F494874

General Info

Members Datasets Scaffolds Average Seq Length
1578 370 1578 339

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100156849|Ga0070683_1001568492
Length 372
Sequence MAADQPGFLAVACYVLVRRADMIPSSDSSQDQNSYRDFYAGKRVMITGGLGFIGSNLARRLVALDARVLLVDSLIADCGGNLFNIDDIANQLTVNIADVRQPSTMNYLVRGCDVIFNLAGQVSHIDSMRDPYTDLEVNCRSQLTILEACRNHNVAAKVVYAGTRQVYGKPDSLPVNESHLVRPTDVNGINKVAGEYYHLVYNNVFRIRACSLRLTNVYGPRQLIKHNRQGFIGWFIRLAVEGRTISLYGDGSQLRDLVYVDDTVDAFLRVGANDACNGEVFNVGGAEPVSLKRLASTLVRIAGSGSVECVPWPEENKAIDIGSFYTDSRKLMARTGWQPLVSIDDGFRETINFYRANLSHYVTDSAASEEAS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
200 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
201 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
202 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
203 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
204 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
205 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
206 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
207 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
208 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
209 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
210 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
211 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
212 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
213 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
214 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
215 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
216 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
217 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
218 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
222 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
223 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
224 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
225 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
226 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
229 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
230 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
231 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
232 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
233 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
234 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
235 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
236 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
237 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
238 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
239 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
240 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
241 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
242 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
243 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
244 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
245 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
246 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
247 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
248 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
249 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
250 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
251 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
252 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
253 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
254 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
255 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
256 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
257 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
258 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
259 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
260 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
261 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
262 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
263 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
264 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
265 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
266 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
267 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
268 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
269 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
270 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
271 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
272 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
273 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
274 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
275 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
276 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
277 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
278 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
279 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
280 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
281 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
282 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
283 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
284 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
285 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
286 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
287 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
288 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
289 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
294 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
295 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
296 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
297 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
298 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
301 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
302 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
303 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
304 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
305 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
306 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
322 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
323 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
324 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
325 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
326 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
327 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
328 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
329 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
330 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
331 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
332 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
333 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
334 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
335 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
336 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
339 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
340 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
341 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
342 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
343 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
344 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
345 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
346 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
347 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
348 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
349 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
350 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
351 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
352 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
353 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
354 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
355 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
356 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
357 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
358 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
359 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
360 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
361 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
362 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
363 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
364 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
365 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
366 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
367 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
368 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
369 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
370 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.44
Nodule 0
Rhizoplane 2.79
Rhizosphere 91.83
Stem 0
Stem Tuber 0
Unclassified 0.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2730243 2162886007 Bacteria 1759
2 MRS1b_contig_593976 2162886011 Unclassified 1745
3 JGI24746J21847_1000748 3300001977 Bacteria 4992
4 JGI24749J21850_1009619 3300002076 Bacteria 1351
5 JGI25406J46586_10015538 3300003203 Bacteria 3206
6 Ga0065714_10101838 3300005288 Bacteria 1633
7 Ga0065704_10071765 3300005289 Bacteria 9984
8 Ga0065712_10001067 3300005290 Bacteria 7125
9 Ga0065712_10005487 3300005290 Bacteria 2868
10 Ga0065712_10069094 3300005290 Bacteria 8039
11 Ga0065715_10001036 3300005293 Bacteria 8463
12 Ga0065715_10007743 3300005293 Bacteria 4845
13 Ga0065715_10090431 3300005293 Bacteria 7025
14 Ga0065715_10129367 3300005293 Bacteria 2047
15 Ga0065715_10138485 3300005293 Bacteria 1891
16 Ga0065707_10001235 3300005295 Bacteria 9850
17 Ga0065707_10086346 3300005295 Bacteria 5521
18 Ga0070676_10000699 3300005328 Bacteria 16384
19 Ga0070676_10003338 3300005328 Bacteria 8349
20 Ga0070683_100015263 3300005329 Bacteria 6745
21 Ga0070683_100156849 3300005329 Bacteria 2159
22 Ga0070690_100012690 3300005330 Bacteria 4962
23 Ga0070690_100015022 3300005330 Bacteria 4608
24 Ga0070690_100032433 3300005330 Bacteria 3263
25 Ga0070670_100001433 3300005331 Bacteria 19191
26 Ga0070670_100005513 3300005331 Bacteria 10678
27 Ga0070670_100009794 3300005331 Bacteria 8186
28 Ga0070670_100042068 3300005331 Bacteria 3927
29 Ga0070670_100055469 3300005331 Bacteria 3401
30 Ga0070670_100069005 3300005331 Bacteria 3034
31 Ga0070670_100098593 3300005331 Bacteria 2515
32 Ga0070670_100354094 3300005331 Bacteria 1290
33 Ga0070677_10002373 3300005333 Bacteria 6013
34 Ga0070677_10051419 3300005333 Bacteria 1667
35 Ga0070677_10067860 3300005333 Unclassified 1491
36 Ga0068869_100000964 3300005334 Bacteria 16738
37 Ga0068869_100002046 3300005334 Bacteria 12124
38 Ga0068869_100008375 3300005334 Bacteria 6663
39 Ga0068869_100040887 3300005334 Bacteria 3317
40 Ga0068869_100201951 3300005334 Bacteria 1568
41 Ga0070666_10003461 3300005335 Bacteria 9565
42 Ga0070666_10015679 3300005335 Bacteria 4836
43 Ga0070666_10186971 3300005335 Bacteria 1455
44 Ga0068868_100026828 3300005338 Bacteria 4392
45 Ga0068868_100119177 3300005338 Bacteria 2151
46 Ga0070660_100009277 3300005339 Bacteria 6916
47 Ga0070660_100108065 3300005339 Bacteria 2211
48 Ga0070689_100000517 3300005340 Bacteria 22784
49 Ga0070689_100007688 3300005340 Bacteria 7550
50 Ga0070689_100012832 3300005340 Bacteria 6049
51 Ga0070689_100022688 3300005340 Bacteria 4690
52 Ga0070689_100054436 3300005340 Bacteria 3098
53 Ga0070689_100167533 3300005340 Bacteria 1779
54 Ga0070691_10003375 3300005341 Bacteria 7177
55 Ga0070687_100001731 3300005343 Bacteria 7850
56 Ga0070687_100086297 3300005343 Bacteria 1725
57 Ga0070687_100091868 3300005343 Bacteria 1681
58 Ga0070687_100199336 3300005343 Unclassified 1212
59 Ga0070661_100078861 3300005344 Bacteria 2430
60 Ga0070661_100157117 3300005344 Unclassified 1721
61 Ga0070668_100018384 3300005347 Bacteria 5247
62 Ga0070668_100035114 3300005347 Bacteria 3822
63 Ga0070669_100000645 3300005353 Bacteria 25815
64 Ga0070669_100001131 3300005353 Bacteria 19486
65 Ga0070669_100015255 3300005353 Bacteria 5473
66 Ga0070669_100028635 3300005353 Bacteria 4012
67 Ga0070669_100040011 3300005353 Bacteria 3407
68 Ga0070669_100049696 3300005353 Bacteria 3062
69 Ga0070669_100092094 3300005353 Bacteria 2275
70 Ga0070669_100097505 3300005353 Bacteria 2213
71 Ga0070669_100106293 3300005353 Bacteria 2124
72 Ga0070675_100000715 3300005354 Bacteria 23087
73 Ga0070675_100003599 3300005354 Bacteria 11787
74 Ga0070675_100003805 3300005354 Bacteria 11456
75 Ga0070675_100004466 3300005354 Bacteria 10667
76 Ga0070675_100005236 3300005354 Bacteria 9898
77 Ga0070675_100018523 3300005354 Bacteria 5544
78 Ga0070675_100025109 3300005354 Bacteria 4775
79 Ga0070675_100036855 3300005354 Bacteria 3982
80 Ga0070675_100039451 3300005354 Bacteria 3853
81 Ga0070675_100076331 3300005354 Bacteria 2787
82 Ga0070675_100086005 3300005354 Bacteria 2627
83 Ga0070675_100092816 3300005354 Bacteria 2531
84 Ga0070675_100112339 3300005354 Bacteria 2307
85 Ga0070675_100139881 3300005354 Bacteria 2069
86 Ga0070675_100162626 3300005354 Bacteria 1921
87 Ga0070671_100026568 3300005355 Bacteria 4759
88 Ga0070671_100026757 3300005355 Bacteria 4744
89 Ga0070671_100044066 3300005355 Bacteria 3707
90 Ga0070671_100067896 3300005355 Bacteria 2973
91 Ga0070671_100083344 3300005355 Bacteria 2673
92 Ga0070671_100132433 3300005355 Bacteria 2100
93 Ga0070674_100039604 3300005356 Bacteria 3184
94 Ga0070674_100074754 3300005356 Bacteria 2405
95 Ga0070674_100175840 3300005356 Bacteria 1636
96 Ga0070673_100013476 3300005364 Bacteria 5658
97 Ga0070673_100024349 3300005364 Bacteria 4438
98 Ga0070673_100028511 3300005364 Bacteria 4153
99 Ga0070673_100030309 3300005364 Bacteria 4046
100 Ga0070673_100037732 3300005364 Bacteria 3683
101 Ga0070673_100053604 3300005364 Bacteria 3169
102 Ga0070688_100001469 3300005365 Bacteria 11704
103 Ga0070688_100007851 3300005365 Bacteria 5770
104 Ga0070688_100009789 3300005365 Bacteria 5265
105 Ga0070688_100028770 3300005365 Bacteria 3321
106 Ga0070688_100043186 3300005365 Bacteria 2776
107 Ga0070688_100087439 3300005365 Bacteria 2030
108 Ga0070659_100020780 3300005366 Bacteria 4992
109 Ga0070659_100067705 3300005366 Bacteria 2832
110 Ga0070667_100028584 3300005367 Bacteria 4642
111 Ga0070667_100059563 3300005367 Bacteria 3230
112 Ga0070667_100260920 3300005367 Bacteria 1551
113 Ga0070709_10001229 3300005434 Bacteria 14045
114 Ga0070714_100011142 3300005435 Bacteria 7127
115 Ga0070714_100019140 3300005435 Bacteria 5573
116 Ga0070713_100003818 3300005436 Bacteria 9970
117 Ga0070713_100009874 3300005436 Bacteria 6867
118 Ga0070713_100014146 3300005436 Bacteria 5913
119 Ga0070713_100409165 3300005436 Bacteria 1268
120 Ga0070701_10009060 3300005438 Bacteria 4344
121 Ga0070701_10016856 3300005438 Bacteria 3405
122 Ga0070705_100000578 3300005440 Bacteria 21273
123 Ga0070705_100004206 3300005440 Bacteria 7030
124 Ga0070705_100009633 3300005440 Bacteria 4808
125 Ga0070705_100078093 3300005440 Unclassified 2024
126 Ga0070705_100231924 3300005440 Bacteria 1285
127 Ga0070700_100002426 3300005441 Bacteria 9493
128 Ga0070700_100011538 3300005441 Bacteria 4897
129 Ga0070700_100033750 3300005441 Bacteria 3085
130 Ga0070700_100112912 3300005441 Bacteria 1809
131 Ga0070694_100012204 3300005444 Bacteria 5339
132 Ga0070694_100012406 3300005444 Bacteria 5296
133 Ga0070694_100024346 3300005444 Bacteria 3907
134 Ga0070694_100100079 3300005444 Bacteria 2050
135 Ga0070694_100213336 3300005444 Bacteria 1445
136 Ga0070708_100008245 3300005445 Bacteria 8365
137 Ga0070708_100081280 3300005445 Bacteria 2934
138 Ga0070708_100170013 3300005445 Bacteria 2034
139 Ga0070663_100016695 3300005455 Bacteria 4776
140 Ga0070663_100078067 3300005455 Bacteria 2426
141 Ga0070663_100175618 3300005455 Bacteria 1658
142 Ga0070678_100026473 3300005456 Bacteria 3922
143 Ga0070678_100131841 3300005456 Bacteria 1987
144 Ga0070678_100135310 3300005456 Bacteria 1964
145 Ga0070678_100136269 3300005456 Bacteria 1958
146 Ga0070678_100154596 3300005456 Bacteria 1852
147 Ga0070662_100015165 3300005457 Bacteria 5156
148 Ga0070662_100086103 3300005457 Bacteria 2350
149 Ga0070662_100169665 3300005457 Bacteria 1713
150 Ga0070662_100183498 3300005457 Bacteria 1651
151 Ga0070681_10003182 3300005458 Bacteria 15287
152 Ga0070681_10027541 3300005458 Bacteria 5714
153 Ga0070681_10338138 3300005458 Bacteria 1415
154 Ga0070681_10407187 3300005458 Bacteria 1272
155 Ga0068867_100005370 3300005459 Bacteria 9060
156 Ga0068867_100006297 3300005459 Bacteria 8396
157 Ga0068867_100021910 3300005459 Bacteria 4563
158 Ga0068867_100039829 3300005459 Bacteria 3427
159 Ga0068867_100165568 3300005459 Bacteria 1747
160 Ga0070685_10007833 3300005466 Bacteria 5469
161 Ga0070685_10013390 3300005466 Bacteria 4324
162 Ga0070685_10054417 3300005466 Bacteria 2321
163 Ga0070685_10090103 3300005466 Bacteria 1855
164 Ga0070685_10107806 3300005466 Bacteria 1711
165 Ga0070706_100004428 3300005467 Bacteria 13564
166 Ga0070706_100009225 3300005467 Bacteria 9192
167 Ga0070706_100012509 3300005467 Bacteria 7860
168 Ga0070706_100032615 3300005467 Bacteria 4805
169 Ga0070706_100050048 3300005467 Bacteria 3856
170 Ga0070706_100173872 3300005467 Bacteria 2011
171 Ga0070707_100005678 3300005468 Bacteria 11651
172 Ga0070707_100007127 3300005468 Bacteria 10366
173 Ga0070707_100010426 3300005468 Bacteria 8655
174 Ga0070707_100067124 3300005468 Bacteria 3449
175 Ga0070707_100069496 3300005468 Bacteria 3391
176 Ga0070707_100079569 3300005468 Bacteria 3163
177 Ga0070707_100229368 3300005468 Bacteria 1808
178 Ga0070698_100002994 3300005471 Bacteria 18609
179 Ga0070698_100014186 3300005471 Bacteria 8422
180 Ga0070698_100019157 3300005471 Bacteria 7194
181 Ga0070698_100019232 3300005471 Bacteria 7176
182 Ga0070698_100025565 3300005471 Bacteria 6154
183 Ga0070698_100062473 3300005471 Bacteria 3758
184 Ga0070698_100097531 3300005471 Bacteria 2915
185 Ga0070698_100101836 3300005471 Bacteria 2843
186 Ga0070698_100130472 3300005471 Bacteria 2469
187 Ga0070698_100208485 3300005471 Bacteria 1890
188 Ga0070699_100000346 3300005518 Bacteria 44833
189 Ga0070699_100001478 3300005518 Bacteria 21521
190 Ga0070699_100001918 3300005518 Bacteria 18790
191 Ga0070699_100004383 3300005518 Bacteria 12471
192 Ga0070699_100004733 3300005518 Bacteria 12029
193 Ga0070699_100108942 3300005518 Bacteria 2431
194 Ga0070699_100147846 3300005518 Bacteria 2077
195 Ga0070699_100251656 3300005518 Bacteria 1578
196 Ga0070679_100271417 3300005530 Bacteria 1650
197 Ga0070684_100058430 3300005535 Bacteria 3371
198 Ga0070684_100061777 3300005535 Bacteria 3280
199 Ga0070697_100002599 3300005536 Bacteria 13893
200 Ga0070697_100018537 3300005536 Bacteria 5487
201 Ga0070697_100061332 3300005536 Bacteria 3067
202 Ga0070697_100074303 3300005536 Bacteria 2793
203 Ga0070697_100126882 3300005536 Bacteria 2137
204 Ga0070697_100133649 3300005536 Unclassified 2082
205 Ga0070697_100230011 3300005536 Bacteria 1581
206 Ga0070697_100237038 3300005536 Bacteria 1557
207 Ga0070672_100002400 3300005543 Bacteria 11863
208 Ga0070672_100011951 3300005543 Bacteria 6070
209 Ga0070672_100014113 3300005543 Bacteria 5654
210 Ga0070672_100038500 3300005543 Bacteria 3654
211 Ga0070672_100048803 3300005543 Bacteria 3291
212 Ga0070672_100063580 3300005543 Bacteria 2915
213 Ga0070672_100065840 3300005543 Bacteria 2867
214 Ga0070672_100130333 3300005543 Bacteria 2066
215 Ga0070672_100239060 3300005543 Unclassified 1527
216 Ga0070686_100000389 3300005544 Bacteria 28031
217 Ga0070686_100003096 3300005544 Bacteria 9114
218 Ga0070695_100000001 3300005545 Bacteria 150757
219 Ga0070695_100000155 3300005545 Bacteria 32258
220 Ga0070695_100006557 3300005545 Bacteria 6878
221 Ga0070695_100060102 3300005545 Bacteria 2462
222 Ga0070695_100080846 3300005545 Bacteria 2149
223 Ga0070695_100132550 3300005545 Bacteria 1719
224 Ga0070696_100000499 3300005546 Bacteria 24777
225 Ga0070696_100011530 3300005546 Bacteria 5922
226 Ga0070696_100012876 3300005546 Bacteria 5613
227 Ga0070696_100014340 3300005546 Bacteria 5315
228 Ga0070696_100026489 3300005546 Bacteria 3944
229 Ga0070696_100037761 3300005546 Bacteria 3332
230 Ga0070696_100161469 3300005546 Bacteria 1651
231 Ga0070665_100001535 3300005548 Bacteria 26671
232 Ga0070665_100005335 3300005548 Bacteria 13281
233 Ga0070665_100005633 3300005548 Bacteria 12877
234 Ga0070665_100008373 3300005548 Bacteria 10462
235 Ga0070665_100044136 3300005548 Bacteria 4478
236 Ga0070665_100085824 3300005548 Bacteria 3154
237 Ga0070665_100096348 3300005548 Bacteria 2964
238 Ga0070704_100004806 3300005549 Bacteria 7827
239 Ga0070704_100013480 3300005549 Bacteria 5073
240 Ga0070704_100027985 3300005549 Bacteria 3745
241 Ga0070704_100032495 3300005549 Bacteria 3521
242 Ga0070704_100159659 3300005549 Bacteria 1782
243 Ga0070664_100003519 3300005564 Bacteria 12645
244 Ga0070664_100010094 3300005564 Bacteria 7655
245 Ga0070664_100021168 3300005564 Bacteria 5357
246 Ga0070664_100043334 3300005564 Bacteria 3797
247 Ga0070664_100112150 3300005564 Bacteria 2381
248 Ga0070664_100235096 3300005564 Bacteria 1644
249 Ga0070664_100257173 3300005564 Bacteria 1571
250 Ga0068857_100014602 3300005577 Bacteria 6850
251 Ga0068857_100026939 3300005577 Bacteria 5069
252 Ga0068857_100035158 3300005577 Bacteria 4435
253 Ga0068857_100069095 3300005577 Bacteria 3145
254 Ga0068857_100392093 3300005577 Bacteria 1291
255 Ga0068854_100011771 3300005578 Bacteria 5710
256 Ga0068854_100152009 3300005578 Bacteria 1786
257 Ga0068854_100157595 3300005578 Bacteria 1756
258 Ga0068854_100210859 3300005578 Bacteria 1532
259 Ga0068856_100317905 3300005614 Bacteria 1574
260 Ga0070702_100000153 3300005615 Bacteria 21550
261 Ga0070702_100020699 3300005615 Bacteria 3450
262 Ga0070702_100041336 3300005615 Bacteria 2585
263 Ga0070702_100084963 3300005615 Bacteria 1905
264 Ga0070702_100170388 3300005615 Bacteria 1416
265 Ga0068852_100050096 3300005616 Bacteria 3577
266 Ga0068859_100009133 3300005617 Bacteria 10008
267 Ga0068859_100010205 3300005617 Bacteria 9453
268 Ga0068859_100116308 3300005617 Bacteria 2739
269 Ga0068859_100187982 3300005617 Bacteria 2149
270 Ga0068859_100277433 3300005617 Bacteria 1769
271 Ga0068859_100285400 3300005617 Bacteria 1743
272 Ga0068859_100342316 3300005617 Bacteria 1590
273 Ga0068859_100480126 3300005617 Bacteria 1338
274 Ga0068864_100023290 3300005618 Bacteria 5199
275 Ga0068864_100031127 3300005618 Bacteria 4526
276 Ga0068864_100073503 3300005618 Bacteria 2981
277 Ga0068864_100096638 3300005618 Bacteria 2614
278 Ga0068864_100168127 3300005618 Bacteria 1998
279 Ga0068864_100200541 3300005618 Bacteria 1833
280 Ga0068861_100002974 3300005719 Bacteria 11182
281 Ga0068861_100033397 3300005719 Bacteria 3795
282 Ga0068861_100098192 3300005719 Bacteria 2324
283 Ga0068861_100449349 3300005719 Bacteria 1154
284 Ga0068851_10068409 3300005834 Bacteria 1833
285 Ga0068870_10000595 3300005840 Bacteria 13754
286 Ga0068870_10002177 3300005840 Bacteria 8121
287 Ga0068863_100007204 3300005841 Bacteria 10910
288 Ga0068863_100017949 3300005841 Bacteria 6771
289 Ga0068863_100019511 3300005841 Bacteria 6485
290 Ga0068863_100088220 3300005841 Bacteria 2939
291 Ga0068863_100148469 3300005841 Bacteria 2243
292 Ga0068863_100199172 3300005841 Bacteria 1926
293 Ga0068858_100001189 3300005842 Bacteria 26942
294 Ga0068858_100013485 3300005842 Bacteria 7711
295 Ga0068858_100017801 3300005842 Bacteria 6652
296 Ga0068858_100019692 3300005842 Bacteria 6309
297 Ga0068858_100021737 3300005842 Bacteria 5994
298 Ga0068858_100053904 3300005842 Bacteria 3719
299 Ga0068858_100131767 3300005842 Bacteria 2345
300 Ga0068858_100152523 3300005842 Bacteria 2173
301 Ga0068860_100020931 3300005843 Bacteria 6337
302 Ga0068860_100045691 3300005843 Bacteria 4176
303 Ga0068860_100075347 3300005843 Bacteria 3209
304 Ga0068860_100105547 3300005843 Bacteria 2690
305 Ga0068860_100188787 3300005843 Bacteria 1994
306 Ga0068862_100003731 3300005844 Bacteria 12999
307 Ga0068862_100035062 3300005844 Bacteria 4247
308 Ga0068862_100036167 3300005844 Bacteria 4185
309 Ga0068862_100039812 3300005844 Bacteria 3994
310 Ga0068862_100190266 3300005844 Bacteria 1846
311 Ga0081539_10000093 3300005985 Bacteria 207314
312 Ga0081539_10001136 3300005985 Bacteria 48290
313 Ga0081539_10003103 3300005985 Bacteria 21299
314 Ga0081539_10022160 3300005985 Bacteria 4212
315 Ga0070717_10153985 3300006028 Bacteria 1990
316 Ga0075365_10001748 3300006038 Bacteria 10103
317 Ga0075365_10002173 3300006038 Bacteria 9441
318 Ga0075365_10021174 3300006038 Bacteria 4051
319 Ga0075365_10022464 3300006038 Bacteria 3953
320 Ga0075368_10000187 3300006042 Bacteria 16952
321 Ga0075368_10018561 3300006042 Bacteria 2615
322 Ga0075368_10020078 3300006042 Bacteria 2527
323 Ga0075368_10053336 3300006042 Bacteria 1609
324 Ga0075363_100000316 3300006048 Bacteria 14295
325 Ga0075363_100015142 3300006048 Bacteria 3784
326 Ga0075363_100027390 3300006048 Bacteria 2922
327 Ga0075363_100035163 3300006048 Bacteria 2620
328 Ga0075364_10001673 3300006051 Bacteria 12174
329 Ga0075364_10009904 3300006051 Bacteria 5733
330 Ga0075364_10023890 3300006051 Bacteria 3874
331 Ga0075364_10093904 3300006051 Bacteria 1992
332 Ga0075364_10133839 3300006051 Bacteria 1665
333 Ga0070715_10036856 3300006163 Bacteria 2020
334 Ga0075362_10000255 3300006177 Bacteria 14819
335 Ga0075362_10001616 3300006177 Bacteria 7309
336 Ga0075362_10003766 3300006177 Bacteria 5366
337 Ga0075367_10000522 3300006178 Bacteria 14464
338 Ga0075367_10000879 3300006178 Bacteria 12052
339 Ga0075367_10001875 3300006178 Bacteria 9299
340 Ga0075367_10043340 3300006178 Bacteria 2636
341 Ga0075367_10048792 3300006178 Bacteria 2494
342 Ga0075367_10081000 3300006178 Bacteria 1964
343 Ga0075369_10008128 3300006186 Bacteria 4025
344 Ga0075366_10000322 3300006195 Bacteria 21867
345 Ga0075366_10001215 3300006195 Bacteria 12799
346 Ga0075366_10021446 3300006195 Bacteria 3754
347 Ga0075366_10081945 3300006195 Bacteria 1928
348 Ga0097621_100001459 3300006237 Bacteria 16171
349 Ga0097621_100005845 3300006237 Bacteria 8690
350 Ga0097621_100022037 3300006237 Bacteria 4940
351 Ga0097621_100025087 3300006237 Bacteria 4662
352 Ga0097621_100053601 3300006237 Bacteria 3287
353 Ga0097621_100065705 3300006237 Bacteria 2986
354 Ga0097621_100099369 3300006237 Bacteria 2446
355 Ga0075370_10000989 3300006353 Bacteria 11763
356 Ga0075370_10002195 3300006353 Bacteria 8964
357 Ga0075370_10023697 3300006353 Bacteria 3383
358 Ga0068871_100002675 3300006358 Bacteria 12162
359 Ga0068871_100010750 3300006358 Bacteria 6694
360 Ga0068871_100022423 3300006358 Bacteria 4866
361 Ga0068871_100045322 3300006358 Bacteria 3539
362 Ga0068871_100065658 3300006358 Bacteria 2972
363 Ga0068871_100159556 3300006358 Bacteria 1928
364 Ga0068871_100175016 3300006358 Bacteria 1842
365 Ga0068871_100236522 3300006358 Bacteria 1587
366 Ga0068871_100354334 3300006358 Bacteria 1299
367 Ga0075428_100000185 3300006844 Bacteria 58526
368 Ga0075428_100001280 3300006844 Bacteria 26808
369 Ga0075428_100001446 3300006844 Bacteria 25375
370 Ga0075428_100006198 3300006844 Bacteria 13304
371 Ga0075428_100008564 3300006844 Bacteria 11345
372 Ga0075428_100009291 3300006844 Bacteria 10901
373 Ga0075428_100012430 3300006844 Bacteria 9470
374 Ga0075428_100021075 3300006844 Bacteria 7218
375 Ga0075428_100026906 3300006844 Bacteria 6370
376 Ga0075428_100034478 3300006844 Bacteria 5582
377 Ga0075428_100035422 3300006844 Bacteria 5503
378 Ga0075428_100119596 3300006844 Bacteria 2868
379 Ga0075428_100392384 3300006844 Bacteria 1488
380 Ga0075430_100002132 3300006846 Bacteria 16372
381 Ga0075430_100003023 3300006846 Bacteria 14074
382 Ga0075430_100003870 3300006846 Bacteria 12607
383 Ga0075430_100004199 3300006846 Bacteria 12151
384 Ga0075430_100012727 3300006846 Bacteria 7169
385 Ga0075430_100029567 3300006846 Bacteria 4649
386 Ga0075430_100039049 3300006846 Bacteria 4020
387 Ga0075430_100052635 3300006846 Bacteria 3429
388 Ga0075430_100060471 3300006846 Bacteria 3184
389 Ga0075430_100299898 3300006846 Bacteria 1329
390 Ga0075431_100000373 3300006847 Bacteria 35683
391 Ga0075431_100002264 3300006847 Bacteria 18442
392 Ga0075431_100007134 3300006847 Bacteria 11102
393 Ga0075431_100018235 3300006847 Bacteria 7140
394 Ga0075431_100021410 3300006847 Bacteria 6611
395 Ga0075431_100035406 3300006847 Bacteria 5141
396 Ga0075431_100037491 3300006847 Bacteria 4993
397 Ga0075431_100054199 3300006847 Bacteria 4135
398 Ga0075431_100056264 3300006847 Bacteria 4058
399 Ga0075431_100072903 3300006847 Bacteria 3543
400 Ga0075431_100102893 3300006847 Bacteria 2948
401 Ga0075431_100113244 3300006847 Bacteria 2800
402 Ga0075431_100120492 3300006847 Bacteria 2707
403 Ga0075431_100171495 3300006847 Bacteria 2229
404 Ga0075431_100300913 3300006847 Bacteria 1620
405 Ga0075433_10002985 3300006852 Bacteria 12993
406 Ga0075433_10006599 3300006852 Bacteria 9186
407 Ga0075433_10006822 3300006852 Bacteria 9050
408 Ga0075433_10009859 3300006852 Bacteria 7656
409 Ga0075433_10021172 3300006852 Bacteria 5449
410 Ga0075433_10025021 3300006852 Bacteria 5045
411 Ga0075433_10032074 3300006852 Bacteria 4497
412 Ga0075433_10035188 3300006852 Bacteria 4305
413 Ga0075433_10035760 3300006852 Bacteria 4275
414 Ga0075433_10045217 3300006852 Bacteria 3827
415 Ga0075433_10047600 3300006852 Bacteria 3730
416 Ga0075433_10073732 3300006852 Bacteria 3002
417 Ga0075433_10167532 3300006852 Bacteria 1955
418 Ga0075433_10189384 3300006852 Bacteria 1830
419 Ga0075433_10235385 3300006852 Bacteria 1626
420 Ga0075433_10237001 3300006852 Bacteria 1620
421 Ga0075433_10289828 3300006852 Bacteria 1450
422 Ga0075434_100000731 3300006871 Bacteria 25794
423 Ga0075434_100002369 3300006871 Bacteria 16520
424 Ga0075434_100008333 3300006871 Bacteria 9631
425 Ga0075434_100011984 3300006871 Bacteria 8204
426 Ga0075434_100024211 3300006871 Bacteria 5933
427 Ga0075434_100024802 3300006871 Bacteria 5863
428 Ga0075434_100028894 3300006871 Bacteria 5452
429 Ga0075434_100029393 3300006871 Bacteria 5407
430 Ga0075434_100031225 3300006871 Bacteria 5251
431 Ga0075434_100074457 3300006871 Bacteria 3389
432 Ga0075434_100101777 3300006871 Bacteria 2880
433 Ga0075434_100138004 3300006871 Bacteria 2458
434 Ga0075434_100353251 3300006871 Bacteria 1491
435 Ga0075429_100003913 3300006880 Bacteria 12726
436 Ga0075429_100004068 3300006880 Bacteria 12535
437 Ga0075429_100004956 3300006880 Bacteria 11469
438 Ga0075429_100005224 3300006880 Bacteria 11168
439 Ga0075429_100005784 3300006880 Bacteria 10672
440 Ga0075429_100016230 3300006880 Bacteria 6453
441 Ga0075429_100021887 3300006880 Bacteria 5542
442 Ga0075429_100022310 3300006880 Bacteria 5491
443 Ga0075429_100037163 3300006880 Bacteria 4239
444 Ga0075429_100061324 3300006880 Bacteria 3276
445 Ga0075429_100093695 3300006880 Bacteria 2619
446 Ga0075429_100095622 3300006880 Bacteria 2591
447 Ga0075429_100113467 3300006880 Bacteria 2369
448 Ga0075429_100117838 3300006880 Bacteria 2321
449 Ga0075429_100156217 3300006880 Bacteria 1997
450 Ga0068865_100005643 3300006881 Bacteria 7595
451 Ga0068865_100012805 3300006881 Bacteria 5287
452 Ga0068865_100056541 3300006881 Bacteria 2734
453 Ga0068865_100138737 3300006881 Bacteria 1831
454 Ga0068865_100248289 3300006881 Bacteria 1403
455 Ga0075436_100029447 3300006914 Bacteria 3776
456 Ga0075436_100070091 3300006914 Bacteria 2423
457 Ga0075436_100116289 3300006914 Bacteria 1869
458 Ga0075436_100178143 3300006914 Bacteria 1502
459 Ga0075436_100207319 3300006914 Bacteria 1389
460 Ga0075436_100251327 3300006914 Bacteria 1259
461 Ga0075436_100289226 3300006914 Bacteria 1173
462 Ga0097620_100009133 3300006931 Bacteria 10008
463 Ga0097620_100010205 3300006931 Bacteria 9453
464 Ga0097620_100116301 3300006931 Bacteria 2739
465 Ga0097620_100187991 3300006931 Bacteria 2149
466 Ga0097620_100277410 3300006931 Bacteria 1769
467 Ga0097620_100285404 3300006931 Bacteria 1743
468 Ga0097620_100342343 3300006931 Bacteria 1590
469 Ga0097620_100480116 3300006931 Bacteria 1338
470 Ga0097620_100512561 3300006931 Bacteria 1294
471 Ga0075435_100000052 3300007076 Bacteria 58955
472 Ga0075435_100000404 3300007076 Bacteria 26487
473 Ga0075435_100003568 3300007076 Bacteria 10570
474 Ga0075435_100007864 3300007076 Bacteria 7627
475 Ga0075435_100012963 3300007076 Bacteria 6184
476 Ga0075435_100015716 3300007076 Bacteria 5694
477 Ga0075435_100021740 3300007076 Bacteria 4940
478 Ga0075435_100026855 3300007076 Bacteria 4497
479 Ga0075435_100046358 3300007076 Bacteria 3486
480 Ga0075435_100065047 3300007076 Bacteria 2964
481 Ga0075435_100075361 3300007076 Bacteria 2763
482 Ga0075435_100192867 3300007076 Bacteria 1725
483 Ga0105240_10011048 3300009093 Bacteria 12626
484 Ga0105240_10062219 3300009093 Bacteria 4647
485 Ga0105240_10068347 3300009093 Bacteria 4400
486 Ga0105240_10408376 3300009093 Bacteria 1528
487 Ga0111539_10000156 3300009094 Bacteria 77946
488 Ga0111539_10000160 3300009094 Bacteria 76643
489 Ga0111539_10000270 3300009094 Bacteria 62014
490 Ga0111539_10000324 3300009094 Bacteria 58406
491 Ga0111539_10000696 3300009094 Bacteria 43539
492 Ga0111539_10002555 3300009094 Bacteria 24100
493 Ga0111539_10002949 3300009094 Bacteria 22579
494 Ga0111539_10004422 3300009094 Bacteria 18377
495 Ga0111539_10005052 3300009094 Bacteria 17138
496 Ga0111539_10006977 3300009094 Bacteria 14496
497 Ga0111539_10008296 3300009094 Bacteria 13224
498 Ga0111539_10013117 3300009094 Bacteria 10365
499 Ga0111539_10029312 3300009094 Bacteria 6706
500 Ga0111539_10034783 3300009094 Bacteria 6104
501 Ga0111539_10055606 3300009094 Bacteria 4705
502 Ga0111539_10092328 3300009094 Bacteria 3557
503 Ga0111539_10103837 3300009094 Bacteria 3335
504 Ga0111539_10154451 3300009094 Bacteria 2686
505 Ga0111539_10212420 3300009094 Bacteria 2254
506 Ga0111539_10317099 3300009094 Bacteria 1814
507 Ga0111539_10356257 3300009094 Bacteria 1703
508 Ga0111539_10425764 3300009094 Bacteria 1546
509 Ga0111539_10437248 3300009094 Bacteria 1523
510 Ga0111539_10460950 3300009094 Bacteria 1480
511 Ga0111539_10551888 3300009094 Bacteria 1342
512 Ga0111539_10602778 3300009094 Bacteria 1279
513 Ga0105245_10015209 3300009098 Bacteria 6704
514 Ga0105245_10299277 3300009098 Bacteria 1578
515 Ga0105247_10009155 3300009101 Bacteria 6027
516 Ga0105247_10043414 3300009101 Bacteria 2754
517 Ga0114129_10000307 3300009147 Bacteria 57086
518 Ga0114129_10000371 3300009147 Bacteria 52193
519 Ga0114129_10000408 3300009147 Bacteria 50625
520 Ga0114129_10000789 3300009147 Bacteria 40604
521 Ga0114129_10001485 3300009147 Bacteria 31758
522 Ga0114129_10002512 3300009147 Bacteria 25458
523 Ga0114129_10002976 3300009147 Bacteria 23733
524 Ga0114129_10003376 3300009147 Bacteria 22429
525 Ga0114129_10003839 3300009147 Bacteria 21177
526 Ga0114129_10004401 3300009147 Bacteria 19869
527 Ga0114129_10011453 3300009147 Bacteria 12629
528 Ga0114129_10018940 3300009147 Bacteria 9807
529 Ga0114129_10020006 3300009147 Bacteria 9527
530 Ga0114129_10020472 3300009147 Bacteria 9409
531 Ga0114129_10025138 3300009147 Bacteria 8441
532 Ga0114129_10028539 3300009147 Bacteria 7907
533 Ga0114129_10029022 3300009147 Bacteria 7836
534 Ga0114129_10030915 3300009147 Bacteria 7573
535 Ga0114129_10031216 3300009147 Bacteria 7534
536 Ga0114129_10043738 3300009147 Bacteria 6301
537 Ga0114129_10074121 3300009147 Bacteria 4741
538 Ga0114129_10089707 3300009147 Bacteria 4261
539 Ga0114129_10090426 3300009147 Bacteria 4244
540 Ga0114129_10148635 3300009147 Bacteria 3208
541 Ga0114129_10183389 3300009147 Bacteria 2846
542 Ga0114129_10187259 3300009147 Bacteria 2812
543 Ga0114129_10200198 3300009147 Bacteria 2706
544 Ga0114129_10215160 3300009147 Bacteria 2595
545 Ga0114129_10230305 3300009147 Bacteria 2496
546 Ga0114129_10313663 3300009147 Bacteria 2087
547 Ga0114129_10685264 3300009147 Bacteria 1319
548 Ga0114129_10737072 3300009147 Bacteria 1263
549 Ga0105243_10009286 3300009148 Bacteria 7503
550 Ga0105243_10010331 3300009148 Bacteria 7091
551 Ga0105243_10020118 3300009148 Bacteria 5060
552 Ga0105243_10501327 3300009148 Bacteria 1150
553 Ga0105242_10009242 3300009176 Bacteria 7563
554 Ga0105242_10024360 3300009176 Bacteria 4779
555 Ga0105242_10235946 3300009176 Bacteria 1642
556 Ga0105248_10000664 3300009177 Bacteria 39095
557 Ga0105248_10022913 3300009177 Bacteria 6935
558 Ga0105248_10037673 3300009177 Bacteria 5410
559 Ga0105248_10110888 3300009177 Bacteria 3094
560 Ga0105248_10122926 3300009177 Bacteria 2928
561 Ga0105248_10149386 3300009177 Bacteria 2636
562 Ga0105248_10191801 3300009177 Bacteria 2303
563 Ga0105248_10322789 3300009177 Bacteria 1739
564 Ga0105248_10614595 3300009177 Bacteria 1226
565 Ga0105237_10026334 3300009545 Bacteria 5943
566 Ga0105237_10201661 3300009545 Bacteria 1990
567 Ga0105238_10063751 3300009551 Bacteria 3686
568 Ga0105249_10000918 3300009553 Bacteria 26060
569 Ga0105249_10012062 3300009553 Bacteria 7607
570 Ga0105249_10037699 3300009553 Bacteria 4387
571 Ga0105249_10247945 3300009553 Bacteria 1764
572 Ga0105249_10323631 3300009553 Bacteria 1553
573 Ga0105249_10331160 3300009553 Bacteria 1536
574 Ga0105246_10020796 3300011119 Bacteria 4214
575 Ga0105246_10126138 3300011119 Bacteria 1904
576 Ga0157369_10203349 3300013105 Bacteria 2078
577 Ga0157374_10002073 3300013296 Bacteria 16874
578 Ga0157374_10052814 3300013296 Bacteria 3787
579 Ga0157378_10320788 3300013297 Bacteria 1505
580 Ga0163162_10011402 3300013306 Bacteria 8668
581 Ga0163162_10022874 3300013306 Bacteria 6163
582 Ga0163162_10074473 3300013306 Bacteria 3454
583 Ga0163162_10152487 3300013306 Bacteria 2429
584 Ga0163162_10186499 3300013306 Bacteria 2201
585 Ga0157375_10048928 3300013308 Bacteria 4139
586 Ga0157375_10065147 3300013308 Bacteria 3631
587 Ga0157375_10068990 3300013308 Bacteria 3540
588 Ga0157375_10103262 3300013308 Bacteria 2937
589 Ga0157375_10166281 3300013308 Unclassified 2351
590 Ga0157375_10350807 3300013308 Bacteria 1641
591 Ga0157375_10385068 3300013308 Bacteria 1569
592 Ga0157375_10470754 3300013308 Bacteria 1422
593 Ga0163163_10000071 3300014325 Bacteria 112778
594 Ga0163163_10004809 3300014325 Bacteria 11600
595 Ga0163163_10120836 3300014325 Bacteria 2653
596 Ga0163163_10170607 3300014325 Bacteria 2222
597 Ga0163163_10191023 3300014325 Bacteria 2096
598 Ga0163163_10243315 3300014325 Bacteria 1849
599 Ga0163163_10438416 3300014325 Bacteria 1366
600 Ga0157380_10013458 3300014326 Bacteria 5964
601 Ga0157380_10034893 3300014326 Bacteria 3882
602 Ga0157380_10035610 3300014326 Bacteria 3845
603 Ga0157380_10059429 3300014326 Bacteria 3050
604 Ga0157380_10062877 3300014326 Bacteria 2975
605 Ga0157380_10069645 3300014326 Bacteria 2840
606 Ga0157380_10106531 3300014326 Bacteria 2346
607 Ga0157380_10130237 3300014326 Bacteria 2145
608 Ga0157380_10138972 3300014326 Bacteria 2084
609 Ga0157380_10183966 3300014326 Bacteria 1838
610 Ga0157380_10252211 3300014326 Bacteria 1598
611 Ga0157380_10291239 3300014326 Bacteria 1499
612 Ga0157380_10304241 3300014326 Bacteria 1470
613 Ga0157377_10001507 3300014745 Bacteria 10096
614 Ga0157377_10137578 3300014745 Bacteria 1498
615 Ga0157377_10138251 3300014745 Bacteria 1495
616 Ga0157379_10024463 3300014968 Bacteria 5361
617 Ga0157379_10040072 3300014968 Bacteria 4180
618 Ga0157379_10069759 3300014968 Bacteria 3144
619 Ga0157379_10118520 3300014968 Bacteria 2381
620 Ga0157379_10262727 3300014968 Bacteria 1569
621 Ga0157376_10013740 3300014969 Bacteria 6053
622 Ga0157376_10017805 3300014969 Bacteria 5430
623 Ga0157376_10019635 3300014969 Bacteria 5214
624 Ga0157376_10034156 3300014969 Bacteria 4104
625 Ga0157376_10060947 3300014969 Bacteria 3171
626 Ga0157376_10135307 3300014969 Bacteria 2204
627 Ga0157376_10267496 3300014969 Bacteria 1604
628 Ga0163161_10019798 3300017792 Bacteria 4722
629 Ga0163161_10162283 3300017792 Bacteria 1704
630 Ga0213876_10006867 3300021384 Bacteria 6204
631 Ga0213875_10051717 3300021388 Bacteria 1924
632 Ga0213871_10012564 3300021441 Bacteria 1971
633 Ga0207697_10000081 3300025315 Bacteria 42074
634 Ga0207697_10000859 3300025315 Bacteria 17191
635 Ga0207697_10015962 3300025315 Bacteria 3098
636 Ga0207656_10011322 3300025321 Bacteria 3368
637 Ga0207656_10034002 3300025321 Bacteria 2126
638 Ga0207682_10003668 3300025893 Bacteria 6622
639 Ga0207682_10008568 3300025893 Bacteria 4043
640 Ga0207682_10016256 3300025893 Bacteria 2901
641 Ga0207682_10050030 3300025893 Bacteria 1727
642 Ga0207688_10000175 3300025901 Bacteria 28328
643 Ga0207688_10001748 3300025901 Bacteria 11531
644 Ga0207688_10093726 3300025901 Bacteria 1727
645 Ga0207685_10022549 3300025905 Bacteria 2130
646 Ga0207645_10000703 3300025907 Bacteria 27863
647 Ga0207645_10004989 3300025907 Bacteria 9726
648 Ga0207645_10013596 3300025907 Bacteria 5480
649 Ga0207645_10057998 3300025907 Bacteria 2472
650 Ga0207645_10137861 3300025907 Bacteria 1589
651 Ga0207645_10278439 3300025907 Bacteria 1110
652 Ga0207643_10000659 3300025908 Bacteria 21561
653 Ga0207643_10003278 3300025908 Bacteria 8743
654 Ga0207643_10003545 3300025908 Bacteria 8401
655 Ga0207643_10004895 3300025908 Bacteria 7167
656 Ga0207684_10002365 3300025910 Bacteria 19093
657 Ga0207684_10010457 3300025910 Bacteria 8168
658 Ga0207684_10094407 3300025910 Bacteria 2551
659 Ga0207684_10107005 3300025910 Bacteria 2393
660 Ga0207684_10280410 3300025910 Bacteria 1437
661 Ga0207654_10163622 3300025911 Bacteria 1439
662 Ga0207707_10032200 3300025912 Bacteria 4589
663 Ga0207707_10051040 3300025912 Bacteria 3602
664 Ga0207707_10083906 3300025912 Bacteria 2782
665 Ga0207707_10097772 3300025912 Bacteria 2566
666 Ga0207707_10252209 3300025912 Bacteria 1533
667 Ga0207707_10411063 3300025912 Bacteria 1161
668 Ga0207695_10007956 3300025913 Bacteria 13373
669 Ga0207695_10018579 3300025913 Bacteria 8032
670 Ga0207671_10051456 3300025914 Bacteria 3052
671 Ga0207693_10003762 3300025915 Bacteria 12931
672 Ga0207660_10165361 3300025917 Bacteria 1709
673 Ga0207662_10014269 3300025918 Bacteria 4455
674 Ga0207662_10018751 3300025918 Bacteria 3930
675 Ga0207662_10020071 3300025918 Bacteria 3811
676 Ga0207662_10071121 3300025918 Bacteria 2106
677 Ga0207662_10087969 3300025918 Bacteria 1907
678 Ga0207657_10017295 3300025919 Bacteria 6920
679 Ga0207649_10033009 3300025920 Bacteria 3089
680 Ga0207649_10237393 3300025920 Bacteria 1307
681 Ga0207652_10026301 3300025921 Bacteria 4845
682 Ga0207646_10008400 3300025922 Bacteria 10352
683 Ga0207646_10011103 3300025922 Bacteria 8745
684 Ga0207646_10028669 3300025922 Bacteria 5065
685 Ga0207646_10043644 3300025922 Bacteria 4026
686 Ga0207646_10062795 3300025922 Bacteria 3316
687 Ga0207646_10069126 3300025922 Bacteria 3154
688 Ga0207646_10078015 3300025922 Bacteria 2960
689 Ga0207646_10149029 3300025922 Bacteria 2109
690 Ga0207681_10000808 3300025923 Bacteria 20616
691 Ga0207681_10006008 3300025923 Bacteria 7446
692 Ga0207681_10008481 3300025923 Bacteria 6280
693 Ga0207681_10025744 3300025923 Bacteria 3787
694 Ga0207681_10038184 3300025923 Bacteria 3180
695 Ga0207681_10046024 3300025923 Bacteria 2933
696 Ga0207681_10166314 3300025923 Bacteria 1668
697 Ga0207681_10231337 3300025923 Bacteria 1435
698 Ga0207650_10001995 3300025925 Bacteria 14306
699 Ga0207650_10004750 3300025925 Bacteria 9280
700 Ga0207650_10009640 3300025925 Bacteria 6602
701 Ga0207650_10011892 3300025925 Bacteria 5997
702 Ga0207650_10012937 3300025925 Bacteria 5769
703 Ga0207650_10035203 3300025925 Bacteria 3634
704 Ga0207650_10038244 3300025925 Bacteria 3503
705 Ga0207650_10069096 3300025925 Bacteria 2654
706 Ga0207650_10257824 3300025925 Bacteria 1414
707 Ga0207659_10000076 3300025926 Bacteria 62373
708 Ga0207659_10002812 3300025926 Bacteria 10376
709 Ga0207659_10003576 3300025926 Bacteria 9358
710 Ga0207659_10006571 3300025926 Bacteria 7136
711 Ga0207659_10010468 3300025926 Bacteria 5830
712 Ga0207659_10012655 3300025926 Bacteria 5379
713 Ga0207659_10048735 3300025926 Bacteria 3002
714 Ga0207659_10068782 3300025926 Bacteria 2577
715 Ga0207659_10070589 3300025926 Bacteria 2547
716 Ga0207659_10071040 3300025926 Bacteria 2541
717 Ga0207659_10071645 3300025926 Bacteria 2531
718 Ga0207659_10142364 3300025926 Bacteria 1863
719 Ga0207659_10291417 3300025926 Bacteria 1337
720 Ga0207687_10009881 3300025927 Bacteria 6247
721 Ga0207687_10015618 3300025927 Bacteria 4981
722 Ga0207700_10009310 3300025928 Bacteria 6130
723 Ga0207700_10045485 3300025928 Bacteria 3240
724 Ga0207700_10358144 3300025928 Bacteria 1272
725 Ga0207644_10004800 3300025931 Bacteria 8803
726 Ga0207644_10017765 3300025931 Bacteria 4809
727 Ga0207644_10073361 3300025931 Bacteria 2509
728 Ga0207644_10135843 3300025931 Bacteria 1888
729 Ga0207644_10188002 3300025931 Bacteria 1623
730 Ga0207644_10198406 3300025931 Bacteria 1582
731 Ga0207690_10103263 3300025932 Bacteria 2040
732 Ga0207706_10000390 3300025933 Bacteria 47471
733 Ga0207706_10011236 3300025933 Bacteria 8165
734 Ga0207706_10013278 3300025933 Bacteria 7492
735 Ga0207706_10126412 3300025933 Bacteria 2249
736 Ga0207706_10212713 3300025933 Bacteria 1694
737 Ga0207686_10004368 3300025934 Bacteria 7578
738 Ga0207686_10036898 3300025934 Bacteria 2946
739 Ga0207686_10061435 3300025934 Bacteria 2382
740 Ga0207686_10111888 3300025934 Bacteria 1843
741 Ga0207686_10203108 3300025934 Bacteria 1421
742 Ga0207709_10087481 3300025935 Bacteria 2026
743 Ga0207670_10007140 3300025936 Bacteria 6225
744 Ga0207670_10013055 3300025936 Bacteria 4884
745 Ga0207670_10076244 3300025936 Bacteria 2333
746 Ga0207670_10155802 3300025936 Unclassified 1700
747 Ga0207670_10234871 3300025936 Bacteria 1410
748 Ga0207670_10269564 3300025936 Bacteria 1323
749 Ga0207669_10035712 3300025937 Bacteria 2832
750 Ga0207669_10129407 3300025937 Bacteria 1731
751 Ga0207669_10225962 3300025937 Bacteria 1377
752 Ga0207669_10261655 3300025937 Bacteria 1294
753 Ga0207669_10289000 3300025937 Bacteria 1240
754 Ga0207704_10015344 3300025938 Bacteria 3902
755 Ga0207704_10025756 3300025938 Bacteria 3215
756 Ga0207704_10026635 3300025938 Bacteria 3175
757 Ga0207704_10121194 3300025938 Bacteria 1790
758 Ga0207704_10260530 3300025938 Bacteria 1307
759 Ga0207691_10000697 3300025940 Bacteria 33255
760 Ga0207691_10003713 3300025940 Bacteria 14811
761 Ga0207691_10020421 3300025940 Bacteria 6261
762 Ga0207691_10030634 3300025940 Bacteria 5025
763 Ga0207691_10039583 3300025940 Bacteria 4361
764 Ga0207691_10082395 3300025940 Bacteria 2889
765 Ga0207691_10093958 3300025940 Bacteria 2684
766 Ga0207691_10110778 3300025940 Bacteria 2441
767 Ga0207691_10127772 3300025940 Bacteria 2248
768 Ga0207711_10027843 3300025941 Bacteria 4750
769 Ga0207711_10041623 3300025941 Bacteria 3912
770 Ga0207711_10041929 3300025941 Bacteria 3898
771 Ga0207711_10045880 3300025941 Bacteria 3734
772 Ga0207711_10066907 3300025941 Bacteria 3109
773 Ga0207711_10081369 3300025941 Bacteria 2830
774 Ga0207711_10112357 3300025941 Bacteria 2424
775 Ga0207711_10216365 3300025941 Bacteria 1751
776 Ga0207689_10000944 3300025942 Bacteria 27922
777 Ga0207689_10001675 3300025942 Bacteria 21042
778 Ga0207689_10104988 3300025942 Bacteria 2321
779 Ga0207689_10122409 3300025942 Bacteria 2139
780 Ga0207689_10189634 3300025942 Bacteria 1696
781 Ga0207661_10016797 3300025944 Bacteria 5404
782 Ga0207661_10061119 3300025944 Bacteria 3043
783 Ga0207661_10188052 3300025944 Bacteria 1809
784 Ga0207679_10011333 3300025945 Bacteria 5768
785 Ga0207679_10028683 3300025945 Bacteria 3866
786 Ga0207679_10049203 3300025945 Bacteria 3074
787 Ga0207679_10113327 3300025945 Bacteria 2145
788 Ga0207651_10012741 3300025960 Bacteria 4775
789 Ga0207651_10019111 3300025960 Bacteria 4097
790 Ga0207651_10094385 3300025960 Bacteria 2199
791 Ga0207651_10118581 3300025960 Bacteria 2002
792 Ga0207651_10159842 3300025960 Bacteria 1765
793 Ga0207651_10162583 3300025960 Bacteria 1752
794 Ga0207712_10024163 3300025961 Bacteria 4021
795 Ga0207668_10372177 3300025972 Bacteria 1200
796 Ga0207668_10383156 3300025972 Bacteria 1184
797 Ga0207640_10131219 3300025981 Bacteria 1812
798 Ga0207640_10136928 3300025981 Bacteria 1779
799 Ga0207640_10158282 3300025981 Bacteria 1672
800 Ga0207658_10038900 3300025986 Bacteria 3430
801 Ga0207658_10212712 3300025986 Bacteria 1621
802 Ga0207677_10018039 3300026023 Bacteria 4227
803 Ga0207677_10022830 3300026023 Bacteria 3852
804 Ga0207677_10094329 3300026023 Bacteria 2184
805 Ga0207677_10095699 3300026023 Bacteria 2171
806 Ga0207677_10183431 3300026023 Bacteria 1648
807 Ga0207677_10245041 3300026023 Bacteria 1452
808 Ga0207703_10008596 3300026035 Bacteria 8059
809 Ga0207703_10010663 3300026035 Bacteria 7178
810 Ga0207703_10024671 3300026035 Bacteria 4731
811 Ga0207703_10029019 3300026035 Bacteria 4364
812 Ga0207703_10118545 3300026035 Bacteria 2269
813 Ga0207703_10141864 3300026035 Bacteria 2086
814 Ga0207703_10145622 3300026035 Bacteria 2060
815 Ga0207639_10177808 3300026041 Unclassified 1808
816 Ga0207639_10216468 3300026041 Bacteria 1652
817 Ga0207678_10050761 3300026067 Bacteria 3583
818 Ga0207678_10051330 3300026067 Bacteria 3560
819 Ga0207678_10091298 3300026067 Bacteria 2603
820 Ga0207708_10013389 3300026075 Bacteria 6129
821 Ga0207708_10014977 3300026075 Bacteria 5810
822 Ga0207708_10019196 3300026075 Bacteria 5150
823 Ga0207708_10032141 3300026075 Bacteria 3986
824 Ga0207708_10040632 3300026075 Bacteria 3545
825 Ga0207708_10068386 3300026075 Bacteria 2719
826 Ga0207708_10070047 3300026075 Bacteria 2686
827 Ga0207708_10078829 3300026075 Bacteria 2530
828 Ga0207708_10288851 3300026075 Bacteria 1331
829 Ga0207641_10002582 3300026088 Bacteria 16638
830 Ga0207641_10048341 3300026088 Bacteria 3590
831 Ga0207641_10062303 3300026088 Bacteria 3182
832 Ga0207641_10138181 3300026088 Bacteria 2195
833 Ga0207641_10257292 3300026088 Bacteria 1633
834 Ga0207641_10268670 3300026088 Bacteria 1600
835 Ga0207641_10353107 3300026088 Bacteria 1402
836 Ga0207648_10000821 3300026089 Bacteria 35108
837 Ga0207648_10021176 3300026089 Bacteria 5846
838 Ga0207648_10026438 3300026089 Bacteria 5157
839 Ga0207648_10027253 3300026089 Bacteria 5075
840 Ga0207648_10028891 3300026089 Bacteria 4915
841 Ga0207648_10042395 3300026089 Bacteria 3994
842 Ga0207676_10009653 3300026095 Bacteria 6867
843 Ga0207676_10029836 3300026095 Bacteria 4087
844 Ga0207676_10056367 3300026095 Bacteria 3089
845 Ga0207676_10178086 3300026095 Bacteria 1859
846 Ga0207676_10240274 3300026095 Bacteria 1624
847 Ga0207676_10357222 3300026095 Bacteria 1353
848 Ga0207676_10519594 3300026095 Bacteria 1133
849 Ga0207674_10021650 3300026116 Bacteria 6922
850 Ga0207674_10027260 3300026116 Bacteria 6048
851 Ga0207674_10129264 3300026116 Bacteria 2490
852 Ga0207674_10186825 3300026116 Bacteria 2022
853 Ga0207674_10420748 3300026116 Bacteria 1291
854 Ga0207675_100012476 3300026118 Bacteria 7937
855 Ga0207675_100028140 3300026118 Bacteria 5233
856 Ga0207675_100036435 3300026118 Bacteria 4589
857 Ga0207675_100039984 3300026118 Bacteria 4376
858 Ga0207675_100040529 3300026118 Bacteria 4349
859 Ga0207675_100042017 3300026118 Bacteria 4268
860 Ga0207675_100046772 3300026118 Bacteria 4042
861 Ga0207675_100048339 3300026118 Bacteria 3971
862 Ga0207675_100116962 3300026118 Bacteria 2520
863 Ga0207675_100118864 3300026118 Bacteria 2499
864 Ga0207675_100134538 3300026118 Bacteria 2345
865 Ga0207675_100281005 3300026118 Bacteria 1617
866 Ga0207683_10012599 3300026121 Bacteria 7213
867 Ga0207683_10026021 3300026121 Bacteria 5053
868 Ga0207683_10027273 3300026121 Bacteria 4936
869 Ga0207683_10057984 3300026121 Bacteria 3399
870 Ga0207683_10074035 3300026121 Bacteria 3013
871 Ga0207683_10141816 3300026121 Bacteria 2165
872 Ga0207683_10194565 3300026121 Bacteria 1842
873 Ga0207683_10237053 3300026121 Bacteria 1664
874 Ga0209813_10000512 3300027866 Bacteria 9141
875 Ga0209813_10035191 3300027866 Bacteria 1498
876 Ga0207428_10000070 3300027907 Bacteria 147650
877 Ga0207428_10000234 3300027907 Bacteria 76592
878 Ga0207428_10000400 3300027907 Bacteria 53869
879 Ga0207428_10000481 3300027907 Bacteria 48194
880 Ga0207428_10000970 3300027907 Bacteria 31814
881 Ga0207428_10002148 3300027907 Bacteria 19811
882 Ga0207428_10003192 3300027907 Bacteria 16044
883 Ga0207428_10004284 3300027907 Bacteria 13648
884 Ga0207428_10012387 3300027907 Bacteria 7492
885 Ga0207428_10043674 3300027907 Bacteria 3619
886 Ga0207428_10079947 3300027907 Bacteria 2555
887 Ga0207428_10124185 3300027907 Bacteria 1977
888 Ga0207428_10129058 3300027907 Bacteria 1935
889 Ga0207428_10197336 3300027907 Bacteria 1515
890 Ga0268266_10003216 3300028379 Bacteria 16509
891 Ga0268266_10018204 3300028379 Bacteria 5989
892 Ga0268266_10036472 3300028379 Bacteria 4185
893 Ga0268266_10061556 3300028379 Bacteria 3237
894 Ga0268265_10001312 3300028380 Bacteria 21329
895 Ga0268265_10016423 3300028380 Bacteria 5085
896 Ga0268265_10045899 3300028380 Bacteria 3263
897 Ga0268265_10109520 3300028380 Bacteria 2251
898 Ga0268265_10135216 3300028380 Bacteria 2056
899 Ga0268265_10206601 3300028380 Bacteria 1708
900 Ga0268265_10285298 3300028380 Bacteria 1479
901 Ga0268264_10006226 3300028381 Bacteria 10069
902 Ga0268264_10023051 3300028381 Bacteria 5080
903 Ga0268264_10116951 3300028381 Bacteria 2344
904 Ga0268264_10170366 3300028381 Bacteria 1968
905 Ga0265320_10056306 3300031240 Bacteria 1890
906 Ga0307408_100033103 3300031548 Bacteria 3608
907 Ga0307408_100035134 3300031548 Bacteria 3515
908 Ga0307408_100059370 3300031548 Bacteria 2784
909 Ga0307408_100126278 3300031548 Bacteria 1990
910 Ga0307408_100159240 3300031548 Bacteria 1791
911 Ga0316579_10008200 3300031691 Bacteria 4347
912 Ga0265314_10017566 3300031711 Bacteria 5611
913 Ga0307405_10000373 3300031731 Bacteria 16766
914 Ga0307405_10022391 3300031731 Bacteria 3572
915 Ga0307405_10046263 3300031731 Bacteria 2672
916 Ga0316577_10004072 3300031733 Bacteria 7491
917 Ga0316577_10011921 3300031733 Bacteria 4723
918 Ga0307413_10010814 3300031824 Bacteria 4450
919 Ga0307413_10050111 3300031824 Bacteria 2507
920 Ga0307410_10020313 3300031852 Bacteria 4059
921 Ga0307410_10031856 3300031852 Bacteria 3387
922 Ga0307410_10116585 3300031852 Bacteria 1941
923 Ga0307410_10266071 3300031852 Bacteria 1339
924 Ga0307410_10334537 3300031852 Bacteria 1205
925 Ga0307406_10007994 3300031901 Bacteria 5893
926 Ga0307406_10021479 3300031901 Bacteria 3818
927 Ga0307407_10002148 3300031903 Bacteria 7581
928 Ga0307407_10008101 3300031903 Bacteria 4800
929 Ga0307407_10012900 3300031903 Bacteria 4037
930 Ga0307407_10113261 3300031903 Bacteria 1707
931 Ga0307412_10003351 3300031911 Bacteria 8902
932 Ga0307412_10037270 3300031911 Bacteria 3123
933 Ga0307409_100001999 3300031995 Bacteria 10458
934 Ga0307409_100006545 3300031995 Bacteria 6861
935 Ga0307409_100038377 3300031995 Bacteria 3542
936 Ga0307409_100309075 3300031995 Bacteria 1474
937 Ga0307409_100398375 3300031995 Bacteria 1314
938 Ga0307416_100004712 3300032002 Bacteria 8265
939 Ga0307416_100018870 3300032002 Bacteria 4874
940 Ga0307416_100019475 3300032002 Bacteria 4812
941 Ga0307416_100031948 3300032002 Bacteria 3971
942 Ga0307416_100034559 3300032002 Bacteria 3848
943 Ga0307416_100072405 3300032002 Bacteria 2868
944 Ga0307416_100091844 3300032002 Bacteria 2609
945 Ga0307416_100307291 3300032002 Bacteria 1580
946 Ga0307416_100363192 3300032002 Bacteria 1471
947 Ga0307414_10029924 3300032004 Bacteria 3551
948 Ga0307414_10031537 3300032004 Bacteria 3478
949 Ga0307414_10081630 3300032004 Bacteria 2368
950 Ga0307414_10251627 3300032004 Bacteria 1469
951 Ga0307411_10000802 3300032005 Bacteria 11716
952 Ga0307411_10013781 3300032005 Bacteria 4476
953 Ga0307411_10018788 3300032005 Bacteria 3976
954 Ga0307411_10058335 3300032005 Bacteria 2554
955 Ga0307411_10059648 3300032005 Bacteria 2530
956 Ga0307411_10065630 3300032005 Bacteria 2435
957 Ga0307415_100020045 3300032126 Bacteria 4073
958 Ga0307415_100020627 3300032126 Bacteria 4028
959 Ga0307415_100026945 3300032126 Bacteria 3634
960 Ga0307415_100060077 3300032126 Bacteria 2625
961 Ga0307415_100077262 3300032126 Bacteria 2363
962 Ga0307415_100152027 3300032126 Bacteria 1783
963 Ga0307415_100216487 3300032126 Bacteria 1532
964 Ga0316585_10025073 3300032137 Unclassified 1848
965 Ga0307507_10175969 3300033179 Bacteria 1542
966 Ga0373948_0000676 3300034817 Bacteria 4431
967 Ga0373938_0001388 3300034957 Bacteria 3874
968 Ga0373934_0000325 3300035086 Bacteria 16805
969 Ga0373951_0003229 3300035091 Bacteria 3986
970 Ga0373932_0003775 3300035112 Bacteria 3612
971 Ga0373932_0003989 3300035112 Bacteria 3515
972 Ga0373939_0005435 3300035114 Bacteria 3034
973 Ga0373941_0002913 3300035115 Bacteria 3816
974 Ga0373941_0075170 3300035115 Bacteria 1130
975 Ga0373945_0074859 3300035116 Bacteria 1288
976 Ga0373956_0009905 3300035119 Bacteria 3885
977 Ga0373957_0007056 3300035120 Bacteria 3573
978 Ga0373960_0000470 3300035121 Bacteria 7983
979 Ga0373943_0178810 3300035170 Bacteria 1165
980 Ga0373946_0006590 3300035171 Bacteria 4214
981 Ga0373946_0115245 3300035171 Bacteria 1221
982 Ga0373955_0113000 3300035172 Bacteria 1572
983 Ga0373942_0000397 3300035207 Bacteria 12081
984 Ga0373961_0001177 3300035241 Bacteria 8144
985 Ga0316574_0118045 3300035398 Bacteria 1702
986 Ga0373924_0035833 3300035410 Bacteria 2013
987 Ga0373931_0000745 3300035691 Bacteria 13573
988 Ga0373931_0121855 3300035691 Bacteria 1491
989 Ga0373935_0086377 3300035692 Bacteria 2047
990 Ga0373927_0172763 3300035695 Bacteria 1417
991 Ga0373933_0005577 3300035724 Bacteria 6858
992 Ga0373933_0052198 3300035724 Bacteria 2446
993 Ga0373933_0061846 3300035724 Bacteria 2260
994 Ga0373933_0242448 3300035724 Bacteria 1159
995 Ga0373947_0003351 3300035725 Bacteria 9485
996 Ga0373947_0073535 3300035725 Bacteria 2101
997 Ga0373947_0252306 3300035725 Bacteria 1167
998 Ga0373937_0000553 3300036401 Bacteria 33171
999 Ga0373937_0005022 3300036401 Bacteria 11259
1000 Ga0373937_0045652 3300036401 Bacteria 4004
1001 Ga0373937_0114119 3300036401 Bacteria 2514
1002 Ga0373937_0138202 3300036401 Bacteria 2279
1003 Ga0316582_0019928 3300036647 Bacteria 3934
1004 Ga0316582_0073152 3300036647 Bacteria 2224
1005 Ga0316582_0235184 3300036647 Bacteria 1254
1006 Ga0316584_0006669 3300036712 Bacteria 7829
1007 Ga0316584_0014292 3300036712 Bacteria 5646
1008 Ga0316584_0017430 3300036712 Bacteria 5163
1009 Ga0316584_0023607 3300036712 Bacteria 4493
1010 Ga0373925_0001772 3300037068 Bacteria 18014
1011 Ga0373925_0036314 3300037068 Bacteria 3637
1012 Ga0373925_0179181 3300037068 Bacteria 1676
1013 Ga0395900_0093819 3300037418 Bacteria 3083
1014 Ga0395898_0059755 3300037466 Bacteria 3707
1015 Ga0316581_0004087 3300037588 Bacteria 3689
1016 Ga0436364_0590967 3300037853 Bacteria 2641
1017 Ga0436364_1082044 3300037853 Bacteria 18328
1018 Ga0436364_1302977 3300037853 Bacteria 2357
1019 Ga0436364_1305890 3300037853 Bacteria 22680
1020 Ga0436364_1472607 3300037853 Bacteria 2472
1021 Ga0436364_1561614 3300037853 Bacteria 2954
1022 Ga0395901_0047163 3300038443 Bacteria 4474
1023 Ga0436365_0139158 3300039437 Bacteria 50885
1024 Ga0436365_0376598 3300039437 Bacteria 3136
1025 Ga0436365_0651011 3300039437 Bacteria 2653
1026 Ga0436365_1086484 3300039437 Unclassified 2300
1027 Ga0436365_1466729 3300039437 Bacteria 1277
1028 Ga0436360_0552544 3300039438 Bacteria 1058
1029 Ga0436361_0344725 3300039447 Unclassified 2135
1030 Ga0436363_0783963 3300039450 Bacteria 1496
1031 Ga0436362_0261806 3300039453 Unclassified 1259
1032 Ga0436362_0371299 3300039453 Bacteria 2442
1033 Ga0439453_0003954 3300041408 Bacteria 2174
1034 Ga0439433_0020844 3300041999 Bacteria 1464
1035 Ga0439450_004696 3300042008 Bacteria 2352
1036 Ga0439462_0042081 3300042015 Bacteria 1220
1037 Ga0439446_0002820 3300042156 Bacteria 4225
1038 Ga0439434_0054737 3300042435 Bacteria 1241
1039 Ga0439435_0001535 3300042436 Bacteria 4306
1040 Ga0439435_0002906 3300042436 Bacteria 3481
1041 Ga0439435_0009051 3300042436 Bacteria 2328
1042 Ga0439435_0019563 3300042436 Bacteria 1737
1043 Ga0439464_0011961 3300042439 Bacteria 2305
1044 Ga0439464_0022799 3300042439 Bacteria 1727
1045 Ga0439464_0037890 3300042439 Bacteria 1369
1046 Ga0439460_0003307 3300042461 Bacteria 3905
1047 Ga0439460_0013868 3300042461 Bacteria 2113
1048 Ga0451577_0083619 3300042876 Bacteria 2847
1049 Ga0451577_0136756 3300042876 Bacteria 2200
1050 Ga0451577_0140841 3300042876 Bacteria 2167
1051 Ga0466972_0003571 3300044658 Bacteria 7730
1052 Ga0466965_0005467 3300044683 Bacteria 5728
1053 Ga0453684_0025392 3300044712 Bacteria 8605
1054 Ga0453684_0200007 3300044712 Bacteria 2330
1055 Ga0453684_0403822 3300044712 Bacteria 1530
1056 Ga0466968_0000343 3300044735 Bacteria 15044
1057 Ga0466960_0001705 3300044901 Bacteria 8058
1058 Ga0466960_0003254 3300044901 Bacteria 6222
1059 Ga0466960_0042912 3300044901 Bacteria 2149
1060 Ga0451576_0008579 3300045051 Bacteria 11977
1061 Ga0451576_0035534 3300045051 Bacteria 5285
1062 Ga0451576_0037883 3300045051 Bacteria 5105
1063 Ga0451576_0109277 3300045051 Bacteria 2877
1064 Ga0451576_0196605 3300045051 Bacteria 2106
1065 Ga0495592_0111810 3300046454 Bacteria 1932
1066 Ga0495592_0117608 3300046454 Bacteria 1874
1067 Ga0495592_0122636 3300046454 Bacteria 1826
1068 Ga0495592_0233332 3300046454 Bacteria 1224
1069 Ga0495603_0018871 3300046455 Bacteria 4174
1070 Ga0495603_0049212 3300046455 Bacteria 2509
1071 Ga0495603_0128026 3300046455 Bacteria 1479
1072 Ga0495603_0169570 3300046455 Bacteria 1265
1073 Ga0495629_0030437 3300046459 Bacteria 3827
1074 Ga0495629_0077711 3300046459 Bacteria 2317
1075 Ga0495629_0093372 3300046459 Bacteria 2100
1076 Ga0495629_0187228 3300046459 Bacteria 1433
1077 Ga0495638_0013639 3300046460 Bacteria 5521
1078 Ga0495638_0021731 3300046460 Bacteria 4220
1079 Ga0495651_0022991 3300046462 Bacteria 4848
1080 Ga0495653_0205253 3300046463 Bacteria 1335
1081 Ga0495582_0095485 3300046473 Bacteria 1661
1082 Ga0495664_0059284 3300046477 Bacteria 2278
1083 Ga0495584_0012217 3300046491 Bacteria 4387
1084 Ga0495608_0003061 3300046511 Bacteria 11950
1085 Ga0495628_0158473 3300046516 Bacteria 1721
1086 Ga0495630_0048503 3300046517 Bacteria 3178
1087 Ga0495630_0351424 3300046517 Bacteria 1128
1088 Ga0495643_0005940 3300046522 Bacteria 8145
1089 Ga0495642_0004288 3300046528 Bacteria 5544
1090 Ga0495640_0094560 3300046533 Bacteria 1968
1091 Ga0495586_0045465 3300046535 Bacteria 2366
1092 Ga0495586_0059180 3300046535 Bacteria 2082
1093 Ga0495586_0081698 3300046535 Bacteria 1776
1094 Ga0495598_0006925 3300046537 Unclassified 2578
1095 Ga0495598_0030293 3300046537 Bacteria 1515
1096 Ga0495609_0006559 3300046538 Bacteria 5928
1097 Ga0495609_0013870 3300046538 Bacteria 3799
1098 Ga0495621_0006268 3300046539 Bacteria 3462
1099 Ga0495645_0000493 3300046543 Bacteria 27347
1100 Ga0495667_0057927 3300046559 Bacteria 2546
1101 Ga0495656_0037964 3300046615 Bacteria 1993
1102 Ga0495656_0059848 3300046615 Bacteria 1658
1103 Ga0495634_0090105 3300046642 Bacteria 1993
1104 Ga0495634_0254622 3300046642 Unclassified 1073
1105 Ga0495635_0124885 3300046663 Bacteria 1755
1106 Ga0495635_0204655 3300046663 Bacteria 1338
1107 Ga0495659_0005434 3300046664 Bacteria 4009
1108 Ga0495659_0033411 3300046664 Bacteria 1806
1109 Ga0495588_0023048 3300046674 Bacteria 3079
1110 Ga0495599_0079706 3300046678 Bacteria 2045
1111 Ga0495658_0004399 3300046683 Bacteria 6939
1112 Ga0495658_0012264 3300046683 Bacteria 4335
1113 Ga0495669_0022032 3300046684 Unclassified 2767
1114 Ga0495613_0001719 3300046689 Bacteria 16660
1115 Ga0495613_0101747 3300046689 Bacteria 2075
1116 Ga0495613_0114944 3300046689 Bacteria 1937
1117 Ga0495636_0051556 3300047318 Bacteria 1725
1118 Ga0495636_0053425 3300047318 Bacteria 1696
1119 Ga0495674_0045345 3300047319 Bacteria 3904
1120 Ga0495674_0046339 3300047319 Bacteria 3859
1121 Ga0495674_0186251 3300047319 Bacteria 1727
1122 Ga0495672_0054727 3300047320 Bacteria 2330
1123 Ga0495685_003103 3300047447 Bacteria 5271
1124 Ga0495684_0009207 3300047471 Bacteria 7622
1125 Ga0495684_0048074 3300047471 Bacteria 3262
1126 Ga0495684_0050126 3300047471 Bacteria 3189
1127 Ga0495684_0067641 3300047471 Bacteria 2717
1128 Ga0495593_0223807 3300047673 Bacteria 944
1129 Ga0496100_0178629 3300048903 Bacteria 1534
1130 Ga0496101_0173885 3300048904 Bacteria 1656
1131 Ga0496102_0021815 3300048905 Bacteria 5668
1132 Ga0496102_0061953 3300048905 Bacteria 3425
1133 Ga0496102_0073068 3300048905 Bacteria 3152
1134 Ga0496102_0113568 3300048905 Bacteria 2527
1135 Ga0496102_0300036 3300048905 Bacteria 1514
1136 Ga0496104_0023831 3300048907 Bacteria 5628
1137 Ga0496104_0030192 3300048907 Bacteria 5035
1138 Ga0496104_0060848 3300048907 Bacteria 3578
1139 Ga0496104_0196168 3300048907 Bacteria 1931
1140 Ga0496104_0252226 3300048907 Bacteria 1677
1141 Ga0496104_0257083 3300048907 Bacteria 1659
1142 Ga0496104_0331960 3300048907 Bacteria 1434
1143 Ga0496105_0060932 3300048908 Bacteria 3114
1144 Ga0496105_0220907 3300048908 Bacteria 1542
1145 Ga0496106_0034476 3300048909 Bacteria 3780
1146 Ga0496106_0056067 3300048909 Bacteria 2979
1147 Ga0496107_0037865 3300048910 Bacteria 3462
1148 Ga0496107_0071330 3300048910 Bacteria 2524
1149 Ga0496108_0000077 3300048911 Bacteria 104725
1150 Ga0496108_0006264 3300048911 Bacteria 9640
1151 Ga0496108_0013522 3300048911 Bacteria 6661
1152 Ga0496109_0009858 3300048912 Bacteria 8155
1153 Ga0496109_0036244 3300048912 Bacteria 4453
1154 Ga0496109_0198310 3300048912 Bacteria 1887
1155 Ga0496109_0525862 3300048912 Bacteria 1116
1156 Ga0496110_0051930 3300048913 Bacteria 3603
1157 Ga0496110_0102383 3300048913 Bacteria 2568
1158 Ga0496110_0175965 3300048913 Bacteria 1942
1159 Ga0496111_0024229 3300048914 Bacteria 4271
1160 Ga0496111_0217367 3300048914 Bacteria 1420
1161 Ga0496112_0010820 3300048915 Bacteria 8301
1162 Ga0496112_0026730 3300048915 Bacteria 5559
1163 Ga0496112_0190677 3300048915 Bacteria 2012
1164 Ga0496112_0456760 3300048915 Unclassified 1215
1165 Ga0496113_0074221 3300048916 Bacteria 2593
1166 Ga0496113_0091816 3300048916 Bacteria 2341
1167 Ga0496114_0011050 3300048917 Bacteria 7203
1168 Ga0496114_0041678 3300048917 Bacteria 3805
1169 Ga0496114_0053075 3300048917 Bacteria 3378
1170 Ga0496115_0006646 3300048918 Bacteria 8486
1171 Ga0496115_0044889 3300048918 Bacteria 3527
1172 Ga0496115_0194379 3300048918 Bacteria 1676
1173 Ga0501298_005591 3300049521 Bacteria 2023
1174 Ga0501031_0002515 3300049568 Bacteria 11674
1175 Ga0501031_0065947 3300049568 Bacteria 2359
1176 Ga0501031_0077081 3300049568 Bacteria 2171
1177 Ga0501032_0000594 3300049569 Bacteria 29204
1178 Ga0501032_0015836 3300049569 Bacteria 5316
1179 Ga0501032_0025751 3300049569 Bacteria 4054
1180 Ga0501032_0040454 3300049569 Bacteria 3169
1181 Ga0501032_0049435 3300049569 Bacteria 2836
1182 Ga0501033_0002780 3300049570 Bacteria 14670
1183 Ga0501033_0003021 3300049570 Bacteria 14040
1184 Ga0501033_0003873 3300049570 Bacteria 12164
1185 Ga0501033_0014866 3300049570 Bacteria 5909
1186 Ga0501033_0118080 3300049570 Bacteria 1927
1187 Ga0501034_0000989 3300049571 Bacteria 40796
1188 Ga0501034_0007042 3300049571 Bacteria 11994
1189 Ga0501034_0029251 3300049571 Bacteria 5601
1190 Ga0501034_0031709 3300049571 Bacteria 5367
1191 Ga0501034_0063566 3300049571 Bacteria 3704
1192 Ga0501036_0006817 3300049572 Bacteria 9280
1193 Ga0501036_0012231 3300049572 Bacteria 7109
1194 Ga0501036_0102611 3300049572 Bacteria 2419
1195 Ga0501036_0128739 3300049572 Bacteria 2137
1196 Ga0501037_0008778 3300049573 Bacteria 7411
1197 Ga0501037_0008815 3300049573 Bacteria 7392
1198 Ga0501037_0021628 3300049573 Bacteria 4755
1199 Ga0501037_0053384 3300049573 Bacteria 2956
1200 Ga0501037_0067497 3300049573 Bacteria 2604
1201 Ga0501037_0169340 3300049573 Bacteria 1553
1202 Ga0501038_0006000 3300049574 Bacteria 11236
1203 Ga0501038_0026332 3300049574 Bacteria 5179
1204 Ga0501039_0013772 3300049575 Bacteria 6187
1205 Ga0501039_0017140 3300049575 Bacteria 5555
1206 Ga0501039_0022659 3300049575 Bacteria 4820
1207 Ga0501039_0034163 3300049575 Bacteria 3924
1208 Ga0501039_0037595 3300049575 Bacteria 3737
1209 Ga0501039_0093667 3300049575 Bacteria 2341
1210 Ga0501039_0124465 3300049575 Bacteria 2022
1211 Ga0501040_0000223 3300049576 Bacteria 33236
1212 Ga0501040_0043247 3300049576 Bacteria 3070
1213 Ga0501040_0081272 3300049576 Bacteria 2246
1214 Ga0501040_0127135 3300049576 Bacteria 1790
1215 Ga0501040_0151808 3300049576 Bacteria 1634
1216 Ga0501041_0011415 3300049577 Bacteria 5250
1217 Ga0501041_0014294 3300049577 Bacteria 4713
1218 Ga0501041_0017929 3300049577 Bacteria 4214
1219 Ga0501041_0031457 3300049577 Bacteria 3207
1220 Ga0501041_0076403 3300049577 Bacteria 2061
1221 Ga0501041_0215916 3300049577 Bacteria 1203
1222 Ga0501042_0001934 3300049578 Bacteria 12467
1223 Ga0501042_0002776 3300049578 Bacteria 10822
1224 Ga0501042_0066852 3300049578 Bacteria 2570
1225 Ga0501042_0068486 3300049578 Bacteria 2538
1226 Ga0501043_0000285 3300049579 Bacteria 45721
1227 Ga0501043_0004957 3300049579 Bacteria 10770
1228 Ga0501043_0021725 3300049579 Bacteria 5031
1229 Ga0501043_0037724 3300049579 Bacteria 3800
1230 Ga0501043_0078462 3300049579 Bacteria 2595
1231 Ga0501043_0105304 3300049579 Bacteria 2216
1232 Ga0501043_0113866 3300049579 Bacteria 2124
1233 Ga0501043_0164537 3300049579 Bacteria 1732
1234 Ga0501046_0001864 3300049580 Bacteria 20078
1235 Ga0501046_0009389 3300049580 Bacteria 8456
1236 Ga0501046_0013407 3300049580 Bacteria 6940
1237 Ga0501046_0031107 3300049580 Bacteria 4330
1238 Ga0501046_0053464 3300049580 Bacteria 3180
1239 Ga0501046_0091027 3300049580 Bacteria 2346
1240 Ga0501047_0001605 3300049581 Bacteria 22037
1241 Ga0501047_0002079 3300049581 Bacteria 19160
1242 Ga0501047_0002524 3300049581 Bacteria 17437
1243 Ga0501047_0032690 3300049581 Bacteria 5023
1244 Ga0501047_0112880 3300049581 Bacteria 2599
1245 Ga0501048_0030431 3300049582 Bacteria 3906
1246 Ga0501048_0037392 3300049582 Bacteria 3485
1247 Ga0501048_0046852 3300049582 Bacteria 3086
1248 Ga0501048_0053807 3300049582 Bacteria 2860
1249 Ga0501048_0066877 3300049582 Bacteria 2540
1250 Ga0501048_0073792 3300049582 Bacteria 2408
1251 Ga0501048_0127839 3300049582 Bacteria 1797
1252 Ga0501048_0135564 3300049582 Bacteria 1740
1253 Ga0501048_0135839 3300049582 Bacteria 1738
1254 Ga0501067_0020421 3300049583 Bacteria 3666
1255 Ga0501067_0023005 3300049583 Bacteria 3451
1256 Ga0501067_0032476 3300049583 Bacteria 2898
1257 Ga0501067_0037370 3300049583 Bacteria 2697
1258 Ga0501067_0038010 3300049583 Bacteria 2673
1259 Ga0501067_0046308 3300049583 Bacteria 2414
1260 Ga0501068_0028241 3300049584 Bacteria 3316
1261 Ga0501068_0029674 3300049584 Bacteria 3240
1262 Ga0501068_0032487 3300049584 Bacteria 3104
1263 Ga0501068_0069299 3300049584 Bacteria 2150
1264 Ga0501068_0112699 3300049584 Bacteria 1692
1265 Ga0501069_0000964 3300049585 Bacteria 13706
1266 Ga0501069_0004730 3300049585 Bacteria 7041
1267 Ga0501070_0023127 3300049586 Bacteria 5205
1268 Ga0501070_0081194 3300049586 Bacteria 2682
1269 Ga0501070_0088768 3300049586 Bacteria 2558
1270 Ga0501070_0672293 3300049586 Bacteria 821
1271 Ga0501071_0001640 3300049587 Bacteria 13148
1272 Ga0501071_0001811 3300049587 Bacteria 12650
1273 Ga0501071_0011572 3300049587 Bacteria 5953
1274 Ga0501071_0012597 3300049587 Bacteria 5742
1275 Ga0501071_0014104 3300049587 Bacteria 5464
1276 Ga0501071_0060411 3300049587 Bacteria 2744
1277 Ga0501071_0201233 3300049587 Bacteria 1496
1278 Ga0501072_0012508 3300049588 Bacteria 6489
1279 Ga0501072_0024980 3300049588 Bacteria 4652
1280 Ga0501072_0032710 3300049588 Bacteria 4073
1281 Ga0501072_0034747 3300049588 Bacteria 3950
1282 Ga0501072_0115505 3300049588 Bacteria 2137
1283 Ga0501072_0119091 3300049588 Bacteria 2104
1284 Ga0501073_0001727 3300049589 Bacteria 16237
1285 Ga0501073_0003896 3300049589 Bacteria 11208
1286 Ga0501073_0004945 3300049589 Bacteria 10002
1287 Ga0501073_0014655 3300049589 Bacteria 5695
1288 Ga0501073_0018175 3300049589 Bacteria 5081
1289 Ga0501073_0033355 3300049589 Bacteria 3666
1290 Ga0501073_0096697 3300049589 Bacteria 2051
1291 Ga0501073_0156392 3300049589 Bacteria 1580
1292 Ga0501074_0025661 3300049590 Bacteria 4277
1293 Ga0501074_0030303 3300049590 Bacteria 3920
1294 Ga0501074_0089372 3300049590 Bacteria 2206
1295 Ga0501074_0294327 3300049590 Bacteria 1153
1296 Ga0501075_0024239 3300049591 Bacteria 4446
1297 Ga0501075_0026333 3300049591 Bacteria 4280
1298 Ga0501075_0028887 3300049591 Bacteria 4097
1299 Ga0501075_0052530 3300049591 Bacteria 3064
1300 Ga0501075_0135639 3300049591 Bacteria 1875
1301 Ga0501075_0141537 3300049591 Bacteria 1833
1302 Ga0501075_0259906 3300049591 Unclassified 1323
1303 Ga0501075_0286415 3300049591 Bacteria 1255
1304 Ga0501076_0000179 3300049592 Bacteria 37508
1305 Ga0501076_0004732 3300049592 Bacteria 9712
1306 Ga0501076_0007584 3300049592 Bacteria 7900
1307 Ga0501076_0023784 3300049592 Bacteria 4727
1308 Ga0501076_0041119 3300049592 Bacteria 3635
1309 Ga0501076_0055225 3300049592 Bacteria 3150
1310 Ga0501076_0068314 3300049592 Bacteria 2839
1311 Ga0501076_0108504 3300049592 Bacteria 2242
1312 Ga0501076_0253131 3300049592 Bacteria 1441
1313 Ga0501077_0018060 3300049593 Bacteria 4458
1314 Ga0501077_0037003 3300049593 Bacteria 3109
1315 Ga0501077_0055677 3300049593 Bacteria 2511
1316 Ga0501079_0003374 3300049741 Bacteria 11714
1317 Ga0501079_0017221 3300049741 Bacteria 5517
1318 Ga0501079_0031287 3300049741 Bacteria 4090
1319 Ga0501079_0042597 3300049741 Bacteria 3505
1320 Ga0501079_0045898 3300049741 Bacteria 3372
1321 Ga0501079_0051801 3300049741 Bacteria 3170
1322 Ga0501079_0062463 3300049741 Bacteria 2873
1323 Ga0501079_0084175 3300049741 Bacteria 2460
1324 Ga0501079_0113743 3300049741 Bacteria 2104
1325 Ga0501079_0133726 3300049741 Bacteria 1930
1326 Ga0501079_0276527 3300049741 Unclassified 1313
1327 Ga0501080_0014909 3300049742 Bacteria 7155
1328 Ga0501080_0020114 3300049742 Bacteria 6178
1329 Ga0501080_0042829 3300049742 Bacteria 4214
1330 Ga0501080_0051305 3300049742 Bacteria 3838
1331 Ga0501080_0054814 3300049742 Bacteria 3713
1332 Ga0501080_0086788 3300049742 Bacteria 2908
1333 Ga0501080_0132665 3300049742 Bacteria 2306
1334 Ga0501080_0167400 3300049742 Bacteria 2028
1335 Ga0501080_0365220 3300049742 Bacteria 1302
1336 Ga0501081_0017108 3300049743 Bacteria 4796
1337 Ga0501081_0039608 3300049743 Bacteria 3226
1338 Ga0501081_0085999 3300049743 Bacteria 2207
1339 Ga0501081_0208773 3300049743 Bacteria 1418
1340 Ga0501081_0286558 3300049743 Bacteria 1207
1341 Ga0501083_0001360 3300049744 Bacteria 16618
1342 Ga0501083_0016462 3300049744 Bacteria 5175
1343 Ga0501083_0150803 3300049744 Bacteria 1522
1344 Ga0501035_0014031 3300049822 Bacteria 7392
1345 Ga0501035_0062886 3300049822 Bacteria 3302
1346 Ga0501035_0063294 3300049822 Bacteria 3290
1347 Ga0501035_0070710 3300049822 Bacteria 3091
1348 Ga0501035_0103723 3300049822 Bacteria 2494
1349 Ga0501035_0141613 3300049822 Bacteria 2090
1350 Ga0501035_0172317 3300049822 Bacteria 1869
1351 Ga0501035_0282765 3300049822 Bacteria 1402
1352 Ga0501044_0003133 3300049823 Bacteria 18734
1353 Ga0501044_0004893 3300049823 Bacteria 14967
1354 Ga0501044_0039726 3300049823 Bacteria 4906
1355 Ga0501044_0070579 3300049823 Bacteria 3553
1356 Ga0501044_0077632 3300049823 Bacteria 3367
1357 Ga0501045_0004268 3300049824 Bacteria 9856
1358 Ga0501045_0008879 3300049824 Bacteria 7017
1359 Ga0501045_0009645 3300049824 Bacteria 6756
1360 Ga0501045_0031327 3300049824 Bacteria 3852
1361 Ga0501045_0074760 3300049824 Bacteria 2495
1362 Ga0501045_0101489 3300049824 Bacteria 2130
1363 Ga0501045_0106232 3300049824 Bacteria 2080
1364 nmdc:mga03683_265_c1 3300050489 Bacteria 16161
1365 nmdc:mga03683_41095_c1 3300050489 Bacteria 1899
1366 nmdc:mga03n38_1246_c1 3300050490 Bacteria 7162
1367 nmdc:mga03n38_20788_c1 3300050490 Bacteria 2632
1368 nmdc:mga00v17_14477_c1 3300050491 Bacteria 4403
1369 nmdc:mga00v17_156279_c1 3300050491 Bacteria 1467
1370 nmdc:mga00v17_37918_c1 3300050491 Bacteria 2880
1371 nmdc:mga00v17_77713_c1 3300050491 Bacteria 2067
1372 nmdc:mga0yw44_1474_c1 3300050492 Bacteria 9375
1373 nmdc:mga0yw44_160852_c1 3300050492 Bacteria 1470
1374 nmdc:mga0yw44_22799_c1 3300050492 Bacteria 3517
1375 nmdc:mga0yw44_40858_c1 3300050492 Bacteria 2758
1376 nmdc:mga0k408_11896_c1 3300050493 Bacteria 4748
1377 nmdc:mga0k408_145299_c1 3300050493 Bacteria 1412
1378 nmdc:mga0k408_18006_c1 3300050493 Bacteria 3938
1379 nmdc:mga0k408_18784_c1 3300050493 Bacteria 3860
1380 nmdc:mga0k408_22366_c1 3300050493 Bacteria 3560
1381 nmdc:mga0k408_31950_c1 3300050493 Bacteria 3008
1382 nmdc:mga0k408_4239_c1 3300050493 Bacteria 7608
1383 nmdc:mga06z11_12999_c1 3300050494 Bacteria 3639
1384 nmdc:mga06z11_2066_c1 3300050494 Bacteria 7623
1385 nmdc:mga06z11_2787_c1 3300050494 Bacteria 6697
1386 nmdc:mga06z11_34056_c1 3300050494 Bacteria 2497
1387 nmdc:mga04h51_279_c1 3300050495 Bacteria 13081
1388 nmdc:mga04h51_33034_c1 3300050495 Bacteria 1645
1389 nmdc:mga07m45_25880_c1 3300050496 Bacteria 3222
1390 nmdc:mga07m45_30385_c1 3300050496 Bacteria 2992
1391 nmdc:mga05p37_1026_c1 3300050507 Bacteria 31791
1392 nmdc:mga05p37_108734_c1 3300050507 Bacteria 3411
1393 nmdc:mga05p37_109221_c1 3300050507 Bacteria 3000
1394 nmdc:mga05p37_111890_c1 3300050507 Bacteria 3358
1395 nmdc:mga05p37_153982_c1 3300050507 Bacteria 2810
1396 nmdc:mga05p37_16784_c1 3300050507 Bacteria 8827
1397 nmdc:mga05p37_176062_c1 3300050507 Bacteria 2606
1398 nmdc:mga05p37_18019_c1 3300050507 Bacteria 8529
1399 nmdc:mga05p37_18668_c1 3300050507 Bacteria 8381
1400 nmdc:mga05p37_236821_c1 3300050507 Bacteria 2197
1401 nmdc:mga05p37_257578_c1 3300050507 Bacteria 2090
1402 nmdc:mga05p37_25860_c1 3300050507 Bacteria 7137
1403 nmdc:mga05p37_322971_c1 3300050507 Bacteria 1826
1404 nmdc:mga05p37_330777_c1 3300050507 Bacteria 1800
1405 nmdc:mga05p37_34310_c1 3300050507 Bacteria 6214
1406 nmdc:mga05p37_34620_c1 3300050507 Bacteria 6187
1407 nmdc:mga05p37_38415_c1 3300050507 Bacteria 5872
1408 nmdc:mga05p37_445259_c1 3300050507 Bacteria 1501
1409 nmdc:mga05p37_4675_c1 3300050507 Bacteria 16005
1410 nmdc:mga05p37_53467_c1 3300050507 Bacteria 4966
1411 nmdc:mga05p37_5387_c1 3300050507 Bacteria 15041
1412 nmdc:mga05p37_548435_c1 3300050507 Bacteria 1317
1413 nmdc:mga05p37_6052_c1 3300050507 Bacteria 14241
1414 nmdc:mga05p37_651139_c1 3300050507 Bacteria 1180
1415 nmdc:mga05p37_6700_c1 3300050507 Bacteria 13572
1416 nmdc:mga05p37_7021_c1 3300050507 Bacteria 13274
1417 nmdc:mga05p37_708658_c1 3300050507 Bacteria 1117
1418 nmdc:mga05p37_78381_c1 3300050507 Bacteria 4068
1419 nmdc:mga05p37_83007_c1 3300050507 Bacteria 3948
1420 nmdc:mga09592_120546_c1 3300050508 Bacteria 2253
1421 nmdc:mga09592_139339_c1 3300050508 Bacteria 2090
1422 nmdc:mga09592_14385_c1 3300050508 Bacteria 6459
1423 nmdc:mga09592_15209_c1 3300050508 Bacteria 6288
1424 nmdc:mga09592_2118_c1 3300050508 Bacteria 16016
1425 nmdc:mga09592_21193_c1 3300050508 Bacteria 5355
1426 nmdc:mga09592_21228_c1 3300050508 Bacteria 5351
1427 nmdc:mga09592_219_c1 3300050508 Bacteria 41151
1428 nmdc:mga09592_26367_c1 3300050508 Bacteria 4814
1429 nmdc:mga09592_3794_c1 3300050508 Bacteria 12162
1430 nmdc:mga09592_7566_c1 3300050508 Bacteria 8836
1431 nmdc:mga09592_87113_c1 3300050508 Bacteria 2665
1432 nmdc:mga09592_92922_c1 3300050508 Bacteria 2579
1433 nmdc:mga09592_938_c1 3300050508 Bacteria 14168
1434 nmdc:mga0qj67_11622_c1 3300050509 Bacteria 6603
1435 nmdc:mga0qj67_160753_c1 3300050509 Bacteria 1823
1436 nmdc:mga0qj67_181242_c1 3300050509 Unclassified 1711
1437 nmdc:mga0qj67_23504_c1 3300050509 Bacteria 4744
1438 nmdc:mga0qj67_29438_c1 3300050509 Bacteria 4266
1439 nmdc:mga0qj67_32481_c1 3300050509 Bacteria 4071
1440 nmdc:mga0qj67_39067_c1 3300050509 Bacteria 3726
1441 nmdc:mga0qj67_402_c1 3300050509 Bacteria 29827
1442 nmdc:mga0qj67_43311_c1 3300050509 Bacteria 3545
1443 nmdc:mga0qj67_73854_c1 3300050509 Bacteria 2724
1444 nmdc:mga0qj67_937_c1 3300050509 Bacteria 20089
1445 nmdc:mga0qj67_9878_c1 3300050509 Bacteria 7115
1446 nmdc:mga06r32_113865_c1 3300050510 Bacteria 2663
1447 nmdc:mga06r32_1407_c1 3300050510 Bacteria 21715
1448 nmdc:mga06r32_1608_c1 3300050510 Bacteria 20365
1449 nmdc:mga06r32_255436_c1 3300050510 Bacteria 1740
1450 nmdc:mga06r32_288400_c1 3300050510 Bacteria 1628
1451 nmdc:mga06r32_329721_c1 3300050510 Bacteria 1511
1452 nmdc:mga06r32_38073_c1 3300050510 Bacteria 4553
1453 nmdc:mga06r32_39351_c1 3300050510 Bacteria 4485
1454 nmdc:mga06r32_49845_c1 3300050510 Bacteria 4006
1455 nmdc:mga06r32_62317_c1 3300050510 Unclassified 3593
1456 nmdc:mga06r32_68410_c1 3300050510 Bacteria 3431
1457 nmdc:mga06r32_75625_c1 3300050510 Bacteria 3269
1458 nmdc:mga06r32_97439_c1 3300050510 Bacteria 2882
1459 nmdc:mga08y16_10_c1 3300050511 Bacteria 470512
1460 nmdc:mga08y16_13034_c1 3300050511 Bacteria 8748
1461 nmdc:mga08y16_142065_c1 3300050511 Bacteria 2496
1462 nmdc:mga08y16_16069_c1 3300050511 Bacteria 7871
1463 nmdc:mga08y16_1646_c1 3300050511 Bacteria 22621
1464 nmdc:mga08y16_1915_c1 3300050511 Bacteria 21221
1465 nmdc:mga08y16_194135_c1 3300050511 Bacteria 2105
1466 nmdc:mga08y16_196337_c1 3300050511 Bacteria 2092
1467 nmdc:mga08y16_221968_c1 3300050511 Bacteria 1956
1468 nmdc:mga08y16_2467_c1 3300050511 Bacteria 18993
1469 nmdc:mga08y16_254091_c1 3300050511 Bacteria 1816
1470 nmdc:mga08y16_280094_c1 3300050511 Bacteria 1720
1471 nmdc:mga08y16_3210_c1 3300050511 Bacteria 16913
1472 nmdc:mga08y16_353_c1 3300050511 Bacteria 41478
1473 nmdc:mga08y16_35677_c1 3300050511 Bacteria 5223
1474 nmdc:mga08y16_389_c1 3300050511 Bacteria 40159
1475 nmdc:mga08y16_46066_c1 3300050511 Bacteria 4567
1476 nmdc:mga08y16_4788_c1 3300050511 Bacteria 14118
1477 nmdc:mga08y16_5423_c1 3300050511 Bacteria 13335
1478 nmdc:mga08y16_5683_c1 3300050511 Bacteria 13067
1479 nmdc:mga08y16_60570_c1 3300050511 Bacteria 3953
1480 nmdc:mga08y16_71377_c1 3300050511 Bacteria 3619
1481 nmdc:mga08y16_80748_c1 3300050511 Bacteria 3391
1482 nmdc:mga08y16_99013_c1 3300050511 Bacteria 3036
1483 nmdc:mga0n895_10132_c1 3300050512 Bacteria 8296
1484 nmdc:mga0n895_119673_c1 3300050512 Bacteria 2654
1485 nmdc:mga0n895_1316_c1 3300050512 Bacteria 18393
1486 nmdc:mga0n895_202988_c1 3300050512 Bacteria 2013
1487 nmdc:mga0n895_23367_c1 3300050512 Bacteria 3985
1488 nmdc:mga0n895_24690_c1 3300050512 Bacteria 5667
1489 nmdc:mga0n895_269171_c1 3300050512 Bacteria 1728
1490 nmdc:mga0n895_26996_c1 3300050512 Bacteria 5448
1491 nmdc:mga0n895_308189_c1 3300050512 Bacteria 1605
1492 nmdc:mga0n895_3430_c1 3300050512 Bacteria 12790
1493 nmdc:mga0n895_34345_c1 3300050512 Bacteria 4880
1494 nmdc:mga0n895_49179_c1 3300050512 Bacteria 4130
1495 nmdc:mga0n895_511201_c1 3300050512 Bacteria 1209
1496 nmdc:mga0n895_53821_c1 3300050512 Bacteria 3956
1497 nmdc:mga0n895_87737_c1 3300050512 Bacteria 3109
1498 nmdc:mga0n895_8_c1 3300050512 Bacteria 121439
1499 nmdc:mga0n895_97727_c1 3300050512 Bacteria 2942
1500 nmdc:mga0rr50_10032_c1 3300050513 Bacteria 5993
1501 nmdc:mga0rr50_113520_c1 3300050513 Bacteria 2147
1502 nmdc:mga0rr50_141743_c1 3300050513 Bacteria 1934
1503 nmdc:mga0rr50_145528_c1 3300050513 Bacteria 1910
1504 nmdc:mga0rr50_23725_c1 3300050513 Bacteria 4237
1505 nmdc:mga0rr50_23_c1 3300050513 Bacteria 116800
1506 nmdc:mga0rr50_46504_c1 3300050513 Bacteria 3196
1507 nmdc:mga0rr50_618_c1 3300050513 Bacteria 19051
1508 nmdc:mga0rr50_73526_c1 3300050513 Bacteria 2614
1509 nmdc:mga0rr50_92664_c1 3300050513 Bacteria 2356
1510 nmdc:mga08x19_12493_c1 3300050514 Bacteria 5119
1511 nmdc:mga08x19_165_c1 3300050514 Bacteria 54991
1512 nmdc:mga08x19_166032_c1 3300050514 Bacteria 1501
1513 nmdc:mga08x19_74849_c1 3300050514 Bacteria 2213
1514 nmdc:mga08x19_9112_c1 3300050514 Bacteria 5925
1515 nmdc:mga0a205_10903_c1 3300050515 Bacteria 8361
1516 nmdc:mga0a205_1158_c1 3300050515 Bacteria 21936
1517 nmdc:mga0a205_126867_c1 3300050515 Bacteria 2451
1518 nmdc:mga0a205_133545_c1 3300050515 Bacteria 2382
1519 nmdc:mga0a205_17674_c1 3300050515 Bacteria 6693
1520 nmdc:mga0a205_17695_c1 3300050515 Bacteria 6689
1521 nmdc:mga0a205_1881_c1 3300050515 Bacteria 18198
1522 nmdc:mga0a205_22816_c1 3300050515 Bacteria 5933
1523 nmdc:mga0a205_24895_c1 3300050515 Bacteria 5696
1524 nmdc:mga0a205_39035_c1 3300050515 Bacteria 2793
1525 nmdc:mga0a205_40980_c1 3300050515 Bacteria 3140
1526 nmdc:mga0a205_43612_c1 3300050515 Bacteria 4324
1527 nmdc:mga0a205_95171_c1 3300050515 Bacteria 2877
1528 nmdc:mga0sz30_10389_c1 3300050516 Bacteria 3567
1529 Ga0495595_0032412 3300053084 Bacteria 2354
1530 Ga0495595_0047937 3300053084 Bacteria 1972
1531 Ga0495619_0011947 3300053085 Bacteria 5470
1532 Ga0495619_0070915 3300053085 Bacteria 2331
1533 Ga0495619_0115027 3300053085 Bacteria 1840
1534 Ga0495619_0190764 3300053085 Bacteria 1418
1535 Ga0495619_0211269 3300053085 Bacteria 1344
1536 Ga0500646_0041707 3300053090 Bacteria 1294
1537 Ga0500641_0005555 3300053096 Bacteria 4466
1538 Ga0500568_0002816 3300053139 Bacteria 10044
1539 Ga0500616_0007973 3300053153 Bacteria 6647
1540 Ga0500645_006429 3300053730 Bacteria 4195
1541 Ga0500645_013479 3300053730 Bacteria 2623
1542 Ga0501084_0000669 3300054114 Bacteria 26157
1543 Ga0501084_0021923 3300054114 Bacteria 5328
1544 Ga0501084_0026735 3300054114 Bacteria 4818
1545 Ga0501084_0037950 3300054114 Bacteria 4026
1546 Ga0501084_0052591 3300054114 Bacteria 3407
1547 Ga0501084_0071570 3300054114 Bacteria 2904
1548 Ga0501084_0125809 3300054114 Bacteria 2157
1549 Ga0501084_0146406 3300054114 Bacteria 1990
1550 Ga0501084_0248691 3300054114 Bacteria 1501
1551 Ga0501084_0310300 3300054114 Bacteria 1332
1552 Ga0590071_000443 3300059421 Bacteria 12027
1553 Ga0590071_000759 3300059421 Bacteria 9033
1554 Ga0590074_000489 3300059423 Bacteria 5840
1555 Ga0590074_006229 3300059423 Bacteria 1980
1556 Ga0590075_000255 3300059424 Bacteria 15045
1557 Ga0590075_000473 3300059424 Bacteria 10800
1558 Ga0590075_009706 3300059424 Bacteria 2308
1559 Ga0590075_023976 3300059424 Unclassified 1530
1560 Ga0590077_000033 3300059426 Bacteria 32115
1561 Ga0590077_000272 3300059426 Bacteria 14641
1562 Ga0590077_001357 3300059426 Bacteria 5775
1563 Ga0501082_0006545 3300060353 Bacteria 10095
1564 Ga0501082_0018802 3300060353 Bacteria 5953
1565 Ga0501082_0023847 3300060353 Bacteria 5276
1566 Ga0501082_0042784 3300060353 Bacteria 3905
1567 Ga0501082_0049299 3300060353 Bacteria 3631
1568 Ga0501082_0122567 3300060353 Bacteria 2254
1569 Ga0501082_0123224 3300060353 Bacteria 2248
1570 Ga0501082_0179954 3300060353 Bacteria 1839
1571 Ga0501082_0297195 3300060353 Bacteria 1406
1572 Ga0501082_0372452 3300060353 Bacteria 1246
1573 Ga0530510_0000198 3300061734 Bacteria 37256
1574 Ga0530510_0002864 3300061734 Bacteria 11858
1575 Ga0530510_0054064 3300061734 Bacteria 2902
1576 Ga0530510_0100495 3300061734 Bacteria 2115
1577 Ga0530510_0207328 3300061734 Bacteria 1456
1578 Ga0530510_0282030 3300061734 Bacteria 1241

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049586 Ga0501070_0672293 Ga0501070_0672293_51_806 248
2 3300049588 Ga0501072_0119091 Ga0501072_0119091_97_948 278
3 3300046517 Ga0495630_0351424 Ga0495630_0351424_14_913 295
4 3300047673 Ga0495593_0223807 Ga0495593_0223807_33_932 295
5 3300025907 Ga0207645_10278439 Ga0207645_102784391 301
6 3300039453 Ga0436362_0261806 Ga0436362_0261806_33_971 303
7 3300009176 Ga0105242_10024360 Ga0105242_100243605 305
8 3300014969 Ga0157376_10034156 Ga0157376_100341562 305
9 3300049592 Ga0501076_0068314 Ga0501076_0068314_795_1727 305
10 3300009177 Ga0105248_10614595 Ga0105248_106145952 306
11 3300013297 Ga0157378_10320788 Ga0157378_103207882 306
12 3300049577 Ga0501041_0215916 Ga0501041_0215916_245_1186 310
13 3300005331 Ga0070670_100098593 Ga0070670_1000985932 311
14 3300013105 Ga0157369_10203349 Ga0157369_102033492 313
15 3300025912 Ga0207707_10097772 Ga0207707_100977723 313
16 3300060353 Ga0501082_0372452 Ga0501082_0372452_236_1189 315
17 3300032126 Ga0307415_100152027 Ga0307415_1001520272 316
18 3300036712 Ga0316584_0014292 Ga0316584_0014292_3748_4698 316
19 3300005459 Ga0068867_100165568 Ga0068867_1001655682 318
20 3300006237 Ga0097621_100005845 Ga0097621_1000058453 318
21 3300006358 Ga0068871_100022423 Ga0068871_1000224233 318
22 3300013308 Ga0157375_10385068 Ga0157375_103850682 318
23 3300039447 Ga0436361_0344725 Ga0436361_0344725_179_1186 318
24 3300048903 Ga0496100_0178629 Ga0496100_0178629_395_1351 318
25 3300048911 Ga0496108_0013522 Ga0496108_0013522_2204_3160 318
26 3300048912 Ga0496109_0525862 Ga0496109_0525862_140_1096 318
27 3300048913 Ga0496110_0175965 Ga0496110_0175965_617_1573 318
28 3300048914 Ga0496111_0217367 Ga0496111_0217367_320_1276 318
29 3300048917 Ga0496114_0053075 Ga0496114_0053075_1398_2354 318
30 3300026121 Ga0207683_10141816 Ga0207683_101418162 321
31 3300042015 Ga0439462_0042081 Ga0439462_0042081_18_983 321
32 3300049583 Ga0501067_0020421 Ga0501067_0020421_1335_2300 321
33 3300059421 Ga0590071_000443 Ga0590071_000443_4994_6022 321
34 3300059423 Ga0590074_006229 Ga0590074_006229_10_1038 321
35 3300059424 Ga0590075_000473 Ga0590075_000473_2545_3573 321
36 3300059426 Ga0590077_001357 Ga0590077_001357_2985_4013 321
37 3300005549 Ga0070704_100013480 Ga0070704_1000134803 322
38 3300009101 Ga0105247_10043414 Ga0105247_100434143 322
39 3300009147 Ga0114129_10025138 Ga0114129_100251382 322
40 3300021441 Ga0213871_10012564 Ga0213871_100125642 322
41 3300039438 Ga0436360_0552544 Ga0436360_0552544_23_1018 322
42 3300039453 Ga0436362_0371299 Ga0436362_0371299_1097_2113 322
43 3300049576 Ga0501040_0127135 Ga0501040_0127135_225_1196 322
44 3300050510 nmdc:mga06r32_39351_c1 nmdc:mga06r32_39351_c1_2146_3138 322
45 3300005339 Ga0070660_100009277 Ga0070660_1000092776 323
46 3300006163 Ga0070715_10036856 Ga0070715_100368562 323
47 3300006844 Ga0075428_100008564 Ga0075428_10000856410 323
48 3300006847 Ga0075431_100072903 Ga0075431_1000729032 323
49 3300006871 Ga0075434_100024802 Ga0075434_1000248024 323
50 3300009094 Ga0111539_10092328 Ga0111539_100923282 323
51 3300009147 Ga0114129_10043738 Ga0114129_100437386 323
52 3300014969 Ga0157376_10060947 Ga0157376_100609472 323
53 3300025905 Ga0207685_10022549 Ga0207685_100225492 323
54 3300025912 Ga0207707_10051040 Ga0207707_100510402 323
55 3300025917 Ga0207660_10165361 Ga0207660_101653612 323
56 3300025919 Ga0207657_10017295 Ga0207657_100172956 323
57 3300025920 Ga0207649_10237393 Ga0207649_102373932 323
58 3300025921 Ga0207652_10026301 Ga0207652_100263015 323
59 3300032004 Ga0307414_10081630 Ga0307414_100816302 323
60 3300035171 Ga0373946_0115245 Ga0373946_0115245_225_1202 323
61 3300035724 Ga0373933_0052198 Ga0373933_0052198_122_1105 323
62 3300035725 Ga0373947_0252306 Ga0373947_0252306_128_1114 323
63 3300036401 Ga0373937_0138202 Ga0373937_0138202_554_1540 323
64 3300042439 Ga0439464_0022799 Ga0439464_0022799_27_1040 323
65 3300046454 Ga0495592_0111810 Ga0495592_0111810_787_1770 323
66 3300046459 Ga0495629_0077711 Ga0495629_0077711_754_1737 323
67 3300046473 Ga0495582_0095485 Ga0495582_0095485_246_1232 323
68 3300046517 Ga0495630_0048503 Ga0495630_0048503_251_1234 323
69 3300046689 Ga0495613_0001719 Ga0495613_0001719_12494_13477 323
70 3300047319 Ga0495674_0046339 Ga0495674_0046339_2699_3682 323
71 3300047471 Ga0495684_0048074 Ga0495684_0048074_2036_3019 323
72 3300048905 Ga0496102_0113568 Ga0496102_0113568_925_1911 323
73 3300048908 Ga0496105_0060932 Ga0496105_0060932_1648_2634 323
74 3300048915 Ga0496112_0190677 Ga0496112_0190677_511_1494 323
75 3300048917 Ga0496114_0011050 Ga0496114_0011050_1765_2751 323
76 3300048918 Ga0496115_0194379 Ga0496115_0194379_304_1290 323
77 3300053085 Ga0495619_0011947 Ga0495619_0011947_2891_3874 323
78 3300005458 Ga0070681_10027541 Ga0070681_100275414 324
79 3300006846 Ga0075430_100299898 Ga0075430_1002998982 324
80 3300009147 Ga0114129_10000307 Ga0114129_1000030720 324
81 3300009147 Ga0114129_10003839 Ga0114129_1000383917 324
82 3300014325 Ga0163163_10438416 Ga0163163_104384162 324
83 3300035695 Ga0373927_0172763 Ga0373927_0172763_168_1154 324
84 3300037853 Ga0436364_1472607 Ga0436364_1472607_1245_2255 324
85 3300050507 nmdc:mga05p37_6700_c1 nmdc:mga05p37_6700_c1_10544_11533 324
86 3300050509 nmdc:mga0qj67_160753_c1 nmdc:mga0qj67_160753_c1_497_1474 324
87 3300049572 Ga0501036_0012231 Ga0501036_0012231_294_1283 325
88 3300049575 Ga0501039_0022659 Ga0501039_0022659_307_1296 325
89 3300049576 Ga0501040_0000223 Ga0501040_0000223_22580_23569 325
90 3300049577 Ga0501041_0014294 Ga0501041_0014294_1710_2699 325
91 3300049578 Ga0501042_0001934 Ga0501042_0001934_1483_2472 325
92 3300049579 Ga0501043_0037724 Ga0501043_0037724_2502_3491 325
93 3300049580 Ga0501046_0009389 Ga0501046_0009389_6218_7207 325
94 3300049582 Ga0501048_0030431 Ga0501048_0030431_2379_3368 325
95 3300049582 Ga0501048_0073792 Ga0501048_0073792_197_1210 325
96 3300049587 Ga0501071_0011572 Ga0501071_0011572_4197_5186 325
97 3300049587 Ga0501071_0060411 Ga0501071_0060411_783_1796 325
98 3300049588 Ga0501072_0115505 Ga0501072_0115505_990_1979 325
99 3300049590 Ga0501074_0089372 Ga0501074_0089372_796_1785 325
100 3300049591 Ga0501075_0026333 Ga0501075_0026333_2537_3526 325
101 3300049591 Ga0501075_0286415 Ga0501075_0286415_188_1174 325
102 3300049592 Ga0501076_0000179 Ga0501076_0000179_7363_8352 325
103 3300049593 Ga0501077_0018060 Ga0501077_0018060_259_1248 325
104 3300049741 Ga0501079_0084175 Ga0501079_0084175_715_1704 325
105 3300049741 Ga0501079_0276527 Ga0501079_0276527_138_1151 325
106 3300049742 Ga0501080_0086788 Ga0501080_0086788_49_1038 325
107 3300049822 Ga0501035_0062886 Ga0501035_0062886_1221_2210 325
108 3300049822 Ga0501035_0282765 Ga0501035_0282765_370_1356 325
109 3300049824 Ga0501045_0008879 Ga0501045_0008879_4066_5055 325
110 3300054114 Ga0501084_0000669 Ga0501084_0000669_19070_20059 325
111 3300054114 Ga0501084_0310300 Ga0501084_0310300_48_1034 325
112 3300060353 Ga0501082_0018802 Ga0501082_0018802_428_1417 325
113 3300061734 Ga0530510_0000198 Ga0530510_0000198_33068_34057 325
114 3300001977 JGI24746J21847_1000748 JGI24746J21847_10007483 326
115 3300002076 JGI24749J21850_1009619 JGI24749J21850_10096192 326
116 3300005293 Ga0065715_10001036 Ga0065715_100010364 326
117 3300005328 Ga0070676_10003338 Ga0070676_100033385 326
118 3300005330 Ga0070690_100015022 Ga0070690_1000150223 326
119 3300005333 Ga0070677_10002373 Ga0070677_100023732 326
120 3300005334 Ga0068869_100008375 Ga0068869_1000083755 326
121 3300005335 Ga0070666_10003461 Ga0070666_100034612 326
122 3300005338 Ga0068868_100119177 Ga0068868_1001191772 326
123 3300005340 Ga0070689_100000517 Ga0070689_1000005176 326
124 3300005344 Ga0070661_100157117 Ga0070661_1001571172 326
125 3300005353 Ga0070669_100000645 Ga0070669_10000064513 326
126 3300005354 Ga0070675_100092816 Ga0070675_1000928162 326
127 3300005355 Ga0070671_100044066 Ga0070671_1000440663 326
128 3300005364 Ga0070673_100013476 Ga0070673_1000134765 326
129 3300005365 Ga0070688_100001469 Ga0070688_1000014696 326
130 3300005366 Ga0070659_100020780 Ga0070659_1000207802 326
131 3300005367 Ga0070667_100059563 Ga0070667_1000595632 326
132 3300005438 Ga0070701_10009060 Ga0070701_100090604 326
133 3300005445 Ga0070708_100170013 Ga0070708_1001700132 326
134 3300005457 Ga0070662_100015165 Ga0070662_1000151655 326
135 3300005459 Ga0068867_100039829 Ga0068867_1000398292 326
136 3300005466 Ga0070685_10013390 Ga0070685_100133903 326
137 3300005543 Ga0070672_100011951 Ga0070672_1000119515 326
138 3300005543 Ga0070672_100239060 Ga0070672_1002390601 326
139 3300005544 Ga0070686_100003096 Ga0070686_1000030968 326
140 3300005548 Ga0070665_100005335 Ga0070665_1000053356 326
141 3300005548 Ga0070665_100096348 Ga0070665_1000963482 326
142 3300005564 Ga0070664_100003519 Ga0070664_10000351911 326
143 3300005577 Ga0068857_100035158 Ga0068857_1000351583 326
144 3300005617 Ga0068859_100009133 Ga0068859_1000091335 326
145 3300005617 Ga0068859_100285400 Ga0068859_1002854002 326
146 3300005840 Ga0068870_10000595 Ga0068870_100005953 326
147 3300005841 Ga0068863_100017949 Ga0068863_1000179494 326
148 3300005842 Ga0068858_100019692 Ga0068858_1000196925 326
149 3300005843 Ga0068860_100045691 Ga0068860_1000456913 326
150 3300005844 Ga0068862_100035062 Ga0068862_1000350623 326
151 3300006237 Ga0097621_100099369 Ga0097621_1000993693 326
152 3300006844 Ga0075428_100000185 Ga0075428_10000018541 326
153 3300006847 Ga0075431_100054199 Ga0075431_1000541993 326
154 3300006852 Ga0075433_10045217 Ga0075433_100452173 326
155 3300006871 Ga0075434_100074457 Ga0075434_1000744573 326
156 3300006880 Ga0075429_100061324 Ga0075429_1000613242 326
157 3300006881 Ga0068865_100005643 Ga0068865_1000056434 326
158 3300006931 Ga0097620_100009133 Ga0097620_1000091335 326
159 3300006931 Ga0097620_100285404 Ga0097620_1002854042 326
160 3300007076 Ga0075435_100065047 Ga0075435_1000650473 326
161 3300009094 Ga0111539_10000324 Ga0111539_1000032432 326
162 3300009148 Ga0105243_10501327 Ga0105243_105013272 326
163 3300009553 Ga0105249_10000918 Ga0105249_1000091816 326
164 3300011119 Ga0105246_10020796 Ga0105246_100207962 326
165 3300013306 Ga0163162_10022874 Ga0163162_100228746 326
166 3300013308 Ga0157375_10103262 Ga0157375_101032622 326
167 3300014326 Ga0157380_10035610 Ga0157380_100356102 326
168 3300014745 Ga0157377_10001507 Ga0157377_100015079 326
169 3300014968 Ga0157379_10040072 Ga0157379_100400722 326
170 3300025315 Ga0207697_10000081 Ga0207697_1000008136 326
171 3300025893 Ga0207682_10003668 Ga0207682_100036682 326
172 3300025901 Ga0207688_10000175 Ga0207688_1000017518 326
173 3300025907 Ga0207645_10004989 Ga0207645_100049893 326
174 3300025908 Ga0207643_10000659 Ga0207643_1000065911 326
175 3300025918 Ga0207662_10020071 Ga0207662_100200714 326
176 3300025923 Ga0207681_10006008 Ga0207681_100060087 326
177 3300025925 Ga0207650_10035203 Ga0207650_100352034 326
178 3300025926 Ga0207659_10071645 Ga0207659_100716453 326
179 3300025932 Ga0207690_10103263 Ga0207690_101032632 326
180 3300025933 Ga0207706_10000390 Ga0207706_1000039020 326
181 3300025936 Ga0207670_10013055 Ga0207670_100130553 326
182 3300025940 Ga0207691_10000697 Ga0207691_100006975 326
183 3300025942 Ga0207689_10000944 Ga0207689_1000094425 326
184 3300025960 Ga0207651_10019111 Ga0207651_100191114 326
185 3300025960 Ga0207651_10094385 Ga0207651_100943852 326
186 3300025986 Ga0207658_10212712 Ga0207658_102127122 326
187 3300026023 Ga0207677_10094329 Ga0207677_100943292 326
188 3300026023 Ga0207677_10245041 Ga0207677_102450412 326
189 3300026035 Ga0207703_10029019 Ga0207703_100290193 326
190 3300026067 Ga0207678_10091298 Ga0207678_100912982 326
191 3300026075 Ga0207708_10014977 Ga0207708_100149775 326
192 3300026088 Ga0207641_10062303 Ga0207641_100623032 326
193 3300026089 Ga0207648_10027253 Ga0207648_100272533 326
194 3300026116 Ga0207674_10027260 Ga0207674_100272603 326
195 3300026116 Ga0207674_10129264 Ga0207674_101292642 326
196 3300026118 Ga0207675_100118864 Ga0207675_1001188642 326
197 3300026121 Ga0207683_10026021 Ga0207683_100260212 326
198 3300027907 Ga0207428_10000234 Ga0207428_1000023414 326
199 3300027907 Ga0207428_10002148 Ga0207428_100021487 326
200 3300028380 Ga0268265_10045899 Ga0268265_100458992 326
201 3300028381 Ga0268264_10023051 Ga0268264_100230515 326
202 3300045051 Ga0451576_0035534 Ga0451576_0035534_1949_2932 326
203 3300046462 Ga0495651_0022991 Ga0495651_0022991_1364_2347 326
204 3300046615 Ga0495656_0037964 Ga0495656_0037964_206_1189 326
205 3300046642 Ga0495634_0254622 Ga0495634_0254622_32_1027 326
206 3300049587 Ga0501071_0201233 Ga0501071_0201233_257_1240 326
207 3300050508 nmdc:mga09592_15209_c1 nmdc:mga09592_15209_c1_2066_3049 326
208 3300050508 nmdc:mga09592_21228_c1 nmdc:mga09592_21228_c1_1223_2206 326
209 3300050509 nmdc:mga0qj67_9878_c1 nmdc:mga0qj67_9878_c1_1075_2058 326
210 3300050511 nmdc:mga08y16_16069_c1 nmdc:mga08y16_16069_c1_1072_2055 326
211 3300050512 nmdc:mga0n895_10132_c1 nmdc:mga0n895_10132_c1_6973_7956 326
212 3300050513 nmdc:mga0rr50_10032_c1 nmdc:mga0rr50_10032_c1_2078_3061 326
213 3300050515 nmdc:mga0a205_17695_c1 nmdc:mga0a205_17695_c1_2142_3125 326
214 2162886011 MRS1b_contig_593976 MRS1b_0411.00000850 327
215 3300005290 Ga0065712_10069094 Ga0065712_100690943 327
216 3300005356 Ga0070674_100175840 Ga0070674_1001758402 327
217 3300006846 Ga0075430_100003870 Ga0075430_1000038707 327
218 3300006847 Ga0075431_100056264 Ga0075431_1000562642 327
219 3300031852 Ga0307410_10116585 Ga0307410_101165852 327
220 3300031995 Ga0307409_100398375 Ga0307409_1003983751 327
221 3300046463 Ga0495653_0205253 Ga0495653_0205253_332_1318 327
222 3300050508 nmdc:mga09592_219_c1 nmdc:mga09592_219_c1_1767_2792 327
223 3300050509 nmdc:mga0qj67_402_c1 nmdc:mga0qj67_402_c1_16871_17896 327
224 3300005289 Ga0065704_10071765 Ga0065704_100717654 328
225 3300005295 Ga0065707_10001235 Ga0065707_100012354 328
226 3300005295 Ga0065707_10086346 Ga0065707_100863462 328
227 3300005340 Ga0070689_100012832 Ga0070689_1000128323 328
228 3300005343 Ga0070687_100001731 Ga0070687_1000017313 328
229 3300005344 Ga0070661_100078861 Ga0070661_1000788612 328
230 3300005353 Ga0070669_100001131 Ga0070669_1000011319 328
231 3300005354 Ga0070675_100003805 Ga0070675_1000038055 328
232 3300005436 Ga0070713_100014146 Ga0070713_1000141466 328
233 3300005440 Ga0070705_100078093 Ga0070705_1000780932 328
234 3300005441 Ga0070700_100033750 Ga0070700_1000337504 328
235 3300005467 Ga0070706_100004428 Ga0070706_1000044282 328
236 3300005467 Ga0070706_100012509 Ga0070706_1000125095 328
237 3300005468 Ga0070707_100005678 Ga0070707_1000056787 328
238 3300005471 Ga0070698_100014186 Ga0070698_1000141866 328
239 3300005518 Ga0070699_100147846 Ga0070699_1001478462 328
240 3300005536 Ga0070697_100002599 Ga0070697_1000025993 328
241 3300005545 Ga0070695_100000001 Ga0070695_10000000145 328
242 3300006844 Ga0075428_100006198 Ga0075428_10000619811 328
243 3300006852 Ga0075433_10002985 Ga0075433_1000298510 328
244 3300006852 Ga0075433_10035188 Ga0075433_100351883 328
245 3300006871 Ga0075434_100101777 Ga0075434_1001017774 328
246 3300007076 Ga0075435_100021740 Ga0075435_1000217403 328
247 3300009093 Ga0105240_10011048 Ga0105240_100110486 328
248 3300009147 Ga0114129_10148635 Ga0114129_101486353 328
249 3300009545 Ga0105237_10026334 Ga0105237_100263344 328
250 3300014968 Ga0157379_10262727 Ga0157379_102627272 328
251 3300025910 Ga0207684_10002365 Ga0207684_100023654 328
252 3300025913 Ga0207695_10007956 Ga0207695_100079566 328
253 3300025914 Ga0207671_10051456 Ga0207671_100514563 328
254 3300025922 Ga0207646_10011103 Ga0207646_100111033 328
255 3300025922 Ga0207646_10069126 Ga0207646_100691263 328
256 3300025928 Ga0207700_10045485 Ga0207700_100454852 328
257 3300035172 Ga0373955_0113000 Ga0373955_0113000_355_1341 328
258 3300035724 Ga0373933_0061846 Ga0373933_0061846_88_1074 328
259 3300036401 Ga0373937_0045652 Ga0373937_0045652_1385_2371 328
260 3300042461 Ga0439460_0003307 Ga0439460_0003307_2718_3710 328
261 3300048905 Ga0496102_0061953 Ga0496102_0061953_1103_2089 328
262 3300049570 Ga0501033_0118080 Ga0501033_0118080_639_1631 328
263 3300049578 Ga0501042_0068486 Ga0501042_0068486_1082_2074 328
264 3300049582 Ga0501048_0135564 Ga0501048_0135564_579_1571 328
265 3300049587 Ga0501071_0014104 Ga0501071_0014104_3506_4498 328
266 3300049591 Ga0501075_0028887 Ga0501075_0028887_2603_3595 328
267 3300049592 Ga0501076_0023784 Ga0501076_0023784_2978_3970 328
268 3300049742 Ga0501080_0365220 Ga0501080_0365220_51_1043 328
269 3300049744 Ga0501083_0150803 Ga0501083_0150803_445_1437 328
270 3300049822 Ga0501035_0070710 Ga0501035_0070710_134_1126 328
271 3300049824 Ga0501045_0074760 Ga0501045_0074760_273_1265 328
272 3300050507 nmdc:mga05p37_109221_c1 nmdc:mga05p37_109221_c1_131_1120 328
273 3300050512 nmdc:mga0n895_119673_c1 nmdc:mga0n895_119673_c1_188_1177 328
274 3300050512 nmdc:mga0n895_202988_c1 nmdc:mga0n895_202988_c1_34_1023 328
275 3300050512 nmdc:mga0n895_34345_c1 nmdc:mga0n895_34345_c1_2204_3193 328
276 3300050515 nmdc:mga0a205_24895_c1 nmdc:mga0a205_24895_c1_1435_2424 328
277 3300053730 Ga0500645_013479 Ga0500645_013479_346_1332 328
278 3300005334 Ga0068869_100040887 Ga0068869_1000408873 329
279 3300005467 Ga0070706_100032615 Ga0070706_1000326153 329
280 3300005471 Ga0070698_100019232 Ga0070698_1000192322 329
281 3300005471 Ga0070698_100025565 Ga0070698_1000255652 329
282 3300005518 Ga0070699_100108942 Ga0070699_1001089422 329
283 3300005536 Ga0070697_100074303 Ga0070697_1000743032 329
284 3300006038 Ga0075365_10001748 Ga0075365_100017487 329
285 3300006048 Ga0075363_100027390 Ga0075363_1000273903 329
286 3300006051 Ga0075364_10133839 Ga0075364_101338392 329
287 3300006177 Ga0075362_10001616 Ga0075362_100016165 329
288 3300006178 Ga0075367_10001875 Ga0075367_100018757 329
289 3300006844 Ga0075428_100009291 Ga0075428_1000092919 329
290 3300006844 Ga0075428_100392384 Ga0075428_1003923842 329
291 3300006846 Ga0075430_100052635 Ga0075430_1000526352 329
292 3300006852 Ga0075433_10073732 Ga0075433_100737323 329
293 3300006871 Ga0075434_100138004 Ga0075434_1001380042 329
294 3300006880 Ga0075429_100003913 Ga0075429_1000039133 329
295 3300009094 Ga0111539_10602778 Ga0111539_106027782 329
296 3300009147 Ga0114129_10001485 Ga0114129_1000148516 329
297 3300009147 Ga0114129_10031216 Ga0114129_100312163 329
298 3300025910 Ga0207684_10107005 Ga0207684_101070052 329
299 3300046460 Ga0495638_0021731 Ga0495638_0021731_392_1384 329
300 3300049576 Ga0501040_0081272 Ga0501040_0081272_24_1025 329
301 3300049589 Ga0501073_0156392 Ga0501073_0156392_250_1245 329
302 3300050507 nmdc:mga05p37_1026_c1 nmdc:mga05p37_1026_c1_19685_20677 329
303 3300050507 nmdc:mga05p37_34620_c1 nmdc:mga05p37_34620_c1_5018_6052 329
304 3300050508 nmdc:mga09592_3794_c1 nmdc:mga09592_3794_c1_9974_10966 329
305 3300050510 nmdc:mga06r32_329721_c1 nmdc:mga06r32_329721_c1_383_1378 329
306 3300050512 nmdc:mga0n895_53821_c1 nmdc:mga0n895_53821_c1_1282_2277 329
307 3300050515 nmdc:mga0a205_40980_c1 nmdc:mga0a205_40980_c1_1670_2665 329
308 3300054114 Ga0501084_0248691 Ga0501084_0248691_23_1015 329
309 3300005334 Ga0068869_100000964 Ga0068869_10000096413 330
310 3300005340 Ga0070689_100007688 Ga0070689_1000076883 330
311 3300005340 Ga0070689_100022688 Ga0070689_1000226883 330
312 3300005343 Ga0070687_100091868 Ga0070687_1000918681 330
313 3300005343 Ga0070687_100199336 Ga0070687_1001993362 330
314 3300005347 Ga0070668_100018384 Ga0070668_1000183841 330
315 3300005353 Ga0070669_100092094 Ga0070669_1000920943 330
316 3300005354 Ga0070675_100039451 Ga0070675_1000394512 330
317 3300005364 Ga0070673_100028511 Ga0070673_1000285113 330
318 3300005364 Ga0070673_100037732 Ga0070673_1000377323 330
319 3300005365 Ga0070688_100007851 Ga0070688_1000078515 330
320 3300005435 Ga0070714_100011142 Ga0070714_1000111426 330
321 3300005436 Ga0070713_100409165 Ga0070713_1004091652 330
322 3300005438 Ga0070701_10016856 Ga0070701_100168563 330
323 3300005441 Ga0070700_100011538 Ga0070700_1000115382 330
324 3300005455 Ga0070663_100175618 Ga0070663_1001756182 330
325 3300005459 Ga0068867_100021910 Ga0068867_1000219103 330
326 3300005466 Ga0070685_10007833 Ga0070685_100078332 330
327 3300005467 Ga0070706_100009225 Ga0070706_1000092259 330
328 3300005468 Ga0070707_100007127 Ga0070707_1000071276 330
329 3300005546 Ga0070696_100037761 Ga0070696_1000377613 330
330 3300005564 Ga0070664_100112150 Ga0070664_1001121502 330
331 3300005617 Ga0068859_100010205 Ga0068859_1000102053 330
332 3300005719 Ga0068861_100098192 Ga0068861_1000981922 330
333 3300005719 Ga0068861_100449349 Ga0068861_1004493492 330
334 3300005841 Ga0068863_100007204 Ga0068863_1000072049 330
335 3300005842 Ga0068858_100053904 Ga0068858_1000539043 330
336 3300005843 Ga0068860_100105547 Ga0068860_1001055473 330
337 3300005844 Ga0068862_100036167 Ga0068862_1000361672 330
338 3300006042 Ga0075368_10053336 Ga0075368_100533362 330
339 3300006048 Ga0075363_100035163 Ga0075363_1000351632 330
340 3300006178 Ga0075367_10000879 Ga0075367_100008797 330
341 3300006195 Ga0075366_10000322 Ga0075366_100003228 330
342 3300006844 Ga0075428_100001446 Ga0075428_1000014469 330
343 3300006844 Ga0075428_100119596 Ga0075428_1001195962 330
344 3300006847 Ga0075431_100000373 Ga0075431_10000037312 330
345 3300006847 Ga0075431_100102893 Ga0075431_1001028932 330
346 3300006852 Ga0075433_10047600 Ga0075433_100476003 330
347 3300006880 Ga0075429_100004956 Ga0075429_1000049566 330
348 3300006880 Ga0075429_100113467 Ga0075429_1001134672 330
349 3300006881 Ga0068865_100012805 Ga0068865_1000128053 330
350 3300006931 Ga0097620_100010205 Ga0097620_1000102053 330
351 3300009094 Ga0111539_10000156 Ga0111539_1000015616 330
352 3300009148 Ga0105243_10020118 Ga0105243_100201182 330
353 3300009553 Ga0105249_10037699 Ga0105249_100376992 330
354 3300013306 Ga0163162_10074473 Ga0163162_100744733 330
355 3300013308 Ga0157375_10166281 Ga0157375_101662812 330
356 3300025908 Ga0207643_10003545 Ga0207643_100035456 330
357 3300025910 Ga0207684_10010457 Ga0207684_100104572 330
358 3300025915 Ga0207693_10003762 Ga0207693_100037624 330
359 3300025918 Ga0207662_10087969 Ga0207662_100879692 330
360 3300025922 Ga0207646_10008400 Ga0207646_100084006 330
361 3300025926 Ga0207659_10071040 Ga0207659_100710402 330
362 3300025928 Ga0207700_10358144 Ga0207700_103581442 330
363 3300025935 Ga0207709_10087481 Ga0207709_100874812 330
364 3300025936 Ga0207670_10076244 Ga0207670_100762442 330
365 3300025936 Ga0207670_10155802 Ga0207670_101558022 330
366 3300025936 Ga0207670_10269564 Ga0207670_102695642 330
367 3300025937 Ga0207669_10129407 Ga0207669_101294072 330
368 3300025940 Ga0207691_10003713 Ga0207691_1000371311 330
369 3300025941 Ga0207711_10112357 Ga0207711_101123573 330
370 3300025942 Ga0207689_10104988 Ga0207689_101049883 330
371 3300025942 Ga0207689_10189634 Ga0207689_101896342 330
372 3300025945 Ga0207679_10113327 Ga0207679_101133272 330
373 3300025972 Ga0207668_10372177 Ga0207668_103721772 330
374 3300025981 Ga0207640_10158282 Ga0207640_101582822 330
375 3300026023 Ga0207677_10018039 Ga0207677_100180392 330
376 3300026035 Ga0207703_10118545 Ga0207703_101185452 330
377 3300026035 Ga0207703_10145622 Ga0207703_101456222 330
378 3300026067 Ga0207678_10051330 Ga0207678_100513303 330
379 3300026075 Ga0207708_10019196 Ga0207708_100191963 330
380 3300026088 Ga0207641_10048341 Ga0207641_100483412 330
381 3300026089 Ga0207648_10026438 Ga0207648_100264383 330
382 3300026095 Ga0207676_10357222 Ga0207676_103572222 330
383 3300026116 Ga0207674_10186825 Ga0207674_101868252 330
384 3300026118 Ga0207675_100042017 Ga0207675_1000420173 330
385 3300027866 Ga0209813_10035191 Ga0209813_100351912 330
386 3300027907 Ga0207428_10000070 Ga0207428_1000007039 330
387 3300044901 Ga0466960_0001705 Ga0466960_0001705_5054_6046 330
388 3300046459 Ga0495629_0187228 Ga0495629_0187228_163_1155 330
389 3300046477 Ga0495664_0059284 Ga0495664_0059284_875_1867 330
390 3300046535 Ga0495586_0045465 Ga0495586_0045465_276_1268 330
391 3300046642 Ga0495634_0090105 Ga0495634_0090105_686_1678 330
392 3300046663 Ga0495635_0124885 Ga0495635_0124885_679_1671 330
393 3300046689 Ga0495613_0114944 Ga0495613_0114944_152_1144 330
394 3300047319 Ga0495674_0045345 Ga0495674_0045345_2412_3404 330
395 3300047471 Ga0495684_0050126 Ga0495684_0050126_622_1614 330
396 3300048907 Ga0496104_0023831 Ga0496104_0023831_1941_2933 330
397 3300048907 Ga0496104_0030192 Ga0496104_0030192_437_1429 330
398 3300048908 Ga0496105_0220907 Ga0496105_0220907_39_1031 330
399 3300048912 Ga0496109_0009858 Ga0496109_0009858_5032_6024 330
400 3300048912 Ga0496109_0198310 Ga0496109_0198310_148_1140 330
401 3300048915 Ga0496112_0010820 Ga0496112_0010820_3835_4827 330
402 3300048916 Ga0496113_0091816 Ga0496113_0091816_1041_2033 330
403 3300048918 Ga0496115_0006646 Ga0496115_0006646_7163_8155 330
404 3300049577 Ga0501041_0031457 Ga0501041_0031457_2088_3083 330
405 3300049588 Ga0501072_0032710 Ga0501072_0032710_1492_2487 330
406 3300049592 Ga0501076_0007584 Ga0501076_0007584_5914_6909 330
407 3300049741 Ga0501079_0045898 Ga0501079_0045898_540_1535 330
408 3300049743 Ga0501081_0017108 Ga0501081_0017108_2869_3864 330
409 3300049743 Ga0501081_0286558 Ga0501081_0286558_57_1064 330
410 3300050490 nmdc:mga03n38_20788_c1 nmdc:mga03n38_20788_c1_892_1893 330
411 3300050493 nmdc:mga0k408_4239_c1 nmdc:mga0k408_4239_c1_508_1509 330
412 3300050494 nmdc:mga06z11_2066_c1 nmdc:mga06z11_2066_c1_4419_5420 330
413 3300050495 nmdc:mga04h51_33034_c1 nmdc:mga04h51_33034_c1_213_1214 330
414 3300050507 nmdc:mga05p37_153982_c1 nmdc:mga05p37_153982_c1_1641_2639 330
415 3300050508 nmdc:mga09592_2118_c1 nmdc:mga09592_2118_c1_5497_6495 330
416 3300050508 nmdc:mga09592_26367_c1 nmdc:mga09592_26367_c1_1198_2199 330
417 3300050510 nmdc:mga06r32_1608_c1 nmdc:mga06r32_1608_c1_6078_7079 330
418 3300050511 nmdc:mga08y16_13034_c1 nmdc:mga08y16_13034_c1_4988_6007 330
419 3300050511 nmdc:mga08y16_1915_c1 nmdc:mga08y16_1915_c1_4909_5910 330
420 3300054114 Ga0501084_0146406 Ga0501084_0146406_397_1392 330
421 3300060353 Ga0501082_0023847 Ga0501082_0023847_2113_3108 330
422 3300005354 Ga0070675_100112339 Ga0070675_1001123392 331
423 3300005466 Ga0070685_10090103 Ga0070685_100901032 331
424 3300005616 Ga0068852_100050096 Ga0068852_1000500962 331
425 3300005617 Ga0068859_100187982 Ga0068859_1001879822 331
426 3300005617 Ga0068859_100480126 Ga0068859_1004801262 331
427 3300005841 Ga0068863_100199172 Ga0068863_1001991722 331
428 3300006038 Ga0075365_10022464 Ga0075365_100224642 331
429 3300006042 Ga0075368_10000187 Ga0075368_1000018711 331
430 3300006048 Ga0075363_100000316 Ga0075363_10000031611 331
431 3300006048 Ga0075363_100015142 Ga0075363_1000151423 331
432 3300006051 Ga0075364_10001673 Ga0075364_1000167310 331
433 3300006051 Ga0075364_10093904 Ga0075364_100939042 331
434 3300006177 Ga0075362_10000255 Ga0075362_100002556 331
435 3300006178 Ga0075367_10000522 Ga0075367_100005225 331
436 3300006186 Ga0075369_10008128 Ga0075369_100081285 331
437 3300006195 Ga0075366_10001215 Ga0075366_1000121510 331
438 3300006195 Ga0075366_10021446 Ga0075366_100214463 331
439 3300006237 Ga0097621_100053601 Ga0097621_1000536013 331
440 3300006353 Ga0075370_10000989 Ga0075370_100009899 331
441 3300006353 Ga0075370_10023697 Ga0075370_100236972 331
442 3300006358 Ga0068871_100045322 Ga0068871_1000453223 331
443 3300006358 Ga0068871_100236522 Ga0068871_1002365222 331
444 3300006931 Ga0097620_100187991 Ga0097620_1001879912 331
445 3300006931 Ga0097620_100480116 Ga0097620_1004801162 331
446 3300014968 Ga0157379_10118520 Ga0157379_101185201 331
447 3300017792 Ga0163161_10019798 Ga0163161_100197982 331
448 3300025912 Ga0207707_10411063 Ga0207707_104110631 331
449 3300025937 Ga0207669_10261655 Ga0207669_102616552 331
450 3300025938 Ga0207704_10015344 Ga0207704_100153443 331
451 3300025938 Ga0207704_10260530 Ga0207704_102605301 331
452 3300025941 Ga0207711_10066907 Ga0207711_100669073 331
453 3300025942 Ga0207689_10122409 Ga0207689_101224092 331
454 3300026088 Ga0207641_10353107 Ga0207641_103531072 331
455 3300027866 Ga0209813_10000512 Ga0209813_100005124 331
456 3300031903 Ga0307407_10113261 Ga0307407_101132612 331
457 3300031995 Ga0307409_100309075 Ga0307409_1003090752 331
458 3300033179 Ga0307507_10175969 Ga0307507_101759692 331
459 3300039437 Ga0436365_0376598 Ga0436365_0376598_1968_2975 331
460 3300042876 Ga0451577_0136756 Ga0451577_0136756_414_1412 331
461 3300044658 Ga0466972_0003571 Ga0466972_0003571_1325_2320 331
462 3300044683 Ga0466965_0005467 Ga0466965_0005467_4451_5446 331
463 3300044712 Ga0453684_0025392 Ga0453684_0025392_3461_4459 331
464 3300044735 Ga0466968_0000343 Ga0466968_0000343_3922_4917 331
465 3300044901 Ga0466960_0003254 Ga0466960_0003254_1434_2429 331
466 3300048911 Ga0496108_0000077 Ga0496108_0000077_13543_14538 331
467 3300048917 Ga0496114_0041678 Ga0496114_0041678_2759_3754 331
468 3300048918 Ga0496115_0044889 Ga0496115_0044889_1492_2487 331
469 3300049589 Ga0501073_0001727 Ga0501073_0001727_2002_3006 331
470 3300050489 nmdc:mga03683_265_c1 nmdc:mga03683_265_c1_13207_14211 331
471 3300050490 nmdc:mga03n38_1246_c1 nmdc:mga03n38_1246_c1_4033_5037 331
472 3300050491 nmdc:mga00v17_14477_c1 nmdc:mga00v17_14477_c1_2381_3385 331
473 3300050491 nmdc:mga00v17_156279_c1 nmdc:mga00v17_156279_c1_158_1156 331
474 3300050492 nmdc:mga0yw44_22799_c1 nmdc:mga0yw44_22799_c1_2379_3383 331
475 3300050493 nmdc:mga0k408_11896_c1 nmdc:mga0k408_11896_c1_1090_2094 331
476 3300050493 nmdc:mga0k408_18784_c1 nmdc:mga0k408_18784_c1_1481_2479 331
477 3300050493 nmdc:mga0k408_22366_c1 nmdc:mga0k408_22366_c1_1448_2446 331
478 3300050494 nmdc:mga06z11_2787_c1 nmdc:mga06z11_2787_c1_135_1139 331
479 3300050495 nmdc:mga04h51_279_c1 nmdc:mga04h51_279_c1_3190_4194 331
480 3300050496 nmdc:mga07m45_30385_c1 nmdc:mga07m45_30385_c1_1556_2554 331
481 3300050516 nmdc:mga0sz30_10389_c1 nmdc:mga0sz30_10389_c1_2418_3422 331
482 3300005331 Ga0070670_100069005 Ga0070670_1000690053 332
483 3300005353 Ga0070669_100097505 Ga0070669_1000975052 332
484 3300005354 Ga0070675_100025109 Ga0070675_1000251093 332
485 3300005355 Ga0070671_100067896 Ga0070671_1000678962 332
486 3300005367 Ga0070667_100260920 Ga0070667_1002609202 332
487 3300005444 Ga0070694_100100079 Ga0070694_1001000792 332
488 3300005456 Ga0070678_100026473 Ga0070678_1000264733 332
489 3300005543 Ga0070672_100038500 Ga0070672_1000385003 332
490 3300005548 Ga0070665_100044136 Ga0070665_1000441362 332
491 3300005548 Ga0070665_100085824 Ga0070665_1000858242 332
492 3300005618 Ga0068864_100073503 Ga0068864_1000735033 332
493 3300009094 Ga0111539_10013117 Ga0111539_100131179 332
494 3300009147 Ga0114129_10215160 Ga0114129_102151601 332
495 3300009177 Ga0105248_10110888 Ga0105248_101108882 332
496 3300009177 Ga0105248_10149386 Ga0105248_101493862 332
497 3300009553 Ga0105249_10247945 Ga0105249_102479452 332
498 3300014326 Ga0157380_10013458 Ga0157380_100134584 332
499 3300014326 Ga0157380_10106531 Ga0157380_101065312 332
500 3300025931 Ga0207644_10017765 Ga0207644_100177652 332
501 3300025940 Ga0207691_10020421 Ga0207691_100204214 332
502 3300025960 Ga0207651_10118581 Ga0207651_101185812 332
503 3300025960 Ga0207651_10159842 Ga0207651_101598422 332
504 3300025972 Ga0207668_10383156 Ga0207668_103831562 332
505 3300026075 Ga0207708_10288851 Ga0207708_102888512 332
506 3300026118 Ga0207675_100134538 Ga0207675_1001345382 332
507 3300026118 Ga0207675_100281005 Ga0207675_1002810052 332
508 3300026121 Ga0207683_10027273 Ga0207683_100272733 332
509 3300027907 Ga0207428_10000400 Ga0207428_1000040017 332
510 3300027907 Ga0207428_10012387 Ga0207428_100123874 332
511 3300028379 Ga0268266_10036472 Ga0268266_100364722 332
512 3300037418 Ga0395900_0093819 Ga0395900_0093819_630_1634 332
513 3300037466 Ga0395898_0059755 Ga0395898_0059755_1446_2450 332
514 3300046460 Ga0495638_0013639 Ga0495638_0013639_2040_3041 332
515 3300049578 Ga0501042_0066852 Ga0501042_0066852_1100_2107 332
516 3300050507 nmdc:mga05p37_34310_c1 nmdc:mga05p37_34310_c1_3377_4381 332
517 3300050507 nmdc:mga05p37_445259_c1 nmdc:mga05p37_445259_c1_235_1242 332
518 3300050508 nmdc:mga09592_120546_c1 nmdc:mga09592_120546_c1_474_1481 332
519 3300050511 nmdc:mga08y16_196337_c1 nmdc:mga08y16_196337_c1_231_1238 332
520 3300050511 nmdc:mga08y16_221968_c1 nmdc:mga08y16_221968_c1_123_1130 332
521 3300050511 nmdc:mga08y16_389_c1 nmdc:mga08y16_389_c1_11828_12835 332
522 3300050511 nmdc:mga08y16_80748_c1 nmdc:mga08y16_80748_c1_543_1550 332
523 3300050512 nmdc:mga0n895_511201_c1 nmdc:mga0n895_511201_c1_76_1086 332
524 3300053090 Ga0500646_0041707 Ga0500646_0041707_108_1115 332
525 3300005339 Ga0070660_100108065 Ga0070660_1001080652 333
526 3300005366 Ga0070659_100067705 Ga0070659_1000677052 333
527 3300005530 Ga0070679_100271417 Ga0070679_1002714172 333
528 3300005614 Ga0068856_100317905 Ga0068856_1003179052 333
529 3300006852 Ga0075433_10289828 Ga0075433_102898282 333
530 3300009147 Ga0114129_10685264 Ga0114129_106852642 333
531 3300031824 Ga0307413_10050111 Ga0307413_100501113 333
532 3300038443 Ga0395901_0047163 Ga0395901_0047163_3352_4374 333
533 3300042436 Ga0439435_0002906 Ga0439435_0002906_403_1434 333
534 3300042439 Ga0439464_0037890 Ga0439464_0037890_250_1257 333
535 3300042461 Ga0439460_0013868 Ga0439460_0013868_796_1803 333
536 3300048905 Ga0496102_0300036 Ga0496102_0300036_247_1254 333
537 3300048907 Ga0496104_0252226 Ga0496104_0252226_277_1284 333
538 3300049571 Ga0501034_0007042 Ga0501034_0007042_288_1295 333
539 3300050507 nmdc:mga05p37_257578_c1 nmdc:mga05p37_257578_c1_430_1437 333
540 3300005331 Ga0070670_100055469 Ga0070670_1000554693 334
541 3300005354 Ga0070675_100036855 Ga0070675_1000368553 334
542 3300005356 Ga0070674_100039604 Ga0070674_1000396042 334
543 3300005436 Ga0070713_100009874 Ga0070713_1000098743 334
544 3300005467 Ga0070706_100173872 Ga0070706_1001738722 334
545 3300005471 Ga0070698_100208485 Ga0070698_1002084852 334
546 3300005518 Ga0070699_100004383 Ga0070699_1000043832 334
547 3300005535 Ga0070684_100061777 Ga0070684_1000617772 334
548 3300005615 Ga0070702_100020699 Ga0070702_1000206994 334
549 3300006038 Ga0075365_10002173 Ga0075365_100021735 334
550 3300006038 Ga0075365_10021174 Ga0075365_100211743 334
551 3300006042 Ga0075368_10020078 Ga0075368_100200783 334
552 3300006051 Ga0075364_10009904 Ga0075364_100099042 334
553 3300006051 Ga0075364_10023890 Ga0075364_100238902 334
554 3300006177 Ga0075362_10003766 Ga0075362_100037663 334
555 3300006178 Ga0075367_10043340 Ga0075367_100433402 334
556 3300006178 Ga0075367_10048792 Ga0075367_100487922 334
557 3300006195 Ga0075366_10081945 Ga0075366_100819453 334
558 3300006353 Ga0075370_10002195 Ga0075370_100021955 334
559 3300006914 Ga0075436_100178143 Ga0075436_1001781432 334
560 3300009093 Ga0105240_10062219 Ga0105240_100622194 334
561 3300009177 Ga0105248_10191801 Ga0105248_101918013 334
562 3300009545 Ga0105237_10201661 Ga0105237_102016611 334
563 3300025907 Ga0207645_10137861 Ga0207645_101378612 334
564 3300025926 Ga0207659_10291417 Ga0207659_102914172 334
565 3300025928 Ga0207700_10009310 Ga0207700_100093105 334
566 3300025934 Ga0207686_10036898 Ga0207686_100368983 334
567 3300025937 Ga0207669_10225962 Ga0207669_102259622 334
568 3300026089 Ga0207648_10021176 Ga0207648_100211766 334
569 3300026121 Ga0207683_10074035 Ga0207683_100740351 334
570 3300028380 Ga0268265_10135216 Ga0268265_101352162 334
571 3300031691 Ga0316579_10008200 Ga0316579_100082003 334
572 3300031733 Ga0316577_10004072 Ga0316577_100040728 334
573 3300031733 Ga0316577_10011921 Ga0316577_100119212 334
574 3300032126 Ga0307415_100026945 Ga0307415_1000269454 334
575 3300032137 Ga0316585_10025073 Ga0316585_100250732 334
576 3300035170 Ga0373943_0178810 Ga0373943_0178810_41_1048 334
577 3300035398 Ga0316574_0118045 Ga0316574_0118045_357_1403 334
578 3300035691 Ga0373931_0121855 Ga0373931_0121855_233_1249 334
579 3300035724 Ga0373933_0005577 Ga0373933_0005577_280_1287 334
580 3300035725 Ga0373947_0073535 Ga0373947_0073535_393_1400 334
581 3300036401 Ga0373937_0005022 Ga0373937_0005022_6720_7727 334
582 3300036647 Ga0316582_0019928 Ga0316582_0019928_1817_2863 334
583 3300036647 Ga0316582_0073152 Ga0316582_0073152_461_1507 334
584 3300036647 Ga0316582_0235184 Ga0316582_0235184_33_1076 334
585 3300036712 Ga0316584_0006669 Ga0316584_0006669_3734_4780 334
586 3300036712 Ga0316584_0017430 Ga0316584_0017430_1169_2212 334
587 3300036712 Ga0316584_0023607 Ga0316584_0023607_2690_3736 334
588 3300037068 Ga0373925_0001772 Ga0373925_0001772_13317_14324 334
589 3300037588 Ga0316581_0004087 Ga0316581_0004087_1297_2340 334
590 3300037853 Ga0436364_0590967 Ga0436364_0590967_143_1162 334
591 3300042156 Ga0439446_0002820 Ga0439446_0002820_2034_3047 334
592 3300046535 Ga0495586_0081698 Ga0495586_0081698_464_1471 334
593 3300046559 Ga0495667_0057927 Ga0495667_0057927_875_1882 334
594 3300046663 Ga0495635_0204655 Ga0495635_0204655_141_1148 334
595 3300046689 Ga0495613_0101747 Ga0495613_0101747_28_1035 334
596 3300047320 Ga0495672_0054727 Ga0495672_0054727_142_1149 334
597 3300049583 Ga0501067_0046308 Ga0501067_0046308_480_1499 334
598 3300049743 Ga0501081_0208773 Ga0501081_0208773_10_1026 334
599 3300050489 nmdc:mga03683_41095_c1 nmdc:mga03683_41095_c1_411_1418 334
600 3300050491 nmdc:mga00v17_37918_c1 nmdc:mga00v17_37918_c1_771_1778 334
601 3300050491 nmdc:mga00v17_77713_c1 nmdc:mga00v17_77713_c1_104_1111 334
602 3300050492 nmdc:mga0yw44_1474_c1 nmdc:mga0yw44_1474_c1_7376_8383 334
603 3300050492 nmdc:mga0yw44_160852_c1 nmdc:mga0yw44_160852_c1_348_1355 334
604 3300050492 nmdc:mga0yw44_40858_c1 nmdc:mga0yw44_40858_c1_924_1931 334
605 3300050493 nmdc:mga0k408_145299_c1 nmdc:mga0k408_145299_c1_133_1155 334
606 3300050493 nmdc:mga0k408_18006_c1 nmdc:mga0k408_18006_c1_2031_3038 334
607 3300050493 nmdc:mga0k408_31950_c1 nmdc:mga0k408_31950_c1_641_1648 334
608 3300050494 nmdc:mga06z11_12999_c1 nmdc:mga06z11_12999_c1_1021_2028 334
609 3300050494 nmdc:mga06z11_34056_c1 nmdc:mga06z11_34056_c1_114_1121 334
610 3300050496 nmdc:mga07m45_25880_c1 nmdc:mga07m45_25880_c1_920_1927 334
611 3300050514 nmdc:mga08x19_166032_c1 nmdc:mga08x19_166032_c1_472_1479 334
612 3300053085 Ga0495619_0070915 Ga0495619_0070915_1095_2102 334
613 3300053096 Ga0500641_0005555 Ga0500641_0005555_2503_3519 334
614 3300053139 Ga0500568_0002816 Ga0500568_0002816_3811_4818 334
615 3300005335 Ga0070666_10015679 Ga0070666_100156794 335
616 3300005441 Ga0070700_100112912 Ga0070700_1001129122 335
617 3300005445 Ga0070708_100008245 Ga0070708_1000082454 335
618 3300005457 Ga0070662_100183498 Ga0070662_1001834982 335
619 3300005467 Ga0070706_100050048 Ga0070706_1000500484 335
620 3300005468 Ga0070707_100067124 Ga0070707_1000671242 335
621 3300005471 Ga0070698_100062473 Ga0070698_1000624733 335
622 3300005471 Ga0070698_100101836 Ga0070698_1001018362 335
623 3300005544 Ga0070686_100000389 Ga0070686_10000038927 335
624 3300005549 Ga0070704_100159659 Ga0070704_1001596592 335
625 3300005578 Ga0068854_100011771 Ga0068854_1000117717 335
626 3300005617 Ga0068859_100277433 Ga0068859_1002774332 335
627 3300005842 Ga0068858_100001189 Ga0068858_10000118911 335
628 3300006237 Ga0097621_100022037 Ga0097621_1000220374 335
629 3300006358 Ga0068871_100175016 Ga0068871_1001750162 335
630 3300006871 Ga0075434_100024211 Ga0075434_1000242112 335
631 3300006871 Ga0075434_100029393 Ga0075434_1000293936 335
632 3300006880 Ga0075429_100156217 Ga0075429_1001562172 335
633 3300006914 Ga0075436_100116289 Ga0075436_1001162892 335
634 3300006931 Ga0097620_100277410 Ga0097620_1002774102 335
635 3300007076 Ga0075435_100000404 Ga0075435_10000040422 335
636 3300007076 Ga0075435_100007864 Ga0075435_1000078644 335
637 3300007076 Ga0075435_100026855 Ga0075435_1000268555 335
638 3300009094 Ga0111539_10103837 Ga0111539_101038372 335
639 3300009094 Ga0111539_10356257 Ga0111539_103562572 335
640 3300009148 Ga0105243_10010331 Ga0105243_100103312 335
641 3300009176 Ga0105242_10235946 Ga0105242_102359462 335
642 3300009177 Ga0105248_10037673 Ga0105248_100376733 335
643 3300014968 Ga0157379_10069759 Ga0157379_100697592 335
644 3300014969 Ga0157376_10135307 Ga0157376_101353072 335
645 3300021384 Ga0213876_10006867 Ga0213876_100068674 335
646 3300021388 Ga0213875_10051717 Ga0213875_100517171 335
647 3300025910 Ga0207684_10280410 Ga0207684_102804102 335
648 3300025911 Ga0207654_10163622 Ga0207654_101636222 335
649 3300025927 Ga0207687_10015618 Ga0207687_100156184 335
650 3300025934 Ga0207686_10111888 Ga0207686_101118882 335
651 3300025937 Ga0207669_10289000 Ga0207669_102890002 335
652 3300026035 Ga0207703_10010663 Ga0207703_100106637 335
653 3300026041 Ga0207639_10216468 Ga0207639_102164682 335
654 3300026075 Ga0207708_10068386 Ga0207708_100683862 335
655 3300026118 Ga0207675_100028140 Ga0207675_1000281404 335
656 3300026118 Ga0207675_100039984 Ga0207675_1000399844 335
657 3300027907 Ga0207428_10197336 Ga0207428_101973362 335
658 3300032002 Ga0307416_100363192 Ga0307416_1003631922 335
659 3300032126 Ga0307415_100216487 Ga0307415_1002164872 335
660 3300034817 Ga0373948_0000676 Ga0373948_0000676_1798_2817 335
661 3300034957 Ga0373938_0001388 Ga0373938_0001388_1240_2259 335
662 3300035091 Ga0373951_0003229 Ga0373951_0003229_2348_3367 335
663 3300035112 Ga0373932_0003775 Ga0373932_0003775_539_1558 335
664 3300035114 Ga0373939_0005435 Ga0373939_0005435_1718_2737 335
665 3300035115 Ga0373941_0002913 Ga0373941_0002913_520_1539 335
666 3300035121 Ga0373960_0000470 Ga0373960_0000470_5571_6590 335
667 3300035207 Ga0373942_0000397 Ga0373942_0000397_1960_2979 335
668 3300035241 Ga0373961_0001177 Ga0373961_0001177_157_1176 335
669 3300035691 Ga0373931_0000745 Ga0373931_0000745_8258_9277 335
670 3300037853 Ga0436364_1082044 Ga0436364_1082044_11256_12278 335
671 3300037853 Ga0436364_1302977 Ga0436364_1302977_589_1611 335
672 3300037853 Ga0436364_1305890 Ga0436364_1305890_1536_2558 335
673 3300037853 Ga0436364_1561614 Ga0436364_1561614_809_1831 335
674 3300039437 Ga0436365_0139158 Ga0436365_0139158_26997_28019 335
675 3300039437 Ga0436365_0651011 Ga0436365_0651011_365_1387 335
676 3300039450 Ga0436363_0783963 Ga0436363_0783963_430_1452 335
677 3300041999 Ga0439433_0020844 Ga0439433_0020844_124_1140 335
678 3300045051 Ga0451576_0196605 Ga0451576_0196605_282_1301 335
679 3300046455 Ga0495603_0169570 Ga0495603_0169570_210_1229 335
680 3300048905 Ga0496102_0021815 Ga0496102_0021815_990_2009 335
681 3300048909 Ga0496106_0056067 Ga0496106_0056067_612_1631 335
682 3300048910 Ga0496107_0037865 Ga0496107_0037865_2149_3168 335
683 3300049575 Ga0501039_0124465 Ga0501039_0124465_525_1547 335
684 3300049582 Ga0501048_0127839 Ga0501048_0127839_200_1222 335
685 3300049591 Ga0501075_0259906 Ga0501075_0259906_101_1123 335
686 3300049592 Ga0501076_0055225 Ga0501076_0055225_525_1547 335
687 3300049742 Ga0501080_0132665 Ga0501080_0132665_1062_2084 335
688 3300049743 Ga0501081_0039608 Ga0501081_0039608_329_1351 335
689 3300050508 nmdc:mga09592_92922_c1 nmdc:mga09592_92922_c1_711_1736 335
690 3300050512 nmdc:mga0n895_308189_c1 nmdc:mga0n895_308189_c1_254_1273 335
691 3300050512 nmdc:mga0n895_87737_c1 nmdc:mga0n895_87737_c1_1338_2360 335
692 3300050513 nmdc:mga0rr50_113520_c1 nmdc:mga0rr50_113520_c1_197_1219 335
693 3300050513 nmdc:mga0rr50_46504_c1 nmdc:mga0rr50_46504_c1_1669_2688 335
694 3300050513 nmdc:mga0rr50_618_c1 nmdc:mga0rr50_618_c1_5920_6939 335
695 3300050514 nmdc:mga08x19_74849_c1 nmdc:mga08x19_74849_c1_870_1889 335
696 3300054114 Ga0501084_0125809 Ga0501084_0125809_351_1373 335
697 3300059424 Ga0590075_009706 Ga0590075_009706_233_1249 335
698 3300061734 Ga0530510_0054064 Ga0530510_0054064_1017_2039 335
699 3300061734 Ga0530510_0100495 Ga0530510_0100495_789_1811 335
700 3300005334 Ga0068869_100201951 Ga0068869_1002019512 336
701 3300005338 Ga0068868_100026828 Ga0068868_1000268282 336
702 3300005356 Ga0070674_100074754 Ga0070674_1000747542 336
703 3300005434 Ga0070709_10001229 Ga0070709_100012292 336
704 3300005435 Ga0070714_100019140 Ga0070714_1000191406 336
705 3300005436 Ga0070713_100003818 Ga0070713_1000038189 336
706 3300005458 Ga0070681_10407187 Ga0070681_104071872 336
707 3300005536 Ga0070697_100018537 Ga0070697_1000185376 336
708 3300005536 Ga0070697_100126882 Ga0070697_1001268821 336
709 3300005548 Ga0070665_100005633 Ga0070665_10000563312 336
710 3300005564 Ga0070664_100257173 Ga0070664_1002571732 336
711 3300005618 Ga0068864_100096638 Ga0068864_1000966382 336
712 3300005841 Ga0068863_100148469 Ga0068863_1001484692 336
713 3300005842 Ga0068858_100021737 Ga0068858_1000217375 336
714 3300006028 Ga0070717_10153985 Ga0070717_101539852 336
715 3300006237 Ga0097621_100001459 Ga0097621_1000014592 336
716 3300006237 Ga0097621_100065705 Ga0097621_1000657054 336
717 3300006358 Ga0068871_100002675 Ga0068871_1000026758 336
718 3300006358 Ga0068871_100010750 Ga0068871_1000107508 336
719 3300006358 Ga0068871_100159556 Ga0068871_1001595562 336
720 3300006358 Ga0068871_100354334 Ga0068871_1003543342 336
721 3300006847 Ga0075431_100300913 Ga0075431_1003009132 336
722 3300006852 Ga0075433_10006822 Ga0075433_100068224 336
723 3300006852 Ga0075433_10009859 Ga0075433_100098592 336
724 3300006852 Ga0075433_10032074 Ga0075433_100320744 336
725 3300006852 Ga0075433_10035760 Ga0075433_100357604 336
726 3300006852 Ga0075433_10189384 Ga0075433_101893842 336
727 3300006871 Ga0075434_100008333 Ga0075434_1000083335 336
728 3300006871 Ga0075434_100028894 Ga0075434_1000288943 336
729 3300006881 Ga0068865_100248289 Ga0068865_1002482892 336
730 3300006914 Ga0075436_100207319 Ga0075436_1002073192 336
731 3300006914 Ga0075436_100289226 Ga0075436_1002892261 336
732 3300007076 Ga0075435_100003568 Ga0075435_10000356811 336
733 3300007076 Ga0075435_100012963 Ga0075435_1000129632 336
734 3300009093 Ga0105240_10068347 Ga0105240_100683474 336
735 3300009093 Ga0105240_10408376 Ga0105240_104083762 336
736 3300009098 Ga0105245_10015209 Ga0105245_100152095 336
737 3300009101 Ga0105247_10009155 Ga0105247_100091552 336
738 3300009147 Ga0114129_10000789 Ga0114129_1000078919 336
739 3300009147 Ga0114129_10004401 Ga0114129_1000440118 336
740 3300009147 Ga0114129_10011453 Ga0114129_1001145311 336
741 3300009147 Ga0114129_10030915 Ga0114129_100309156 336
742 3300009147 Ga0114129_10313663 Ga0114129_103136632 336
743 3300009177 Ga0105248_10000664 Ga0105248_1000066415 336
744 3300013308 Ga0157375_10470754 Ga0157375_104707542 336
745 3300014325 Ga0163163_10170607 Ga0163163_101706072 336
746 3300014969 Ga0157376_10013740 Ga0157376_100137406 336
747 3300025913 Ga0207695_10018579 Ga0207695_100185794 336
748 3300025922 Ga0207646_10078015 Ga0207646_100780153 336
749 3300025922 Ga0207646_10149029 Ga0207646_101490293 336
750 3300025934 Ga0207686_10061435 Ga0207686_100614352 336
751 3300025934 Ga0207686_10203108 Ga0207686_102031082 336
752 3300025941 Ga0207711_10027843 Ga0207711_100278433 336
753 3300025941 Ga0207711_10045880 Ga0207711_100458804 336
754 3300025941 Ga0207711_10081369 Ga0207711_100813694 336
755 3300026035 Ga0207703_10024671 Ga0207703_100246715 336
756 3300026095 Ga0207676_10009653 Ga0207676_100096538 336
757 3300028379 Ga0268266_10061556 Ga0268266_100615562 336
758 3300028381 Ga0268264_10170366 Ga0268264_101703662 336
759 3300031240 Ga0265320_10056306 Ga0265320_100563062 336
760 3300031711 Ga0265314_10017566 Ga0265314_100175665 336
761 3300032002 Ga0307416_100072405 Ga0307416_1000724052 336
762 3300032002 Ga0307416_100091844 Ga0307416_1000918443 336
763 3300032004 Ga0307414_10251627 Ga0307414_102516271 336
764 3300032005 Ga0307411_10018788 Ga0307411_100187882 336
765 3300032126 Ga0307415_100060077 Ga0307415_1000600773 336
766 3300035116 Ga0373945_0074859 Ga0373945_0074859_152_1177 336
767 3300035171 Ga0373946_0006590 Ga0373946_0006590_389_1414 336
768 3300035410 Ga0373924_0035833 Ga0373924_0035833_204_1229 336
769 3300035725 Ga0373947_0003351 Ga0373947_0003351_3623_4648 336
770 3300037068 Ga0373925_0179181 Ga0373925_0179181_148_1173 336
771 3300042876 Ga0451577_0083619 Ga0451577_0083619_392_1423 336
772 3300044712 Ga0453684_0200007 Ga0453684_0200007_431_1483 336
773 3300044901 Ga0466960_0042912 Ga0466960_0042912_256_1281 336
774 3300046511 Ga0495608_0003061 Ga0495608_0003061_5885_6910 336
775 3300046516 Ga0495628_0158473 Ga0495628_0158473_624_1643 336
776 3300046533 Ga0495640_0094560 Ga0495640_0094560_142_1161 336
777 3300046535 Ga0495586_0059180 Ga0495586_0059180_987_2006 336
778 3300046543 Ga0495645_0000493 Ga0495645_0000493_11367_12389 336
779 3300046683 Ga0495658_0004399 Ga0495658_0004399_499_1521 336
780 3300047319 Ga0495674_0186251 Ga0495674_0186251_339_1361 336
781 3300047471 Ga0495684_0009207 Ga0495684_0009207_6246_7268 336
782 3300047471 Ga0495684_0067641 Ga0495684_0067641_856_1875 336
783 3300048904 Ga0496101_0173885 Ga0496101_0173885_534_1559 336
784 3300048907 Ga0496104_0060848 Ga0496104_0060848_511_1530 336
785 3300048907 Ga0496104_0257083 Ga0496104_0257083_486_1511 336
786 3300048907 Ga0496104_0331960 Ga0496104_0331960_248_1282 336
787 3300048911 Ga0496108_0006264 Ga0496108_0006264_4456_5475 336
788 3300048915 Ga0496112_0026730 Ga0496112_0026730_1872_2891 336
789 3300049569 Ga0501032_0040454 Ga0501032_0040454_177_1202 336
790 3300049571 Ga0501034_0029251 Ga0501034_0029251_2972_3997 336
791 3300049573 Ga0501037_0067497 Ga0501037_0067497_1056_2081 336
792 3300049581 Ga0501047_0002524 Ga0501047_0002524_13126_14151 336
793 3300049586 Ga0501070_0081194 Ga0501070_0081194_1318_2343 336
794 3300049590 Ga0501074_0025661 Ga0501074_0025661_1709_2731 336
795 3300049593 Ga0501077_0037003 Ga0501077_0037003_89_1111 336
796 3300049823 Ga0501044_0004893 Ga0501044_0004893_5516_6541 336
797 3300049824 Ga0501045_0101489 Ga0501045_0101489_1088_2110 336
798 3300050507 nmdc:mga05p37_111890_c1 nmdc:mga05p37_111890_c1_2009_3031 336
799 3300050507 nmdc:mga05p37_16784_c1 nmdc:mga05p37_16784_c1_818_1864 336
800 3300050507 nmdc:mga05p37_25860_c1 nmdc:mga05p37_25860_c1_5336_6367 336
801 3300050507 nmdc:mga05p37_78381_c1 nmdc:mga05p37_78381_c1_1428_2453 336
802 3300050512 nmdc:mga0n895_1316_c1 nmdc:mga0n895_1316_c1_1364_2392 336
803 3300050512 nmdc:mga0n895_49179_c1 nmdc:mga0n895_49179_c1_299_1324 336
804 3300050513 nmdc:mga0rr50_73526_c1 nmdc:mga0rr50_73526_c1_89_1114 336
805 3300050515 nmdc:mga0a205_10903_c1 nmdc:mga0a205_10903_c1_2573_3619 336
806 3300050515 nmdc:mga0a205_126867_c1 nmdc:mga0a205_126867_c1_1108_2133 336
807 3300050515 nmdc:mga0a205_1881_c1 nmdc:mga0a205_1881_c1_1880_2908 336
808 3300050515 nmdc:mga0a205_43612_c1 nmdc:mga0a205_43612_c1_2836_3867 336
809 3300053084 Ga0495595_0032412 Ga0495595_0032412_665_1690 336
810 3300053085 Ga0495619_0115027 Ga0495619_0115027_687_1712 336
811 3300053085 Ga0495619_0190764 Ga0495619_0190764_272_1291 336
812 3300053153 Ga0500616_0007973 Ga0500616_0007973_3846_4862 336
813 3300053730 Ga0500645_006429 Ga0500645_006429_840_1856 336
814 3300060353 Ga0501082_0179954 Ga0501082_0179954_58_1119 336
815 3300005293 Ga0065715_10138485 Ga0065715_101384852 337
816 3300005354 Ga0070675_100004466 Ga0070675_1000044663 337
817 3300005354 Ga0070675_100076331 Ga0070675_1000763313 337
818 3300005355 Ga0070671_100026568 Ga0070671_1000265682 337
819 3300005364 Ga0070673_100024349 Ga0070673_1000243494 337
820 3300005458 Ga0070681_10338138 Ga0070681_103381381 337
821 3300005471 Ga0070698_100130472 Ga0070698_1001304722 337
822 3300005518 Ga0070699_100001478 Ga0070699_1000014782 337
823 3300005518 Ga0070699_100251656 Ga0070699_1002516562 337
824 3300005545 Ga0070695_100080846 Ga0070695_1000808462 337
825 3300005548 Ga0070665_100001535 Ga0070665_1000015358 337
826 3300005548 Ga0070665_100008373 Ga0070665_1000083737 337
827 3300005549 Ga0070704_100027985 Ga0070704_1000279854 337
828 3300005578 Ga0068854_100210859 Ga0068854_1002108592 337
829 3300005617 Ga0068859_100342316 Ga0068859_1003423162 337
830 3300005618 Ga0068864_100168127 Ga0068864_1001681272 337
831 3300005834 Ga0068851_10068409 Ga0068851_100684092 337
832 3300005842 Ga0068858_100017801 Ga0068858_1000178012 337
833 3300005844 Ga0068862_100190266 Ga0068862_1001902662 337
834 3300005985 Ga0081539_10001136 Ga0081539_100011363 337
835 3300005985 Ga0081539_10022160 Ga0081539_100221602 337
836 3300006846 Ga0075430_100002132 Ga0075430_1000021325 337
837 3300006846 Ga0075430_100039049 Ga0075430_1000390493 337
838 3300006847 Ga0075431_100035406 Ga0075431_1000354063 337
839 3300006847 Ga0075431_100120492 Ga0075431_1001204922 337
840 3300006852 Ga0075433_10235385 Ga0075433_102353852 337
841 3300006880 Ga0075429_100095622 Ga0075429_1000956222 337
842 3300006880 Ga0075429_100117838 Ga0075429_1001178382 337
843 3300006914 Ga0075436_100070091 Ga0075436_1000700913 337
844 3300006931 Ga0097620_100342343 Ga0097620_1003423432 337
845 3300006931 Ga0097620_100512561 Ga0097620_1005125612 337
846 3300007076 Ga0075435_100000052 Ga0075435_10000005231 337
847 3300007076 Ga0075435_100046358 Ga0075435_1000463584 337
848 3300007076 Ga0075435_100192867 Ga0075435_1001928672 337
849 3300009094 Ga0111539_10212420 Ga0111539_102124202 337
850 3300009094 Ga0111539_10437248 Ga0111539_104372482 337
851 3300009094 Ga0111539_10460950 Ga0111539_104609502 337
852 3300009098 Ga0105245_10299277 Ga0105245_102992772 337
853 3300009147 Ga0114129_10020006 Ga0114129_100200064 337
854 3300009176 Ga0105242_10009242 Ga0105242_100092427 337
855 3300009177 Ga0105248_10022913 Ga0105248_100229136 337
856 3300009177 Ga0105248_10322789 Ga0105248_103227892 337
857 3300009553 Ga0105249_10331160 Ga0105249_103311601 337
858 3300013296 Ga0157374_10002073 Ga0157374_100020738 337
859 3300013306 Ga0163162_10011402 Ga0163162_100114023 337
860 3300013308 Ga0157375_10350807 Ga0157375_103508072 337
861 3300014325 Ga0163163_10120836 Ga0163163_101208362 337
862 3300014325 Ga0163163_10243315 Ga0163163_102433152 337
863 3300014326 Ga0157380_10183966 Ga0157380_101839662 337
864 3300014968 Ga0157379_10024463 Ga0157379_100244632 337
865 3300014969 Ga0157376_10017805 Ga0157376_100178056 337
866 3300025321 Ga0207656_10034002 Ga0207656_100340022 337
867 3300025893 Ga0207682_10008568 Ga0207682_100085682 337
868 3300025893 Ga0207682_10050030 Ga0207682_100500302 337
869 3300025912 Ga0207707_10083906 Ga0207707_100839063 337
870 3300025912 Ga0207707_10252209 Ga0207707_102522092 337
871 3300025925 Ga0207650_10069096 Ga0207650_100690962 337
872 3300025926 Ga0207659_10000076 Ga0207659_1000007655 337
873 3300025927 Ga0207687_10009881 Ga0207687_100098812 337
874 3300025934 Ga0207686_10004368 Ga0207686_100043687 337
875 3300025937 Ga0207669_10035712 Ga0207669_100357123 337
876 3300025941 Ga0207711_10041623 Ga0207711_100416232 337
877 3300025941 Ga0207711_10216365 Ga0207711_102163652 337
878 3300025960 Ga0207651_10012741 Ga0207651_100127412 337
879 3300025960 Ga0207651_10162583 Ga0207651_101625832 337
880 3300025981 Ga0207640_10136928 Ga0207640_101369282 337
881 3300026023 Ga0207677_10022830 Ga0207677_100228303 337
882 3300026023 Ga0207677_10183431 Ga0207677_101834312 337
883 3300026088 Ga0207641_10257292 Ga0207641_102572922 337
884 3300026095 Ga0207676_10029836 Ga0207676_100298364 337
885 3300026095 Ga0207676_10519594 Ga0207676_105195941 337
886 3300026118 Ga0207675_100046772 Ga0207675_1000467723 337
887 3300028379 Ga0268266_10003216 Ga0268266_100032166 337
888 3300028379 Ga0268266_10018204 Ga0268266_100182043 337
889 3300028380 Ga0268265_10109520 Ga0268265_101095202 337
890 3300031548 Ga0307408_100126278 Ga0307408_1001262782 337
891 3300031731 Ga0307405_10046263 Ga0307405_100462632 337
892 3300031911 Ga0307412_10037270 Ga0307412_100372703 337
893 3300032002 Ga0307416_100031948 Ga0307416_1000319482 337
894 3300032005 Ga0307411_10065630 Ga0307411_100656303 337
895 3300035692 Ga0373935_0086377 Ga0373935_0086377_156_1181 337
896 3300036401 Ga0373937_0114119 Ga0373937_0114119_1016_2044 337
897 3300037068 Ga0373925_0036314 Ga0373925_0036314_765_1835 337
898 3300039437 Ga0436365_1466729 Ga0436365_1466729_186_1214 337
899 3300046454 Ga0495592_0233332 Ga0495592_0233332_108_1130 337
900 3300046455 Ga0495603_0128026 Ga0495603_0128026_340_1386 337
901 3300046459 Ga0495629_0093372 Ga0495629_0093372_527_1597 337
902 3300046678 Ga0495599_0079706 Ga0495599_0079706_842_1864 337
903 3300048907 Ga0496104_0196168 Ga0496104_0196168_891_1916 337
904 3300049587 Ga0501071_0012597 Ga0501071_0012597_4268_5284 337
905 3300049588 Ga0501072_0012508 Ga0501072_0012508_5311_6327 337
906 3300049592 Ga0501076_0041119 Ga0501076_0041119_1361_2377 337
907 3300049741 Ga0501079_0031287 Ga0501079_0031287_1057_2073 337
908 3300049742 Ga0501080_0167400 Ga0501080_0167400_272_1288 337
909 3300049824 Ga0501045_0031327 Ga0501045_0031327_2621_3637 337
910 3300050507 nmdc:mga05p37_18019_c1 nmdc:mga05p37_18019_c1_3184_4248 337
911 3300050507 nmdc:mga05p37_7021_c1 nmdc:mga05p37_7021_c1_4267_5286 337
912 3300050507 nmdc:mga05p37_708658_c1 nmdc:mga05p37_708658_c1_22_1086 337
913 3300050508 nmdc:mga09592_14385_c1 nmdc:mga09592_14385_c1_4561_5580 337
914 3300050509 nmdc:mga0qj67_23504_c1 nmdc:mga0qj67_23504_c1_2595_3614 337
915 3300050509 nmdc:mga0qj67_29438_c1 nmdc:mga0qj67_29438_c1_3167_4186 337
916 3300050509 nmdc:mga0qj67_937_c1 nmdc:mga0qj67_937_c1_14983_16008 337
917 3300050510 nmdc:mga06r32_38073_c1 nmdc:mga06r32_38073_c1_981_2000 337
918 3300050510 nmdc:mga06r32_49845_c1 nmdc:mga06r32_49845_c1_1110_2129 337
919 3300050511 nmdc:mga08y16_254091_c1 nmdc:mga08y16_254091_c1_28_1113 337
920 3300050512 nmdc:mga0n895_8_c1 nmdc:mga0n895_8_c1_114476_115522 337
921 3300050513 nmdc:mga0rr50_141743_c1 nmdc:mga0rr50_141743_c1_750_1775 337
922 3300050513 nmdc:mga0rr50_23_c1 nmdc:mga0rr50_23_c1_29430_30476 337
923 3300050514 nmdc:mga08x19_12493_c1 nmdc:mga08x19_12493_c1_2785_3810 337
924 3300050514 nmdc:mga08x19_165_c1 nmdc:mga08x19_165_c1_24516_25562 337
925 3300050515 nmdc:mga0a205_95171_c1 nmdc:mga0a205_95171_c1_1280_2344 337
926 3300053084 Ga0495595_0047937 Ga0495595_0047937_731_1756 337
927 3300053085 Ga0495619_0211269 Ga0495619_0211269_161_1189 337
928 3300060353 Ga0501082_0123224 Ga0501082_0123224_1191_2207 337
929 3300061734 Ga0530510_0207328 Ga0530510_0207328_144_1166 337
930 3300005331 Ga0070670_100042068 Ga0070670_1000420684 338
931 3300005331 Ga0070670_100354094 Ga0070670_1003540942 338
932 3300005365 Ga0070688_100028770 Ga0070688_1000287704 338
933 3300005365 Ga0070688_100043186 Ga0070688_1000431862 338
934 3300005456 Ga0070678_100154596 Ga0070678_1001545962 338
935 3300005457 Ga0070662_100086103 Ga0070662_1000861032 338
936 3300005564 Ga0070664_100010094 Ga0070664_1000100946 338
937 3300005564 Ga0070664_100043334 Ga0070664_1000433343 338
938 3300005577 Ga0068857_100014602 Ga0068857_1000146025 338
939 3300005843 Ga0068860_100188787 Ga0068860_1001887872 338
940 3300005985 Ga0081539_10003103 Ga0081539_1000310310 338
941 3300006042 Ga0075368_10018561 Ga0075368_100185612 338
942 3300006178 Ga0075367_10081000 Ga0075367_100810002 338
943 3300006844 Ga0075428_100026906 Ga0075428_1000269063 338
944 3300006847 Ga0075431_100007134 Ga0075431_1000071349 338
945 3300006852 Ga0075433_10167532 Ga0075433_101675322 338
946 3300006852 Ga0075433_10237001 Ga0075433_102370012 338
947 3300006871 Ga0075434_100002369 Ga0075434_1000023699 338
948 3300006871 Ga0075434_100353251 Ga0075434_1003532512 338
949 3300006880 Ga0075429_100037163 Ga0075429_1000371633 338
950 3300009094 Ga0111539_10006977 Ga0111539_100069773 338
951 3300009147 Ga0114129_10000408 Ga0114129_1000040829 338
952 3300009147 Ga0114129_10018940 Ga0114129_1001894011 338
953 3300009147 Ga0114129_10187259 Ga0114129_101872592 338
954 3300013308 Ga0157375_10048928 Ga0157375_100489283 338
955 3300014326 Ga0157380_10062877 Ga0157380_100628772 338
956 3300014326 Ga0157380_10252211 Ga0157380_102522112 338
957 3300014326 Ga0157380_10291239 Ga0157380_102912392 338
958 3300014326 Ga0157380_10304241 Ga0157380_103042412 338
959 3300014969 Ga0157376_10267496 Ga0157376_102674962 338
960 3300025918 Ga0207662_10071121 Ga0207662_100711212 338
961 3300025925 Ga0207650_10011892 Ga0207650_100118924 338
962 3300025925 Ga0207650_10257824 Ga0207650_102578242 338
963 3300025926 Ga0207659_10012655 Ga0207659_100126555 338
964 3300025931 Ga0207644_10188002 Ga0207644_101880022 338
965 3300025940 Ga0207691_10110778 Ga0207691_101107782 338
966 3300025940 Ga0207691_10127772 Ga0207691_101277722 338
967 3300025945 Ga0207679_10028683 Ga0207679_100286833 338
968 3300025945 Ga0207679_10049203 Ga0207679_100492034 338
969 3300026116 Ga0207674_10021650 Ga0207674_100216505 338
970 3300026121 Ga0207683_10194565 Ga0207683_101945652 338
971 3300027907 Ga0207428_10043674 Ga0207428_100436742 338
972 3300028381 Ga0268264_10116951 Ga0268264_101169512 338
973 3300031548 Ga0307408_100159240 Ga0307408_1001592402 338
974 3300041408 Ga0439453_0003954 Ga0439453_0003954_347_1393 338
975 3300042436 Ga0439435_0019563 Ga0439435_0019563_639_1685 338
976 3300044712 Ga0453684_0403822 Ga0453684_0403822_394_1425 338
977 3300046522 Ga0495643_0005940 Ga0495643_0005940_3082_4122 338
978 3300050507 nmdc:mga05p37_322971_c1 nmdc:mga05p37_322971_c1_552_1586 338
979 3300050507 nmdc:mga05p37_53467_c1 nmdc:mga05p37_53467_c1_2007_3038 338
980 3300050509 nmdc:mga0qj67_39067_c1 nmdc:mga0qj67_39067_c1_2062_3093 338
981 3300050511 nmdc:mga08y16_71377_c1 nmdc:mga08y16_71377_c1_412_1434 338
982 3300050512 nmdc:mga0n895_269171_c1 nmdc:mga0n895_269171_c1_450_1472 338
983 3300050512 nmdc:mga0n895_3430_c1 nmdc:mga0n895_3430_c1_1365_2396 338
984 3300050515 nmdc:mga0a205_133545_c1 nmdc:mga0a205_133545_c1_443_1465 338
985 3300050515 nmdc:mga0a205_39035_c1 nmdc:mga0a205_39035_c1_516_1547 338
986 3300059426 Ga0590077_000272 Ga0590077_000272_1735_2760 338
987 3300003203 JGI25406J46586_10015538 JGI25406J46586_100155382 339
988 3300005288 Ga0065714_10101838 Ga0065714_101018381 339
989 3300005290 Ga0065712_10001067 Ga0065712_100010673 339
990 3300005290 Ga0065712_10005487 Ga0065712_100054872 339
991 3300005293 Ga0065715_10007743 Ga0065715_100077433 339
992 3300005293 Ga0065715_10090431 Ga0065715_100904317 339
993 3300005293 Ga0065715_10129367 Ga0065715_101293672 339
994 3300005329 Ga0070683_100156849 Ga0070683_1001568492 339
995 3300005330 Ga0070690_100032433 Ga0070690_1000324332 339
996 3300005331 Ga0070670_100001433 Ga0070670_1000014336 339
997 3300005331 Ga0070670_100009794 Ga0070670_1000097947 339
998 3300005333 Ga0070677_10067860 Ga0070677_100678601 339
999 3300005335 Ga0070666_10186971 Ga0070666_101869712 339
1000 3300005340 Ga0070689_100054436 Ga0070689_1000544362 339
1001 3300005340 Ga0070689_100167533 Ga0070689_1001675332 339
1002 3300005343 Ga0070687_100086297 Ga0070687_1000862972 339
1003 3300005347 Ga0070668_100035114 Ga0070668_1000351143 339
1004 3300005353 Ga0070669_100040011 Ga0070669_1000400113 339
1005 3300005353 Ga0070669_100049696 Ga0070669_1000496962 339
1006 3300005353 Ga0070669_100106293 Ga0070669_1001062932 339
1007 3300005354 Ga0070675_100005236 Ga0070675_10000523610 339
1008 3300005354 Ga0070675_100018523 Ga0070675_1000185236 339
1009 3300005354 Ga0070675_100162626 Ga0070675_1001626262 339
1010 3300005364 Ga0070673_100030309 Ga0070673_1000303092 339
1011 3300005364 Ga0070673_100053604 Ga0070673_1000536044 339
1012 3300005365 Ga0070688_100009789 Ga0070688_1000097892 339
1013 3300005367 Ga0070667_100028584 Ga0070667_1000285845 339
1014 3300005440 Ga0070705_100231924 Ga0070705_1002319242 339
1015 3300005455 Ga0070663_100078067 Ga0070663_1000780672 339
1016 3300005456 Ga0070678_100131841 Ga0070678_1001318412 339
1017 3300005456 Ga0070678_100136269 Ga0070678_1001362692 339
1018 3300005457 Ga0070662_100169665 Ga0070662_1001696651 339
1019 3300005466 Ga0070685_10054417 Ga0070685_100544172 339
1020 3300005468 Ga0070707_100010426 Ga0070707_1000104267 339
1021 3300005468 Ga0070707_100229368 Ga0070707_1002293682 339
1022 3300005543 Ga0070672_100002400 Ga0070672_1000024002 339
1023 3300005543 Ga0070672_100063580 Ga0070672_1000635802 339
1024 3300005543 Ga0070672_100065840 Ga0070672_1000658402 339
1025 3300005545 Ga0070695_100006557 Ga0070695_1000065573 339
1026 3300005564 Ga0070664_100235096 Ga0070664_1002350962 339
1027 3300005577 Ga0068857_100392093 Ga0068857_1003920932 339
1028 3300005578 Ga0068854_100152009 Ga0068854_1001520092 339
1029 3300005615 Ga0070702_100041336 Ga0070702_1000413362 339
1030 3300005617 Ga0068859_100116308 Ga0068859_1001163083 339
1031 3300005618 Ga0068864_100200541 Ga0068864_1002005412 339
1032 3300005719 Ga0068861_100033397 Ga0068861_1000333972 339
1033 3300005841 Ga0068863_100088220 Ga0068863_1000882202 339
1034 3300005842 Ga0068858_100152523 Ga0068858_1001525232 339
1035 3300005843 Ga0068860_100075347 Ga0068860_1000753473 339
1036 3300005844 Ga0068862_100039812 Ga0068862_1000398125 339
1037 3300005985 Ga0081539_10000093 Ga0081539_10000093172 339
1038 3300006237 Ga0097621_100025087 Ga0097621_1000250874 339
1039 3300006358 Ga0068871_100065658 Ga0068871_1000656583 339
1040 3300006844 Ga0075428_100012430 Ga0075428_1000124306 339
1041 3300006844 Ga0075428_100021075 Ga0075428_1000210752 339
1042 3300006844 Ga0075428_100034478 Ga0075428_1000344782 339
1043 3300006844 Ga0075428_100035422 Ga0075428_1000354226 339
1044 3300006846 Ga0075430_100003023 Ga0075430_10000302313 339
1045 3300006846 Ga0075430_100004199 Ga0075430_1000041994 339
1046 3300006846 Ga0075430_100012727 Ga0075430_1000127275 339
1047 3300006846 Ga0075430_100029567 Ga0075430_1000295672 339
1048 3300006846 Ga0075430_100060471 Ga0075430_1000604714 339
1049 3300006847 Ga0075431_100002264 Ga0075431_10000226417 339
1050 3300006847 Ga0075431_100018235 Ga0075431_1000182354 339
1051 3300006847 Ga0075431_100021410 Ga0075431_1000214104 339
1052 3300006847 Ga0075431_100037491 Ga0075431_1000374913 339
1053 3300006847 Ga0075431_100113244 Ga0075431_1001132443 339
1054 3300006847 Ga0075431_100171495 Ga0075431_1001714952 339
1055 3300006852 Ga0075433_10006599 Ga0075433_100065994 339
1056 3300006852 Ga0075433_10021172 Ga0075433_100211723 339
1057 3300006871 Ga0075434_100000731 Ga0075434_10000073112 339
1058 3300006880 Ga0075429_100004068 Ga0075429_1000040686 339
1059 3300006880 Ga0075429_100005784 Ga0075429_1000057843 339
1060 3300006880 Ga0075429_100021887 Ga0075429_1000218873 339
1061 3300006880 Ga0075429_100022310 Ga0075429_1000223104 339
1062 3300006880 Ga0075429_100093695 Ga0075429_1000936953 339
1063 3300006881 Ga0068865_100056541 Ga0068865_1000565412 339
1064 3300006914 Ga0075436_100029447 Ga0075436_1000294472 339
1065 3300006931 Ga0097620_100116301 Ga0097620_1001163013 339
1066 3300007076 Ga0075435_100015716 Ga0075435_1000157163 339
1067 3300009094 Ga0111539_10000160 Ga0111539_1000016014 339
1068 3300009094 Ga0111539_10000270 Ga0111539_1000027043 339
1069 3300009094 Ga0111539_10002949 Ga0111539_1000294911 339
1070 3300009094 Ga0111539_10004422 Ga0111539_100044224 339
1071 3300009094 Ga0111539_10008296 Ga0111539_1000829612 339
1072 3300009094 Ga0111539_10029312 Ga0111539_100293126 339
1073 3300009094 Ga0111539_10034783 Ga0111539_100347834 339
1074 3300009094 Ga0111539_10055606 Ga0111539_100556062 339
1075 3300009094 Ga0111539_10154451 Ga0111539_101544513 339
1076 3300009094 Ga0111539_10425764 Ga0111539_104257642 339
1077 3300009094 Ga0111539_10551888 Ga0111539_105518881 339
1078 3300009147 Ga0114129_10000371 Ga0114129_1000037140 339
1079 3300009147 Ga0114129_10002976 Ga0114129_100029766 339
1080 3300009147 Ga0114129_10003376 Ga0114129_100033767 339
1081 3300009147 Ga0114129_10020472 Ga0114129_100204723 339
1082 3300009147 Ga0114129_10074121 Ga0114129_100741213 339
1083 3300009147 Ga0114129_10089707 Ga0114129_100897074 339
1084 3300009147 Ga0114129_10090426 Ga0114129_100904263 339
1085 3300009147 Ga0114129_10200198 Ga0114129_102001983 339
1086 3300009147 Ga0114129_10230305 Ga0114129_102303052 339
1087 3300009147 Ga0114129_10737072 Ga0114129_107370722 339
1088 3300009553 Ga0105249_10323631 Ga0105249_103236312 339
1089 3300013296 Ga0157374_10052814 Ga0157374_100528144 339
1090 3300013306 Ga0163162_10152487 Ga0163162_101524872 339
1091 3300014325 Ga0163163_10000071 Ga0163163_1000007124 339
1092 3300014325 Ga0163163_10004809 Ga0163163_100048094 339
1093 3300014326 Ga0157380_10069645 Ga0157380_100696452 339
1094 3300014326 Ga0157380_10130237 Ga0157380_101302372 339
1095 3300014745 Ga0157377_10138251 Ga0157377_101382512 339
1096 3300014969 Ga0157376_10019635 Ga0157376_100196352 339
1097 3300017792 Ga0163161_10162283 Ga0163161_101622832 339
1098 3300025893 Ga0207682_10016256 Ga0207682_100162563 339
1099 3300025901 Ga0207688_10093726 Ga0207688_100937262 339
1100 3300025907 Ga0207645_10057998 Ga0207645_100579982 339
1101 3300025908 Ga0207643_10004895 Ga0207643_100048957 339
1102 3300025918 Ga0207662_10014269 Ga0207662_100142695 339
1103 3300025922 Ga0207646_10028669 Ga0207646_100286694 339
1104 3300025923 Ga0207681_10025744 Ga0207681_100257442 339
1105 3300025923 Ga0207681_10038184 Ga0207681_100381842 339
1106 3300025923 Ga0207681_10046024 Ga0207681_100460243 339
1107 3300025923 Ga0207681_10166314 Ga0207681_101663142 339
1108 3300025923 Ga0207681_10231337 Ga0207681_102313372 339
1109 3300025925 Ga0207650_10004750 Ga0207650_100047502 339
1110 3300025925 Ga0207650_10009640 Ga0207650_100096405 339
1111 3300025926 Ga0207659_10006571 Ga0207659_100065711 339
1112 3300025926 Ga0207659_10010468 Ga0207659_100104682 339
1113 3300025926 Ga0207659_10048735 Ga0207659_100487353 339
1114 3300025926 Ga0207659_10068782 Ga0207659_100687822 339
1115 3300025933 Ga0207706_10013278 Ga0207706_100132783 339
1116 3300025938 Ga0207704_10025756 Ga0207704_100257563 339
1117 3300025938 Ga0207704_10121194 Ga0207704_101211942 339
1118 3300025940 Ga0207691_10030634 Ga0207691_100306343 339
1119 3300025940 Ga0207691_10039583 Ga0207691_100395832 339
1120 3300025940 Ga0207691_10082395 Ga0207691_100823952 339
1121 3300025941 Ga0207711_10041929 Ga0207711_100419292 339
1122 3300025944 Ga0207661_10188052 Ga0207661_101880522 339
1123 3300025981 Ga0207640_10131219 Ga0207640_101312192 339
1124 3300025986 Ga0207658_10038900 Ga0207658_100389002 339
1125 3300026035 Ga0207703_10141864 Ga0207703_101418642 339
1126 3300026075 Ga0207708_10070047 Ga0207708_100700473 339
1127 3300026075 Ga0207708_10078829 Ga0207708_100788293 339
1128 3300026088 Ga0207641_10002582 Ga0207641_100025829 339
1129 3300026088 Ga0207641_10268670 Ga0207641_102686702 339
1130 3300026089 Ga0207648_10028891 Ga0207648_100288914 339
1131 3300026095 Ga0207676_10240274 Ga0207676_102402742 339
1132 3300026116 Ga0207674_10420748 Ga0207674_104207482 339
1133 3300026118 Ga0207675_100040529 Ga0207675_1000405292 339
1134 3300026118 Ga0207675_100048339 Ga0207675_1000483393 339
1135 3300026118 Ga0207675_100116962 Ga0207675_1001169622 339
1136 3300026121 Ga0207683_10012599 Ga0207683_100125993 339
1137 3300026121 Ga0207683_10057984 Ga0207683_100579842 339
1138 3300027907 Ga0207428_10000970 Ga0207428_1000097014 339
1139 3300027907 Ga0207428_10003192 Ga0207428_100031929 339
1140 3300027907 Ga0207428_10079947 Ga0207428_100799473 339
1141 3300027907 Ga0207428_10124185 Ga0207428_101241852 339
1142 3300027907 Ga0207428_10129058 Ga0207428_101290582 339
1143 3300028380 Ga0268265_10016423 Ga0268265_100164234 339
1144 3300028380 Ga0268265_10206601 Ga0268265_102066012 339
1145 3300028380 Ga0268265_10285298 Ga0268265_102852982 339
1146 3300031548 Ga0307408_100059370 Ga0307408_1000593702 339
1147 3300031852 Ga0307410_10266071 Ga0307410_102660712 339
1148 3300032002 Ga0307416_100018870 Ga0307416_1000188704 339
1149 3300032002 Ga0307416_100034559 Ga0307416_1000345592 339
1150 3300032002 Ga0307416_100307291 Ga0307416_1003072912 339
1151 3300032005 Ga0307411_10058335 Ga0307411_100583352 339
1152 3300032005 Ga0307411_10059648 Ga0307411_100596482 339
1153 3300032126 Ga0307415_100077262 Ga0307415_1000772622 339
1154 3300035086 Ga0373934_0000325 Ga0373934_0000325_11262_12287 339
1155 3300035112 Ga0373932_0003989 Ga0373932_0003989_937_1968 339
1156 3300035115 Ga0373941_0075170 Ga0373941_0075170_39_1070 339
1157 3300035119 Ga0373956_0009905 Ga0373956_0009905_1604_2629 339
1158 3300035120 Ga0373957_0007056 Ga0373957_0007056_1254_2279 339
1159 3300035724 Ga0373933_0242448 Ga0373933_0242448_106_1131 339
1160 3300036401 Ga0373937_0000553 Ga0373937_0000553_27947_28972 339
1161 3300042008 Ga0439450_004696 Ga0439450_004696_676_1731 339
1162 3300042435 Ga0439434_0054737 Ga0439434_0054737_87_1130 339
1163 3300042436 Ga0439435_0001535 Ga0439435_0001535_2697_3752 339
1164 3300042439 Ga0439464_0011961 Ga0439464_0011961_1173_2228 339
1165 3300046454 Ga0495592_0117608 Ga0495592_0117608_431_1456 339
1166 3300046537 Ga0495598_0030293 Ga0495598_0030293_243_1289 339
1167 3300046615 Ga0495656_0059848 Ga0495656_0059848_327_1373 339
1168 3300048912 Ga0496109_0036244 Ga0496109_0036244_539_1570 339
1169 3300048913 Ga0496110_0102383 Ga0496110_0102383_597_1622 339
1170 3300048915 Ga0496112_0456760 Ga0496112_0456760_80_1165 339
1171 3300048916 Ga0496113_0074221 Ga0496113_0074221_171_1202 339
1172 3300049521 Ga0501298_005591 Ga0501298_005591_307_1344 339
1173 3300049568 Ga0501031_0065947 Ga0501031_0065947_591_1616 339
1174 3300049568 Ga0501031_0077081 Ga0501031_0077081_550_1575 339
1175 3300049569 Ga0501032_0000594 Ga0501032_0000594_24053_25099 339
1176 3300049569 Ga0501032_0025751 Ga0501032_0025751_1403_2428 339
1177 3300049570 Ga0501033_0003021 Ga0501033_0003021_4781_5806 339
1178 3300049571 Ga0501034_0000989 Ga0501034_0000989_24806_25852 339
1179 3300049571 Ga0501034_0063566 Ga0501034_0063566_673_1698 339
1180 3300049573 Ga0501037_0008815 Ga0501037_0008815_1687_2712 339
1181 3300049573 Ga0501037_0021628 Ga0501037_0021628_2015_3061 339
1182 3300049573 Ga0501037_0053384 Ga0501037_0053384_385_1431 339
1183 3300049574 Ga0501038_0006000 Ga0501038_0006000_2144_3169 339
1184 3300049575 Ga0501039_0013772 Ga0501039_0013772_2237_3283 339
1185 3300049575 Ga0501039_0017140 Ga0501039_0017140_977_2023 339
1186 3300049575 Ga0501039_0034163 Ga0501039_0034163_2626_3651 339
1187 3300049576 Ga0501040_0043247 Ga0501040_0043247_1817_2863 339
1188 3300049576 Ga0501040_0151808 Ga0501040_0151808_270_1316 339
1189 3300049577 Ga0501041_0011415 Ga0501041_0011415_1463_2509 339
1190 3300049577 Ga0501041_0017929 Ga0501041_0017929_2157_3203 339
1191 3300049577 Ga0501041_0076403 Ga0501041_0076403_740_1771 339
1192 3300049579 Ga0501043_0000285 Ga0501043_0000285_32495_33520 339
1193 3300049579 Ga0501043_0004957 Ga0501043_0004957_1418_2464 339
1194 3300049579 Ga0501043_0078462 Ga0501043_0078462_1308_2333 339
1195 3300049579 Ga0501043_0105304 Ga0501043_0105304_1034_2059 339
1196 3300049579 Ga0501043_0113866 Ga0501043_0113866_735_1781 339
1197 3300049580 Ga0501046_0001864 Ga0501046_0001864_1883_2929 339
1198 3300049580 Ga0501046_0013407 Ga0501046_0013407_914_1939 339
1199 3300049580 Ga0501046_0031107 Ga0501046_0031107_3006_4031 339
1200 3300049580 Ga0501046_0091027 Ga0501046_0091027_912_1958 339
1201 3300049581 Ga0501047_0001605 Ga0501047_0001605_10474_11520 339
1202 3300049581 Ga0501047_0002079 Ga0501047_0002079_15892_16917 339
1203 3300049581 Ga0501047_0032690 Ga0501047_0032690_151_1176 339
1204 3300049582 Ga0501048_0037392 Ga0501048_0037392_1846_2871 339
1205 3300049582 Ga0501048_0046852 Ga0501048_0046852_1665_2690 339
1206 3300049582 Ga0501048_0135839 Ga0501048_0135839_603_1634 339
1207 3300049583 Ga0501067_0032476 Ga0501067_0032476_1555_2601 339
1208 3300049583 Ga0501067_0037370 Ga0501067_0037370_938_1963 339
1209 3300049584 Ga0501068_0028241 Ga0501068_0028241_1644_2669 339
1210 3300049584 Ga0501068_0029674 Ga0501068_0029674_103_1149 339
1211 3300049584 Ga0501068_0069299 Ga0501068_0069299_903_1928 339
1212 3300049584 Ga0501068_0112699 Ga0501068_0112699_47_1093 339
1213 3300049589 Ga0501073_0003896 Ga0501073_0003896_6965_8011 339
1214 3300049589 Ga0501073_0018175 Ga0501073_0018175_3709_4734 339
1215 3300049589 Ga0501073_0033355 Ga0501073_0033355_2260_3285 339
1216 3300049589 Ga0501073_0096697 Ga0501073_0096697_178_1224 339
1217 3300049590 Ga0501074_0294327 Ga0501074_0294327_76_1101 339
1218 3300049591 Ga0501075_0024239 Ga0501075_0024239_287_1318 339
1219 3300049591 Ga0501075_0135639 Ga0501075_0135639_557_1603 339
1220 3300049591 Ga0501075_0141537 Ga0501075_0141537_143_1171 339
1221 3300049592 Ga0501076_0004732 Ga0501076_0004732_4640_5686 339
1222 3300049592 Ga0501076_0108504 Ga0501076_0108504_686_1714 339
1223 3300049593 Ga0501077_0055677 Ga0501077_0055677_1335_2360 339
1224 3300049741 Ga0501079_0017221 Ga0501079_0017221_4450_5496 339
1225 3300049741 Ga0501079_0042597 Ga0501079_0042597_1576_2607 339
1226 3300049741 Ga0501079_0113743 Ga0501079_0113743_870_1895 339
1227 3300049742 Ga0501080_0020114 Ga0501080_0020114_766_1812 339
1228 3300049742 Ga0501080_0051305 Ga0501080_0051305_2094_3119 339
1229 3300049742 Ga0501080_0054814 Ga0501080_0054814_1580_2626 339
1230 3300049743 Ga0501081_0085999 Ga0501081_0085999_700_1731 339
1231 3300049822 Ga0501035_0014031 Ga0501035_0014031_475_1521 339
1232 3300049822 Ga0501035_0172317 Ga0501035_0172317_337_1368 339
1233 3300049823 Ga0501044_0003133 Ga0501044_0003133_4452_5498 339
1234 3300049823 Ga0501044_0070579 Ga0501044_0070579_1812_2837 339
1235 3300049824 Ga0501045_0009645 Ga0501045_0009645_4913_5959 339
1236 3300049824 Ga0501045_0106232 Ga0501045_0106232_496_1542 339
1237 3300050507 nmdc:mga05p37_18668_c1 nmdc:mga05p37_18668_c1_1517_2548 339
1238 3300050507 nmdc:mga05p37_330777_c1 nmdc:mga05p37_330777_c1_549_1604 339
1239 3300050507 nmdc:mga05p37_38415_c1 nmdc:mga05p37_38415_c1_3623_4666 339
1240 3300050507 nmdc:mga05p37_4675_c1 nmdc:mga05p37_4675_c1_9208_10263 339
1241 3300050507 nmdc:mga05p37_548435_c1 nmdc:mga05p37_548435_c1_184_1230 339
1242 3300050507 nmdc:mga05p37_6052_c1 nmdc:mga05p37_6052_c1_535_1566 339
1243 3300050507 nmdc:mga05p37_651139_c1 nmdc:mga05p37_651139_c1_84_1130 339
1244 3300050507 nmdc:mga05p37_83007_c1 nmdc:mga05p37_83007_c1_426_1457 339
1245 3300050508 nmdc:mga09592_139339_c1 nmdc:mga09592_139339_c1_758_1783 339
1246 3300050508 nmdc:mga09592_21193_c1 nmdc:mga09592_21193_c1_2979_4019 339
1247 3300050508 nmdc:mga09592_7566_c1 nmdc:mga09592_7566_c1_5195_6250 339
1248 3300050508 nmdc:mga09592_87113_c1 nmdc:mga09592_87113_c1_1143_2174 339
1249 3300050508 nmdc:mga09592_938_c1 nmdc:mga09592_938_c1_5743_6798 339
1250 3300050509 nmdc:mga0qj67_11622_c1 nmdc:mga0qj67_11622_c1_3165_4211 339
1251 3300050509 nmdc:mga0qj67_181242_c1 nmdc:mga0qj67_181242_c1_646_1701 339
1252 3300050509 nmdc:mga0qj67_32481_c1 nmdc:mga0qj67_32481_c1_2118_3164 339
1253 3300050509 nmdc:mga0qj67_43311_c1 nmdc:mga0qj67_43311_c1_1763_2788 339
1254 3300050509 nmdc:mga0qj67_73854_c1 nmdc:mga0qj67_73854_c1_966_1991 339
1255 3300050510 nmdc:mga06r32_113865_c1 nmdc:mga06r32_113865_c1_37_1083 339
1256 3300050510 nmdc:mga06r32_1407_c1 nmdc:mga06r32_1407_c1_8614_9669 339
1257 3300050510 nmdc:mga06r32_255436_c1 nmdc:mga06r32_255436_c1_298_1323 339
1258 3300050510 nmdc:mga06r32_288400_c1 nmdc:mga06r32_288400_c1_18_1049 339
1259 3300050510 nmdc:mga06r32_62317_c1 nmdc:mga06r32_62317_c1_21_1076 339
1260 3300050510 nmdc:mga06r32_68410_c1 nmdc:mga06r32_68410_c1_885_1931 339
1261 3300050510 nmdc:mga06r32_75625_c1 nmdc:mga06r32_75625_c1_1650_2675 339
1262 3300050511 nmdc:mga08y16_10_c1 nmdc:mga08y16_10_c1_12130_13161 339
1263 3300050511 nmdc:mga08y16_142065_c1 nmdc:mga08y16_142065_c1_22_1047 339
1264 3300050511 nmdc:mga08y16_1646_c1 nmdc:mga08y16_1646_c1_13709_14755 339
1265 3300050511 nmdc:mga08y16_194135_c1 nmdc:mga08y16_194135_c1_775_1845 339
1266 3300050511 nmdc:mga08y16_2467_c1 nmdc:mga08y16_2467_c1_16191_17246 339
1267 3300050511 nmdc:mga08y16_35677_c1 nmdc:mga08y16_35677_c1_2410_3456 339
1268 3300050511 nmdc:mga08y16_46066_c1 nmdc:mga08y16_46066_c1_1011_2045 339
1269 3300050511 nmdc:mga08y16_5683_c1 nmdc:mga08y16_5683_c1_9768_10808 339
1270 3300050511 nmdc:mga08y16_60570_c1 nmdc:mga08y16_60570_c1_2659_3696 339
1271 3300050511 nmdc:mga08y16_99013_c1 nmdc:mga08y16_99013_c1_937_1992 339
1272 3300050512 nmdc:mga0n895_26996_c1 nmdc:mga0n895_26996_c1_1546_2592 339
1273 3300050513 nmdc:mga0rr50_23725_c1 nmdc:mga0rr50_23725_c1_1766_2803 339
1274 3300050514 nmdc:mga08x19_9112_c1 nmdc:mga08x19_9112_c1_211_1248 339
1275 3300050515 nmdc:mga0a205_1158_c1 nmdc:mga0a205_1158_c1_18497_19543 339
1276 3300050515 nmdc:mga0a205_22816_c1 nmdc:mga0a205_22816_c1_3353_4390 339
1277 3300054114 Ga0501084_0021923 Ga0501084_0021923_1160_2206 339
1278 3300054114 Ga0501084_0026735 Ga0501084_0026735_1530_2555 339
1279 3300060353 Ga0501082_0006545 Ga0501082_0006545_3571_4617 339
1280 3300060353 Ga0501082_0042784 Ga0501082_0042784_717_1763 339
1281 3300060353 Ga0501082_0122567 Ga0501082_0122567_897_1943 339
1282 3300060353 Ga0501082_0297195 Ga0501082_0297195_323_1348 339
1283 3300061734 Ga0530510_0002864 Ga0530510_0002864_400_1446 339
1284 3300061734 Ga0530510_0282030 Ga0530510_0282030_176_1204 339
1285 3300005328 Ga0070676_10000699 Ga0070676_1000069910 340
1286 3300005330 Ga0070690_100012690 Ga0070690_1000126902 340
1287 3300005331 Ga0070670_100005513 Ga0070670_1000055137 340
1288 3300005333 Ga0070677_10051419 Ga0070677_100514192 340
1289 3300005334 Ga0068869_100002046 Ga0068869_10000204610 340
1290 3300005341 Ga0070691_10003375 Ga0070691_100033752 340
1291 3300005353 Ga0070669_100015255 Ga0070669_1000152552 340
1292 3300005353 Ga0070669_100028635 Ga0070669_1000286354 340
1293 3300005354 Ga0070675_100000715 Ga0070675_10000071515 340
1294 3300005354 Ga0070675_100003599 Ga0070675_1000035993 340
1295 3300005354 Ga0070675_100086005 Ga0070675_1000860052 340
1296 3300005355 Ga0070671_100026757 Ga0070671_1000267575 340
1297 3300005365 Ga0070688_100087439 Ga0070688_1000874392 340
1298 3300005440 Ga0070705_100009633 Ga0070705_1000096333 340
1299 3300005441 Ga0070700_100002426 Ga0070700_1000024264 340
1300 3300005444 Ga0070694_100012406 Ga0070694_1000124063 340
1301 3300005455 Ga0070663_100016695 Ga0070663_1000166954 340
1302 3300005456 Ga0070678_100135310 Ga0070678_1001353102 340
1303 3300005459 Ga0068867_100005370 Ga0068867_1000053709 340
1304 3300005459 Ga0068867_100006297 Ga0068867_10000629710 340
1305 3300005466 Ga0070685_10107806 Ga0070685_101078062 340
1306 3300005468 Ga0070707_100069496 Ga0070707_1000694963 340
1307 3300005471 Ga0070698_100019157 Ga0070698_1000191577 340
1308 3300005471 Ga0070698_100097531 Ga0070698_1000975312 340
1309 3300005543 Ga0070672_100014113 Ga0070672_1000141135 340
1310 3300005543 Ga0070672_100048803 Ga0070672_1000488033 340
1311 3300005543 Ga0070672_100130333 Ga0070672_1001303332 340
1312 3300005545 Ga0070695_100132550 Ga0070695_1001325502 340
1313 3300005546 Ga0070696_100014340 Ga0070696_1000143405 340
1314 3300005564 Ga0070664_100021168 Ga0070664_1000211684 340
1315 3300005578 Ga0068854_100157595 Ga0068854_1001575952 340
1316 3300005615 Ga0070702_100000153 Ga0070702_1000001535 340
1317 3300005615 Ga0070702_100170388 Ga0070702_1001703882 340
1318 3300005618 Ga0068864_100023290 Ga0068864_1000232905 340
1319 3300005618 Ga0068864_100031127 Ga0068864_1000311274 340
1320 3300005842 Ga0068858_100013485 Ga0068858_1000134859 340
1321 3300006844 Ga0075428_100001280 Ga0075428_10000128011 340
1322 3300006880 Ga0075429_100005224 Ga0075429_10000522411 340
1323 3300006880 Ga0075429_100016230 Ga0075429_1000162305 340
1324 3300009094 Ga0111539_10000696 Ga0111539_1000069612 340
1325 3300009094 Ga0111539_10002555 Ga0111539_1000255511 340
1326 3300009094 Ga0111539_10005052 Ga0111539_1000505215 340
1327 3300009094 Ga0111539_10317099 Ga0111539_103170992 340
1328 3300009551 Ga0105238_10063751 Ga0105238_100637512 340
1329 3300011119 Ga0105246_10126138 Ga0105246_101261382 340
1330 3300013308 Ga0157375_10065147 Ga0157375_100651472 340
1331 3300014325 Ga0163163_10191023 Ga0163163_101910232 340
1332 3300014326 Ga0157380_10034893 Ga0157380_100348934 340
1333 3300014326 Ga0157380_10138972 Ga0157380_101389721 340
1334 3300025315 Ga0207697_10000859 Ga0207697_1000085911 340
1335 3300025321 Ga0207656_10011322 Ga0207656_100113222 340
1336 3300025901 Ga0207688_10001748 Ga0207688_100017486 340
1337 3300025907 Ga0207645_10000703 Ga0207645_100007038 340
1338 3300025920 Ga0207649_10033009 Ga0207649_100330092 340
1339 3300025922 Ga0207646_10062795 Ga0207646_100627953 340
1340 3300025923 Ga0207681_10008481 Ga0207681_100084817 340
1341 3300025925 Ga0207650_10001995 Ga0207650_100019959 340
1342 3300025925 Ga0207650_10012937 Ga0207650_100129373 340
1343 3300025926 Ga0207659_10003576 Ga0207659_100035763 340
1344 3300025926 Ga0207659_10070589 Ga0207659_100705892 340
1345 3300025926 Ga0207659_10142364 Ga0207659_101423642 340
1346 3300025931 Ga0207644_10004800 Ga0207644_100048008 340
1347 3300025931 Ga0207644_10073361 Ga0207644_100733612 340
1348 3300025931 Ga0207644_10135843 Ga0207644_101358432 340
1349 3300025933 Ga0207706_10126412 Ga0207706_101264122 340
1350 3300025933 Ga0207706_10212713 Ga0207706_102127132 340
1351 3300025936 Ga0207670_10234871 Ga0207670_102348712 340
1352 3300025938 Ga0207704_10026635 Ga0207704_100266352 340
1353 3300025942 Ga0207689_10001675 Ga0207689_1000167511 340
1354 3300025944 Ga0207661_10061119 Ga0207661_100611192 340
1355 3300025945 Ga0207679_10011333 Ga0207679_100113333 340
1356 3300026023 Ga0207677_10095699 Ga0207677_100956992 340
1357 3300026067 Ga0207678_10050761 Ga0207678_100507613 340
1358 3300026075 Ga0207708_10032141 Ga0207708_100321413 340
1359 3300026075 Ga0207708_10040632 Ga0207708_100406322 340
1360 3300026089 Ga0207648_10000821 Ga0207648_1000082112 340
1361 3300026089 Ga0207648_10042395 Ga0207648_100423954 340
1362 3300026095 Ga0207676_10056367 Ga0207676_100563673 340
1363 3300026095 Ga0207676_10178086 Ga0207676_101780861 340
1364 3300026118 Ga0207675_100012476 Ga0207675_1000124762 340
1365 3300026118 Ga0207675_100036435 Ga0207675_1000364353 340
1366 3300026121 Ga0207683_10237053 Ga0207683_102370532 340
1367 3300027907 Ga0207428_10004284 Ga0207428_100042844 340
1368 3300031548 Ga0307408_100035134 Ga0307408_1000351343 340
1369 3300031731 Ga0307405_10000373 Ga0307405_1000037311 340
1370 3300031852 Ga0307410_10031856 Ga0307410_100318563 340
1371 3300031901 Ga0307406_10007994 Ga0307406_100079943 340
1372 3300031903 Ga0307407_10008101 Ga0307407_100081013 340
1373 3300031911 Ga0307412_10003351 Ga0307412_100033518 340
1374 3300031995 Ga0307409_100001999 Ga0307409_1000019998 340
1375 3300032002 Ga0307416_100019475 Ga0307416_1000194752 340
1376 3300032004 Ga0307414_10029924 Ga0307414_100299243 340
1377 3300032005 Ga0307411_10000802 Ga0307411_1000080210 340
1378 3300032126 Ga0307415_100020045 Ga0307415_1000200453 340
1379 3300039437 Ga0436365_1086484 Ga0436365_1086484_114_1157 340
1380 3300042436 Ga0439435_0009051 Ga0439435_0009051_691_1725 340
1381 3300046454 Ga0495592_0122636 Ga0495592_0122636_733_1764 340
1382 3300046455 Ga0495603_0049212 Ga0495603_0049212_1077_2108 340
1383 3300046459 Ga0495629_0030437 Ga0495629_0030437_1667_2698 340
1384 3300046683 Ga0495658_0012264 Ga0495658_0012264_408_1448 340
1385 3300048905 Ga0496102_0073068 Ga0496102_0073068_2060_3091 340
1386 3300048909 Ga0496106_0034476 Ga0496106_0034476_1151_2182 340
1387 3300048910 Ga0496107_0071330 Ga0496107_0071330_449_1480 340
1388 3300048913 Ga0496110_0051930 Ga0496110_0051930_1853_2884 340
1389 3300048914 Ga0496111_0024229 Ga0496111_0024229_871_1908 340
1390 3300049568 Ga0501031_0002515 Ga0501031_0002515_3522_4550 340
1391 3300049569 Ga0501032_0015836 Ga0501032_0015836_3157_4185 340
1392 3300049569 Ga0501032_0049435 Ga0501032_0049435_806_1834 340
1393 3300049570 Ga0501033_0002780 Ga0501033_0002780_6993_8021 340
1394 3300049570 Ga0501033_0003873 Ga0501033_0003873_8047_9075 340
1395 3300049570 Ga0501033_0014866 Ga0501033_0014866_866_1894 340
1396 3300049571 Ga0501034_0031709 Ga0501034_0031709_1986_3014 340
1397 3300049572 Ga0501036_0006817 Ga0501036_0006817_290_1318 340
1398 3300049572 Ga0501036_0102611 Ga0501036_0102611_1354_2382 340
1399 3300049572 Ga0501036_0128739 Ga0501036_0128739_49_1077 340
1400 3300049573 Ga0501037_0008778 Ga0501037_0008778_792_1820 340
1401 3300049573 Ga0501037_0169340 Ga0501037_0169340_373_1401 340
1402 3300049574 Ga0501038_0026332 Ga0501038_0026332_3414_4442 340
1403 3300049575 Ga0501039_0037595 Ga0501039_0037595_1874_2902 340
1404 3300049575 Ga0501039_0093667 Ga0501039_0093667_122_1162 340
1405 3300049578 Ga0501042_0002776 Ga0501042_0002776_7863_8891 340
1406 3300049579 Ga0501043_0021725 Ga0501043_0021725_3059_4087 340
1407 3300049579 Ga0501043_0164537 Ga0501043_0164537_15_1043 340
1408 3300049580 Ga0501046_0053464 Ga0501046_0053464_785_1813 340
1409 3300049581 Ga0501047_0112880 Ga0501047_0112880_1001_2029 340
1410 3300049582 Ga0501048_0053807 Ga0501048_0053807_887_1915 340
1411 3300049582 Ga0501048_0066877 Ga0501048_0066877_601_1629 340
1412 3300049583 Ga0501067_0023005 Ga0501067_0023005_1421_2449 340
1413 3300049583 Ga0501067_0038010 Ga0501067_0038010_1098_2126 340
1414 3300049584 Ga0501068_0032487 Ga0501068_0032487_699_1727 340
1415 3300049585 Ga0501069_0000964 Ga0501069_0000964_5863_6891 340
1416 3300049585 Ga0501069_0004730 Ga0501069_0004730_3537_4565 340
1417 3300049586 Ga0501070_0023127 Ga0501070_0023127_3928_4956 340
1418 3300049586 Ga0501070_0088768 Ga0501070_0088768_113_1141 340
1419 3300049587 Ga0501071_0001640 Ga0501071_0001640_10044_11084 340
1420 3300049587 Ga0501071_0001811 Ga0501071_0001811_240_1268 340
1421 3300049588 Ga0501072_0024980 Ga0501072_0024980_107_1141 340
1422 3300049588 Ga0501072_0034747 Ga0501072_0034747_1342_2382 340
1423 3300049589 Ga0501073_0004945 Ga0501073_0004945_8047_9075 340
1424 3300049589 Ga0501073_0014655 Ga0501073_0014655_3278_4306 340
1425 3300049590 Ga0501074_0030303 Ga0501074_0030303_2240_3268 340
1426 3300049591 Ga0501075_0052530 Ga0501075_0052530_1680_2720 340
1427 3300049592 Ga0501076_0253131 Ga0501076_0253131_391_1425 340
1428 3300049741 Ga0501079_0003374 Ga0501079_0003374_6776_7804 340
1429 3300049741 Ga0501079_0051801 Ga0501079_0051801_505_1539 340
1430 3300049741 Ga0501079_0062463 Ga0501079_0062463_1003_2031 340
1431 3300049741 Ga0501079_0133726 Ga0501079_0133726_250_1278 340
1432 3300049742 Ga0501080_0014909 Ga0501080_0014909_1368_2396 340
1433 3300049742 Ga0501080_0042829 Ga0501080_0042829_3150_4178 340
1434 3300049744 Ga0501083_0001360 Ga0501083_0001360_1799_2827 340
1435 3300049744 Ga0501083_0016462 Ga0501083_0016462_2570_3598 340
1436 3300049822 Ga0501035_0063294 Ga0501035_0063294_37_1065 340
1437 3300049822 Ga0501035_0103723 Ga0501035_0103723_113_1141 340
1438 3300049822 Ga0501035_0141613 Ga0501035_0141613_946_1974 340
1439 3300049823 Ga0501044_0039726 Ga0501044_0039726_2172_3200 340
1440 3300049823 Ga0501044_0077632 Ga0501044_0077632_986_2014 340
1441 3300049824 Ga0501045_0004268 Ga0501045_0004268_6295_7323 340
1442 3300050510 nmdc:mga06r32_97439_c1 nmdc:mga06r32_97439_c1_666_1748 340
1443 3300050511 nmdc:mga08y16_280094_c1 nmdc:mga08y16_280094_c1_116_1198 340
1444 3300050511 nmdc:mga08y16_3210_c1 nmdc:mga08y16_3210_c1_14685_15734 340
1445 3300050511 nmdc:mga08y16_353_c1 nmdc:mga08y16_353_c1_14536_15582 340
1446 3300050511 nmdc:mga08y16_5423_c1 nmdc:mga08y16_5423_c1_1847_2884 340
1447 3300054114 Ga0501084_0037950 Ga0501084_0037950_2353_3381 340
1448 3300054114 Ga0501084_0052591 Ga0501084_0052591_2065_3093 340
1449 3300054114 Ga0501084_0071570 Ga0501084_0071570_343_1377 340
1450 3300060353 Ga0501082_0049299 Ga0501082_0049299_2435_3463 340
1451 2162886007 SwRhRL2b_contig_2730243 SwRhRL2b_0880.00000600 341
1452 3300005329 Ga0070683_100015263 Ga0070683_1000152633 341
1453 3300005354 Ga0070675_100139881 Ga0070675_1001398812 341
1454 3300005355 Ga0070671_100083344 Ga0070671_1000833442 341
1455 3300005355 Ga0070671_100132433 Ga0070671_1001324332 341
1456 3300005440 Ga0070705_100000578 Ga0070705_10000057812 341
1457 3300005440 Ga0070705_100004206 Ga0070705_1000042067 341
1458 3300005444 Ga0070694_100012204 Ga0070694_1000122045 341
1459 3300005444 Ga0070694_100024346 Ga0070694_1000243462 341
1460 3300005444 Ga0070694_100213336 Ga0070694_1002133362 341
1461 3300005445 Ga0070708_100081280 Ga0070708_1000812802 341
1462 3300005458 Ga0070681_10003182 Ga0070681_100031824 341
1463 3300005468 Ga0070707_100079569 Ga0070707_1000795692 341
1464 3300005471 Ga0070698_100002994 Ga0070698_1000029946 341
1465 3300005518 Ga0070699_100000346 Ga0070699_10000034618 341
1466 3300005518 Ga0070699_100001918 Ga0070699_10000191817 341
1467 3300005518 Ga0070699_100004733 Ga0070699_10000473311 341
1468 3300005535 Ga0070684_100058430 Ga0070684_1000584302 341
1469 3300005536 Ga0070697_100061332 Ga0070697_1000613322 341
1470 3300005536 Ga0070697_100133649 Ga0070697_1001336492 341
1471 3300005536 Ga0070697_100230011 Ga0070697_1002300111 341
1472 3300005536 Ga0070697_100237038 Ga0070697_1002370382 341
1473 3300005545 Ga0070695_100000155 Ga0070695_10000015525 341
1474 3300005545 Ga0070695_100060102 Ga0070695_1000601022 341
1475 3300005546 Ga0070696_100000499 Ga0070696_1000004999 341
1476 3300005546 Ga0070696_100011530 Ga0070696_1000115302 341
1477 3300005546 Ga0070696_100012876 Ga0070696_1000128764 341
1478 3300005546 Ga0070696_100026489 Ga0070696_1000264892 341
1479 3300005546 Ga0070696_100161469 Ga0070696_1001614692 341
1480 3300005549 Ga0070704_100004806 Ga0070704_1000048062 341
1481 3300005549 Ga0070704_100032495 Ga0070704_1000324952 341
1482 3300005577 Ga0068857_100026939 Ga0068857_1000269393 341
1483 3300005577 Ga0068857_100069095 Ga0068857_1000690952 341
1484 3300005615 Ga0070702_100084963 Ga0070702_1000849632 341
1485 3300005719 Ga0068861_100002974 Ga0068861_1000029748 341
1486 3300005840 Ga0068870_10002177 Ga0068870_100021773 341
1487 3300005841 Ga0068863_100019511 Ga0068863_1000195114 341
1488 3300005842 Ga0068858_100131767 Ga0068858_1001317672 341
1489 3300005843 Ga0068860_100020931 Ga0068860_1000209315 341
1490 3300005844 Ga0068862_100003731 Ga0068862_10000373111 341
1491 3300006852 Ga0075433_10025021 Ga0075433_100250215 341
1492 3300006871 Ga0075434_100011984 Ga0075434_1000119842 341
1493 3300006871 Ga0075434_100031225 Ga0075434_1000312253 341
1494 3300006881 Ga0068865_100138737 Ga0068865_1001387372 341
1495 3300006914 Ga0075436_100251327 Ga0075436_1002513272 341
1496 3300007076 Ga0075435_100075361 Ga0075435_1000753613 341
1497 3300009147 Ga0114129_10002512 Ga0114129_1000251214 341
1498 3300009147 Ga0114129_10028539 Ga0114129_100285395 341
1499 3300009147 Ga0114129_10029022 Ga0114129_100290227 341
1500 3300009147 Ga0114129_10183389 Ga0114129_101833893 341
1501 3300009148 Ga0105243_10009286 Ga0105243_100092864 341
1502 3300009177 Ga0105248_10122926 Ga0105248_101229262 341
1503 3300009553 Ga0105249_10012062 Ga0105249_100120626 341
1504 3300013306 Ga0163162_10186499 Ga0163162_101864992 341
1505 3300013308 Ga0157375_10068990 Ga0157375_100689902 341
1506 3300014326 Ga0157380_10059429 Ga0157380_100594292 341
1507 3300014745 Ga0157377_10137578 Ga0157377_101375782 341
1508 3300025315 Ga0207697_10015962 Ga0207697_100159623 341
1509 3300025907 Ga0207645_10013596 Ga0207645_100135965 341
1510 3300025908 Ga0207643_10003278 Ga0207643_100032783 341
1511 3300025910 Ga0207684_10094407 Ga0207684_100944073 341
1512 3300025912 Ga0207707_10032200 Ga0207707_100322003 341
1513 3300025918 Ga0207662_10018751 Ga0207662_100187513 341
1514 3300025922 Ga0207646_10043644 Ga0207646_100436444 341
1515 3300025923 Ga0207681_10000808 Ga0207681_100008088 341
1516 3300025925 Ga0207650_10038244 Ga0207650_100382442 341
1517 3300025926 Ga0207659_10002812 Ga0207659_100028123 341
1518 3300025931 Ga0207644_10198406 Ga0207644_101984062 341
1519 3300025933 Ga0207706_10011236 Ga0207706_100112362 341
1520 3300025936 Ga0207670_10007140 Ga0207670_100071403 341
1521 3300025940 Ga0207691_10093958 Ga0207691_100939583 341
1522 3300025944 Ga0207661_10016797 Ga0207661_100167973 341
1523 3300025961 Ga0207712_10024163 Ga0207712_100241632 341
1524 3300026035 Ga0207703_10008596 Ga0207703_100085965 341
1525 3300026041 Ga0207639_10177808 Ga0207639_101778082 341
1526 3300026075 Ga0207708_10013389 Ga0207708_100133893 341
1527 3300026088 Ga0207641_10138181 Ga0207641_101381812 341
1528 3300027907 Ga0207428_10000481 Ga0207428_1000048123 341
1529 3300028380 Ga0268265_10001312 Ga0268265_1000131219 341
1530 3300028381 Ga0268264_10006226 Ga0268264_100062263 341
1531 3300031548 Ga0307408_100033103 Ga0307408_1000331032 341
1532 3300031731 Ga0307405_10022391 Ga0307405_100223914 341
1533 3300031824 Ga0307413_10010814 Ga0307413_100108144 341
1534 3300031852 Ga0307410_10020313 Ga0307410_100203134 341
1535 3300031852 Ga0307410_10334537 Ga0307410_103345372 341
1536 3300031901 Ga0307406_10021479 Ga0307406_100214793 341
1537 3300031903 Ga0307407_10002148 Ga0307407_100021488 341
1538 3300031903 Ga0307407_10012900 Ga0307407_100129004 341
1539 3300031995 Ga0307409_100006545 Ga0307409_1000065454 341
1540 3300031995 Ga0307409_100038377 Ga0307409_1000383772 341
1541 3300032002 Ga0307416_100004712 Ga0307416_1000047128 341
1542 3300032004 Ga0307414_10031537 Ga0307414_100315373 341
1543 3300032005 Ga0307411_10013781 Ga0307411_100137814 341
1544 3300032126 Ga0307415_100020627 Ga0307415_1000206272 341
1545 3300042876 Ga0451577_0140841 Ga0451577_0140841_14_1039 341
1546 3300045051 Ga0451576_0008579 Ga0451576_0008579_3179_4204 341
1547 3300045051 Ga0451576_0037883 Ga0451576_0037883_2392_3417 341
1548 3300045051 Ga0451576_0109277 Ga0451576_0109277_665_1690 341
1549 3300046455 Ga0495603_0018871 Ga0495603_0018871_470_1495 341
1550 3300046491 Ga0495584_0012217 Ga0495584_0012217_2221_3246 341
1551 3300046528 Ga0495642_0004288 Ga0495642_0004288_2036_3061 341
1552 3300046537 Ga0495598_0006925 Ga0495598_0006925_469_1494 341
1553 3300046538 Ga0495609_0006559 Ga0495609_0006559_1683_2708 341
1554 3300046538 Ga0495609_0013870 Ga0495609_0013870_85_1110 341
1555 3300046539 Ga0495621_0006268 Ga0495621_0006268_414_1439 341
1556 3300046664 Ga0495659_0005434 Ga0495659_0005434_2240_3265 341
1557 3300046664 Ga0495659_0033411 Ga0495659_0033411_520_1545 341
1558 3300046674 Ga0495588_0023048 Ga0495588_0023048_899_1924 341
1559 3300046684 Ga0495669_0022032 Ga0495669_0022032_1252_2277 341
1560 3300047318 Ga0495636_0051556 Ga0495636_0051556_200_1225 341
1561 3300047318 Ga0495636_0053425 Ga0495636_0053425_22_1047 341
1562 3300047447 Ga0495685_003103 Ga0495685_003103_344_1369 341
1563 3300050507 nmdc:mga05p37_108734_c1 nmdc:mga05p37_108734_c1_789_1814 341
1564 3300050507 nmdc:mga05p37_176062_c1 nmdc:mga05p37_176062_c1_1092_2117 341
1565 3300050507 nmdc:mga05p37_236821_c1 nmdc:mga05p37_236821_c1_957_1982 341
1566 3300050507 nmdc:mga05p37_5387_c1 nmdc:mga05p37_5387_c1_726_1751 341
1567 3300050511 nmdc:mga08y16_4788_c1 nmdc:mga08y16_4788_c1_8420_9445 341
1568 3300050512 nmdc:mga0n895_23367_c1 nmdc:mga0n895_23367_c1_2450_3475 341
1569 3300050512 nmdc:mga0n895_24690_c1 nmdc:mga0n895_24690_c1_834_1859 341
1570 3300050512 nmdc:mga0n895_97727_c1 nmdc:mga0n895_97727_c1_332_1357 341
1571 3300050513 nmdc:mga0rr50_145528_c1 nmdc:mga0rr50_145528_c1_192_1217 341
1572 3300050513 nmdc:mga0rr50_92664_c1 nmdc:mga0rr50_92664_c1_834_1859 341
1573 3300050515 nmdc:mga0a205_17674_c1 nmdc:mga0a205_17674_c1_5143_6168 341
1574 3300059421 Ga0590071_000759 Ga0590071_000759_7812_8846 341
1575 3300059423 Ga0590074_000489 Ga0590074_000489_4680_5714 341
1576 3300059424 Ga0590075_000255 Ga0590075_000255_13345_14379 341
1577 3300059424 Ga0590075_023976 Ga0590075_023976_217_1251 341
1578 3300059426 Ga0590077_000033 Ga0590077_000033_937_1971 341

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

44

284

0.92

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

45

350

0.92

PF04321

RmlD_sub_bind

RmlD substrate binding domain

42

321

0.86

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

44

321

0.79

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

45

313

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pnl-assembly1.cif.gz_A structure of epimerase mth375 from the thermophilic pseudomurein-containing methanogen methanothermobacter thermautotrophicus 0.94 4 328
6wjb-assembly1.cif.gz_A udp-glcnac c4-epimerase from pseudomonas protegens in complex with nad and udp-glcnac 0.9333 11 321
6wja-assembly1.cif.gz_A udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac 0.9331 11 321
4zrn-assembly1.cif.gz_B crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima 0.9273 12 326
6kv9-assembly1.cif.gz_A-2 moee5 in complex with udp-glucuronic acid and nad 0.9271 12 326
ID Description Score Start End Superfamily
af_Q2G2D7_8_231_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.971 9 40 3.90.180.10
6dntA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9545 9 252 3.40.50.720
6dntA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9407 9 252 3.40.50.720
af_Q2G289_4_319_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9358 11 329 3.40.50.720
4zrnB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9334 12 253 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A833L2H9-F1-model_v4 UDP-glucose 4-epimerase 0.9916 4 330
AF-A0A351U6P9-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9913 8 330
AF-A0A832KCE3-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9913 6 330
AF-A0A1F9U198-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9902 7 330
AF-A0A660YIH7-F1-model_v4 NAD-dependent epimerase 0.9902 7 133

Feature Viewer

pLDDT pTM Quality
93.54 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map