteria 10638
1497 Ga0501082_0009272 3300060353 Bacteria 8482
1498 Ga0501082_0009819 3300060353 Bacteria 8246
1499 Ga0501082_0011751 3300060353 Bacteria 7526
1500 Ga0501082_0022398 3300060353 Bacteria 5442
1501 Ga0501082_0036672 3300060353 Bacteria 4223
1502 Ga0501082_0041378 3300060353 Bacteria 3973
1503 Ga0501082_0168060 3300060353 Bacteria 1906
1504 Ga0530510_0006270 3300061734 Bacteria 8274

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035725 Ga0373947_0166420 Ga0373947_0166420_25_1296 412
2 3300053118 Ga0500594_0028149 Ga0500594_0028149_158_1441 412
3 3300026075 Ga0207708_10173702 Ga0207708_101737022 414
4 3300053091 Ga0500647_0034444 Ga0500647_0034444_12_1289 415
5 3300028800 Ga0265338_10000005 Ga0265338_1000000531 417
6 3300031241 Ga0265325_10000010 Ga0265325_10000010153 417
7 3300031249 Ga0265339_10000373 Ga0265339_1000037322 417
8 3300031250 Ga0265331_10007691 Ga0265331_100076913 417
9 3300031595 Ga0265313_10000828 Ga0265313_1000082822 417
10 3300031712 Ga0265342_10011836 Ga0265342_100118365 417
11 3300009098 Ga0105245_10117376 Ga0105245_101173762 421
12 3300030521 Ga0307511_10006795 Ga0307511_100067957 426
13 3300031235 Ga0265330_10044664 Ga0265330_100446642 427
14 3300050514 nmdc:mga08x19_53313_c1 nmdc:mga08x19_53313_c1_18_1325 427
15 3300035410 Ga0373924_0046937 Ga0373924_0046937_16_1383 441
16 3300053154 Ga0500619_000410 Ga0500619_000410_3683_5179 442
17 3300009093 Ga0105240_10097689 Ga0105240_100976891 443
18 3300026142 Ga0207698_10131448 Ga0207698_101314482 443
19 3300047471 Ga0495684_0051341 Ga0495684_0051341_1678_3108 443
20 3300048913 Ga0496110_0085989 Ga0496110_0085989_101_1540 444
21 3300050491 nmdc:mga00v17_556_c1 nmdc:mga00v17_556_c1_7876_9366 444
22 3300049571 Ga0501034_0034539 Ga0501034_0034539_1157_2503 447
23 3300046472 Ga0495580_0000623 Ga0495580_0000623_18597_20054 449
24 3300049571 Ga0501034_0125189 Ga0501034_0125189_663_2174 449
25 3300049573 Ga0501037_0031335 Ga0501037_0031335_1029_2540 449
26 3300049575 Ga0501039_0042977 Ga0501039_0042977_657_2168 449
27 3300049580 Ga0501046_0014609 Ga0501046_0014609_933_2444 449
28 3300049581 Ga0501047_0048151 Ga0501047_0048151_1028_2539 449
29 3300049583 Ga0501067_0011536 Ga0501067_0011536_3167_4678 449
30 3300049590 Ga0501074_0007496 Ga0501074_0007496_289_1800 449
31 3300049744 Ga0501083_0086245 Ga0501083_0086245_153_1664 449
32 3300049823 Ga0501044_0052538 Ga0501044_0052538_675_2186 449
33 3300060353 Ga0501082_0009272 Ga0501082_0009272_6041_7552 449
34 3300037853 Ga0436364_0349574 Ga0436364_0349574_2122_3672 450
35 3300005535 Ga0070684_100008936 Ga0070684_1000089365 451
36 3300050514 nmdc:mga08x19_39731_c1 nmdc:mga08x19_39731_c1_519_2024 451
37 3300009545 Ga0105237_10038994 Ga0105237_100389944 452
38 3300049571 Ga0501034_0098899 Ga0501034_0098899_282_1784 452
39 3300049581 Ga0501047_0005989 Ga0501047_0005989_3225_4727 452
40 3300049583 Ga0501067_0008182 Ga0501067_0008182_2867_4369 452
41 3300049588 Ga0501072_0001422 Ga0501072_0001422_8977_10479 452
42 3300049589 Ga0501073_0005612 Ga0501073_0005612_3774_5276 452
43 3300049742 Ga0501080_0017229 Ga0501080_0017229_2297_3799 452
44 3300054114 Ga0501084_0038494 Ga0501084_0038494_1389_2891 452
45 3300005344 Ga0070661_100009887 Ga0070661_1000098874 453
46 3300009551 Ga0105238_10006280 Ga0105238_1000628010 453
47 3300010375 Ga0105239_10001205 Ga0105239_100012052 453
48 3300014325 Ga0163163_10020329 Ga0163163_100203296 453
49 3300025906 Ga0207699_10063104 Ga0207699_100631042 453
50 3300025915 Ga0207693_10114151 Ga0207693_101141512 453
51 3300025920 Ga0207649_10010115 Ga0207649_100101152 453
52 3300025924 Ga0207694_10000005 Ga0207694_10000005622 453
53 3300035725 Ga0373947_0157617 Ga0373947_0157617_18_1382 453
54 3300048907 Ga0496104_0031344 Ga0496104_0031344_2253_3797 453
55 3300048908 Ga0496105_0010018 Ga0496105_0010018_788_2332 453
56 3300048911 Ga0496108_0001076 Ga0496108_0001076_13635_15179 453
57 3300048912 Ga0496109_0004224 Ga0496109_0004224_143_1687 453
58 3300048914 Ga0496111_0001104 Ga0496111_0001104_2744_4288 453
59 3300048916 Ga0496113_0001759 Ga0496113_0001759_9084_10628 453
60 3300048918 Ga0496115_0002043 Ga0496115_0002043_8688_10232 453
61 3300049823 Ga0501044_0050805 Ga0501044_0050805_2739_4235 453
62 3300005539 Ga0068853_100005824 Ga0068853_1000058244 454
63 3300009177 Ga0105248_10000001 Ga0105248_10000001172 454
64 3300013105 Ga0157369_10028852 Ga0157369_100288524 454
65 3300025924 Ga0207694_10006940 Ga0207694_100069403 454
66 3300025941 Ga0207711_10000002 Ga0207711_10000002873 454
67 3300026041 Ga0207639_10003830 Ga0207639_100038308 454
68 3300036401 Ga0373937_0014180 Ga0373937_0014180_2943_4463 454
69 3300005354 Ga0070675_100200758 Ga0070675_1002007581 455
70 3300005459 Ga0068867_100003555 Ga0068867_1000035557 455
71 3300005563 Ga0068855_100000750 Ga0068855_10000075028 455
72 3300005842 Ga0068858_100002317 Ga0068858_1000023178 455
73 3300009093 Ga0105240_10001534 Ga0105240_1000153427 455
74 3300009148 Ga0105243_10001995 Ga0105243_1000199512 455
75 3300009174 Ga0105241_10022849 Ga0105241_100228491 455
76 3300009176 Ga0105242_10005119 Ga0105242_100051193 455
77 3300025913 Ga0207695_10000003 Ga0207695_100000031278 455
78 3300025949 Ga0207667_10000183 Ga0207667_1000018368 455
79 3300026089 Ga0207648_10004006 Ga0207648_100040066 455
80 3300026116 Ga0207674_10086040 Ga0207674_100860402 455
81 3300031730 Ga0307516_10119891 Ga0307516_101198912 455
82 3300049460 Ga0495682_0006639 Ga0495682_0006639_2250_3830 455
83 3300003214 JGI25165J46597_1000425 JGI25165J46597_100042512 456
84 3300025261 Ga0209233_1000013 Ga0209233_1000013223 456
85 3300049592 Ga0501076_0085799 Ga0501076_0085799_52_1425 456
86 3300005435 Ga0070714_100019460 Ga0070714_1000194603 457
87 3300005436 Ga0070713_100055856 Ga0070713_1000558562 457
88 3300006028 Ga0070717_10036878 Ga0070717_100368784 457
89 3300006042 Ga0075368_10009253 Ga0075368_100092532 457
90 3300025909 Ga0207705_10086576 Ga0207705_100865763 457
91 3300025929 Ga0207664_10061900 Ga0207664_100619003 457
92 3300050495 nmdc:mga04h51_2625_c1 nmdc:mga04h51_2625_c1_1221_2720 457
93 3300003214 JGI25165J46597_1000630 JGI25165J46597_10006304 458
94 3300025233 Ga0209437_100075 Ga0209437_100075212 458
95 3300025261 Ga0209233_1000056 Ga0209233_100005638 458
96 3300005366 Ga0070659_100031620 Ga0070659_1000316201 459
97 3300005563 Ga0068855_100034186 Ga0068855_1000341864 459
98 3300009093 Ga0105240_10089167 Ga0105240_100891673 459
99 3300035091 Ga0373951_0000554 Ga0373951_0000554_8994_10373 459
100 3300054114 Ga0501084_0071817 Ga0501084_0071817_1463_2845 459
101 iso_pu_bacteria 2909042592 2909043423 461
102 3300035117 Ga0373953_0038779 Ga0373953_0038779_232_1725 462
103 3300036401 Ga0373937_0017558 Ga0373937_0017558_2659_4050 462
104 3300045049 Ga0466959_0024431 Ga0466959_0024431_2373_3872 462
105 3300046675 Ga0495657_0046426 Ga0495657_0046426_612_2102 462
106 3300046678 Ga0495599_0024233 Ga0495599_0024233_621_2111 462
107 3300046809 Ga0495600_0034134 Ga0495600_0034134_982_2373 462
108 3300047317 Ga0495604_0016150 Ga0495604_0016150_4083_5474 462
109 3300047322 Ga0495680_0036127 Ga0495680_0036127_2032_3423 462
110 3300049572 Ga0501036_0167886 Ga0501036_0167886_288_1793 462
111 3300049579 Ga0501043_0027059 Ga0501043_0027059_2102_3607 462
112 3300049822 Ga0501035_0101804 Ga0501035_0101804_171_1676 462
113 3300049823 Ga0501044_0068347 Ga0501044_0068347_1015_2520 462
114 3300053077 Ga0495601_0004636 Ga0495601_0004636_4045_5436 462
115 3300053078 Ga0495612_0006851 Ga0495612_0006851_106_1497 462
116 3300053085 Ga0495619_0000149 Ga0495619_0000149_16430_17821 462
117 3300035114 Ga0373939_0000796 Ga0373939_0000796_3336_4841 463
118 3300049570 Ga0501033_0025682 Ga0501033_0025682_398_1906 463
119 3300049581 Ga0501047_0002210 Ga0501047_0002210_15347_16855 463
120 3300049822 Ga0501035_0017934 Ga0501035_0017934_4739_6247 463
121 3300049823 Ga0501044_0010411 Ga0501044_0010411_3662_5170 463
122 3300053151 Ga0500604_0001669 Ga0500604_0001669_4520_6010 463
123 3300031241 Ga0265325_10000981 Ga0265325_1000098112 464
124 3300039450 Ga0436363_1230015 Ga0436363_1230015_21523_23022 464
125 3300048913 Ga0496110_0046016 Ga0496110_0046016_106_1629 464
126 3300003215 JGI25153J46596_10003084 JGI25153J46596_100030847 465
127 3300021384 Ga0213876_10001486 Ga0213876_1000148613 465
128 3300025297 Ga0209758_1000036 Ga0209758_1000036186 465
129 3300039437 Ga0436365_1253031 Ga0436365_1253031_2977_4476 465
130 3300031344 Ga0265316_10064482 Ga0265316_100644821 466
131 3300031595 Ga0265313_10012072 Ga0265313_100120724 466
132 3300032133 Ga0316583_10000001 Ga0316583_1000000156 466
133 3300031247 Ga0265340_10000215 Ga0265340_100002159 468
134 3300049571 Ga0501034_0006840 Ga0501034_0006840_6171_7715 468
135 3300049586 Ga0501070_0053235 Ga0501070_0053235_1459_3003 468
136 3300049822 Ga0501035_0035245 Ga0501035_0035245_2775_4319 468
137 3300060353 Ga0501082_0041378 Ga0501082_0041378_2197_3741 468
138 3300046513 Ga0495616_0031798 Ga0495616_0031798_437_1876 469
139 3300053130 Ga0500642_0018321 Ga0500642_0018321_805_2244 469
140 3300053151 Ga0500604_0007067 Ga0500604_0007067_1119_2558 469
141 3300025261 Ga0209233_1004714 Ga0209233_10047143 470
142 3300031249 Ga0265339_10000761 Ga0265339_100007611 470
143 3300031595 Ga0265313_10000183 Ga0265313_1000018311 470
144 3300046462 Ga0495651_0132798 Ga0495651_0132798_383_1798 470
145 3300049823 Ga0501044_0173049 Ga0501044_0173049_568_2064 470
146 iso_pu_bacteria 2885383462 2885388336 470
147 3300037471 Ga0395905_0007796 Ga0395905_0007796_6884_8332 471
148 3300050508 nmdc:mga09592_159435_c1 nmdc:mga09592_159435_c1_23_1465 471
149 3300025297 Ga0209758_1005859 Ga0209758_10058598 472
150 3300031247 Ga0265340_10023065 Ga0265340_100230654 472
151 3300053130 Ga0500642_0004544 Ga0500642_0004544_920_2422 472
152 iso_pu_bacteria 2842482326 2842486557 472
153 iso_pu_bacteria 2908446538 2908449555 472
154 3300013297 Ga0157378_10008089 Ga0157378_100080893 473
155 3300014968 Ga0157379_10032776 Ga0157379_100327762 473
156 3300031727 Ga0316576_10038495 Ga0316576_100384954 473
157 3300038742 Ga0400486_12350 Ga0400486_12350_1169_2689 473
158 3300039110 Ga0400487_23952 Ga0400487_23952_1995_3515 473
159 3300039450 Ga0436363_1455042 Ga0436363_1455042_2041_3471 473
160 3300049570 Ga0501033_0024009 Ga0501033_0024009_582_2081 473
161 3300049570 Ga0501033_0149616 Ga0501033_0149616_51_1547 473
162 3300049572 Ga0501036_0003716 Ga0501036_0003716_7183_8682 473
163 3300049573 Ga0501037_0005152 Ga0501037_0005152_3523_5022 473
164 3300049574 Ga0501038_0000855 Ga0501038_0000855_15859_17358 473
165 3300049574 Ga0501038_0096952 Ga0501038_0096952_58_1557 473
166 3300049575 Ga0501039_0001098 Ga0501039_0001098_11776_13275 473
167 3300049579 Ga0501043_0006194 Ga0501043_0006194_6099_7598 473
168 3300049580 Ga0501046_0001693 Ga0501046_0001693_5559_7058 473
169 3300049583 Ga0501067_0020087 Ga0501067_0020087_83_1582 473
170 3300049585 Ga0501069_0000530 Ga0501069_0000530_13254_14753 473
171 3300049589 Ga0501073_0005360 Ga0501073_0005360_1337_2836 473
172 3300049590 Ga0501074_0002512 Ga0501074_0002512_3341_4840 473
173 3300049742 Ga0501080_0003197 Ga0501080_0003197_6119_7618 473
174 3300049744 Ga0501083_0007566 Ga0501083_0007566_1883_3382 473
175 3300053087 Ga0500643_003007 Ga0500643_003007_5951_7462 473
176 3300053119 Ga0500595_000264 Ga0500595_000264_15241_16800 473
177 3300060353 Ga0501082_0002987 Ga0501082_0002987_7583_9082 473
178 3300031250 Ga0265331_10000015 Ga0265331_1000001584 474
179 3300031251 Ga0265327_10050275 Ga0265327_100502752 474
180 3300048907 Ga0496104_0000035 Ga0496104_0000035_38909_40432 474
181 3300048908 Ga0496105_0000029 Ga0496105_0000029_83724_85247 474
182 3300005327 Ga0070658_10095937 Ga0070658_100959373 475
183 3300005339 Ga0070660_100000909 Ga0070660_1000009093 475
184 3300005458 Ga0070681_10173866 Ga0070681_101738661 475
185 3300005563 Ga0068855_100011163 Ga0068855_1000111637 475
186 3300006871 Ga0075434_100113683 Ga0075434_1001136832 475
187 3300007076 Ga0075435_100064053 Ga0075435_1000640532 475
188 3300009147 Ga0114129_10005152 Ga0114129_100051528 475
189 3300009551 Ga0105238_10079733 Ga0105238_100797332 475
190 3300013307 Ga0157372_10018842 Ga0157372_100188422 475
191 3300025909 Ga0207705_10000461 Ga0207705_100004615 475
192 3300025912 Ga0207707_10001730 Ga0207707_100017307 475
193 3300025919 Ga0207657_10002447 Ga0207657_1000244711 475
194 3300025921 Ga0207652_10002306 Ga0207652_100023068 475
195 3300050512 nmdc:mga0n895_1285_c1 nmdc:mga0n895_1285_c1_9404_10906 475
196 3300050513 nmdc:mga0rr50_12977_c1 nmdc:mga0rr50_12977_c1_1311_2813 475
197 3300050515 nmdc:mga0a205_3731_c1 nmdc:mga0a205_3731_c1_9968_11470 475
198 3300048915 Ga0496112_0322572 Ga0496112_0322572_31_1464 476
199 3300049582 Ga0501048_0011234 Ga0501048_0011234_2594_4123 476
200 3300049586 Ga0501070_0060656 Ga0501070_0060656_1673_3112 476
201 3300002737 JGI25162J39368_1001576 JGI25162J39368_10015763 477
202 3300003214 JGI25165J46597_1000930 JGI25165J46597_10009305 477
203 3300009094 Ga0111539_10034898 Ga0111539_100348984 477
204 3300009551 Ga0105238_10045654 Ga0105238_100456544 477
205 3300025233 Ga0209437_100248 Ga0209437_10024868 477
206 3300025261 Ga0209233_1000241 Ga0209233_100024110 477
207 3300049744 Ga0501083_0029267 Ga0501083_0029267_762_2336 477
208 3300054114 Ga0501084_0026851 Ga0501084_0026851_1044_2618 477
209 3300005937 Ga0081455_10030203 Ga0081455_100302032 478
210 3300005985 Ga0081539_10027859 Ga0081539_100278593 478
211 3300031247 Ga0265340_10021121 Ga0265340_100211213 478
212 3300035171 Ga0373946_0060751 Ga0373946_0060751_36_1475 478
213 3300046529 Ga0495652_0170328 Ga0495652_0170328_186_1625 478
214 3300046536 Ga0495587_0042451 Ga0495587_0042451_29_1468 478
215 3300006846 Ga0075430_100000124 Ga0075430_10000012417 479
216 3300031250 Ga0265331_10010025 Ga0265331_100100254 479
217 3300031595 Ga0265313_10002827 Ga0265313_100028272 479
218 3300031711 Ga0265314_10022187 Ga0265314_100221872 479
219 3300031712 Ga0265342_10019026 Ga0265342_100190261 479
220 3300050509 nmdc:mga0qj67_53_c1 nmdc:mga0qj67_53_c1_27307_28803 479
221 3300005435 Ga0070714_100060923 Ga0070714_1000609231 480
222 3300005436 Ga0070713_100015039 Ga0070713_1000150394 480
223 3300005439 Ga0070711_100066013 Ga0070711_1000660131 480
224 3300005548 Ga0070665_100157648 Ga0070665_1001576482 480
225 3300005614 Ga0068856_100060499 Ga0068856_1000604991 480
226 3300005983 Ga0081540_1000015 Ga0081540_100001546 480
227 3300006028 Ga0070717_10051394 Ga0070717_100513943 480
228 3300006175 Ga0070712_100004535 Ga0070712_1000045356 480
229 3300009147 Ga0114129_10031529 Ga0114129_100315293 480
230 3300025915 Ga0207693_10008167 Ga0207693_100081676 480
231 3300026078 Ga0207702_10104421 Ga0207702_101044212 480
232 3300031251 Ga0265327_10010378 Ga0265327_100103782 480
233 3300031711 Ga0265314_10038560 Ga0265314_100385604 480
234 3300035111 Ga0373923_0007889 Ga0373923_0007889_1150_2655 480
235 3300035116 Ga0373945_0012717 Ga0373945_0012717_579_2060 480
236 3300035170 Ga0373943_0013043 Ga0373943_0013043_1575_3056 480
237 3300035172 Ga0373955_0018679 Ga0373955_0018679_1620_3125 480
238 3300035692 Ga0373935_0062402 Ga0373935_0062402_384_1865 480
239 3300035695 Ga0373927_0068974 Ga0373927_0068974_373_1854 480
240 3300035724 Ga0373933_0054417 Ga0373933_0054417_61_1542 480
241 3300036401 Ga0373937_0002270 Ga0373937_0002270_11359_12864 480
242 3300036401 Ga0373937_0006577 Ga0373937_0006577_3009_4490 480
243 3300037068 Ga0373925_0070825 Ga0373925_0070825_721_2202 480
244 3300037418 Ga0395900_0011990 Ga0395900_0011990_3086_4555 480
245 3300038443 Ga0395901_0000189 Ga0395901_0000189_72204_73709 480
246 3300038443 Ga0395901_0042126 Ga0395901_0042126_2186_3655 480
247 3300039438 Ga0436360_0218419 Ga0436360_0218419_1169_2656 480
248 3300046462 Ga0495651_0043233 Ga0495651_0043233_501_1982 480
249 3300046477 Ga0495664_0005333 Ga0495664_0005333_2372_3853 480
250 3300046516 Ga0495628_0069823 Ga0495628_0069823_981_2462 480
251 3300046543 Ga0495645_0029118 Ga0495645_0029118_971_2452 480
252 3300046663 Ga0495635_0012338 Ga0495635_0012338_562_2043 480
253 3300046678 Ga0495599_0068235 Ga0495599_0068235_646_2127 480
254 3300046680 Ga0495646_0053266 Ga0495646_0053266_619_2100 480
255 3300047317 Ga0495604_0011347 Ga0495604_0011347_3240_4721 480
256 3300048088 Ga0495602_0002276 Ga0495602_0002276_14753_16234 480
257 3300053077 Ga0495601_0004018 Ga0495601_0004018_3223_4704 480
258 3300053078 Ga0495612_0000735 Ga0495612_0000735_1890_3371 480
259 3300053085 Ga0495619_0056118 Ga0495619_0056118_578_2059 480
260 3300002739 JGI25158J39367_1006135 JGI25158J39367_10061351 481
261 3300002987 JGI25159J45721_1000002 JGI25159J45721_1000002208 481
262 3300003354 JGI25160J50197_1000008 JGI25160J50197_1000008208 481
263 3300003374 JGI25161J50226_1000861 JGI25161J50226_10008615 481
264 3300003771 Ga0055526_1000909 Ga0055526_10009096 481
265 3300003781 Ga0055536_1000872 Ga0055536_10008728 481
266 3300003781 Ga0055536_1001764 Ga0055536_10017647 481
267 3300003791 Ga0055530_10010021 Ga0055530_100100212 481
268 3300003794 Ga0055531_10023230 Ga0055531_100232302 481
269 3300004625 Ga0055543_1000040 Ga0055543_100004068 481
270 3300005262 Ga0065165_1000015 Ga0065165_1000015209 481
271 3300005563 Ga0068855_100024634 Ga0068855_1000246344 481
272 3300013249 Ga0171463_1001 Ga0171463_1001198 481
273 3300015684 Ga0183365_10002 Ga0183365_10002429 481
274 3300015690 Ga0183363_1245 Ga0183363_12455 481
275 3300025208 Ga0209436_100315 Ga0209436_10031521 481
276 3300025284 Ga0209130_1000007 Ga0209130_100000794 481
277 3300025292 Ga0209676_1000694 Ga0209676_100069413 481
278 3300025295 Ga0209564_1001342 Ga0209564_10013423 481
279 3300025298 Ga0209050_1002469 Ga0209050_10024698 481
280 3300025299 Ga0209256_1002495 Ga0209256_10024953 481
281 3300025302 Ga0207426_1000064 Ga0207426_100006494 481
282 3300025304 Ga0209257_1002541 Ga0209257_100254115 481
283 3300025919 Ga0207657_10028528 Ga0207657_100285282 481
284 3300032004 Ga0307414_10003726 Ga0307414_100037264 481
285 3300037312 Ga0395899_0079867 Ga0395899_0079867_657_2141 481
286 3300037418 Ga0395900_0021260 Ga0395900_0021260_1204_2688 481
287 3300037471 Ga0395905_0019814 Ga0395905_0019814_2219_3703 481
288 3300038443 Ga0395901_0157471 Ga0395901_0157471_813_2297 481
289 3300046557 Ga0495622_0004155 Ga0495622_0004155_2003_3505 481
290 3300048909 Ga0496106_0172238 Ga0496106_0172238_46_1530 481
291 3300048918 Ga0496115_0020453 Ga0496115_0020453_2212_3687 481
292 3300053104 Ga0500556_0000138 Ga0500556_0000138_25224_26717 481
293 3300053108 Ga0500562_000199 Ga0500562_000199_4806_6299 481
294 3300053122 Ga0500608_000295 Ga0500608_000295_9258_10736 481
295 3300053136 Ga0500559_0000227 Ga0500559_0000227_18208_19692 481
296 3300053177 Ga0500636_0099994 Ga0500636_0099994_101_1585 481
297 3300053736 Ga0500599_000031 Ga0500599_000031_1522_3015 481
298 3300003187 JGI25151J46595_10023935 JGI25151J46595_100239352 482
299 3300003215 JGI25153J46596_10000066 JGI25153J46596_1000006678 482
300 3300006846 Ga0075430_100000268 Ga0075430_1000002683 482
301 3300006847 Ga0075431_100001395 Ga0075431_1000013953 482
302 3300006871 Ga0075434_100002125 Ga0075434_10000212512 482
303 3300007788 Ga0099795_10000202 Ga0099795_100002024 482
304 3300009094 Ga0111539_10000528 Ga0111539_1000052845 482
305 3300009147 Ga0114129_10023179 Ga0114129_100231795 482
306 3300025294 Ga0209025_1000580 Ga0209025_10005803 482
307 3300025297 Ga0209758_1000028 Ga0209758_100002852 482
308 3300025913 Ga0207695_10063089 Ga0207695_100630892 482
309 3300027512 Ga0209179_1000972 Ga0209179_10009722 482
310 3300027907 Ga0207428_10000291 Ga0207428_1000029117 482
311 3300028573 Ga0265334_10027094 Ga0265334_100270942 482
312 3300028800 Ga0265338_10011012 Ga0265338_100110125 482
313 3300028800 Ga0265338_10033183 Ga0265338_100331832 482
314 3300028800 Ga0265338_10042414 Ga0265338_100424144 482
315 3300031239 Ga0265328_10000006 Ga0265328_10000006126 482
316 3300031250 Ga0265331_10001272 Ga0265331_100012723 482
317 3300031344 Ga0265316_10001712 Ga0265316_1000171214 482
318 3300031711 Ga0265314_10004556 Ga0265314_1000455610 482
319 3300049571 Ga0501034_0174228 Ga0501034_0174228_359_1849 482
320 3300049573 Ga0501037_0049126 Ga0501037_0049126_1216_2706 482
321 3300049574 Ga0501038_0042423 Ga0501038_0042423_1886_3376 482
322 3300049581 Ga0501047_0002743 Ga0501047_0002743_8744_10234 482
323 3300049583 Ga0501067_0017501 Ga0501067_0017501_338_1828 482
324 3300049584 Ga0501068_0002058 Ga0501068_0002058_1282_2772 482
325 3300049585 Ga0501069_0045687 Ga0501069_0045687_869_2359 482
326 3300049589 Ga0501073_0009648 Ga0501073_0009648_4615_6105 482
327 3300049742 Ga0501080_0005539 Ga0501080_0005539_5839_7329 482
328 3300049742 Ga0501080_0029572 Ga0501080_0029572_1170_2660 482
329 3300050507 nmdc:mga05p37_262_c1 nmdc:mga05p37_262_c1_2122_3624 482
330 3300050508 nmdc:mga09592_870_c1 nmdc:mga09592_870_c1_1716_3218 482
331 3300050509 nmdc:mga0qj67_662_c1 nmdc:mga0qj67_662_c1_1599_3101 482
332 3300050510 nmdc:mga06r32_4844_c1 nmdc:mga06r32_4844_c1_9684_11186 482
333 3300050512 nmdc:mga0n895_106_c1 nmdc:mga0n895_106_c1_2471_3973 482
334 3300050513 nmdc:mga0rr50_1679_c1 nmdc:mga0rr50_1679_c1_6586_8088 482
335 3300050515 nmdc:mga0a205_46815_c1 nmdc:mga0a205_46815_c1_1607_3109 482
336 3300053087 Ga0500643_004111 Ga0500643_004111_1871_3355 482
337 3300053119 Ga0500595_000709 Ga0500595_000709_16158_17651 482
338 3300053130 Ga0500642_0001557 Ga0500642_0001557_1734_3224 482
339 3300053142 Ga0500577_0021075 Ga0500577_0021075_565_2055 482
340 3300054114 Ga0501084_0005391 Ga0501084_0005391_7804_9294 482
341 3300060353 Ga0501082_0022398 Ga0501082_0022398_44_1534 482
342 3300009101 Ga0105247_10012973 Ga0105247_100129733 483
343 3300025298 Ga0209050_1017759 Ga0209050_10177592 483
344 3300025304 Ga0209257_1000707 Ga0209257_100070741 483
345 3300025900 Ga0207710_10008422 Ga0207710_100084222 483
346 3300025986 Ga0207658_10030724 Ga0207658_100307243 483
347 3300031456 Ga0307513_10037455 Ga0307513_100374553 483
348 3300031456 Ga0307513_10090299 Ga0307513_100902991 483
349 3300048913 Ga0496110_0023210 Ga0496110_0023210_97_1623 483
350 3300049823 Ga0501044_0078256 Ga0501044_0078256_226_1725 483
351 3300050491 nmdc:mga00v17_39324_c1 nmdc:mga00v17_39324_c1_614_2110 483
352 3300053153 Ga0500616_0001405 Ga0500616_0001405_17068_18561 483
353 iso_pu_bacteria 2597490356 2599106076 483
354 iso_pu_bacteria 2846952575 2846955870 483
355 iso_pu_bacteria 2848858292 2848862309 483
356 3300005843 Ga0068860_100024484 Ga0068860_1000244847 484
357 3300005844 Ga0068862_100074022 Ga0068862_1000740224 484
358 3300042436 Ga0439435_0002372 Ga0439435_0002372_1207_2709 484
359 3300005341 Ga0070691_10001125 Ga0070691_100011258 485
360 3300005518 Ga0070699_100060009 Ga0070699_1000600093 485
361 3300005539 Ga0068853_100051703 Ga0068853_1000517032 485
362 3300005545 Ga0070695_100015701 Ga0070695_1000157014 485
363 3300005548 Ga0070665_100028079 Ga0070665_1000280793 485
364 3300005577 Ga0068857_100004571 Ga0068857_1000045713 485
365 3300005614 Ga0068856_100031698 Ga0068856_1000316981 485
366 3300005616 Ga0068852_100005650 Ga0068852_1000056504 485
367 3300006163 Ga0070715_10010165 Ga0070715_100101652 485
368 3300009093 Ga0105240_10005135 Ga0105240_1000513517 485
369 3300009093 Ga0105240_10270366 Ga0105240_102703662 485
370 3300009174 Ga0105241_10066532 Ga0105241_100665322 485
371 3300009545 Ga0105237_10003724 Ga0105237_100037244 485
372 3300013100 Ga0157373_10002797 Ga0157373_100027977 485
373 3300013105 Ga0157369_10002343 Ga0157369_100023437 485
374 3300013307 Ga0157372_10016858 Ga0157372_100168585 485
375 3300025913 Ga0207695_10018732 Ga0207695_100187322 485
376 3300025913 Ga0207695_10039231 Ga0207695_100392313 485
377 3300025914 Ga0207671_10017806 Ga0207671_100178064 485
378 3300026078 Ga0207702_10008671 Ga0207702_100086714 485
379 3300026116 Ga0207674_10000450 Ga0207674_1000045011 485
380 3300026142 Ga0207698_10024345 Ga0207698_100243454 485
381 3300031712 Ga0265342_10008991 Ga0265342_100089914 485
382 3300053119 Ga0500595_009318 Ga0500595_009318_467_1960 485
383 3300053146 Ga0500588_0011898 Ga0500588_0011898_591_2084 485
384 iso_pu_bacteria 2738541281 2738743920 485
385 iso_pu_bacteria 2738543032 2739353150 485
386 iso_pu_bacteria 2837651117 2837652608 485
387 iso_pu_bacteria 2837678835 2837681206 485
388 iso_pu_bacteria 2842698319 2842699226 485
389 3300005468 Ga0070707_100022272 Ga0070707_1000222725 486
390 3300009093 Ga0105240_10110381 Ga0105240_101103812 486
391 3300009551 Ga0105238_10177098 Ga0105238_101770981 486
392 3300021377 Ga0213874_10000714 Ga0213874_100007143 486
393 3300025913 Ga0207695_10131834 Ga0207695_101318343 486
394 3300025922 Ga0207646_10013891 Ga0207646_100138914 486
395 3300025924 Ga0207694_10003938 Ga0207694_1000393810 486
396 3300028800 Ga0265338_10133730 Ga0265338_101337302 486
397 3300031247 Ga0265340_10048393 Ga0265340_100483931 486
398 3300031249 Ga0265339_10010922 Ga0265339_100109224 486
399 3300031595 Ga0265313_10034537 Ga0265313_100345372 486
400 3300036401 Ga0373937_0044879 Ga0373937_0044879_1492_2994 486
401 3300036401 Ga0373937_0144278 Ga0373937_0144278_285_1787 486
402 3300037312 Ga0395899_0044238 Ga0395899_0044238_1591_3087 486
403 3300039437 Ga0436365_0500347 Ga0436365_0500347_1602_3086 486
404 3300039447 Ga0436361_0423103 Ga0436361_0423103_5418_6911 486
405 3300039450 Ga0436363_1330926 Ga0436363_1330926_3132_4616 486
406 3300039453 Ga0436362_0207695 Ga0436362_0207695_1741_3225 486
407 3300046511 Ga0495608_0028033 Ga0495608_0028033_1075_2544 486
408 iso_pu_bacteria 8045864390 8045865887 486
409 3300005347 Ga0070668_100015941 Ga0070668_1000159411 487
410 3300005546 Ga0070696_100019297 Ga0070696_1000192974 487
411 3300006177 Ga0075362_10001053 Ga0075362_100010536 487
412 3300006914 Ga0075436_100058598 Ga0075436_1000585982 487
413 3300009551 Ga0105238_10099033 Ga0105238_100990332 487
414 3300025924 Ga0207694_10049049 Ga0207694_100490493 487
415 3300025961 Ga0207712_10002611 Ga0207712_100026114 487
416 3300028800 Ga0265338_10127284 Ga0265338_101272841 487
417 3300031251 Ga0265327_10000297 Ga0265327_1000029776 487
418 3300031595 Ga0265313_10002260 Ga0265313_100022607 487
419 3300031711 Ga0265314_10033764 Ga0265314_100337642 487
420 3300031712 Ga0265342_10012735 Ga0265342_100127354 487
421 3300035118 Ga0373954_0038891 Ga0373954_0038891_287_1783 487
422 3300037418 Ga0395900_0071113 Ga0395900_0071113_501_2033 487
423 3300037466 Ga0395898_0108109 Ga0395898_0108109_1116_2648 487
424 3300048907 Ga0496104_0014192 Ga0496104_0014192_5613_7136 487
425 3300048908 Ga0496105_0000279 Ga0496105_0000279_19268_20791 487
426 3300048914 Ga0496111_0044749 Ga0496111_0044749_1539_3062 487
427 3300048915 Ga0496112_0004977 Ga0496112_0004977_403_1926 487
428 3300048916 Ga0496113_0000565 Ga0496113_0000565_11338_12861 487
429 3300048928 Ga0496125_0127559 Ga0496125_0127559_18_1541 487
430 3300049568 Ga0501031_0042469 Ga0501031_0042469_668_2152 487
431 3300049571 Ga0501034_0000244 Ga0501034_0000244_34220_35716 487
432 3300049573 Ga0501037_0071363 Ga0501037_0071363_149_1645 487
433 3300049573 Ga0501037_0074822 Ga0501037_0074822_275_1759 487
434 3300049573 Ga0501037_0083403 Ga0501037_0083403_61_1557 487
435 3300049579 Ga0501043_0105928 Ga0501043_0105928_577_2061 487
436 3300049580 Ga0501046_0023967 Ga0501046_0023967_281_1765 487
437 3300049581 Ga0501047_0137524 Ga0501047_0137524_232_1764 487
438 3300049585 Ga0501069_0040811 Ga0501069_0040811_41_1537 487
439 3300049586 Ga0501070_0000185 Ga0501070_0000185_12463_13959 487
440 3300049587 Ga0501071_0118153 Ga0501071_0118153_292_1797 487
441 3300049593 Ga0501077_0102922 Ga0501077_0102922_79_1581 487
442 3300049742 Ga0501080_0000329 Ga0501080_0000329_30699_32195 487
443 3300049822 Ga0501035_0000615 Ga0501035_0000615_21782_23278 487
444 3300049822 Ga0501035_0035672 Ga0501035_0035672_1251_2735 487
445 3300049823 Ga0501044_0001173 Ga0501044_0001173_23363_24859 487
446 3300049823 Ga0501044_0032998 Ga0501044_0032998_3550_5034 487
447 3300050489 nmdc:mga03683_855_c1 nmdc:mga03683_855_c1_2379_3857 487
448 3300050514 nmdc:mga08x19_43241_c1 nmdc:mga08x19_43241_c1_552_2054 487
449 3300053078 Ga0495612_0049281 Ga0495612_0049281_104_1603 487
450 3300053084 Ga0495595_0015878 Ga0495595_0015878_1134_2633 487
451 3300053085 Ga0495619_0052442 Ga0495619_0052442_88_1587 487
452 iso_pu_bacteria 2643221618 2644108968 487
453 iso_pu_bacteria 2643221626 2644151490 487
454 iso_pu_bacteria 2643221655 2644311624 487
455 iso_pu_bacteria 2643221659 2644329882 487
456 iso_pu_bacteria 2643221698 2644546556 487
457 iso_pu_bacteria 2643221712 2644617423 487
458 iso_pu_bacteria 2844163670 2844168493 487
459 iso_pu_bacteria 2941499720 2941500192 487
460 3300003215 JGI25153J46596_10000309 JGI25153J46596_100003091 488
461 3300005336 Ga0070680_100001355 Ga0070680_10000135511 488
462 3300005353 Ga0070669_100034061 Ga0070669_1000340613 488
463 3300005439 Ga0070711_100035513 Ga0070711_1000355132 488
464 3300005458 Ga0070681_10000005 Ga0070681_1000000572 488
465 3300005530 Ga0070679_100001521 Ga0070679_1000015219 488
466 3300005844 Ga0068862_100009918 Ga0068862_1000099183 488
467 3300005844 Ga0068862_100011428 Ga0068862_10001142810 488
468 3300005981 Ga0081538_10002230 Ga0081538_1000223011 488
469 3300006237 Ga0097621_100000004 Ga0097621_1000000041 488
470 3300006358 Ga0068871_100000159 Ga0068871_10000015942 488
471 3300006847 Ga0075431_100028692 Ga0075431_1000286923 488
472 3300009093 Ga0105240_10110008 Ga0105240_101100082 488
473 3300009093 Ga0105240_10273700 Ga0105240_102737002 488
474 3300009094 Ga0111539_10003065 Ga0111539_1000306510 488
475 3300009147 Ga0114129_10021902 Ga0114129_100219027 488
476 3300010375 Ga0105239_10007247 Ga0105239_1000724710 488
477 3300025254 Ga0209148_1001405 Ga0209148_100140511 488
478 3300025272 Ga0209455_1001393 Ga0209455_10013936 488
479 3300025292 Ga0209676_1011507 Ga0209676_10115073 488
480 3300025297 Ga0209758_1000005 Ga0209758_1000005748 488
481 3300025298 Ga0209050_1001984 Ga0209050_100198417 488
482 3300025303 Ga0209051_1004942 Ga0209051_10049422 488
483 3300025304 Ga0209257_1000941 Ga0209257_100094110 488
484 3300025912 Ga0207707_10000005 Ga0207707_10000005231 488
485 3300025913 Ga0207695_10015371 Ga0207695_100153713 488
486 3300025913 Ga0207695_10189468 Ga0207695_101894681 488
487 3300025917 Ga0207660_10000540 Ga0207660_1000054011 488
488 3300025921 Ga0207652_10002047 Ga0207652_1000204716 488
489 3300025923 Ga0207681_10052282 Ga0207681_100522822 488
490 3300027907 Ga0207428_10000096 Ga0207428_1000009679 488
491 3300028380 Ga0268265_10001714 Ga0268265_1000171413 488
492 3300028577 Ga0265318_10007145 Ga0265318_100071454 488
493 3300031238 Ga0265332_10017619 Ga0265332_100176195 488
494 3300031247 Ga0265340_10012334 Ga0265340_100123341 488
495 3300031456 Ga0307513_10027203 Ga0307513_100272034 488
496 3300031595 Ga0265313_10017361 Ga0265313_100173614 488
497 3300031730 Ga0307516_10031151 Ga0307516_100311514 488
498 3300031824 Ga0307413_10006096 Ga0307413_100060963 488
499 3300031852 Ga0307410_10010012 Ga0307410_100100124 488
500 3300031903 Ga0307407_10022461 Ga0307407_100224612 488
501 3300031995 Ga0307409_100013892 Ga0307409_1000138926 488
502 3300032005 Ga0307411_10036592 Ga0307411_100365923 488
503 3300037853 Ga0436364_0896039 Ga0436364_0896039_80_1633 488
504 3300046460 Ga0495638_0055808 Ga0495638_0055808_694_2193 488
505 3300046477 Ga0495664_0072787 Ga0495664_0072787_424_1923 488
506 3300048907 Ga0496104_0000145 Ga0496104_0000145_55947_57461 488
507 3300048908 Ga0496105_0000761 Ga0496105_0000761_12403_13917 488
508 3300049579 Ga0501043_0024691 Ga0501043_0024691_1389_2957 488
509 3300049580 Ga0501046_0067660 Ga0501046_0067660_778_2316 488
510 3300049581 Ga0501047_0098414 Ga0501047_0098414_753_2252 488
511 3300049581 Ga0501047_0136727 Ga0501047_0136727_285_1784 488
512 3300049584 Ga0501068_0022913 Ga0501068_0022913_1406_2944 488
513 3300049585 Ga0501069_0019258 Ga0501069_0019258_47_1585 488
514 3300049586 Ga0501070_0089650 Ga0501070_0089650_949_2448 488
515 3300049588 Ga0501072_0091246 Ga0501072_0091246_401_1939 488
516 3300049589 Ga0501073_0066610 Ga0501073_0066610_480_2048 488
517 3300049742 Ga0501080_0011215 Ga0501080_0011215_5395_6933 488
518 3300049744 Ga0501083_0011666 Ga0501083_0011666_3487_5025 488
519 3300049822 Ga0501035_0056946 Ga0501035_0056946_1906_3405 488
520 3300049823 Ga0501044_0003192 Ga0501044_0003192_15059_16597 488
521 3300049823 Ga0501044_0021386 Ga0501044_0021386_3108_4676 488
522 3300049823 Ga0501044_0078057 Ga0501044_0078057_1181_2680 488
523 3300050507 nmdc:mga05p37_69110_c1 nmdc:mga05p37_69110_c1_2481_3968 488
524 3300050510 nmdc:mga06r32_8735_c1 nmdc:mga06r32_8735_c1_6232_7719 488
525 3300050511 nmdc:mga08y16_419_c1 nmdc:mga08y16_419_c1_22039_23541 488
526 3300050511 nmdc:mga08y16_98740_c1 nmdc:mga08y16_98740_c1_353_1849 488
527 3300053096 Ga0500641_0002459 Ga0500641_0002459_4381_5880 488
528 3300053103 Ga0500555_003351 Ga0500555_003351_1001_2560 488
529 3300053134 Ga0500658_0003055 Ga0500658_0003055_4765_6264 488
530 3300053146 Ga0500588_0001370 Ga0500588_0001370_859_2358 488
531 3300053151 Ga0500604_0001027 Ga0500604_0001027_4879_6462 488
532 3300053153 Ga0500616_0000815 Ga0500616_0000815_4992_6548 488
533 3300053731 Ga0500609_000409 Ga0500609_000409_2153_3652 488
534 3300060353 Ga0501082_0009819 Ga0501082_0009819_6077_7615 488
535 3300060353 Ga0501082_0168060 Ga0501082_0168060_160_1659 488
536 iso_pu_bacteria 2508501122 2509108541 488
537 iso_pu_bacteria 2509276019 2509374432 488
538 iso_pu_bacteria 2512047086 2512532451 488
539 iso_pu_bacteria 2545555834 2545674903 488
540 iso_pu_bacteria 2558860100 2558863459 488
541 iso_pu_bacteria 2643221723 2644675626 488
542 iso_pu_bacteria 2657244999 2657683238 488
543 iso_pu_bacteria 2791355082 2792584189 488
544 iso_pu_bacteria 2791355091 2792622660 488
545 iso_pu_bacteria 2791355092 2792628419 488
546 iso_pu_bacteria 2802429268 2804751373 488
547 iso_pu_bacteria 2829745981 2829746311 488
548 iso_pu_bacteria 2850079185 2850080502 488
549 iso_pu_bacteria 2861691609 2861695204 488
550 iso_pu_bacteria 2913295892 2913297419 488
551 iso_pu_bacteria 2920822456 2920823867 488
552 iso_pu_bacteria 641522639 641645232 488
553 iso_pu_bacteria 643348564 643603453 488
554 iso_pu_bacteria 643692032 643825109 488
555 iso_pu_bacteria 8005658619 8005659954 488
556 iso_pu_bacteria 8049293176 8049293947 488
557 iso_pu_bacteria 8054563764 8054567686 488
558 3300005339 Ga0070660_100003495 Ga0070660_1000034953 489
559 3300005340 Ga0070689_100056156 Ga0070689_1000561562 489
560 3300005366 Ga0070659_100129549 Ga0070659_1001295492 489
561 3300005466 Ga0070685_10034302 Ga0070685_100343021 489
562 3300005546 Ga0070696_100021452 Ga0070696_1000214523 489
563 3300005548 Ga0070665_100003577 Ga0070665_1000035774 489
564 3300005548 Ga0070665_100235267 Ga0070665_1002352671 489
565 3300005563 Ga0068855_100067239 Ga0068855_1000672393 489
566 3300005564 Ga0070664_100121220 Ga0070664_1001212202 489
567 3300006178 Ga0075367_10031616 Ga0075367_100316162 489
568 3300006844 Ga0075428_100182242 Ga0075428_1001822422 489
569 3300006846 Ga0075430_100018540 Ga0075430_1000185402 489
570 3300009094 Ga0111539_10196411 Ga0111539_101964112 489
571 3300009545 Ga0105237_10001366 Ga0105237_1000136614 489
572 3300010375 Ga0105239_10006723 Ga0105239_1000672311 489
573 3300025909 Ga0207705_10011631 Ga0207705_100116315 489
574 3300025912 Ga0207707_10013091 Ga0207707_100130914 489
575 3300025914 Ga0207671_10000215 Ga0207671_1000021515 489
576 3300025918 Ga0207662_10004991 Ga0207662_100049914 489
577 3300025919 Ga0207657_10002651 Ga0207657_1000265115 489
578 3300025945 Ga0207679_10119917 Ga0207679_101199171 489
579 3300025949 Ga0207667_10011707 Ga0207667_100117078 489
580 3300027907 Ga0207428_10149949 Ga0207428_101499491 489
581 3300028379 Ga0268266_10000255 Ga0268266_1000025551 489
582 3300028577 Ga0265318_10000659 Ga0265318_1000065921 489
583 3300031235 Ga0265330_10030262 Ga0265330_100302622 489
584 3300031247 Ga0265340_10004212 Ga0265340_100042123 489
585 3300031711 Ga0265314_10000590 Ga0265314_1000059016 489
586 3300031711 Ga0265314_10034264 Ga0265314_100342643 489
587 3300031712 Ga0265342_10017183 Ga0265342_100171833 489
588 3300031727 Ga0316576_10126773 Ga0316576_101267732 489
589 3300041408 Ga0439453_0000317 Ga0439453_0000317_2434_3930 489
590 3300049581 Ga0501047_0214026 Ga0501047_0214026_104_1582 489
591 3300049583 Ga0501067_0015634 Ga0501067_0015634_454_2058 489
592 3300050509 nmdc:mga0qj67_8287_c1 nmdc:mga0qj67_8287_c1_4728_6224 489
593 3300050510 nmdc:mga06r32_116209_c1 nmdc:mga06r32_116209_c1_23_1519 489
594 3300050511 nmdc:mga08y16_58119_c1 nmdc:mga08y16_58119_c1_558_2042 489
595 3300050512 nmdc:mga0n895_80225_c1 nmdc:mga0n895_80225_c1_1018_2514 489
596 3300050513 nmdc:mga0rr50_62011_c1 nmdc:mga0rr50_62011_c1_927_2423 489
597 iso_pu_bacteria 2889306138 2889307222 489
598 iso_pu_bacteria 2889790730 2889794267 489
599 iso_pu_bacteria 2889914905 2889916774 489
600 3300005327 Ga0070658_10014122 Ga0070658_100141223 490
601 3300005327 Ga0070658_10016709 Ga0070658_100167093 490
602 3300005434 Ga0070709_10000210 Ga0070709_100002103 490
603 3300005435 Ga0070714_100012995 Ga0070714_1000129954 490
604 3300005436 Ga0070713_100000003 Ga0070713_100000003183 490
605 3300005436 Ga0070713_100112481 Ga0070713_1001124811 490
606 3300005439 Ga0070711_100011325 Ga0070711_1000113253 490
607 3300005456 Ga0070678_100083485 Ga0070678_1000834852 490
608 3300005458 Ga0070681_10067938 Ga0070681_100679381 490
609 3300005459 Ga0068867_100015860 Ga0068867_1000158606 490
610 3300005530 Ga0070679_100063748 Ga0070679_1000637483 490
611 3300005548 Ga0070665_100002027 Ga0070665_1000020273 490
612 3300005548 Ga0070665_100028055 Ga0070665_1000280552 490
613 3300005548 Ga0070665_100207570 Ga0070665_1002075702 490
614 3300005563 Ga0068855_100257362 Ga0068855_1002573622 490
615 3300005614 Ga0068856_100001453 Ga0068856_10000145314 490
616 3300005841 Ga0068863_100054264 Ga0068863_1000542643 490
617 3300005842 Ga0068858_100071922 Ga0068858_1000719222 490
618 3300005843 Ga0068860_100140410 Ga0068860_1001404102 490
619 3300005844 Ga0068862_100074118 Ga0068862_1000741182 490
620 3300005937 Ga0081455_10033799 Ga0081455_100337993 490
621 3300006175 Ga0070712_100000031 Ga0070712_1000000314 490
622 3300006175 Ga0070712_100000220 Ga0070712_10000022027 490
623 3300006358 Ga0068871_100026008 Ga0068871_1000260081 490
624 3300006358 Ga0068871_100094587 Ga0068871_1000945873 490
625 3300006871 Ga0075434_100133804 Ga0075434_1001338043 490
626 3300006914 Ga0075436_100000113 Ga0075436_10000011334 490
627 3300007076 Ga0075435_100007213 Ga0075435_1000072134 490
628 3300007076 Ga0075435_100140822 Ga0075435_1001408222 490
629 3300009176 Ga0105242_10023064 Ga0105242_100230646 490
630 3300009176 Ga0105242_10058803 Ga0105242_100588034 490
631 3300009177 Ga0105248_10019512 Ga0105248_100195124 490
632 3300009545 Ga0105237_10070300 Ga0105237_100703002 490
633 3300009551 Ga0105238_10065759 Ga0105238_100657592 490
634 3300009551 Ga0105238_10067309 Ga0105238_100673092 490
635 3300010159 Ga0099796_10000611 Ga0099796_100006114 490
636 3300010375 Ga0105239_10203353 Ga0105239_102033533 490
637 3300011119 Ga0105246_10004807 Ga0105246_100048076 490
638 3300013104 Ga0157370_10020556 Ga0157370_100205566 490
639 3300013308 Ga0157375_10035954 Ga0157375_100359546 490
640 3300014325 Ga0163163_10171418 Ga0163163_101714181 490
641 3300025906 Ga0207699_10000159 Ga0207699_1000015914 490
642 3300025909 Ga0207705_10019293 Ga0207705_100192935 490
643 3300025911 Ga0207654_10002187 Ga0207654_100021877 490
644 3300025915 Ga0207693_10000336 Ga0207693_1000033639 490
645 3300025915 Ga0207693_10001817 Ga0207693_1000181713 490
646 3300025916 Ga0207663_10037951 Ga0207663_100379512 490
647 3300025916 Ga0207663_10061304 Ga0207663_100613042 490
648 3300025916 Ga0207663_10138121 Ga0207663_101381212 490
649 3300025919 Ga0207657_10070939 Ga0207657_100709391 490
650 3300025921 Ga0207652_10049274 Ga0207652_100492744 490
651 3300025928 Ga0207700_10000010 Ga0207700_10000010155 490
652 3300025929 Ga0207664_10007747 Ga0207664_100077473 490
653 3300025934 Ga0207686_10007716 Ga0207686_100077165 490
654 3300025938 Ga0207704_10020825 Ga0207704_100208253 490
655 3300025941 Ga0207711_10004603 Ga0207711_100046039 490
656 3300025942 Ga0207689_10022240 Ga0207689_100222404 490
657 3300025949 Ga0207667_10047626 Ga0207667_100476264 490
658 3300025949 Ga0207667_10117456 Ga0207667_101174561 490
659 3300026078 Ga0207702_10000013 Ga0207702_10000013132 490
660 3300026088 Ga0207641_10149624 Ga0207641_101496242 490
661 3300026089 Ga0207648_10009365 Ga0207648_100093653 490
662 3300026121 Ga0207683_10039303 Ga0207683_100393032 490
663 3300028379 Ga0268266_10029389 Ga0268266_100293893 490
664 3300028379 Ga0268266_10029914 Ga0268266_100299143 490
665 3300028379 Ga0268266_10043108 Ga0268266_100431083 490
666 3300028379 Ga0268266_10067420 Ga0268266_100674201 490
667 3300028381 Ga0268264_10118411 Ga0268264_101184112 490
668 3300028800 Ga0265338_10011268 Ga0265338_1001126810 490
669 3300031241 Ga0265325_10000539 Ga0265325_1000053923 490
670 3300031241 Ga0265325_10001516 Ga0265325_1000151612 490
671 3300031241 Ga0265325_10011331 Ga0265325_100113312 490
672 3300031249 Ga0265339_10008171 Ga0265339_100081713 490
673 3300031250 Ga0265331_10049555 Ga0265331_100495552 490
674 3300031344 Ga0265316_10008166 Ga0265316_100081663 490
675 3300031595 Ga0265313_10003078 Ga0265313_100030786 490
676 3300031595 Ga0265313_10004082 Ga0265313_100040823 490
677 3300031595 Ga0265313_10005415 Ga0265313_100054152 490
678 3300031711 Ga0265314_10043256 Ga0265314_100432562 490
679 3300031711 Ga0265314_10105063 Ga0265314_101050632 490
680 3300032004 Ga0307414_10101421 Ga0307414_101014212 490
681 3300035691 Ga0373931_0013847 Ga0373931_0013847_2165_3667 490
682 3300035695 Ga0373927_0043384 Ga0373927_0043384_1008_2510 490
683 3300036401 Ga0373937_0003552 Ga0373937_0003552_2963_4465 490
684 3300036401 Ga0373937_0022446 Ga0373937_0022446_684_2186 490
685 3300037068 Ga0373925_0019501 Ga0373925_0019501_2062_3564 490
686 3300037418 Ga0395900_0035244 Ga0395900_0035244_1168_2667 490
687 3300039437 Ga0436365_0432451 Ga0436365_0432451_5752_7251 490
688 3300039437 Ga0436365_1135929 Ga0436365_1135929_25_1527 490
689 3300039438 Ga0436360_0525877 Ga0436360_0525877_454_1962 490
690 3300046679 Ga0495623_0050787 Ga0495623_0050787_702_2204 490
691 3300048924 Ga0496121_0001112 Ga0496121_0001112_17582_19081 490
692 3300049570 Ga0501033_0008338 Ga0501033_0008338_4848_6344 490
693 3300049570 Ga0501033_0008803 Ga0501033_0008803_6173_7675 490
694 3300049572 Ga0501036_0021718 Ga0501036_0021718_3605_5101 490
695 3300049579 Ga0501043_0014308 Ga0501043_0014308_3949_5445 490
696 3300049581 Ga0501047_0001813 Ga0501047_0001813_16610_18106 490
697 3300049581 Ga0501047_0018501 Ga0501047_0018501_2187_3689 490
698 3300049586 Ga0501070_0114355 Ga0501070_0114355_364_1866 490
699 3300049589 Ga0501073_0066403 Ga0501073_0066403_296_1795 490
700 3300049822 Ga0501035_0008955 Ga0501035_0008955_5851_7353 490
701 3300049822 Ga0501035_0055825 Ga0501035_0055825_1809_3305 490
702 3300049823 Ga0501044_0010413 Ga0501044_0010413_3105_4601 490
703 3300049823 Ga0501044_0026573 Ga0501044_0026573_1229_2731 490
704 3300050512 nmdc:mga0n895_166505_c1 nmdc:mga0n895_166505_c1_597_2099 490
705 3300050513 nmdc:mga0rr50_2926_c1 nmdc:mga0rr50_2926_c1_6443_7945 490
706 3300050513 nmdc:mga0rr50_6359_c1 nmdc:mga0rr50_6359_c1_4568_6070 490
707 3300050514 nmdc:mga08x19_140_c1 nmdc:mga08x19_140_c1_58047_59549 490
708 iso_pu_bacteria 2595698237 2596371639 490
709 iso_pu_bacteria 2671180139 2671692759 490
710 iso_pu_bacteria 2738543031 2739347349 490
711 iso_pu_bacteria 2902330777 2902336806 490
712 iso_pu_bacteria 2902405164 2902411067 490
713 iso_pu_bacteria 2928125067 2928127896 490
714 iso_pu_bacteria 3003665799 3003670402 490
715 3300005327 Ga0070658_10003518 Ga0070658_1000351811 491
716 3300005336 Ga0070680_100016186 Ga0070680_1000161861 491
717 3300005339 Ga0070660_100016673 Ga0070660_1000166732 491
718 3300005530 Ga0070679_100057286 Ga0070679_1000572864 491
719 3300005563 Ga0068855_100039579 Ga0068855_1000395792 491
720 3300025909 Ga0207705_10006490 Ga0207705_100064906 491
721 3300025912 Ga0207707_10051060 Ga0207707_100510603 491
722 3300025919 Ga0207657_10019404 Ga0207657_100194042 491
723 3300025921 Ga0207652_10005589 Ga0207652_100055894 491
724 3300031595 Ga0265313_10030716 Ga0265313_100307162 491
725 3300031616 Ga0307508_10155818 Ga0307508_101558181 491
726 3300031711 Ga0265314_10030040 Ga0265314_100300404 491
727 3300031712 Ga0265342_10001412 Ga0265342_1000141215 491
728 3300049581 Ga0501047_0049762 Ga0501047_0049762_356_1858 491
729 3300053077 Ga0495601_0098529 Ga0495601_0098529_208_1710 491
730 iso_pu_bacteria 2643221733 2644728710 491
731 iso_pu_bacteria 2643221736 2644747214 491
732 iso_pu_bacteria 2841760612 2841762049 491
733 iso_pu_bacteria 2844104063 2844105074 491
734 iso_pu_bacteria 2851246043 2851248062 491
735 iso_pu_bacteria 2917554339 2917556811 491
736 iso_pu_bacteria 2919450847 2919452097 491
737 3300006186 Ga0075369_10016402 Ga0075369_100164022 492
738 3300006946 Ga0079104_1006936 Ga0079104_10069363 492
739 3300021320 Ga0214544_1000017 Ga0214544_1000017163 492
740 3300021321 Ga0214542_1000006 Ga0214542_100000667 492
741 3300021321 Ga0214542_1015154 Ga0214542_10151545 492
742 3300021327 Ga0214543_1000003 Ga0214543_1000003503 492
743 3300021327 Ga0214543_1000014 Ga0214543_1000014256 492
744 3300028577 Ga0265318_10010340 Ga0265318_100103402 492
745 3300031344 Ga0265316_10029603 Ga0265316_100296034 492
746 3300031595 Ga0265313_10013202 Ga0265313_100132025 492
747 3300031595 Ga0265313_10019249 Ga0265313_100192492 492
748 3300031711 Ga0265314_10015685 Ga0265314_100156852 492
749 3300031712 Ga0265342_10012431 Ga0265342_100124312 492
750 3300031995 Ga0307409_100035374 Ga0307409_1000353743 492
751 3300049743 Ga0501081_0118450 Ga0501081_0118450_152_1654 492
752 iso_pu_bacteria 2643221547 2643756629 492
753 iso_pu_bacteria 2828305725 2828306586 492
754 iso_pu_bacteria 8001845381 8001849818 492
755 3300049568 Ga0501031_0038950 Ga0501031_0038950_1489_3066 493
756 3300049575 Ga0501039_0034987 Ga0501039_0034987_176_1696 493
757 3300049576 Ga0501040_0012936 Ga0501040_0012936_3622_5199 493
758 3300049577 Ga0501041_0060785 Ga0501041_0060785_91_1668 493
759 3300049578 Ga0501042_0048519 Ga0501042_0048519_1000_2577 493
760 3300049579 Ga0501043_0035930 Ga0501043_0035930_990_2480 493
761 3300049580 Ga0501046_0047105 Ga0501046_0047105_1382_2917 493
762 3300049582 Ga0501048_0091956 Ga0501048_0091956_138_1673 493
763 3300049585 Ga0501069_0015025 Ga0501069_0015025_159_1649 493
764 3300049586 Ga0501070_0060609 Ga0501070_0060609_647_2137 493
765 3300049588 Ga0501072_0072536 Ga0501072_0072536_943_2520 493
766 3300049590 Ga0501074_0069547 Ga0501074_0069547_43_1533 493
767 3300049591 Ga0501075_0014665 Ga0501075_0014665_384_1961 493
768 3300049592 Ga0501076_0016577 Ga0501076_0016577_1421_2998 493
769 3300049593 Ga0501077_0003973 Ga0501077_0003973_2160_3737 493
770 3300049741 Ga0501079_0005097 Ga0501079_0005097_5117_6694 493
771 3300049741 Ga0501079_0053143 Ga0501079_0053143_1082_2572 493
772 3300049742 Ga0501080_0065077 Ga0501080_0065077_1120_2610 493
773 3300049742 Ga0501080_0182097 Ga0501080_0182097_338_1918 493
774 3300049743 Ga0501081_0009650 Ga0501081_0009650_2879_4456 493
775 3300049743 Ga0501081_0038528 Ga0501081_0038528_1254_2774 493
776 3300049824 Ga0501045_0006937 Ga0501045_0006937_1761_3338 493
777 3300054114 Ga0501084_0000916 Ga0501084_0000916_10481_12058 493
778 3300060353 Ga0501082_0011751 Ga0501082_0011751_626_2203 493
779 3300061734 Ga0530510_0006270 Ga0530510_0006270_4863_6440 493
780 iso_pu_bacteria 2513237087 2513590194 493
781 iso_pu_bacteria 2513237098 2513675917 493
782 iso_pu_bacteria 2524023210 2524470630 493
783 iso_pu_bacteria 2841957949 2841958769 493
784 iso_pu_bacteria 2903768456 2903776473 493
785 iso_pu_bacteria 8006926726 8006927114 493
786 3300005339 Ga0070660_100183541 Ga0070660_1001835411 494
787 3300005366 Ga0070659_100047637 Ga0070659_1000476373 494
788 3300005536 Ga0070697_100001312 Ga0070697_10000131218 494
789 3300005539 Ga0068853_100043409 Ga0068853_1000434092 494
790 3300005546 Ga0070696_100007901 Ga0070696_1000079012 494
791 3300005547 Ga0070693_100011568 Ga0070693_1000115682 494
792 3300005549 Ga0070704_100052525 Ga0070704_1000525252 494
793 3300005564 Ga0070664_100020724 Ga0070664_1000207243 494
794 3300005577 Ga0068857_100088063 Ga0068857_1000880632 494
795 3300005614 Ga0068856_100197198 Ga0068856_1001971981 494
796 3300005937 Ga0081455_10000078 Ga0081455_1000007814 494
797 3300006914 Ga0075436_100000880 Ga0075436_10000088018 494
798 3300009551 Ga0105238_10078427 Ga0105238_100784272 494
799 3300025917 Ga0207660_10026557 Ga0207660_100265574 494
800 3300025919 Ga0207657_10047840 Ga0207657_100478403 494
801 3300026067 Ga0207678_10000767 Ga0207678_1000076723 494
802 3300026116 Ga0207674_10054132 Ga0207674_100541322 494
803 3300031247 Ga0265340_10017734 Ga0265340_100177341 494
804 3300031249 Ga0265339_10000668 Ga0265339_100006684 494
805 3300031344 Ga0265316_10024421 Ga0265316_100244212 494
806 3300031595 Ga0265313_10002513 Ga0265313_1000251311 494
807 3300031712 Ga0265342_10004138 Ga0265342_100041385 494
808 3300048905 Ga0496102_0025652 Ga0496102_0025652_3652_5184 494
809 3300048906 Ga0496103_0028250 Ga0496103_0028250_1841_3373 494
810 3300048909 Ga0496106_0025043 Ga0496106_0025043_2532_4064 494
811 3300048910 Ga0496107_0011235 Ga0496107_0011235_4012_5544 494
812 3300049571 Ga0501034_0000033 Ga0501034_0000033_163697_165229 494
813 3300049571 Ga0501034_0033151 Ga0501034_0033151_557_2086 494
814 3300049573 Ga0501037_0004103 Ga0501037_0004103_2399_3931 494
815 3300049574 Ga0501038_0020793 Ga0501038_0020793_4214_5746 494
816 3300049575 Ga0501039_0007173 Ga0501039_0007173_3436_4968 494
817 3300049580 Ga0501046_0001603 Ga0501046_0001603_20003_21535 494
818 3300049580 Ga0501046_0027552 Ga0501046_0027552_3027_4556 494
819 3300049581 Ga0501047_0000135 Ga0501047_0000135_46800_48332 494
820 3300049583 Ga0501067_0007201 Ga0501067_0007201_4580_6112 494
821 3300049583 Ga0501067_0016854 Ga0501067_0016854_188_1717 494
822 3300049586 Ga0501070_0034812 Ga0501070_0034812_1991_3523 494
823 3300049589 Ga0501073_0013878 Ga0501073_0013878_2829_4361 494
824 3300049589 Ga0501073_0041811 Ga0501073_0041811_89_1579 494
825 3300049742 Ga0501080_0000002 Ga0501080_0000002_146490_148022 494
826 3300049743 Ga0501081_0083565 Ga0501081_0083565_121_1734 494
827 3300049822 Ga0501035_0000089 Ga0501035_0000089_11118_12650 494
828 3300049823 Ga0501044_0000019 Ga0501044_0000019_163692_165224 494
829 3300050514 nmdc:mga08x19_4_c2 nmdc:mga08x19_4_c2_104874_106373 494
830 iso_pu_bacteria 2523231067 2523469162 494
831 3300005262 Ga0065165_1000072 Ga0065165_100007233 495
832 3300005434 Ga0070709_10089141 Ga0070709_100891412 495
833 3300005981 Ga0081538_10001364 Ga0081538_1000136421 495
834 3300006173 Ga0070716_100024679 Ga0070716_1000246793 495
835 3300021388 Ga0213875_10000007 Ga0213875_10000007325 495
836 3300025294 Ga0209025_1008833 Ga0209025_10088334 495
837 3300025898 Ga0207692_10027262 Ga0207692_100272622 495
838 3300025939 Ga0207665_10038662 Ga0207665_100386621 495
839 3300037853 Ga0436364_0890378 Ga0436364_0890378_9212_10702 495
840 3300039437 Ga0436365_0179164 Ga0436365_0179164_3428_4918 495
841 3300048907 Ga0496104_0053997 Ga0496104_0053997_296_1819 495
842 3300048910 Ga0496107_0026605 Ga0496107_0026605_1805_3295 495
843 3300048917 Ga0496114_0020234 Ga0496114_0020234_3004_4527 495
844 3300053117 Ga0500593_000023 Ga0500593_000023_10995_12491 495
845 3300053139 Ga0500568_0000001 Ga0500568_0000001_309632_311128 495
846 3300005336 Ga0070680_100033651 Ga0070680_1000336512 496
847 3300005337 Ga0070682_100001181 Ga0070682_10000118112 496
848 3300005471 Ga0070698_100003224 Ga0070698_10000322411 496
849 3300005530 Ga0070679_100007820 Ga0070679_1000078203 496
850 3300005539 Ga0068853_100001137 Ga0068853_10000113720 496
851 3300005563 Ga0068855_100011757 Ga0068855_1000117574 496
852 3300005614 Ga0068856_100000205 Ga0068856_10000020556 496
853 3300005937 Ga0081455_10003751 Ga0081455_100037516 496
854 3300005981 Ga0081538_10039723 Ga0081538_100397231 496
855 3300006177 Ga0075362_10000210 Ga0075362_1000021012 496
856 3300006195 Ga0075366_10002325 Ga0075366_100023255 496
857 3300006871 Ga0075434_100018136 Ga0075434_1000181362 496
858 3300006871 Ga0075434_100127019 Ga0075434_1001270192 496
859 3300009093 Ga0105240_10044333 Ga0105240_100443332 496
860 3300009098 Ga0105245_10047942 Ga0105245_100479422 496
861 3300009147 Ga0114129_10097121 Ga0114129_100971214 496
862 3300009545 Ga0105237_10045353 Ga0105237_100453533 496
863 3300025910 Ga0207684_10079794 Ga0207684_100797943 496
864 3300025912 Ga0207707_10214911 Ga0207707_102149112 496
865 3300025914 Ga0207671_10047927 Ga0207671_100479273 496
866 3300025925 Ga0207650_10009355 Ga0207650_100093552 496
867 3300025927 Ga0207687_10035235 Ga0207687_100352352 496
868 3300025931 Ga0207644_10002757 Ga0207644_100027573 496
869 3300025949 Ga0207667_10155385 Ga0207667_101553852 496
870 3300026041 Ga0207639_10023458 Ga0207639_100234583 496
871 3300026078 Ga0207702_10000048 Ga0207702_10000048101 496
872 3300035172 Ga0373955_0004165 Ga0373955_0004165_175_1716 496
873 3300035695 Ga0373927_0048228 Ga0373927_0048228_113_1720 496
874 3300036401 Ga0373937_0008265 Ga0373937_0008265_2203_3744 496
875 3300037418 Ga0395900_0055341 Ga0395900_0055341_1900_3393 496
876 3300037466 Ga0395898_0048738 Ga0395898_0048738_1600_3093 496
877 3300039438 Ga0436360_0154205 Ga0436360_0154205_1799_3331 496
878 3300046454 Ga0495592_0047672 Ga0495592_0047672_543_2036 496
879 3300046459 Ga0495629_0007031 Ga0495629_0007031_1286_2827 496
880 3300046459 Ga0495629_0138572 Ga0495629_0138572_13_1620 496
881 3300046463 Ga0495653_0006259 Ga0495653_0006259_5489_7030 496
882 3300046476 Ga0495662_0079237 Ga0495662_0079237_14_1507 496
883 3300046511 Ga0495608_0006648 Ga0495608_0006648_45_1586 496
884 3300046514 Ga0495618_0016873 Ga0495618_0016873_2303_3844 496
885 3300046536 Ga0495587_0033206 Ga0495587_0033206_285_1892 496
886 3300046536 Ga0495587_0064798 Ga0495587_0064798_535_2076 496
887 3300046543 Ga0495645_0102893 Ga0495645_0102893_176_1783 496
888 3300046559 Ga0495667_0021541 Ga0495667_0021541_526_2067 496
889 3300046642 Ga0495634_0034794 Ga0495634_0034794_683_2224 496
890 3300046663 Ga0495635_0010048 Ga0495635_0010048_1341_2882 496
891 3300046680 Ga0495646_0022136 Ga0495646_0022136_962_2503 496
892 3300046680 Ga0495646_0095316 Ga0495646_0095316_112_1605 496
893 3300046809 Ga0495600_0083245 Ga0495600_0083245_24_1565 496
894 3300047315 Ga0495581_0049534 Ga0495581_0049534_367_1908 496
895 3300047317 Ga0495604_0001090 Ga0495604_0001090_6957_8498 496
896 3300047319 Ga0495674_0003125 Ga0495674_0003125_5288_6829 496
897 3300047322 Ga0495680_0000795 Ga0495680_0000795_30078_31619 496
898 3300047444 Ga0495675_0041740 Ga0495675_0041740_1103_2644 496
899 3300047471 Ga0495684_0005001 Ga0495684_0005001_8119_9660 496
900 3300048088 Ga0495602_0111594 Ga0495602_0111594_529_2136 496
901 3300048905 Ga0496102_0025598 Ga0496102_0025598_2738_4231 496
902 3300048912 Ga0496109_0094808 Ga0496109_0094808_1191_2687 496
903 3300048915 Ga0496112_0110588 Ga0496112_0110588_236_1729 496
904 3300048916 Ga0496113_0128690 Ga0496113_0128690_284_1777 496
905 3300049572 Ga0501036_0006231 Ga0501036_0006231_6093_7601 496
906 3300050493 nmdc:mga0k408_27139_c1 nmdc:mga0k408_27139_c1_1641_3134 496
907 3300050512 nmdc:mga0n895_4616_c1 nmdc:mga0n895_4616_c1_8725_10224 496
908 3300053078 Ga0495612_0022397 Ga0495612_0022397_502_2109 496
909 3300053085 Ga0495619_0005759 Ga0495619_0005759_6187_7728 496
910 3300053177 Ga0500636_0029697 Ga0500636_0029697_828_2417 496
911 3300003659 JGI25404J52841_10003269 JGI25404J52841_100032692 497
912 3300005329 Ga0070683_100004375 Ga0070683_1000043755 497
913 3300005329 Ga0070683_100013099 Ga0070683_1000130993 497
914 3300005333 Ga0070677_10014937 Ga0070677_100149372 497
915 3300005336 Ga0070680_100071354 Ga0070680_1000713541 497
916 3300005340 Ga0070689_100030515 Ga0070689_1000305154 497
917 3300005341 Ga0070691_10031055 Ga0070691_100310552 497
918 3300005367 Ga0070667_100158921 Ga0070667_1001589211 497
919 3300005434 Ga0070709_10011597 Ga0070709_100115973 497
920 3300005439 Ga0070711_100000872 Ga0070711_1000008725 497
921 3300005458 Ga0070681_10063213 Ga0070681_100632131 497
922 3300005530 Ga0070679_100017306 Ga0070679_1000173064 497
923 3300005530 Ga0070679_100195667 Ga0070679_1001956671 497
924 3300005535 Ga0070684_100006821 Ga0070684_1000068217 497
925 3300005614 Ga0068856_100127283 Ga0068856_1001272832 497
926 3300005937 Ga0081455_10022362 Ga0081455_100223624 497
927 3300005981 Ga0081538_10025168 Ga0081538_100251682 497
928 3300005983 Ga0081540_1023609 Ga0081540_10236092 497
929 3300006914 Ga0075436_100015033 Ga0075436_1000150333 497
930 3300009093 Ga0105240_10057124 Ga0105240_100571241 497
931 3300009093 Ga0105240_10172507 Ga0105240_101725072 497
932 3300009174 Ga0105241_10131569 Ga0105241_101315692 497
933 3300010159 Ga0099796_10004793 Ga0099796_100047931 497
934 3300013102 Ga0157371_10030412 Ga0157371_100304122 497
935 3300013105 Ga0157369_10005656 Ga0157369_1000565619 497
936 3300013105 Ga0157369_10022638 Ga0157369_100226382 497
937 3300014325 Ga0163163_10087515 Ga0163163_100875153 497
938 3300025912 Ga0207707_10002657 Ga0207707_100026574 497
939 3300025912 Ga0207707_10029809 Ga0207707_100298093 497
940 3300025915 Ga0207693_10025125 Ga0207693_100251253 497
941 3300025916 Ga0207663_10106845 Ga0207663_101068452 497
942 3300025916 Ga0207663_10133618 Ga0207663_101336181 497
943 3300025917 Ga0207660_10028530 Ga0207660_100285302 497
944 3300025921 Ga0207652_10021078 Ga0207652_100210782 497
945 3300025921 Ga0207652_10095581 Ga0207652_100955813 497
946 3300025928 Ga0207700_10086659 Ga0207700_100866591 497
947 3300025944 Ga0207661_10003325 Ga0207661_100033253 497
948 3300025944 Ga0207661_10032624 Ga0207661_100326242 497
949 3300025949 Ga0207667_10087940 Ga0207667_100879402 497
950 3300025981 Ga0207640_10071656 Ga0207640_100716562 497
951 3300026089 Ga0207648_10018230 Ga0207648_100182303 497
952 3300030521 Ga0307511_10019719 Ga0307511_100197192 497
953 3300031247 Ga0265340_10036288 Ga0265340_100362882 497
954 3300031711 Ga0265314_10028273 Ga0265314_100282733 497
955 3300035086 Ga0373934_0005056 Ga0373934_0005056_1314_2816 497
956 3300035111 Ga0373923_0007548 Ga0373923_0007548_1921_3417 497
957 3300035117 Ga0373953_0000324 Ga0373953_0000324_11014_12516 497
958 3300035118 Ga0373954_0000154 Ga0373954_0000154_3231_4733 497
959 3300035119 Ga0373956_0001735 Ga0373956_0001735_5273_6775 497
960 3300035119 Ga0373956_0002730 Ga0373956_0002730_168_1664 497
961 3300035120 Ga0373957_0003031 Ga0373957_0003031_1173_2675 497
962 3300035170 Ga0373943_0011440 Ga0373943_0011440_2098_3594 497
963 3300035170 Ga0373943_0064676 Ga0373943_0064676_57_1553 497
964 3300035171 Ga0373946_0012973 Ga0373946_0012973_1330_2826 497
965 3300035172 Ga0373955_0001215 Ga0373955_0001215_880_2382 497
966 3300035398 Ga0316574_0002185 Ga0316574_0002185_3092_4591 497
967 3300035410 Ga0373924_0004129 Ga0373924_0004129_2470_3972 497
968 3300035724 Ga0373933_0000619 Ga0373933_0000619_8115_9617 497
969 3300035725 Ga0373947_0064241 Ga0373947_0064241_243_1739 497
970 3300036401 Ga0373937_0001690 Ga0373937_0001690_4644_6146 497
971 3300037418 Ga0395900_0179863 Ga0395900_0179863_511_2007 497
972 3300037466 Ga0395898_0068602 Ga0395898_0068602_215_1711 497
973 3300037853 Ga0436364_1546193 Ga0436364_1546193_319_1833 497
974 3300039447 Ga0436361_1075835 Ga0436361_1075835_1688_3184 497
975 3300044842 Ga0466957_0062799 Ga0466957_0062799_307_1821 497
976 3300045976 Ga0466967_0055363 Ga0466967_0055363_1930_3447 497
977 3300046454 Ga0495592_0044543 Ga0495592_0044543_1539_3041 497
978 3300046454 Ga0495592_0098228 Ga0495592_0098228_564_2060 497
979 3300046459 Ga0495629_0001324 Ga0495629_0001324_4953_6455 497
980 3300046459 Ga0495629_0124854 Ga0495629_0124854_30_1526 497
981 3300046462 Ga0495651_0071108 Ga0495651_0071108_870_2372 497
982 3300046463 Ga0495653_0002693 Ga0495653_0002693_5357_6859 497
983 3300046472 Ga0495580_0083765 Ga0495580_0083765_583_2079 497
984 3300046473 Ga0495582_0007412 Ga0495582_0007412_2641_4137 497
985 3300046475 Ga0495639_0002480 Ga0495639_0002480_5101_6597 497
986 3300046477 Ga0495664_0010182 Ga0495664_0010182_553_2049 497
987 3300046511 Ga0495608_0004458 Ga0495608_0004458_2094_3596 497
988 3300046514 Ga0495618_0004066 Ga0495618_0004066_5507_7003 497
989 3300046514 Ga0495618_0014780 Ga0495618_0014780_1973_3475 497
990 3300046516 Ga0495628_0019113 Ga0495628_0019113_2859_4361 497
991 3300046517 Ga0495630_0051922 Ga0495630_0051922_165_1661 497
992 3300046529 Ga0495652_0000858 Ga0495652_0000858_17663_19165 497
993 3300046529 Ga0495652_0127258 Ga0495652_0127258_278_1774 497
994 3300046536 Ga0495587_0002561 Ga0495587_0002561_8550_10052 497
995 3300046543 Ga0495645_0006861 Ga0495645_0006861_1398_2894 497
996 3300046543 Ga0495645_0050050 Ga0495645_0050050_1280_2782 497
997 3300046559 Ga0495667_0001365 Ga0495667_0001365_12449_13951 497
998 3300046642 Ga0495634_0015956 Ga0495634_0015956_736_2238 497
999 3300046642 Ga0495634_0045061 Ga0495634_0045061_100_1596 497
1000 3300046663 Ga0495635_0000644 Ga0495635_0000644_5713_7215 497
1001 3300046663 Ga0495635_0020252 Ga0495635_0020252_2805_4301 497
1002 3300046675 Ga0495657_0018752 Ga0495657_0018752_402_1904 497
1003 3300046678 Ga0495599_0005428 Ga0495599_0005428_5715_7217 497
1004 3300046680 Ga0495646_0063693 Ga0495646_0063693_143_1639 497
1005 3300046681 Ga0495647_0035865 Ga0495647_0035865_129_1625 497
1006 3300046689 Ga0495613_0089257 Ga0495613_0089257_63_1559 497
1007 3300046809 Ga0495600_0000697 Ga0495600_0000697_3651_5153 497
1008 3300047317 Ga0495604_0010041 Ga0495604_0010041_5720_7222 497
1009 3300047319 Ga0495674_0013845 Ga0495674_0013845_6059_7555 497
1010 3300047319 Ga0495674_0079578 Ga0495674_0079578_688_2184 497
1011 3300047322 Ga0495680_0002127 Ga0495680_0002127_10637_12139 497
1012 3300047444 Ga0495675_0001422 Ga0495675_0001422_7297_8799 497
1013 3300047471 Ga0495684_0000380 Ga0495684_0000380_5367_6869 497
1014 3300047673 Ga0495593_0002795 Ga0495593_0002795_3106_4602 497
1015 3300047673 Ga0495593_0006204 Ga0495593_0006204_1281_2783 497
1016 3300048088 Ga0495602_0006702 Ga0495602_0006702_9703_11205 497
1017 3300048907 Ga0496104_0051998 Ga0496104_0051998_2312_3808 497
1018 3300048909 Ga0496106_0000423 Ga0496106_0000423_5895_7397 497
1019 3300048910 Ga0496107_0000569 Ga0496107_0000569_6041_7543 497
1020 3300048912 Ga0496109_0000393 Ga0496109_0000393_12477_13979 497
1021 3300048912 Ga0496109_0049849 Ga0496109_0049849_159_1655 497
1022 3300048913 Ga0496110_0107904 Ga0496110_0107904_33_1529 497
1023 3300048915 Ga0496112_0072920 Ga0496112_0072920_1192_2688 497
1024 3300049568 Ga0501031_0000520 Ga0501031_0000520_15885_17387 497
1025 3300049568 Ga0501031_0006115 Ga0501031_0006115_4765_6267 497
1026 3300049569 Ga0501032_0000479 Ga0501032_0000479_21230_22732 497
1027 3300049569 Ga0501032_0012520 Ga0501032_0012520_3043_4545 497
1028 3300049570 Ga0501033_0000113 Ga0501033_0000113_25504_27006 497
1029 3300049570 Ga0501033_0000662 Ga0501033_0000662_15826_17328 497
1030 3300049571 Ga0501034_0001074 Ga0501034_0001074_17345_18847 497
1031 3300049571 Ga0501034_0077793 Ga0501034_0077793_1170_2672 497
1032 3300049572 Ga0501036_0000566 Ga0501036_0000566_11958_13460 497
1033 3300049572 Ga0501036_0024264 Ga0501036_0024264_1387_2889 497
1034 3300049573 Ga0501037_0000106 Ga0501037_0000106_5676_7178 497
1035 3300049573 Ga0501037_0003298 Ga0501037_0003298_6476_7978 497
1036 3300049573 Ga0501037_0020118 Ga0501037_0020118_1920_3425 497
1037 3300049573 Ga0501037_0090899 Ga0501037_0090899_243_1748 497
1038 3300049574 Ga0501038_0000108 Ga0501038_0000108_52845_54347 497
1039 3300049574 Ga0501038_0006292 Ga0501038_0006292_7254_8759 497
1040 3300049574 Ga0501038_0015033 Ga0501038_0015033_3739_5241 497
1041 3300049574 Ga0501038_0045933 Ga0501038_0045933_301_1806 497
1042 3300049574 Ga0501038_0151196 Ga0501038_0151196_78_1580 497
1043 3300049575 Ga0501039_0004705 Ga0501039_0004705_8168_9670 497
1044 3300049575 Ga0501039_0038447 Ga0501039_0038447_1484_2986 497
1045 3300049575 Ga0501039_0078104 Ga0501039_0078104_769_2274 497
1046 3300049576 Ga0501040_0022463 Ga0501040_0022463_2258_3763 497
1047 3300049579 Ga0501043_0000035 Ga0501043_0000035_75890_77392 497
1048 3300049580 Ga0501046_0000944 Ga0501046_0000944_8137_9639 497
1049 3300049580 Ga0501046_0010243 Ga0501046_0010243_2492_3994 497
1050 3300049580 Ga0501046_0046656 Ga0501046_0046656_429_1934 497
1051 3300049581 Ga0501047_0012009 Ga0501047_0012009_4010_5515 497
1052 3300049581 Ga0501047_0043581 Ga0501047_0043581_530_2032 497
1053 3300049582 Ga0501048_0002513 Ga0501048_0002513_10224_11726 497
1054 3300049582 Ga0501048_0007804 Ga0501048_0007804_3692_5197 497
1055 3300049583 Ga0501067_0000794 Ga0501067_0000794_11344_12846 497
1056 3300049583 Ga0501067_0007267 Ga0501067_0007267_2319_3824 497
1057 3300049584 Ga0501068_0001073 Ga0501068_0001073_2836_4338 497
1058 3300049584 Ga0501068_0017942 Ga0501068_0017942_33_1538 497
1059 3300049585 Ga0501069_0003838 Ga0501069_0003838_5497_6999 497
1060 3300049585 Ga0501069_0038466 Ga0501069_0038466_367_1863 497
1061 3300049586 Ga0501070_0001087 Ga0501070_0001087_12420_13916 497
1062 3300049586 Ga0501070_0010071 Ga0501070_0010071_5731_7236 497
1063 3300049586 Ga0501070_0066808 Ga0501070_0066808_1325_2821 497
1064 3300049588 Ga0501072_0000367 Ga0501072_0000367_30070_31572 497
1065 3300049590 Ga0501074_0001330 Ga0501074_0001330_12792_14294 497
1066 3300049590 Ga0501074_0010361 Ga0501074_0010361_3456_4961 497
1067 3300049590 Ga0501074_0040151 Ga0501074_0040151_290_1786 497
1068 3300049593 Ga0501077_0043243 Ga0501077_0043243_938_2434 497
1069 3300049741 Ga0501079_0007511 Ga0501079_0007511_6073_7575 497
1070 3300049742 Ga0501080_0011341 Ga0501080_0011341_3068_4570 497
1071 3300049742 Ga0501080_0020142 Ga0501080_0020142_1042_2538 497
1072 3300049742 Ga0501080_0061011 Ga0501080_0061011_131_1633 497
1073 3300049742 Ga0501080_0112923 Ga0501080_0112923_33_1538 497
1074 3300049744 Ga0501083_0008168 Ga0501083_0008168_2516_4018 497
1075 3300049822 Ga0501035_0000632 Ga0501035_0000632_17742_19244 497
1076 3300049822 Ga0501035_0003056 Ga0501035_0003056_559_2061 497
1077 3300049822 Ga0501035_0052242 Ga0501035_0052242_1695_3200 497
1078 3300049823 Ga0501044_0000051 Ga0501044_0000051_69774_71276 497
1079 3300049823 Ga0501044_0001984 Ga0501044_0001984_7235_8740 497
1080 3300049823 Ga0501044_0040506 Ga0501044_0040506_1581_3083 497
1081 3300049823 Ga0501044_0078974 Ga0501044_0078974_525_2021 497
1082 3300049823 Ga0501044_0130808 Ga0501044_0130808_953_2458 497
1083 3300049824 Ga0501045_0011179 Ga0501045_0011179_3786_5291 497
1084 3300050511 nmdc:mga08y16_38066_c1 nmdc:mga08y16_38066_c1_1787_3283 497
1085 3300050514 nmdc:mga08x19_11956_c1 nmdc:mga08x19_11956_c1_861_2360 497
1086 3300053077 Ga0495601_0005999 Ga0495601_0005999_2922_4418 497
1087 3300053077 Ga0495601_0026740 Ga0495601_0026740_205_1701 497
1088 3300053078 Ga0495612_0011475 Ga0495612_0011475_41_1537 497
1089 3300053080 Ga0500635_0002116 Ga0500635_0002116_165_1667 497
1090 3300053084 Ga0495595_0001067 Ga0495595_0001067_5155_6657 497
1091 3300053085 Ga0495619_0000355 Ga0495619_0000355_1966_3468 497
1092 3300053094 Ga0500566_0000026 Ga0500566_0000026_40952_42604 497
1093 3300053095 Ga0500640_000375 Ga0500640_000375_627_2279 497
1094 3300053111 Ga0500572_000596 Ga0500572_000596_2537_4189 497
1095 3300053119 Ga0500595_001923 Ga0500595_001923_5715_7217 497
1096 3300053123 Ga0500614_001603 Ga0500614_001603_1562_3214 497
1097 3300053136 Ga0500559_0009631 Ga0500559_0009631_1653_3155 497
1098 3300053148 Ga0500590_057935 Ga0500590_057935_409_1905 497
1099 3300053150 Ga0500603_000327 Ga0500603_000327_5186_6838 497
1100 3300053159 Ga0500630_000530 Ga0500630_000530_11695_13347 497
1101 3300053162 Ga0500638_000051 Ga0500638_000051_22291_23793 497
1102 3300053163 Ga0500639_000673 Ga0500639_000673_93_1745 497
1103 3300053178 Ga0500637_0000122 Ga0500637_0000122_22301_23803 497
1104 3300053735 Ga0500596_000598 Ga0500596_000598_2718_4370 497
1105 3300054114 Ga0501084_0018383 Ga0501084_0018383_2420_3925 497
1106 3300060353 Ga0501082_0000396 Ga0501082_0000396_20603_22105 497
1107 3300060353 Ga0501082_0005893 Ga0501082_0005893_4028_5533 497
1108 3300005435 Ga0070714_100030592 Ga0070714_1000305921 498
1109 3300005458 Ga0070681_10144328 Ga0070681_101443282 498
1110 3300049568 Ga0501031_0010364 Ga0501031_0010364_1904_3403 498
1111 3300049569 Ga0501032_0027725 Ga0501032_0027725_1645_3144 498
1112 3300049569 Ga0501032_0146932 Ga0501032_0146932_13_1512 498
1113 3300049570 Ga0501033_0017498 Ga0501033_0017498_327_1826 498
1114 3300049570 Ga0501033_0042831 Ga0501033_0042831_345_1844 498
1115 3300049571 Ga0501034_0001563 Ga0501034_0001563_12245_13828 498
1116 3300049571 Ga0501034_0026313 Ga0501034_0026313_4005_5504 498
1117 3300049571 Ga0501034_0051280 Ga0501034_0051280_1064_2563 498
1118 3300049571 Ga0501034_0057834 Ga0501034_0057834_1690_3189 498
1119 3300049571 Ga0501034_0109037 Ga0501034_0109037_1242_2741 498
1120 3300049572 Ga0501036_0002138 Ga0501036_0002138_17_1600 498
1121 3300049572 Ga0501036_0017272 Ga0501036_0017272_1557_3056 498
1122 3300049573 Ga0501037_0011567 Ga0501037_0011567_4712_6211 498
1123 3300049573 Ga0501037_0079085 Ga0501037_0079085_189_1772 498
1124 3300049574 Ga0501038_0052471 Ga0501038_0052471_1663_3162 498
1125 3300049575 Ga0501039_0009601 Ga0501039_0009601_5517_7016 498
1126 3300049575 Ga0501039_0034116 Ga0501039_0034116_178_1677 498
1127 3300049579 Ga0501043_0001890 Ga0501043_0001890_14389_15972 498
1128 3300049579 Ga0501043_0015938 Ga0501043_0015938_956_2455 498
1129 3300049579 Ga0501043_0045090 Ga0501043_0045090_718_2217 498
1130 3300049579 Ga0501043_0045828 Ga0501043_0045828_626_2125 498
1131 3300049579 Ga0501043_0049915 Ga0501043_0049915_21_1520 498
1132 3300049580 Ga0501046_0032549 Ga0501046_0032549_2388_3971 498
1133 3300049581 Ga0501047_0000010 Ga0501047_0000010_327341_328924 498
1134 3300049581 Ga0501047_0014636 Ga0501047_0014636_5494_6993 498
1135 3300049581 Ga0501047_0023800 Ga0501047_0023800_1084_2583 498
1136 3300049582 Ga0501048_0000436 Ga0501048_0000436_22766_24349 498
1137 3300049583 Ga0501067_0012123 Ga0501067_0012123_1505_3004 498
1138 3300049583 Ga0501067_0017461 Ga0501067_0017461_804_2303 498
1139 3300049585 Ga0501069_0008839 Ga0501069_0008839_1624_3123 498
1140 3300049586 Ga0501070_0004796 Ga0501070_0004796_7982_9565 498
1141 3300049586 Ga0501070_0012088 Ga0501070_0012088_1609_3108 498
1142 3300049586 Ga0501070_0081284 Ga0501070_0081284_405_1904 498
1143 3300049586 Ga0501070_0159329 Ga0501070_0159329_151_1650 498
1144 3300049588 Ga0501072_0064027 Ga0501072_0064027_165_1664 498
1145 3300049589 Ga0501073_0017448 Ga0501073_0017448_3641_5140 498
1146 3300049589 Ga0501073_0026774 Ga0501073_0026774_1901_3484 498
1147 3300049592 Ga0501076_0059001 Ga0501076_0059001_107_1606 498
1148 3300049742 Ga0501080_0000148 Ga0501080_0000148_22628_24211 498
1149 3300049744 Ga0501083_0000335 Ga0501083_0000335_2382_3965 498
1150 3300049822 Ga0501035_0027062 Ga0501035_0027062_1658_3157 498
1151 3300049823 Ga0501044_0004630 Ga0501044_0004630_480_2063 498
1152 3300049823 Ga0501044_0026677 Ga0501044_0026677_2327_3826 498
1153 3300049823 Ga0501044_0130308 Ga0501044_0130308_388_1887 498
1154 3300054114 Ga0501084_0066370 Ga0501084_0066370_182_1681 498
1155 3300000041 ARcpr5oldR_c000070 ARcpr5oldR_00007017 499
1156 3300000042 ARSoilYngRDRAFT_c00050 ARSoilYngRDRAFT_000503 499
1157 3300000043 ARcpr5yngRDRAFT_c000063 ARcpr5yngRDRAFT_00006316 499
1158 3300000044 ARSoilOldRDRAFT_c000059 ARSoilOldRDRAFT_0000593 499
1159 3300000652 ARCol0yngRDRAFT_1000071 ARCol0yngRDRAFT_10000713 499
1160 3300002073 JGI24745J21846_1001768 JGI24745J21846_10017682 499
1161 3300002126 JGI24035J26624_1001075 JGI24035J26624_10010752 499
1162 3300002155 JGI24033J26618_1001583 JGI24033J26618_10015831 499
1163 3300005276 Ga0065717_1002103 Ga0065717_10021033 499
1164 3300005290 Ga0065712_10078653 Ga0065712_100786532 499
1165 3300005290 Ga0065712_10086256 Ga0065712_100862561 499
1166 3300005293 Ga0065715_10009862 Ga0065715_100098622 499
1167 3300005293 Ga0065715_10089271 Ga0065715_100892714 499
1168 3300005328 Ga0070676_10039192 Ga0070676_100391922 499
1169 3300005330 Ga0070690_100002133 Ga0070690_1000021331 499
1170 3300005331 Ga0070670_100006337 Ga0070670_1000063372 499
1171 3300005333 Ga0070677_10000122 Ga0070677_1000012215 499
1172 3300005335 Ga0070666_10024298 Ga0070666_100242982 499
1173 3300005335 Ga0070666_10034068 Ga0070666_100340682 499
1174 3300005336 Ga0070680_100012982 Ga0070680_1000129823 499
1175 3300005336 Ga0070680_100034071 Ga0070680_1000340712 499
1176 3300005337 Ga0070682_100000298 Ga0070682_10000029826 499
1177 3300005338 Ga0068868_100001837 Ga0068868_1000018371 499
1178 3300005339 Ga0070660_100039223 Ga0070660_1000392234 499
1179 3300005340 Ga0070689_100001033 Ga0070689_10000103312 499
1180 3300005343 Ga0070687_100000146 Ga0070687_10000014611 499
1181 3300005344 Ga0070661_100000946 Ga0070661_10000094614 499
1182 3300005345 Ga0070692_10000593 Ga0070692_1000059312 499
1183 3300005347 Ga0070668_100014011 Ga0070668_1000140112 499
1184 3300005353 Ga0070669_100001742 Ga0070669_1000017426 499
1185 3300005353 Ga0070669_100067516 Ga0070669_1000675163 499
1186 3300005354 Ga0070675_100008491 Ga0070675_1000084911 499
1187 3300005354 Ga0070675_100061539 Ga0070675_1000615393 499
1188 3300005354 Ga0070675_100087735 Ga0070675_1000877352 499
1189 3300005355 Ga0070671_100025848 Ga0070671_1000258483 499
1190 3300005355 Ga0070671_100059285 Ga0070671_1000592851 499
1191 3300005356 Ga0070674_100000451 Ga0070674_10000045118 499
1192 3300005356 Ga0070674_100063466 Ga0070674_1000634663 499
1193 3300005364 Ga0070673_100000092 Ga0070673_10000009214 499
1194 3300005364 Ga0070673_100061923 Ga0070673_1000619233 499
1195 3300005365 Ga0070688_100000411 Ga0070688_1000004118 499
1196 3300005366 Ga0070659_100000769 Ga0070659_1000007691 499
1197 3300005366 Ga0070659_100004309 Ga0070659_1000043099 499
1198 3300005367 Ga0070667_100005702 Ga0070667_1000057028 499
1199 3300005367 Ga0070667_100086413 Ga0070667_1000864132 499
1200 3300005406 Ga0070703_10002667 Ga0070703_100026673 499
1201 3300005435 Ga0070714_100003697 Ga0070714_1000036978 499
1202 3300005435 Ga0070714_100030497 Ga0070714_1000304973 499
1203 3300005436 Ga0070713_100001980 Ga0070713_10000198010 499
1204 3300005436 Ga0070713_100009547 Ga0070713_1000095474 499
1205 3300005438 Ga0070701_10000011 Ga0070701_1000001133 499
1206 3300005439 Ga0070711_100096352 Ga0070711_1000963522 499
1207 3300005440 Ga0070705_100000747 Ga0070705_1000007479 499
1208 3300005441 Ga0070700_100000306 Ga0070700_10000030614 499
1209 3300005441 Ga0070700_100002292 Ga0070700_1000022927 499
1210 3300005444 Ga0070694_100011937 Ga0070694_1000119371 499
1211 3300005444 Ga0070694_100061408 Ga0070694_1000614081 499
1212 3300005444 Ga0070694_100096449 Ga0070694_1000964492 499
1213 3300005445 Ga0070708_100133278 Ga0070708_1001332781 499
1214 3300005455 Ga0070663_100000398 Ga0070663_10000039814 499
1215 3300005455 Ga0070663_100106726 Ga0070663_1001067262 499
1216 3300005456 Ga0070678_100001144 Ga0070678_10000114414 499
1217 3300005457 Ga0070662_100002806 Ga0070662_1000028068 499
1218 3300005457 Ga0070662_100083585 Ga0070662_1000835851 499
1219 3300005457 Ga0070662_100149404 Ga0070662_1001494042 499
1220 3300005458 Ga0070681_10024804 Ga0070681_100248047 499
1221 3300005459 Ga0068867_100006275 Ga0068867_1000062758 499
1222 3300005466 Ga0070685_10002153 Ga0070685_100021532 499
1223 3300005530 Ga0070679_100096466 Ga0070679_1000964663 499
1224 3300005535 Ga0070684_100038834 Ga0070684_1000388344 499
1225 3300005539 Ga0068853_100007182 Ga0068853_1000071821 499
1226 3300005543 Ga0070672_100006474 Ga0070672_1000064741 499
1227 3300005544 Ga0070686_100000182 Ga0070686_10000018235 499
1228 3300005544 Ga0070686_100004486 Ga0070686_1000044864 499
1229 3300005545 Ga0070695_100001057 Ga0070695_10000105712 499
1230 3300005546 Ga0070696_100001388 Ga0070696_1000013881 499
1231 3300005547 Ga0070693_100000315 Ga0070693_10000031514 499
1232 3300005548 Ga0070665_100188951 Ga0070665_1001889512 499
1233 3300005549 Ga0070704_100000151 Ga0070704_10000015113 499
1234 3300005563 Ga0068855_100007568 Ga0068855_1000075689 499
1235 3300005563 Ga0068855_100050812 Ga0068855_1000508122 499
1236 3300005564 Ga0070664_100001627 Ga0070664_10000162711 499
1237 3300005577 Ga0068857_100009284 Ga0068857_1000092846 499
1238 3300005614 Ga0068856_100002843 Ga0068856_1000028438 499
1239 3300005614 Ga0068856_100048175 Ga0068856_1000481753 499
1240 3300005616 Ga0068852_100107530 Ga0068852_1001075302 499
1241 3300005617 Ga0068859_100002474 Ga0068859_1000024744 499
1242 3300005618 Ga0068864_100001253 Ga0068864_1000012537 499
1243 3300005618 Ga0068864_100149797 Ga0068864_1001497972 499
1244 3300005718 Ga0068866_10000854 Ga0068866_100008541 499
1245 3300005719 Ga0068861_100000542 Ga0068861_1000005428 499
1246 3300005719 Ga0068861_100032123 Ga0068861_1000321232 499
1247 3300005840 Ga0068870_10000081 Ga0068870_1000008117 499
1248 3300005841 Ga0068863_100000351 Ga0068863_10000035135 499
1249 3300005842 Ga0068858_100001632 Ga0068858_10000163214 499
1250 3300005842 Ga0068858_100174269 Ga0068858_1001742691 499
1251 3300005843 Ga0068860_100003775 Ga0068860_1000037758 499
1252 3300005843 Ga0068860_100060529 Ga0068860_1000605291 499
1253 3300005844 Ga0068862_100001228 Ga0068862_10000122812 499
1254 3300005937 Ga0081455_10000009 Ga0081455_1000000988 499
1255 3300005983 Ga0081540_1031024 Ga0081540_10310242 499
1256 3300006028 Ga0070717_10000822 Ga0070717_100008223 499
1257 3300006173 Ga0070716_100007908 Ga0070716_1000079084 499
1258 3300006237 Ga0097621_100004126 Ga0097621_1000041269 499
1259 3300006237 Ga0097621_100017356 Ga0097621_1000173562 499
1260 3300006358 Ga0068871_100000699 Ga0068871_10000069921 499
1261 3300006358 Ga0068871_100144629 Ga0068871_1001446292 499
1262 3300006871 Ga0075434_100047307 Ga0075434_1000473072 499
1263 3300006871 Ga0075434_100299583 Ga0075434_1002995832 499
1264 3300006881 Ga0068865_100007876 Ga0068865_1000078763 499
1265 3300006914 Ga0075436_100017449 Ga0075436_1000174493 499
1266 3300006931 Ga0097620_100002474 Ga0097620_1000024744 499
1267 3300007076 Ga0075435_100027483 Ga0075435_1000274832 499
1268 3300007076 Ga0075435_100029649 Ga0075435_1000296492 499
1269 3300007076 Ga0075435_100105871 Ga0075435_1001058712 499
1270 3300009011 Ga0105251_10028223 Ga0105251_100282233 499
1271 3300009093 Ga0105240_10114997 Ga0105240_101149972 499
1272 3300009094 Ga0111539_10000173 Ga0111539_1000017333 499
1273 3300009098 Ga0105245_10000366 Ga0105245_1000036637 499
1274 3300009098 Ga0105245_10038080 Ga0105245_100380802 499
1275 3300009101 Ga0105247_10002587 Ga0105247_100025876 499
1276 3300009148 Ga0105243_10001845 Ga0105243_1000184514 499
1277 3300009148 Ga0105243_10011314 Ga0105243_100113145 499
1278 3300009148 Ga0105243_10017476 Ga0105243_100174766 499
1279 3300009148 Ga0105243_10048915 Ga0105243_100489151 499
1280 3300009174 Ga0105241_10001371 Ga0105241_1000137116 499
1281 3300009176 Ga0105242_10000138 Ga0105242_1000013837 499
1282 3300009176 Ga0105242_10013390 Ga0105242_100133905 499
1283 3300009176 Ga0105242_10121562 Ga0105242_101215622 499
1284 3300009177 Ga0105248_10000645 Ga0105248_1000064527 499
1285 3300009177 Ga0105248_10165621 Ga0105248_101656211 499
1286 3300009545 Ga0105237_10104911 Ga0105237_101049112 499
1287 3300009553 Ga0105249_10147215 Ga0105249_101472153 499
1288 3300010375 Ga0105239_10108559 Ga0105239_101085592 499
1289 3300011119 Ga0105246_10059601 Ga0105246_100596014 499
1290 3300013296 Ga0157374_10000406 Ga0157374_1000040638 499
1291 3300013296 Ga0157374_10259582 Ga0157374_102595821 499
1292 3300013297 Ga0157378_10004538 Ga0157378_100045388 499
1293 3300013306 Ga0163162_10008420 Ga0163162_1000842012 499
1294 3300013307 Ga0157372_10001486 Ga0157372_1000148610 499
1295 3300013308 Ga0157375_10002105 Ga0157375_1000210513 499
1296 3300014325 Ga0163163_10008915 Ga0163163_100089155 499
1297 3300014325 Ga0163163_10040741 Ga0163163_100407411 499
1298 3300014745 Ga0157377_10000133 Ga0157377_1000013333 499
1299 3300014745 Ga0157377_10086005 Ga0157377_100860051 499
1300 3300014968 Ga0157379_10005234 Ga0157379_100052343 499
1301 3300014968 Ga0157379_10058922 Ga0157379_100589222 499
1302 3300014969 Ga0157376_10000324 Ga0157376_1000032433 499
1303 3300017792 Ga0163161_10001128 Ga0163161_1000112816 499
1304 3300025271 Ga0207666_1000006 Ga0207666_10000064 499
1305 3300025271 Ga0207666_1000793 Ga0207666_10007932 499
1306 3300025290 Ga0207673_1000119 Ga0207673_10001196 499
1307 3300025315 Ga0207697_10000504 Ga0207697_1000050419 499
1308 3300025315 Ga0207697_10005430 Ga0207697_100054304 499
1309 3300025885 Ga0207653_10016724 Ga0207653_100167242 499
1310 3300025893 Ga0207682_10000040 Ga0207682_1000004021 499
1311 3300025898 Ga0207692_10053307 Ga0207692_100533072 499
1312 3300025899 Ga0207642_10000511 Ga0207642_100005119 499
1313 3300025900 Ga0207710_10009959 Ga0207710_100099592 499
1314 3300025901 Ga0207688_10000319 Ga0207688_1000031920 499
1315 3300025901 Ga0207688_10040095 Ga0207688_100400953 499
1316 3300025903 Ga0207680_10043386 Ga0207680_100433862 499
1317 3300025904 Ga0207647_10004170 Ga0207647_100041708 499
1318 3300025904 Ga0207647_10048581 Ga0207647_100485811 499
1319 3300025907 Ga0207645_10000460 Ga0207645_1000046020 499
1320 3300025908 Ga0207643_10000046 Ga0207643_1000004661 499
1321 3300025911 Ga0207654_10002344 Ga0207654_100023447 499
1322 3300025912 Ga0207707_10072537 Ga0207707_100725373 499
1323 3300025912 Ga0207707_10183158 Ga0207707_101831581 499
1324 3300025914 Ga0207671_10006907 Ga0207671_1000690710 499
1325 3300025914 Ga0207671_10145041 Ga0207671_101450412 499
1326 3300025915 Ga0207693_10006057 Ga0207693_100060577 499
1327 3300025915 Ga0207693_10024739 Ga0207693_100247394 499
1328 3300025915 Ga0207693_10131990 Ga0207693_101319902 499
1329 3300025916 Ga0207663_10046198 Ga0207663_100461982 499
1330 3300025917 Ga0207660_10033652 Ga0207660_100336522 499
1331 3300025918 Ga0207662_10000504 Ga0207662_100005044 499
1332 3300025918 Ga0207662_10001458 Ga0207662_100014588 499
1333 3300025918 Ga0207662_10095849 Ga0207662_100958492 499
1334 3300025919 Ga0207657_10006802 Ga0207657_100068028 499
1335 3300025919 Ga0207657_10037921 Ga0207657_100379213 499
1336 3300025919 Ga0207657_10041776 Ga0207657_100417762 499
1337 3300025920 Ga0207649_10000320 Ga0207649_1000032035 499
1338 3300025920 Ga0207649_10060868 Ga0207649_100608682 499
1339 3300025923 Ga0207681_10000927 Ga0207681_100009272 499
1340 3300025925 Ga0207650_10072819 Ga0207650_100728193 499
1341 3300025925 Ga0207650_10076904 Ga0207650_100769042 499
1342 3300025926 Ga0207659_10004048 Ga0207659_100040486 499
1343 3300025926 Ga0207659_10058748 Ga0207659_100587482 499
1344 3300025927 Ga0207687_10000788 Ga0207687_1000078816 499
1345 3300025928 Ga0207700_10008190 Ga0207700_100081904 499
1346 3300025928 Ga0207700_10037981 Ga0207700_100379812 499
1347 3300025929 Ga0207664_10044040 Ga0207664_100440402 499
1348 3300025929 Ga0207664_10046857 Ga0207664_100468572 499
1349 3300025931 Ga0207644_10000843 Ga0207644_1000084318 499
1350 3300025931 Ga0207644_10093717 Ga0207644_100937171 499
1351 3300025933 Ga0207706_10000828 Ga0207706_1000082818 499
1352 3300025933 Ga0207706_10006202 Ga0207706_100062024 499
1353 3300025934 Ga0207686_10000282 Ga0207686_1000028229 499
1354 3300025935 Ga0207709_10002522 Ga0207709_100025228 499
1355 3300025936 Ga0207670_10002531 Ga0207670_100025315 499
1356 3300025936 Ga0207670_10034741 Ga0207670_100347412 499
1357 3300025939 Ga0207665_10000782 Ga0207665_100007824 499
1358 3300025940 Ga0207691_10005927 Ga0207691_100059278 499
1359 3300025940 Ga0207691_10131298 Ga0207691_101312982 499
1360 3300025940 Ga0207691_10135426 Ga0207691_101354262 499
1361 3300025941 Ga0207711_10011611 Ga0207711_100116115 499
1362 3300025941 Ga0207711_10039772 Ga0207711_100397722 499
1363 3300025942 Ga0207689_10001290 Ga0207689_100012904 499
1364 3300025944 Ga0207661_10000596 Ga0207661_100005968 499
1365 3300025945 Ga0207679_10000299 Ga0207679_1000029939 499
1366 3300025949 Ga0207667_10120607 Ga0207667_101206071 499
1367 3300025960 Ga0207651_10019767 Ga0207651_100197673 499
1368 3300025960 Ga0207651_10026369 Ga0207651_100263693 499
1369 3300025961 Ga0207712_10076133 Ga0207712_100761331 499
1370 3300025972 Ga0207668_10004532 Ga0207668_100045329 499
1371 3300025972 Ga0207668_10024874 Ga0207668_100248742 499
1372 3300025986 Ga0207658_10028866 Ga0207658_100288664 499
1373 3300026023 Ga0207677_10001672 Ga0207677_100016729 499
1374 3300026035 Ga0207703_10007749 Ga0207703_100077492 499
1375 3300026035 Ga0207703_10078482 Ga0207703_100784823 499
1376 3300026067 Ga0207678_10001473 Ga0207678_1000147319 499
1377 3300026067 Ga0207678_10004574 Ga0207678_100045743 499
1378 3300026075 Ga0207708_10003349 Ga0207708_100033498 499
1379 3300026075 Ga0207708_10022753 Ga0207708_100227531 499
1380 3300026075 Ga0207708_10035304 Ga0207708_100353042 499
1381 3300026088 Ga0207641_10033747 Ga0207641_100337472 499
1382 3300026088 Ga0207641_10170058 Ga0207641_101700581 499
1383 3300026089 Ga0207648_10003790 Ga0207648_100037908 499
1384 3300026089 Ga0207648_10065558 Ga0207648_100655582 499
1385 3300026095 Ga0207676_10003931 Ga0207676_100039312 499
1386 3300026095 Ga0207676_10029154 Ga0207676_100291541 499
1387 3300026116 Ga0207674_10000647 Ga0207674_1000064715 499
1388 3300026118 Ga0207675_100000322 Ga0207675_10000032216 499
1389 3300026118 Ga0207675_100113713 Ga0207675_1001137132 499
1390 3300026121 Ga0207683_10000203 Ga0207683_1000020319 499
1391 3300026121 Ga0207683_10006315 Ga0207683_100063154 499
1392 3300026142 Ga0207698_10001938 Ga0207698_100019389 499
1393 3300027695 Ga0209966_1001424 Ga0209966_10014244 499
1394 3300027717 Ga0209998_10002620 Ga0209998_100026202 499
1395 3300027876 Ga0209974_10028113 Ga0209974_100281132 499
1396 3300027907 Ga0207428_10000303 Ga0207428_1000030344 499
1397 3300028379 Ga0268266_10011836 Ga0268266_100118363 499
1398 3300028379 Ga0268266_10101178 Ga0268266_101011781 499
1399 3300028380 Ga0268265_10083324 Ga0268265_100833242 499
1400 3300028381 Ga0268264_10034762 Ga0268264_100347623 499
1401 3300031241 Ga0265325_10000029 Ga0265325_1000002946 499
1402 3300031247 Ga0265340_10028029 Ga0265340_100280292 499
1403 3300031250 Ga0265331_10011041 Ga0265331_100110415 499
1404 3300031595 Ga0265313_10037238 Ga0265313_100372381 499
1405 3300031711 Ga0265314_10027588 Ga0265314_100275884 499
1406 3300034816 Ga0373930_0000161 Ga0373930_0000161_3465_4964 499
1407 3300034817 Ga0373948_0001179 Ga0373948_0001179_1437_2936 499
1408 3300034818 Ga0373950_0000135 Ga0373950_0000135_2005_3504 499
1409 3300034819 Ga0373958_0000166 Ga0373958_0000166_3219_4718 499
1410 3300034820 Ga0373959_0000984 Ga0373959_0000984_1090_2589 499
1411 3300034957 Ga0373938_0000011 Ga0373938_0000011_14588_16087 499
1412 3300035084 Ga0373928_0000095 Ga0373928_0000095_13384_14883 499
1413 3300035085 Ga0373929_0000078 Ga0373929_0000078_10865_12364 499
1414 3300035086 Ga0373934_0018956 Ga0373934_0018956_779_2293 499
1415 3300035090 Ga0373949_0001298 Ga0373949_0001298_1508_3007 499
1416 3300035091 Ga0373951_0002882 Ga0373951_0002882_143_1645 499
1417 3300035092 Ga0373952_0000091 Ga0373952_0000091_2813_4312 499
1418 3300035092 Ga0373952_0002670 Ga0373952_0002670_699_2201 499
1419 3300035112 Ga0373932_0000075 Ga0373932_0000075_21550_23049 499
1420 3300035114 Ga0373939_0000754 Ga0373939_0000754_4741_6240 499
1421 3300035115 Ga0373941_0000258 Ga0373941_0000258_2292_3791 499
1422 3300035115 Ga0373941_0017738 Ga0373941_0017738_271_1773 499
1423 3300035118 Ga0373954_0010698 Ga0373954_0010698_741_2246 499
1424 3300035118 Ga0373954_0029726 Ga0373954_0029726_626_2128 499
1425 3300035119 Ga0373956_0002416 Ga0373956_0002416_2096_3601 499
1426 3300035119 Ga0373956_0009462 Ga0373956_0009462_1645_3159 499
1427 3300035120 Ga0373957_0020695 Ga0373957_0020695_60_1574 499
1428 3300035170 Ga0373943_0053194 Ga0373943_0053194_142_1644 499
1429 3300035172 Ga0373955_0004667 Ga0373955_0004667_2957_4471 499
1430 3300035172 Ga0373955_0026452 Ga0373955_0026452_759_2264 499
1431 3300035207 Ga0373942_0000042 Ga0373942_0000042_18059_19558 499
1432 3300035691 Ga0373931_0000194 Ga0373931_0000194_14605_16107 499
1433 3300035691 Ga0373931_0010791 Ga0373931_0010791_755_2254 499
1434 3300035691 Ga0373931_0029742 Ga0373931_0029742_275_1777 499
1435 3300035692 Ga0373935_0076232 Ga0373935_0076232_109_1623 499
1436 3300035695 Ga0373927_0016287 Ga0373927_0016287_3220_4722 499
1437 3300035724 Ga0373933_0001240 Ga0373933_0001240_10121_11626 499
1438 3300035724 Ga0373933_0002947 Ga0373933_0002947_3948_5462 499
1439 3300035725 Ga0373947_0014104 Ga0373947_0014104_1739_3241 499
1440 3300036401 Ga0373937_0002729 Ga0373937_0002729_5132_6646 499
1441 3300036401 Ga0373937_0002872 Ga0373937_0002872_10727_12232 499
1442 3300036401 Ga0373937_0003641 Ga0373937_0003641_4577_6091 499
1443 3300036401 Ga0373937_0016262 Ga0373937_0016262_2186_3688 499
1444 3300036401 Ga0373937_0214961 Ga0373937_0214961_51_1565 499
1445 3300037068 Ga0373925_0011859 Ga0373925_0011859_1381_2895 499
1446 3300037312 Ga0395899_0002498 Ga0395899_0002498_10904_12460 499
1447 3300037418 Ga0395900_0001761 Ga0395900_0001761_19022_20578 499
1448 3300037418 Ga0395900_0018259 Ga0395900_0018259_5504_7078 499
1449 3300038443 Ga0395901_0009211 Ga0395901_0009211_2763_4337 499
1450 3300039437 Ga0436365_1190710 Ga0436365_1190710_8363_9865 499
1451 3300045051 Ga0451576_0086350 Ga0451576_0086350_88_1587 499
1452 3300046454 Ga0495592_0014946 Ga0495592_0014946_1793_3295 499
1453 3300046454 Ga0495592_0029627 Ga0495592_0029627_1043_2548 499
1454 3300046454 Ga0495592_0047265 Ga0495592_0047265_716_2230 499
1455 3300046455 Ga0495603_0016469 Ga0495603_0016469_834_2339 499
1456 3300046459 Ga0495629_0000688 Ga0495629_0000688_5449_6951 499
1457 3300046459 Ga0495629_0120887 Ga0495629_0120887_268_1773 499
1458 3300046461 Ga0495641_0013090 Ga0495641_0013090_1338_2840 499
1459 3300046462 Ga0495651_0001553 Ga0495651_0001553_14425_15927 499
1460 3300046462 Ga0495651_0004731 Ga0495651_0004731_7011_8516 499
1461 3300046462 Ga0495651_0026515 Ga0495651_0026515_1857_3371 499
1462 3300046463 Ga0495653_0003335 Ga0495653_0003335_2151_3656 499
1463 3300046473 Ga0495582_0019595 Ga0495582_0019595_277_1779 499
1464 3300046477 Ga0495664_0010669 Ga0495664_0010669_2146_3651 499
1465 3300046477 Ga0495664_0028550 Ga0495664_0028550_1139_2653 499
1466 3300046491 Ga0495584_0006207 Ga0495584_0006207_1927_3429 499
1467 3300046492 Ga0495585_0005098 Ga0495585_0005098_1995_3497 499
1468 3300046499 Ga0495594_0007097 Ga0495594_0007097_2699_4201 499
1469 3300046501 Ga0495607_0010029 Ga0495607_0010029_1460_2962 499
1470 3300046511 Ga0495608_0001923 Ga0495608_0001923_5931_7436 499
1471 3300046511 Ga0495608_0047071 Ga0495608_0047071_289_1803 499
1472 3300046516 Ga0495628_0002774 Ga0495628_0002774_7465_8970 499
1473 3300046517 Ga0495630_0049043 Ga0495630_0049043_317_1819 499
1474 3300046523 Ga0495644_0005926 Ga0495644_0005926_2100_3602 499
1475 3300046526 Ga0495666_0016359 Ga0495666_0016359_1618_3120 499
1476 3300046529 Ga0495652_0009916 Ga0495652_0009916_1791_3305 499
1477 3300046529 Ga0495652_0012679 Ga0495652_0012679_5490_6995 499
1478 3300046529 Ga0495652_0147601 Ga0495652_0147601_62_1567 499
1479 3300046533 Ga0495640_0013378 Ga0495640_0013378_1551_3056 499
1480 3300046535 Ga0495586_0034415 Ga0495586_0034415_1068_2573 499
1481 3300046536 Ga0495587_0005522 Ga0495587_0005522_1256_2761 499
1482 3300046543 Ga0495645_0001608 Ga0495645_0001608_2867_4381 499
1483 3300046543 Ga0495645_0003727 Ga0495645_0003727_6728_8233 499
1484 3300046558 Ga0495633_0002344 Ga0495633_0002344_1508_3010 499
1485 3300046559 Ga0495667_0002299 Ga0495667_0002299_2034_3539 499
1486 3300046559 Ga0495667_0010546 Ga0495667_0010546_2141_3655 499
1487 3300046615 Ga0495656_0004917 Ga0495656_0004917_1327_2829 499
1488 3300046642 Ga0495634_0027772 Ga0495634_0027772_1767_3272 499
1489 3300046648 Ga0495611_0003437 Ga0495611_0003437_377_1879 499
1490 3300046663 Ga0495635_0004775 Ga0495635_0004775_2467_3969 499
1491 3300046663 Ga0495635_0012477 Ga0495635_0012477_3950_5455 499
1492 3300046675 Ga0495657_0006210 Ga0495657_0006210_5810_7315 499
1493 3300046678 Ga0495599_0008623 Ga0495599_0008623_2795_4300 499
1494 3300046679 Ga0495623_0006389 Ga0495623_0006389_907_2412 499
1495 3300046679 Ga0495623_0093502 Ga0495623_0093502_224_1738 499
1496 3300046680 Ga0495646_0002648 Ga0495646_0002648_892_2397 499
1497 3300046683 Ga0495658_0000246 Ga0495658_0000246_6697_8199 499
1498 3300046683 Ga0495658_0016322 Ga0495658_0016322_2152_3654 499
1499 3300046689 Ga0495613_0039160 Ga0495613_0039160_1637_3139 499
1500 3300046691 Ga0495670_0000200 Ga0495670_0000200_22197_23699 499
1501 3300046809 Ga0495600_0004321 Ga0495600_0004321_4263_5777 499
1502 3300046809 Ga0495600_0016769 Ga0495600_0016769_156_1661 499
1503 3300046809 Ga0495600_0019067 Ga0495600_0019067_2045_3547 499
1504 3300046809 Ga0495600_0056652 Ga0495600_0056652_958_2472 499
1505 3300047315 Ga0495581_0023234 Ga0495581_0023234_392_1894 499
1506 3300047317 Ga0495604_0001700 Ga0495604_0001700_9129_10634 499
1507 3300047317 Ga0495604_0017616 Ga0495604_0017616_1543_3045 499
1508 3300047319 Ga0495674_0007161 Ga0495674_0007161_2026_3531 499
1509 3300047319 Ga0495674_0043386 Ga0495674_0043386_1510_3024 499
1510 3300047319 Ga0495674_0083519 Ga0495674_0083519_921_2426 499
1511 3300047322 Ga0495680_0011668 Ga0495680_0011668_305_1810 499
1512 3300047322 Ga0495680_0030587 Ga0495680_0030587_1837_3351 499
1513 3300047322 Ga0495680_0030787 Ga0495680_0030787_1903_3405 499
1514 3300047444 Ga0495675_0000357 Ga0495675_0000357_15121_16626 499
1515 3300047444 Ga0495675_0009342 Ga0495675_0009342_488_2002 499
1516 3300047471 Ga0495684_0003417 Ga0495684_0003417_6663_8165 499
1517 3300047673 Ga0495593_0016384 Ga0495593_0016384_1322_2824 499
1518 3300048088 Ga0495602_0003279 Ga0495602_0003279_1562_3076 499
1519 3300048088 Ga0495602_0007195 Ga0495602_0007195_6302_7807 499
1520 3300048903 Ga0496100_0000777 Ga0496100_0000777_3043_4545 499
1521 3300048903 Ga0496100_0020436 Ga0496100_0020436_2024_3526 499
1522 3300048905 Ga0496102_0003434 Ga0496102_0003434_2523_4025 499
1523 3300048905 Ga0496102_0060605 Ga0496102_0060605_96_1595 499
1524 3300048906 Ga0496103_0000880 Ga0496103_0000880_631_2133 499
1525 3300048906 Ga0496103_0070690 Ga0496103_0070690_444_1946 499
1526 3300048907 Ga0496104_0001371 Ga0496104_0001371_9823_11328 499
1527 3300048907 Ga0496104_0006667 Ga0496104_0006667_4866_6509 499
1528 3300048907 Ga0496104_0122751 Ga0496104_0122751_188_1690 499
1529 3300048907 Ga0496104_0173063 Ga0496104_0173063_446_1948 499
1530 3300048908 Ga0496105_0014134 Ga0496105_0014134_4450_5955 499
1531 3300048909 Ga0496106_0004190 Ga0496106_0004190_2593_4095 499
1532 3300048909 Ga0496106_0084751 Ga0496106_0084751_796_2298 499
1533 3300048910 Ga0496107_0002077 Ga0496107_0002077_8516_10018 499
1534 3300048910 Ga0496107_0025684 Ga0496107_0025684_305_1810 499
1535 3300048910 Ga0496107_0026432 Ga0496107_0026432_548_2074 499
1536 3300048911 Ga0496108_0009372 Ga0496108_0009372_961_2466 499
1537 3300048911 Ga0496108_0018077 Ga0496108_0018077_1094_2620 499
1538 3300048911 Ga0496108_0150437 Ga0496108_0150437_475_1977 499
1539 3300048912 Ga0496109_0000902 Ga0496109_0000902_11082_12662 499
1540 3300048912 Ga0496109_0002998 Ga0496109_0002998_10595_12097 499
1541 3300048912 Ga0496109_0046155 Ga0496109_0046155_1951_3453 499
1542 3300048912 Ga0496109_0074316 Ga0496109_0074316_423_1922 499
1543 3300048912 Ga0496109_0175122 Ga0496109_0175122_298_1800 499
1544 3300048913 Ga0496110_0097081 Ga0496110_0097081_181_1842 499
1545 3300048914 Ga0496111_0027637 Ga0496111_0027637_2006_3505 499
1546 3300048915 Ga0496112_0061178 Ga0496112_0061178_627_2132 499
1547 3300048916 Ga0496113_0006436 Ga0496113_0006436_5538_7064 499
1548 3300048917 Ga0496114_0010861 Ga0496114_0010861_5717_7219 499
1549 3300048917 Ga0496114_0132993 Ga0496114_0132993_493_1995 499
1550 3300048918 Ga0496115_0056881 Ga0496115_0056881_293_1798 499
1551 3300049571 Ga0501034_0034189 Ga0501034_0034189_2832_4334 499
1552 3300049574 Ga0501038_0084575 Ga0501038_0084575_858_2363 499
1553 3300049581 Ga0501047_0015955 Ga0501047_0015955_2886_4391 499
1554 3300049588 Ga0501072_0080885 Ga0501072_0080885_519_2024 499
1555 3300049744 Ga0501083_0045658 Ga0501083_0045658_1279_2784 499
1556 3300050511 nmdc:mga08y16_172_c1 nmdc:mga08y16_172_c1_12230_13729 499
1557 3300050512 nmdc:mga0n895_43445_c1 nmdc:mga0n895_43445_c1_1469_2971 499
1558 3300050513 nmdc:mga0rr50_37098_c1 nmdc:mga0rr50_37098_c1_798_2300 499
1559 3300053077 Ga0495601_0002252 Ga0495601_0002252_6692_8206 499
1560 3300053077 Ga0495601_0024497 Ga0495601_0024497_306_1811 499
1561 3300053078 Ga0495612_0000188 Ga0495612_0000188_17204_18718 499
1562 3300053078 Ga0495612_0005933 Ga0495612_0005933_2104_3606 499
1563 3300053078 Ga0495612_0024623 Ga0495612_0024623_722_2236 499
1564 3300053084 Ga0495595_0000656 Ga0495595_0000656_3702_5216 499
1565 3300053084 Ga0495595_0001391 Ga0495595_0001391_7280_8785 499
1566 3300053084 Ga0495595_0002496 Ga0495595_0002496_5016_6518 499
1567 3300053084 Ga0495595_0007222 Ga0495595_0007222_321_1835 499
1568 3300053085 Ga0495619_0000818 Ga0495619_0000818_13744_15258 499
1569 3300053085 Ga0495619_0031008 Ga0495619_0031008_146_1648 499
1570 3300053085 Ga0495619_0061825 Ga0495619_0061825_45_1547 499
1571 3300053085 Ga0495619_0079370 Ga0495619_0079370_434_1939 499
1572 3300053119 Ga0500595_000002 Ga0500595_000002_385780_387294 499
1573 3300053153 Ga0500616_0000002 Ga0500616_0000002_459885_461399 499
1574 3300060353 Ga0501082_0036672 Ga0501082_0036672_2084_3589 499

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00883

Peptidase_M17

Cytosol aminopeptidase family, catalytic domain

236

544

0.96

PF02789

Peptidase_M17_N

Cytosol aminopeptidase family, N-terminal domain

72

199

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y1s-assembly1.cif.gz_A crystal structure of apo leucyl aminopeptidase from bacillus amyloliquefaciens 0.9228 1 499
5lhj-assembly1.cif.gz_A bottromycin maturation enzyme botp 0.9179 16 495
5lhk-assembly1.cif.gz_A bottromycin maturation enzyme botp in complex with mn 0.9169 19 499
7y1s-assembly1.cif.gz_A crystal structure of apo leucyl aminopeptidase from bacillus amyloliquefaciens 0.9157 1 499
5lhk-assembly1.cif.gz_A bottromycin maturation enzyme botp in complex with mn 0.9091 19 499
ID Description Score Start End Superfamily
6omeA02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9754 174 497 3.40.630.10
af_Q9VSM6_230_544_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9724 184 496 3.40.630.10
1lapA02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9712 184 494 3.40.630.10
af_Q2FZV6_163_491_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9709 174 497 3.40.630.10
af_P9WHT3_177_515_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9709 169 496 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A356V307-F1-model_v4 Leucyl aminopeptidase 0.999 249 433 GO:0005737
GO:0006508
GO:0030145
GO:0070006
AF-A0A7S0VPB4-F1-model_v4 Cytosol aminopeptidase domain-containing protein 0.9973 169 335 GO:0005737
GO:0006508
GO:0030145
GO:0070006
AF-A0A3D3AAB4-F1-model_v4 Leucyl aminopeptidase 0.9959 265 499 GO:0005737
GO:0006508
GO:0030145
GO:0070006
AF-A0A356V307-F1-model_v4 Leucyl aminopeptidase 0.9937 249 433 GO:0005737
GO:0006508
GO:0030145
GO:0070006
AF-A0A3C0PQ26-F1-model_v4 Leucyl aminopeptidase 0.9935 323 459 GO:0005737
GO:0006508
GO:0030145
GO:0070006

Feature Viewer

pLDDT pTM Quality
94.66 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map