F494880
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1579 | 559 | 1579 | 134 |
Family's Representative Sequence
| Representative Sequence | 3300001977|JGI24746J21847_1049549|JGI24746J21847_10495491 |
| Length | 136 |
| Sequence | MSMTDPVADFLTRVRNAIQASHETVEIPASKLKIEMARILREQGYINAYELEDPNPDHPGSLIRITLKYAESDRRSAISGLKRVSRPGQRSYVGHGEIPKVLGGMGTAIVSTSHGVMTGHEARDAGVGGEVVAHVW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 5 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 12 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 13 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 14 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 15 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 16 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 19 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 21 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 22 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 86 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 93 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 94 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 95 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 97 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 98 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 99 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 100 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 103 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 105 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 106 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 107 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 108 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 109 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 110 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 111 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 112 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 113 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 115 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 116 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 131 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 132 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 150 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 156 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 221 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 225 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 226 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 227 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 228 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 229 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 231 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 232 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 234 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 235 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 236 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 237 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 238 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 239 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 240 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 243 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 244 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 245 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 246 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 247 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 248 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 249 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 250 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 251 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 252 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 253 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 254 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 255 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 256 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 257 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 258 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 259 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 260 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 261 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 262 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 263 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 264 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 265 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 266 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 267 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 268 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 269 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 270 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 271 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 272 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 273 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 274 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 275 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 276 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 277 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 278 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 279 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 280 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 281 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 282 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 283 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 284 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 285 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 286 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 287 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 289 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 290 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 291 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 292 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 293 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 294 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 295 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 296 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 297 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 298 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 299 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 300 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 301 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 302 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 303 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 304 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 305 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 306 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 307 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 308 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 309 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 310 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 311 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 312 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 313 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 314 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 315 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 316 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 317 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 318 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 319 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 320 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 321 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 322 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 323 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 324 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 325 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 326 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 327 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 328 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 329 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 330 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 331 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 332 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 333 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 334 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 335 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 336 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 337 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 338 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 339 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 340 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 341 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 342 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 343 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 396 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 397 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 398 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 399 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 400 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 401 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 402 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 403 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 404 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 405 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 406 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 407 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 408 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 409 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 410 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 411 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 412 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 413 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 437 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 465 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 468 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 470 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 471 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 474 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 475 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 476 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 477 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 480 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 481 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 482 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 483 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 484 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 485 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 486 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 489 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 492 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 493 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 494 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 495 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 496 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 497 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 498 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 499 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 500 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 501 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 502 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 503 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 504 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 505 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 506 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 507 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 508 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 509 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 510 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 511 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 512 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 513 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 514 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 515 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 516 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 517 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 518 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 519 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 520 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 521 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 522 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 523 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 524 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 525 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 526 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 527 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 528 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 529 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 530 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 531 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 532 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 533 | 3300059603 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 534 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 535 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 536 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 537 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 538 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 539 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 540 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 541 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 542 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 543 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 544 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 545 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 546 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 547 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 548 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 549 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 550 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 551 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 552 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 553 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 554 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 555 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 556 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 557 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 558 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 559 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.81 |
| Metatranscriptomes | 14.19 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.79 |
| Nodule | 0 |
| Rhizoplane | 6.4 |
| Rhizosphere | 88.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNBas_1001136 | 3300000531 | Bacteria | 1364 |
| 2 | CNAas_1007538 | 3300000532 | Bacteria | 708 |
| 3 | LJNas_1021309 | 3300000546 | Bacteria | 691 |
| 4 | LJNas_1023594 | 3300000546 | Unclassified | 657 |
| 5 | JGI24746J21847_1049549 | 3300001977 | Bacteria | 590 |
| 6 | JGI24747J21853_1009491 | 3300001978 | Bacteria | 963 |
| 7 | JGI24740J21852_10002914 | 3300001979 | Bacteria | 7630 |
| 8 | JGI24739J22299_10186775 | 3300001989 | Unclassified | 609 |
| 9 | JGI24737J22298_10084652 | 3300001990 | Unclassified | 942 |
| 10 | JGI24743J22301_10030734 | 3300001991 | Unclassified | 1057 |
| 11 | JGI24738J21930_10023484 | 3300002075 | Bacteria | 1270 |
| 12 | JGI24738J21930_10117691 | 3300002075 | Bacteria | 576 |
| 13 | JGI24749J21850_1034758 | 3300002076 | Bacteria | 730 |
| 14 | JGI24744J21845_10029145 | 3300002077 | Unclassified | 1061 |
| 15 | JGI24742J22300_10064244 | 3300002244 | Bacteria | 678 |
| 16 | JGI25406J46586_10005035 | 3300003203 | Bacteria | 6138 |
| 17 | JGI25407J50210_10154854 | 3300003373 | Bacteria | 564 |
| 18 | Ga0007416J51690_1053647 | 3300003577 | Bacteria | 2822 |
| 19 | Ga0007429J51699_1087349 | 3300003579 | Bacteria | 527 |
| 20 | Ga0058859_10022019 | 3300004798 | Bacteria | 1452 |
| 21 | Ga0058859_10049905 | 3300004798 | Bacteria | 1986 |
| 22 | Ga0058859_10122077 | 3300004798 | Unclassified | 712 |
| 23 | Ga0058863_10080674 | 3300004799 | Bacteria | 1617 |
| 24 | Ga0058863_11733789 | 3300004799 | Bacteria | 758 |
| 25 | Ga0058863_11849541 | 3300004799 | Bacteria | 1772 |
| 26 | Ga0058863_11960175 | 3300004799 | Bacteria | 1086 |
| 27 | Ga0058863_11973879 | 3300004799 | Bacteria | 1531 |
| 28 | Ga0058861_11880043 | 3300004800 | Bacteria | 1029 |
| 29 | Ga0058861_12059017 | 3300004800 | Bacteria | 779 |
| 30 | Ga0058860_10014153 | 3300004801 | Bacteria | 978 |
| 31 | Ga0058860_10174803 | 3300004801 | Bacteria | 2316 |
| 32 | Ga0058862_10148086 | 3300004803 | Bacteria | 1067 |
| 33 | Ga0058862_10173070 | 3300004803 | Bacteria | 775 |
| 34 | Ga0058862_12848635 | 3300004803 | Bacteria | 957 |
| 35 | Ga0070658_10501997 | 3300005327 | Bacteria | 1048 |
| 36 | Ga0070658_10687635 | 3300005327 | Bacteria | 888 |
| 37 | Ga0070676_10260169 | 3300005328 | Bacteria | 1162 |
| 38 | Ga0070683_100052331 | 3300005329 | Bacteria | 3782 |
| 39 | Ga0070683_100116514 | 3300005329 | Bacteria | 2522 |
| 40 | Ga0070683_100461992 | 3300005329 | Bacteria | 1212 |
| 41 | Ga0070683_100736310 | 3300005329 | Bacteria | 944 |
| 42 | Ga0070683_101167809 | 3300005329 | Bacteria | 740 |
| 43 | Ga0070690_100010654 | 3300005330 | Bacteria | 5356 |
| 44 | Ga0070690_100075543 | 3300005330 | Bacteria | 2197 |
| 45 | Ga0070690_100163789 | 3300005330 | Bacteria | 1526 |
| 46 | Ga0070690_100626478 | 3300005330 | Bacteria | 819 |
| 47 | Ga0070690_100764046 | 3300005330 | Bacteria | 747 |
| 48 | Ga0070690_101167670 | 3300005330 | Bacteria | 613 |
| 49 | Ga0070670_100213810 | 3300005331 | Bacteria | 1677 |
| 50 | Ga0070670_101090686 | 3300005331 | Bacteria | 728 |
| 51 | Ga0070670_101311990 | 3300005331 | Bacteria | 663 |
| 52 | Ga0070677_10160298 | 3300005333 | Bacteria | 1055 |
| 53 | Ga0070677_10287340 | 3300005333 | Bacteria | 831 |
| 54 | Ga0068869_100128198 | 3300005334 | Bacteria | 1948 |
| 55 | Ga0068869_100240686 | 3300005334 | Bacteria | 1442 |
| 56 | Ga0068869_100387514 | 3300005334 | Bacteria | 1147 |
| 57 | Ga0068869_100903103 | 3300005334 | Bacteria | 764 |
| 58 | Ga0068869_101317082 | 3300005334 | Bacteria | 637 |
| 59 | Ga0070666_11480973 | 3300005335 | Bacteria | 508 |
| 60 | Ga0070680_100571527 | 3300005336 | Bacteria | 970 |
| 61 | Ga0070680_100763451 | 3300005336 | Bacteria | 833 |
| 62 | Ga0070682_100059998 | 3300005337 | Bacteria | 2404 |
| 63 | Ga0070682_100100622 | 3300005337 | Bacteria | 1907 |
| 64 | Ga0070682_100996786 | 3300005337 | Bacteria | 695 |
| 65 | Ga0070682_101395667 | 3300005337 | Bacteria | 599 |
| 66 | Ga0070682_101835336 | 3300005337 | Unclassified | 530 |
| 67 | Ga0068868_100048880 | 3300005338 | Bacteria | 3319 |
| 68 | Ga0068868_100064173 | 3300005338 | Bacteria | 2915 |
| 69 | Ga0068868_100165391 | 3300005338 | Bacteria | 1829 |
| 70 | Ga0068868_100254888 | 3300005338 | Bacteria | 1478 |
| 71 | Ga0068868_100269267 | 3300005338 | Bacteria | 1439 |
| 72 | Ga0068868_100470831 | 3300005338 | Bacteria | 1096 |
| 73 | Ga0068868_100578536 | 3300005338 | Bacteria | 993 |
| 74 | Ga0070660_100008632 | 3300005339 | Bacteria | 7135 |
| 75 | Ga0070660_100288131 | 3300005339 | Bacteria | 1344 |
| 76 | Ga0070660_100356793 | 3300005339 | Bacteria | 1204 |
| 77 | Ga0070660_100751585 | 3300005339 | Bacteria | 819 |
| 78 | Ga0070689_100068670 | 3300005340 | Bacteria | 2764 |
| 79 | Ga0070689_100108691 | 3300005340 | Bacteria | 2203 |
| 80 | Ga0070689_100133287 | 3300005340 | Bacteria | 1993 |
| 81 | Ga0070689_100643561 | 3300005340 | Bacteria | 922 |
| 82 | Ga0070689_100683432 | 3300005340 | Bacteria | 895 |
| 83 | Ga0070691_10036588 | 3300005341 | Bacteria | 2314 |
| 84 | Ga0070691_10110512 | 3300005341 | Bacteria | 1374 |
| 85 | Ga0070691_10128530 | 3300005341 | Bacteria | 1282 |
| 86 | Ga0070687_100024182 | 3300005343 | Bacteria | 2896 |
| 87 | Ga0070687_100183573 | 3300005343 | Bacteria | 1255 |
| 88 | Ga0070687_100211976 | 3300005343 | Bacteria | 1181 |
| 89 | Ga0070687_100263666 | 3300005343 | Bacteria | 1076 |
| 90 | Ga0070687_100338030 | 3300005343 | Bacteria | 967 |
| 91 | Ga0070661_100218035 | 3300005344 | Bacteria | 1463 |
| 92 | Ga0070661_100295514 | 3300005344 | Bacteria | 1260 |
| 93 | Ga0070661_100379628 | 3300005344 | Bacteria | 1114 |
| 94 | Ga0070692_10035876 | 3300005345 | Bacteria | 2513 |
| 95 | Ga0070692_10093594 | 3300005345 | Bacteria | 1637 |
| 96 | Ga0070692_10308495 | 3300005345 | Bacteria | 969 |
| 97 | Ga0070692_10463542 | 3300005345 | Bacteria | 814 |
| 98 | Ga0070692_10641545 | 3300005345 | Bacteria | 708 |
| 99 | Ga0070668_100058208 | 3300005347 | Bacteria | 2989 |
| 100 | Ga0070668_100254569 | 3300005347 | Bacteria | 1458 |
| 101 | Ga0070669_100355636 | 3300005353 | Bacteria | 1190 |
| 102 | Ga0070669_100376888 | 3300005353 | Bacteria | 1156 |
| 103 | Ga0070675_100049635 | 3300005354 | Bacteria | 3445 |
| 104 | Ga0070675_100148038 | 3300005354 | Bacteria | 2011 |
| 105 | Ga0070675_100814463 | 3300005354 | Bacteria | 854 |
| 106 | Ga0070675_100926955 | 3300005354 | Bacteria | 799 |
| 107 | Ga0070675_101472929 | 3300005354 | Bacteria | 628 |
| 108 | Ga0070671_100171217 | 3300005355 | Bacteria | 1836 |
| 109 | Ga0070671_100837907 | 3300005355 | Bacteria | 802 |
| 110 | Ga0070674_100439922 | 3300005356 | Bacteria | 1074 |
| 111 | Ga0070674_100957954 | 3300005356 | Bacteria | 749 |
| 112 | Ga0070674_101127228 | 3300005356 | Bacteria | 694 |
| 113 | Ga0070673_100135457 | 3300005364 | Bacteria | 2072 |
| 114 | Ga0070673_100541607 | 3300005364 | Bacteria | 1057 |
| 115 | Ga0070688_100011350 | 3300005365 | Bacteria | 4949 |
| 116 | Ga0070688_100058478 | 3300005365 | Bacteria | 2427 |
| 117 | Ga0070688_100201224 | 3300005365 | Bacteria | 1393 |
| 118 | Ga0070688_100331614 | 3300005365 | Bacteria | 1109 |
| 119 | Ga0070688_101588534 | 3300005365 | Bacteria | 534 |
| 120 | Ga0070688_101697073 | 3300005365 | Bacteria | 517 |
| 121 | Ga0070659_100226398 | 3300005366 | Bacteria | 1544 |
| 122 | Ga0070659_100309709 | 3300005366 | Bacteria | 1318 |
| 123 | Ga0070659_100705415 | 3300005366 | Bacteria | 873 |
| 124 | Ga0070659_101176641 | 3300005366 | Bacteria | 677 |
| 125 | Ga0070667_100417554 | 3300005367 | Bacteria | 1223 |
| 126 | Ga0070667_100456329 | 3300005367 | Bacteria | 1168 |
| 127 | Ga0070667_101599054 | 3300005367 | Bacteria | 613 |
| 128 | Ga0070709_11036618 | 3300005434 | Bacteria | 654 |
| 129 | Ga0070714_100126135 | 3300005435 | Bacteria | 2282 |
| 130 | Ga0070714_100737126 | 3300005435 | Bacteria | 952 |
| 131 | Ga0070714_101695932 | 3300005435 | Bacteria | 617 |
| 132 | Ga0070713_101424794 | 3300005436 | Bacteria | 672 |
| 133 | Ga0070713_101745789 | 3300005436 | Bacteria | 604 |
| 134 | Ga0070710_10075464 | 3300005437 | Bacteria | 1954 |
| 135 | Ga0070710_10113037 | 3300005437 | Bacteria | 1634 |
| 136 | Ga0070710_10408617 | 3300005437 | Bacteria | 912 |
| 137 | Ga0070701_10045375 | 3300005438 | Bacteria | 2255 |
| 138 | Ga0070701_10612165 | 3300005438 | Bacteria | 723 |
| 139 | Ga0070701_10794425 | 3300005438 | Bacteria | 645 |
| 140 | Ga0070711_100002145 | 3300005439 | Bacteria | 11183 |
| 141 | Ga0070711_100388833 | 3300005439 | Bacteria | 1130 |
| 142 | Ga0070711_100431513 | 3300005439 | Bacteria | 1076 |
| 143 | Ga0070711_100949338 | 3300005439 | Bacteria | 736 |
| 144 | Ga0070705_100081071 | 3300005440 | Bacteria | 1992 |
| 145 | Ga0070705_100692028 | 3300005440 | Bacteria | 800 |
| 146 | Ga0070705_100810702 | 3300005440 | Bacteria | 746 |
| 147 | Ga0070705_101041823 | 3300005440 | Bacteria | 666 |
| 148 | Ga0070700_100014625 | 3300005441 | Bacteria | 4434 |
| 149 | Ga0070700_100239406 | 3300005441 | Bacteria | 1296 |
| 150 | Ga0070700_100373086 | 3300005441 | Bacteria | 1065 |
| 151 | Ga0070700_100476139 | 3300005441 | Unclassified | 955 |
| 152 | Ga0070700_100491668 | 3300005441 | Bacteria | 942 |
| 153 | Ga0070700_100843368 | 3300005441 | Bacteria | 742 |
| 154 | Ga0070700_101123187 | 3300005441 | Bacteria | 653 |
| 155 | Ga0070700_101502058 | 3300005441 | Bacteria | 573 |
| 156 | Ga0070700_102015478 | 3300005441 | Bacteria | 501 |
| 157 | Ga0070694_100373262 | 3300005444 | Bacteria | 1111 |
| 158 | Ga0070694_100980481 | 3300005444 | Bacteria | 701 |
| 159 | Ga0070694_101203633 | 3300005444 | Bacteria | 635 |
| 160 | Ga0070708_101348895 | 3300005445 | Bacteria | 666 |
| 161 | Ga0070663_100178784 | 3300005455 | Bacteria | 1644 |
| 162 | Ga0070678_100104611 | 3300005456 | Bacteria | 2202 |
| 163 | Ga0070678_100688805 | 3300005456 | Bacteria | 920 |
| 164 | Ga0070678_100719654 | 3300005456 | Bacteria | 901 |
| 165 | Ga0070678_100853820 | 3300005456 | Bacteria | 830 |
| 166 | Ga0070662_100020737 | 3300005457 | Bacteria | 4481 |
| 167 | Ga0070662_100631379 | 3300005457 | Bacteria | 902 |
| 168 | Ga0070662_100631411 | 3300005457 | Bacteria | 902 |
| 169 | Ga0070662_101200231 | 3300005457 | Bacteria | 652 |
| 170 | Ga0070662_101257807 | 3300005457 | Bacteria | 637 |
| 171 | Ga0070681_10167503 | 3300005458 | Bacteria | 2119 |
| 172 | Ga0070681_10263195 | 3300005458 | Bacteria | 1636 |
| 173 | Ga0070681_10301885 | 3300005458 | Bacteria | 1511 |
| 174 | Ga0070681_11193968 | 3300005458 | Bacteria | 683 |
| 175 | Ga0068867_100053386 | 3300005459 | Bacteria | 2985 |
| 176 | Ga0068867_101171712 | 3300005459 | Bacteria | 704 |
| 177 | Ga0068867_101376040 | 3300005459 | Bacteria | 654 |
| 178 | Ga0070685_10001772 | 3300005466 | Bacteria | 11292 |
| 179 | Ga0070685_10023094 | 3300005466 | Bacteria | 3401 |
| 180 | Ga0070685_10107992 | 3300005466 | Bacteria | 1710 |
| 181 | Ga0070685_10214336 | 3300005466 | Bacteria | 1258 |
| 182 | Ga0070685_10329969 | 3300005466 | Bacteria | 1037 |
| 183 | Ga0070706_101171058 | 3300005467 | Bacteria | 707 |
| 184 | Ga0070679_100061371 | 3300005530 | Bacteria | 3747 |
| 185 | Ga0070679_100281248 | 3300005530 | Bacteria | 1616 |
| 186 | Ga0070679_100434053 | 3300005530 | Bacteria | 1258 |
| 187 | Ga0070679_100854135 | 3300005530 | Bacteria | 853 |
| 188 | Ga0070679_100859131 | 3300005530 | Bacteria | 851 |
| 189 | Ga0070679_101088965 | 3300005530 | Bacteria | 744 |
| 190 | Ga0070679_101105160 | 3300005530 | Bacteria | 737 |
| 191 | Ga0070684_100036894 | 3300005535 | Bacteria | 4190 |
| 192 | Ga0070684_100038986 | 3300005535 | Bacteria | 4085 |
| 193 | Ga0070684_100056012 | 3300005535 | Bacteria | 3439 |
| 194 | Ga0070684_100073453 | 3300005535 | Bacteria | 3013 |
| 195 | Ga0070684_100284704 | 3300005535 | Bacteria | 1515 |
| 196 | Ga0070684_100459211 | 3300005535 | Bacteria | 1178 |
| 197 | Ga0070684_100666851 | 3300005535 | Bacteria | 969 |
| 198 | Ga0070684_101738042 | 3300005535 | Bacteria | 589 |
| 199 | Ga0068853_100635959 | 3300005539 | Bacteria | 1015 |
| 200 | Ga0068853_100767835 | 3300005539 | Bacteria | 922 |
| 201 | Ga0068853_102212591 | 3300005539 | Bacteria | 533 |
| 202 | Ga0070672_100119315 | 3300005543 | Bacteria | 2157 |
| 203 | Ga0070672_100159691 | 3300005543 | Bacteria | 1869 |
| 204 | Ga0070672_100366786 | 3300005543 | Bacteria | 1230 |
| 205 | Ga0070686_100068990 | 3300005544 | Bacteria | 2307 |
| 206 | Ga0070686_100134832 | 3300005544 | Bacteria | 1712 |
| 207 | Ga0070686_100179547 | 3300005544 | Bacteria | 1503 |
| 208 | Ga0070686_101012684 | 3300005544 | Bacteria | 682 |
| 209 | Ga0070696_100245985 | 3300005546 | Bacteria | 1351 |
| 210 | Ga0070665_100090116 | 3300005548 | Bacteria | 3073 |
| 211 | Ga0070665_100681997 | 3300005548 | Bacteria | 1040 |
| 212 | Ga0070665_100841054 | 3300005548 | Bacteria | 931 |
| 213 | Ga0070665_101452599 | 3300005548 | Bacteria | 695 |
| 214 | Ga0070704_100198834 | 3300005549 | Bacteria | 1617 |
| 215 | Ga0070704_100334782 | 3300005549 | Bacteria | 1273 |
| 216 | Ga0070704_100535073 | 3300005549 | Bacteria | 1022 |
| 217 | Ga0070704_100813022 | 3300005549 | Bacteria | 836 |
| 218 | Ga0068855_100253211 | 3300005563 | Bacteria | 1964 |
| 219 | Ga0068855_100497070 | 3300005563 | Bacteria | 1326 |
| 220 | Ga0070664_100038200 | 3300005564 | Bacteria | 4040 |
| 221 | Ga0070664_100104636 | 3300005564 | Bacteria | 2464 |
| 222 | Ga0070664_100136855 | 3300005564 | Bacteria | 2154 |
| 223 | Ga0070664_100163037 | 3300005564 | Bacteria | 1973 |
| 224 | Ga0070664_100255965 | 3300005564 | Bacteria | 1575 |
| 225 | Ga0070664_101131440 | 3300005564 | Bacteria | 738 |
| 226 | Ga0068857_100229760 | 3300005577 | Bacteria | 1697 |
| 227 | Ga0068857_100472271 | 3300005577 | Bacteria | 1175 |
| 228 | Ga0068857_101491634 | 3300005577 | Bacteria | 659 |
| 229 | Ga0068857_102158402 | 3300005577 | Bacteria | 547 |
| 230 | Ga0068854_100211908 | 3300005578 | Bacteria | 1528 |
| 231 | Ga0068854_100276299 | 3300005578 | Bacteria | 1351 |
| 232 | Ga0068854_101440939 | 3300005578 | Bacteria | 624 |
| 233 | Ga0068854_102075383 | 3300005578 | Bacteria | 525 |
| 234 | Ga0068856_100299899 | 3300005614 | Bacteria | 1624 |
| 235 | Ga0068856_100682409 | 3300005614 | Bacteria | 1048 |
| 236 | Ga0068856_101347288 | 3300005614 | Bacteria | 728 |
| 237 | Ga0070702_100064234 | 3300005615 | Bacteria | 2147 |
| 238 | Ga0070702_100078971 | 3300005615 | Bacteria | 1966 |
| 239 | Ga0070702_100100832 | 3300005615 | Bacteria | 1770 |
| 240 | Ga0070702_100128944 | 3300005615 | Bacteria | 1594 |
| 241 | Ga0070702_100168715 | 3300005615 | Bacteria | 1422 |
| 242 | Ga0070702_100170116 | 3300005615 | Bacteria | 1417 |
| 243 | Ga0070702_100257237 | 3300005615 | Bacteria | 1187 |
| 244 | Ga0070702_100912812 | 3300005615 | Bacteria | 688 |
| 245 | Ga0068852_100058425 | 3300005616 | Bacteria | 3341 |
| 246 | Ga0068852_100599629 | 3300005616 | Bacteria | 1105 |
| 247 | Ga0068852_100896738 | 3300005616 | Bacteria | 904 |
| 248 | Ga0068852_101356646 | 3300005616 | Bacteria | 733 |
| 249 | Ga0068859_100378791 | 3300005617 | Bacteria | 1510 |
| 250 | Ga0068859_100682304 | 3300005617 | Bacteria | 1118 |
| 251 | Ga0068859_100857652 | 3300005617 | Bacteria | 994 |
| 252 | Ga0068864_100037025 | 3300005618 | Bacteria | 4161 |
| 253 | Ga0068864_100310300 | 3300005618 | Bacteria | 1479 |
| 254 | Ga0068864_100352015 | 3300005618 | Bacteria | 1390 |
| 255 | Ga0068864_100502352 | 3300005618 | Bacteria | 1167 |
| 256 | Ga0068866_10036975 | 3300005718 | Bacteria | 2395 |
| 257 | Ga0068866_10085681 | 3300005718 | Bacteria | 1703 |
| 258 | Ga0068866_10147966 | 3300005718 | Bacteria | 1357 |
| 259 | Ga0068866_10997026 | 3300005718 | Bacteria | 595 |
| 260 | Ga0068861_100047582 | 3300005719 | Bacteria | 3238 |
| 261 | Ga0068861_100267705 | 3300005719 | Bacteria | 1466 |
| 262 | Ga0068861_100294672 | 3300005719 | Bacteria | 1402 |
| 263 | Ga0068861_100305573 | 3300005719 | Bacteria | 1379 |
| 264 | Ga0068851_10097895 | 3300005834 | Bacteria | 1553 |
| 265 | Ga0068851_10118258 | 3300005834 | Bacteria | 1422 |
| 266 | Ga0068851_10465960 | 3300005834 | Bacteria | 753 |
| 267 | Ga0068870_10171657 | 3300005840 | Bacteria | 1294 |
| 268 | Ga0068870_10195990 | 3300005840 | Bacteria | 1222 |
| 269 | Ga0068870_10317657 | 3300005840 | Bacteria | 988 |
| 270 | Ga0068870_10624912 | 3300005840 | Bacteria | 735 |
| 271 | Ga0068870_10757944 | 3300005840 | Bacteria | 675 |
| 272 | Ga0068870_10843130 | 3300005840 | Bacteria | 643 |
| 273 | Ga0068870_11233735 | 3300005840 | Bacteria | 542 |
| 274 | Ga0068863_100472171 | 3300005841 | Bacteria | 1233 |
| 275 | Ga0068863_100869449 | 3300005841 | Unclassified | 901 |
| 276 | Ga0068863_100975030 | 3300005841 | Bacteria | 850 |
| 277 | Ga0068858_100119037 | 3300005842 | Bacteria | 2469 |
| 278 | Ga0068858_100170708 | 3300005842 | Bacteria | 2051 |
| 279 | Ga0068858_100581217 | 3300005842 | Bacteria | 1086 |
| 280 | Ga0068858_100790000 | 3300005842 | Bacteria | 926 |
| 281 | Ga0068858_100838519 | 3300005842 | Bacteria | 898 |
| 282 | Ga0068858_101339832 | 3300005842 | Bacteria | 705 |
| 283 | Ga0068860_100194759 | 3300005843 | Bacteria | 1962 |
| 284 | Ga0068860_101889726 | 3300005843 | Bacteria | 619 |
| 285 | Ga0068860_102778411 | 3300005843 | Bacteria | 508 |
| 286 | Ga0068862_100125512 | 3300005844 | Bacteria | 2266 |
| 287 | Ga0068862_100628815 | 3300005844 | Bacteria | 1033 |
| 288 | Ga0068862_100738553 | 3300005844 | Bacteria | 957 |
| 289 | Ga0081455_10023793 | 3300005937 | Bacteria | 5692 |
| 290 | Ga0081455_10049901 | 3300005937 | Bacteria | 3604 |
| 291 | Ga0081455_10074703 | 3300005937 | Bacteria | 2799 |
| 292 | Ga0081455_10143774 | 3300005937 | Bacteria | 1848 |
| 293 | Ga0081538_10005811 | 3300005981 | Bacteria | 10995 |
| 294 | Ga0081538_10012937 | 3300005981 | Bacteria | 6648 |
| 295 | Ga0081538_10018887 | 3300005981 | Bacteria | 5153 |
| 296 | Ga0081538_10134898 | 3300005981 | Bacteria | 1151 |
| 297 | Ga0081538_10344944 | 3300005981 | Bacteria | 540 |
| 298 | Ga0081540_1016109 | 3300005983 | Bacteria | 4699 |
| 299 | Ga0081540_1054747 | 3300005983 | Bacteria | 1947 |
| 300 | Ga0081539_10001787 | 3300005985 | Bacteria | 34104 |
| 301 | Ga0081539_10099531 | 3300005985 | Bacteria | 1485 |
| 302 | Ga0070717_10012633 | 3300006028 | Bacteria | 6443 |
| 303 | Ga0070717_10177795 | 3300006028 | Bacteria | 1853 |
| 304 | Ga0075365_10112993 | 3300006038 | Bacteria | 1868 |
| 305 | Ga0075365_10122363 | 3300006038 | Bacteria | 1796 |
| 306 | Ga0075365_10426387 | 3300006038 | Bacteria | 936 |
| 307 | Ga0075365_10934141 | 3300006038 | Bacteria | 611 |
| 308 | Ga0075363_100041450 | 3300006048 | Bacteria | 2428 |
| 309 | Ga0075364_10093604 | 3300006051 | Bacteria | 1995 |
| 310 | Ga0075364_10744486 | 3300006051 | Bacteria | 669 |
| 311 | Ga0075364_11053629 | 3300006051 | Bacteria | 552 |
| 312 | Ga0075432_10128863 | 3300006058 | Bacteria | 957 |
| 313 | Ga0070716_100336972 | 3300006173 | Bacteria | 1063 |
| 314 | Ga0070716_100479465 | 3300006173 | Unclassified | 913 |
| 315 | Ga0070712_100012973 | 3300006175 | Bacteria | 5312 |
| 316 | Ga0070712_100063431 | 3300006175 | Bacteria | 2616 |
| 317 | Ga0070712_100102308 | 3300006175 | Bacteria | 2121 |
| 318 | Ga0070712_100130781 | 3300006175 | Bacteria | 1902 |
| 319 | Ga0070712_101806742 | 3300006175 | Bacteria | 535 |
| 320 | Ga0075367_10035159 | 3300006178 | Bacteria | 2899 |
| 321 | Ga0097621_100233018 | 3300006237 | Bacteria | 1608 |
| 322 | Ga0097621_100749330 | 3300006237 | Bacteria | 902 |
| 323 | Ga0097621_101422411 | 3300006237 | Bacteria | 657 |
| 324 | Ga0097621_102371210 | 3300006237 | Bacteria | 508 |
| 325 | Ga0068871_100046531 | 3300006358 | Bacteria | 3495 |
| 326 | Ga0068871_100787265 | 3300006358 | Bacteria | 876 |
| 327 | Ga0068871_101051587 | 3300006358 | Bacteria | 760 |
| 328 | Ga0075428_100254576 | 3300006844 | Bacteria | 1891 |
| 329 | Ga0075428_101672818 | 3300006844 | Bacteria | 664 |
| 330 | Ga0075430_100021314 | 3300006846 | Bacteria | 5509 |
| 331 | Ga0075430_100557860 | 3300006846 | Bacteria | 945 |
| 332 | Ga0075430_100578407 | 3300006846 | Bacteria | 926 |
| 333 | Ga0075431_102060875 | 3300006847 | Bacteria | 525 |
| 334 | Ga0075433_10061451 | 3300006852 | Bacteria | 3291 |
| 335 | Ga0075434_100037786 | 3300006871 | Bacteria | 4780 |
| 336 | Ga0075429_101619717 | 3300006880 | Bacteria | 563 |
| 337 | Ga0068865_100107285 | 3300006881 | Bacteria | 2054 |
| 338 | Ga0068865_100157423 | 3300006881 | Bacteria | 1729 |
| 339 | Ga0068865_100521375 | 3300006881 | Bacteria | 994 |
| 340 | Ga0068865_100820322 | 3300006881 | Bacteria | 804 |
| 341 | Ga0068865_101329792 | 3300006881 | Bacteria | 640 |
| 342 | Ga0068865_101783039 | 3300006881 | Bacteria | 556 |
| 343 | Ga0075436_100068380 | 3300006914 | Bacteria | 2454 |
| 344 | Ga0097620_100378789 | 3300006931 | Bacteria | 1510 |
| 345 | Ga0097620_100682330 | 3300006931 | Bacteria | 1118 |
| 346 | Ga0097620_100857797 | 3300006931 | Bacteria | 994 |
| 347 | Ga0075435_100124548 | 3300007076 | Bacteria | 2153 |
| 348 | Ga0075435_100890484 | 3300007076 | Bacteria | 776 |
| 349 | Ga0099795_10066844 | 3300007788 | Bacteria | 1347 |
| 350 | Ga0105240_10006736 | 3300009093 | Bacteria | 16822 |
| 351 | Ga0105240_10653742 | 3300009093 | Bacteria | 1152 |
| 352 | Ga0105240_10658346 | 3300009093 | Bacteria | 1147 |
| 353 | Ga0105240_10724132 | 3300009093 | Bacteria | 1084 |
| 354 | Ga0111539_10091686 | 3300009094 | Bacteria | 3570 |
| 355 | Ga0111539_10269084 | 3300009094 | Bacteria | 1984 |
| 356 | Ga0111539_10867289 | 3300009094 | Bacteria | 1050 |
| 357 | Ga0111539_11553093 | 3300009094 | Bacteria | 768 |
| 358 | Ga0111539_12442123 | 3300009094 | Bacteria | 606 |
| 359 | Ga0111539_12482805 | 3300009094 | Bacteria | 601 |
| 360 | Ga0111539_12642813 | 3300009094 | Bacteria | 582 |
| 361 | Ga0105245_10000528 | 3300009098 | Bacteria | 35016 |
| 362 | Ga0105245_10133984 | 3300009098 | Bacteria | 2326 |
| 363 | Ga0105245_10271349 | 3300009098 | Bacteria | 1655 |
| 364 | Ga0105245_10287401 | 3300009098 | Bacteria | 1609 |
| 365 | Ga0105245_10664590 | 3300009098 | Bacteria | 1073 |
| 366 | Ga0105245_11223389 | 3300009098 | Bacteria | 799 |
| 367 | Ga0105245_11295828 | 3300009098 | Unclassified | 777 |
| 368 | Ga0105245_11754941 | 3300009098 | Bacteria | 673 |
| 369 | Ga0105245_11922020 | 3300009098 | Bacteria | 645 |
| 370 | Ga0105245_12179872 | 3300009098 | Bacteria | 608 |
| 371 | Ga0105247_10000064 | 3300009101 | Bacteria | 123994 |
| 372 | Ga0105247_10829816 | 3300009101 | Bacteria | 708 |
| 373 | Ga0105247_10966366 | 3300009101 | Bacteria | 663 |
| 374 | Ga0114129_10069437 | 3300009147 | Bacteria | 4911 |
| 375 | Ga0114129_11181798 | 3300009147 | Bacteria | 954 |
| 376 | Ga0114129_11453555 | 3300009147 | Bacteria | 844 |
| 377 | Ga0114129_12152298 | 3300009147 | Bacteria | 672 |
| 378 | Ga0105243_10051478 | 3300009148 | Bacteria | 3257 |
| 379 | Ga0105243_10203167 | 3300009148 | Bacteria | 1739 |
| 380 | Ga0105243_10215376 | 3300009148 | Bacteria | 1694 |
| 381 | Ga0105243_10346988 | 3300009148 | Bacteria | 1362 |
| 382 | Ga0105243_10695140 | 3300009148 | Bacteria | 991 |
| 383 | Ga0105243_10698320 | 3300009148 | Bacteria | 989 |
| 384 | Ga0105243_11304383 | 3300009148 | Bacteria | 743 |
| 385 | Ga0105243_12056873 | 3300009148 | Bacteria | 606 |
| 386 | Ga0105241_10128163 | 3300009174 | Bacteria | 2051 |
| 387 | Ga0105241_10347375 | 3300009174 | Bacteria | 1287 |
| 388 | Ga0105241_10724900 | 3300009174 | Bacteria | 910 |
| 389 | Ga0105241_11028271 | 3300009174 | Bacteria | 772 |
| 390 | Ga0105242_10003277 | 3300009176 | Bacteria | 12618 |
| 391 | Ga0105242_10183321 | 3300009176 | Bacteria | 1848 |
| 392 | Ga0105242_11162749 | 3300009176 | Bacteria | 789 |
| 393 | Ga0105242_11395880 | 3300009176 | Bacteria | 728 |
| 394 | Ga0105248_10182568 | 3300009177 | Bacteria | 2364 |
| 395 | Ga0105248_10427647 | 3300009177 | Bacteria | 1491 |
| 396 | Ga0105248_10877181 | 3300009177 | Bacteria | 1013 |
| 397 | Ga0105248_11105198 | 3300009177 | Bacteria | 896 |
| 398 | Ga0105248_11497626 | 3300009177 | Unclassified | 764 |
| 399 | Ga0105248_11680721 | 3300009177 | Bacteria | 720 |
| 400 | Ga0105237_10000795 | 3300009545 | Bacteria | 43136 |
| 401 | Ga0105237_10037314 | 3300009545 | Bacteria | 4913 |
| 402 | Ga0105237_10703485 | 3300009545 | Bacteria | 1017 |
| 403 | Ga0105237_10727930 | 3300009545 | Bacteria | 998 |
| 404 | Ga0105238_10159249 | 3300009551 | Bacteria | 2233 |
| 405 | Ga0105238_10599601 | 3300009551 | Bacteria | 1109 |
| 406 | Ga0105238_10689752 | 3300009551 | Bacteria | 1033 |
| 407 | Ga0105238_10787619 | 3300009551 | Bacteria | 966 |
| 408 | Ga0105238_10985094 | 3300009551 | Bacteria | 864 |
| 409 | Ga0105238_11062052 | 3300009551 | Bacteria | 832 |
| 410 | Ga0105249_10010014 | 3300009553 | Bacteria | 8319 |
| 411 | Ga0105249_10027935 | 3300009553 | Bacteria | 5092 |
| 412 | Ga0105249_10472886 | 3300009553 | Bacteria | 1295 |
| 413 | Ga0105249_10651314 | 3300009553 | Bacteria | 1111 |
| 414 | Ga0105249_11172973 | 3300009553 | Bacteria | 839 |
| 415 | Ga0105249_11257564 | 3300009553 | Bacteria | 812 |
| 416 | Ga0105249_11314175 | 3300009553 | Bacteria | 795 |
| 417 | Ga0105249_11363762 | 3300009553 | Bacteria | 781 |
| 418 | Ga0105239_10189923 | 3300010375 | Bacteria | 2299 |
| 419 | Ga0105239_10344229 | 3300010375 | Bacteria | 1683 |
| 420 | Ga0105239_10395555 | 3300010375 | Bacteria | 1563 |
| 421 | Ga0105239_10670675 | 3300010375 | Bacteria | 1185 |
| 422 | Ga0105239_11198363 | 3300010375 | Bacteria | 875 |
| 423 | Ga0105239_11312312 | 3300010375 | Bacteria | 835 |
| 424 | Ga0105239_12320804 | 3300010375 | Unclassified | 624 |
| 425 | Ga0105246_10252569 | 3300011119 | Bacteria | 1400 |
| 426 | Ga0105246_10310273 | 3300011119 | Bacteria | 1277 |
| 427 | Ga0105246_10488611 | 3300011119 | Bacteria | 1043 |
| 428 | Ga0105246_10951919 | 3300011119 | Bacteria | 774 |
| 429 | Ga0105246_11188359 | 3300011119 | Bacteria | 701 |
| 430 | Ga0157322_1003805 | 3300012490 | Bacteria | 948 |
| 431 | Ga0157335_1016465 | 3300012492 | Bacteria | 660 |
| 432 | Ga0157373_10109642 | 3300013100 | Bacteria | 1941 |
| 433 | Ga0157371_10324864 | 3300013102 | Bacteria | 1117 |
| 434 | Ga0157371_11609083 | 3300013102 | Bacteria | 509 |
| 435 | Ga0157370_11191915 | 3300013104 | Bacteria | 687 |
| 436 | Ga0157370_11197106 | 3300013104 | Bacteria | 685 |
| 437 | Ga0157369_10000068 | 3300013105 | Bacteria | 144274 |
| 438 | Ga0157369_10273564 | 3300013105 | Bacteria | 1760 |
| 439 | Ga0157369_10475474 | 3300013105 | Bacteria | 1293 |
| 440 | Ga0157369_10589793 | 3300013105 | Bacteria | 1148 |
| 441 | Ga0157369_11183365 | 3300013105 | Bacteria | 780 |
| 442 | Ga0157369_11879110 | 3300013105 | Bacteria | 608 |
| 443 | Ga0157374_10129448 | 3300013296 | Bacteria | 2442 |
| 444 | Ga0157374_10200275 | 3300013296 | Bacteria | 1955 |
| 445 | Ga0157374_10442804 | 3300013296 | Bacteria | 1300 |
| 446 | Ga0157374_10761911 | 3300013296 | Bacteria | 983 |
| 447 | Ga0157374_11820053 | 3300013296 | Bacteria | 634 |
| 448 | Ga0157374_12858385 | 3300013296 | Bacteria | 510 |
| 449 | Ga0157378_10087024 | 3300013297 | Bacteria | 2833 |
| 450 | Ga0157378_10093534 | 3300013297 | Bacteria | 2737 |
| 451 | Ga0157378_10098811 | 3300013297 | Bacteria | 2662 |
| 452 | Ga0157378_11173485 | 3300013297 | Unclassified | 807 |
| 453 | Ga0157378_12191975 | 3300013297 | Bacteria | 604 |
| 454 | Ga0163162_10408973 | 3300013306 | Bacteria | 1490 |
| 455 | Ga0163162_10442697 | 3300013306 | Bacteria | 1432 |
| 456 | Ga0163162_10617802 | 3300013306 | Bacteria | 1209 |
| 457 | Ga0163162_10894844 | 3300013306 | Bacteria | 1001 |
| 458 | Ga0163162_11452811 | 3300013306 | Bacteria | 781 |
| 459 | Ga0163162_12625921 | 3300013306 | Bacteria | 580 |
| 460 | Ga0157372_10085083 | 3300013307 | Bacteria | 3586 |
| 461 | Ga0157372_10274420 | 3300013307 | Bacteria | 1960 |
| 462 | Ga0157372_10553882 | 3300013307 | Bacteria | 1340 |
| 463 | Ga0157372_10779128 | 3300013307 | Bacteria | 1112 |
| 464 | Ga0157372_10927850 | 3300013307 | Bacteria | 1009 |
| 465 | Ga0157372_11708082 | 3300013307 | Bacteria | 724 |
| 466 | Ga0157372_12598440 | 3300013307 | Bacteria | 581 |
| 467 | Ga0157372_12974731 | 3300013307 | Bacteria | 542 |
| 468 | Ga0157375_10260991 | 3300013308 | Bacteria | 1894 |
| 469 | Ga0157375_10902761 | 3300013308 | Bacteria | 1027 |
| 470 | Ga0157375_11400967 | 3300013308 | Bacteria | 823 |
| 471 | Ga0157375_12103571 | 3300013308 | Bacteria | 672 |
| 472 | Ga0157375_12160949 | 3300013308 | Unclassified | 663 |
| 473 | Ga0163163_10207803 | 3300014325 | Bacteria | 2006 |
| 474 | Ga0163163_10275798 | 3300014325 | Bacteria | 1733 |
| 475 | Ga0163163_10338021 | 3300014325 | Bacteria | 1561 |
| 476 | Ga0163163_10568416 | 3300014325 | Bacteria | 1197 |
| 477 | Ga0163163_10689529 | 3300014325 | Bacteria | 1085 |
| 478 | Ga0157380_10796907 | 3300014326 | Bacteria | 961 |
| 479 | Ga0157380_11023414 | 3300014326 | Bacteria | 861 |
| 480 | Ga0157380_11027663 | 3300014326 | Bacteria | 859 |
| 481 | Ga0157380_11731749 | 3300014326 | Bacteria | 683 |
| 482 | Ga0157380_12680162 | 3300014326 | Bacteria | 565 |
| 483 | Ga0157380_12945135 | 3300014326 | Bacteria | 542 |
| 484 | Ga0157377_10347050 | 3300014745 | Bacteria | 995 |
| 485 | Ga0157377_10887749 | 3300014745 | Bacteria | 665 |
| 486 | Ga0157377_11083124 | 3300014745 | Bacteria | 613 |
| 487 | Ga0157377_11408772 | 3300014745 | Bacteria | 550 |
| 488 | Ga0157379_10595549 | 3300014968 | Unclassified | 1032 |
| 489 | Ga0157379_10689748 | 3300014968 | Bacteria | 958 |
| 490 | Ga0157379_11509206 | 3300014968 | Bacteria | 654 |
| 491 | Ga0157376_10187306 | 3300014969 | Bacteria | 1895 |
| 492 | Ga0157376_10332356 | 3300014969 | Bacteria | 1448 |
| 493 | Ga0157376_10347270 | 3300014969 | Bacteria | 1419 |
| 494 | Ga0157376_10696859 | 3300014969 | Bacteria | 1020 |
| 495 | Ga0157376_10745563 | 3300014969 | Bacteria | 988 |
| 496 | Ga0157376_12029854 | 3300014969 | Bacteria | 613 |
| 497 | Ga0157376_12232786 | 3300014969 | Bacteria | 586 |
| 498 | Ga0163161_10166675 | 3300017792 | Bacteria | 1682 |
| 499 | Ga0163161_10260041 | 3300017792 | Bacteria | 1355 |
| 500 | Ga0163161_10690939 | 3300017792 | Bacteria | 849 |
| 501 | Ga0197907_10260649 | 3300020069 | Bacteria | 703 |
| 502 | Ga0197907_11160759 | 3300020069 | Bacteria | 886 |
| 503 | Ga0206356_10156694 | 3300020070 | Bacteria | 771 |
| 504 | Ga0206356_10459118 | 3300020070 | Bacteria | 556 |
| 505 | Ga0206356_10527733 | 3300020070 | Bacteria | 1176 |
| 506 | Ga0206356_10919035 | 3300020070 | Bacteria | 650 |
| 507 | Ga0206356_11545250 | 3300020070 | Bacteria | 561 |
| 508 | Ga0206355_1550264 | 3300020076 | Bacteria | 639 |
| 509 | Ga0206351_10035649 | 3300020077 | Bacteria | 1240 |
| 510 | Ga0206352_10502868 | 3300020078 | Bacteria | 667 |
| 511 | Ga0206352_10895791 | 3300020078 | Unclassified | 904 |
| 512 | Ga0206350_10403330 | 3300020080 | Bacteria | 1107 |
| 513 | Ga0206350_11621122 | 3300020080 | Bacteria | 872 |
| 514 | Ga0206354_10395992 | 3300020081 | Bacteria | 594 |
| 515 | Ga0206354_10577140 | 3300020081 | Bacteria | 1261 |
| 516 | Ga0206354_10729251 | 3300020081 | Bacteria | 557 |
| 517 | Ga0206354_10754954 | 3300020081 | Bacteria | 552 |
| 518 | Ga0206353_10349727 | 3300020082 | Bacteria | 979 |
| 519 | Ga0206353_10441693 | 3300020082 | Bacteria | 1603 |
| 520 | Ga0206353_10938401 | 3300020082 | Bacteria | 1017 |
| 521 | Ga0206353_11230023 | 3300020082 | Bacteria | 937 |
| 522 | Ga0213874_10425682 | 3300021377 | Bacteria | 520 |
| 523 | Ga0224712_10175186 | 3300022467 | Bacteria | 964 |
| 524 | Ga0224712_10179169 | 3300022467 | Bacteria | 954 |
| 525 | Ga0224712_10209681 | 3300022467 | Bacteria | 888 |
| 526 | Ga0224712_10329666 | 3300022467 | Bacteria | 718 |
| 527 | Ga0207426_1105583 | 3300025302 | Bacteria | 719 |
| 528 | Ga0207656_10491943 | 3300025321 | Bacteria | 622 |
| 529 | Ga0207682_10218795 | 3300025893 | Bacteria | 880 |
| 530 | Ga0207682_10272464 | 3300025893 | Bacteria | 790 |
| 531 | Ga0207692_10082034 | 3300025898 | Bacteria | 1727 |
| 532 | Ga0207692_10100092 | 3300025898 | Bacteria | 1589 |
| 533 | Ga0207642_10128502 | 3300025899 | Bacteria | 1319 |
| 534 | Ga0207642_10328675 | 3300025899 | Bacteria | 895 |
| 535 | Ga0207642_10386233 | 3300025899 | Bacteria | 834 |
| 536 | Ga0207642_10803733 | 3300025899 | Bacteria | 598 |
| 537 | Ga0207710_10000220 | 3300025900 | Bacteria | 50023 |
| 538 | Ga0207710_10346056 | 3300025900 | Bacteria | 757 |
| 539 | Ga0207688_10014487 | 3300025901 | Bacteria | 4286 |
| 540 | Ga0207688_10077880 | 3300025901 | Bacteria | 1889 |
| 541 | Ga0207688_10098651 | 3300025901 | Bacteria | 1684 |
| 542 | Ga0207688_10427456 | 3300025901 | Bacteria | 824 |
| 543 | Ga0207688_10578383 | 3300025901 | Bacteria | 707 |
| 544 | Ga0207688_10765419 | 3300025901 | Bacteria | 611 |
| 545 | Ga0207680_10217566 | 3300025903 | Bacteria | 1308 |
| 546 | Ga0207647_10037449 | 3300025904 | Bacteria | 3076 |
| 547 | Ga0207647_10785528 | 3300025904 | Bacteria | 513 |
| 548 | Ga0207699_10412654 | 3300025906 | Bacteria | 963 |
| 549 | Ga0207699_10640395 | 3300025906 | Unclassified | 776 |
| 550 | Ga0207699_10839350 | 3300025906 | Bacteria | 676 |
| 551 | Ga0207645_10194319 | 3300025907 | Bacteria | 1334 |
| 552 | Ga0207643_10056455 | 3300025908 | Bacteria | 2233 |
| 553 | Ga0207643_10060045 | 3300025908 | Bacteria | 2170 |
| 554 | Ga0207643_10067248 | 3300025908 | Bacteria | 2056 |
| 555 | Ga0207643_10085658 | 3300025908 | Bacteria | 1830 |
| 556 | Ga0207643_10130984 | 3300025908 | Bacteria | 1492 |
| 557 | Ga0207643_10620487 | 3300025908 | Bacteria | 697 |
| 558 | Ga0207643_10910315 | 3300025908 | Bacteria | 570 |
| 559 | Ga0207705_10121307 | 3300025909 | Bacteria | 1940 |
| 560 | Ga0207705_10278631 | 3300025909 | Bacteria | 1280 |
| 561 | Ga0207705_10861482 | 3300025909 | Bacteria | 702 |
| 562 | Ga0207654_10112077 | 3300025911 | Bacteria | 1699 |
| 563 | Ga0207654_10345644 | 3300025911 | Bacteria | 1023 |
| 564 | Ga0207654_10940969 | 3300025911 | Bacteria | 627 |
| 565 | Ga0207707_10120608 | 3300025912 | Bacteria | 2293 |
| 566 | Ga0207707_10343294 | 3300025912 | Bacteria | 1287 |
| 567 | Ga0207707_10778780 | 3300025912 | Bacteria | 798 |
| 568 | Ga0207707_11014908 | 3300025912 | Bacteria | 680 |
| 569 | Ga0207707_11111053 | 3300025912 | Bacteria | 644 |
| 570 | Ga0207695_10024364 | 3300025913 | Bacteria | 6812 |
| 571 | Ga0207671_10007459 | 3300025914 | Bacteria | 9487 |
| 572 | Ga0207671_10756199 | 3300025914 | Bacteria | 772 |
| 573 | Ga0207693_10042371 | 3300025915 | Bacteria | 3583 |
| 574 | Ga0207693_10128045 | 3300025915 | Bacteria | 1996 |
| 575 | Ga0207693_10401087 | 3300025915 | Bacteria | 1072 |
| 576 | Ga0207663_10043259 | 3300025916 | Bacteria | 2757 |
| 577 | Ga0207663_10148493 | 3300025916 | Bacteria | 1641 |
| 578 | Ga0207663_10163174 | 3300025916 | Bacteria | 1575 |
| 579 | Ga0207663_10237231 | 3300025916 | Bacteria | 1336 |
| 580 | Ga0207663_10467160 | 3300025916 | Bacteria | 975 |
| 581 | Ga0207663_11631421 | 3300025916 | Bacteria | 519 |
| 582 | Ga0207660_10263503 | 3300025917 | Bacteria | 1364 |
| 583 | Ga0207660_10314975 | 3300025917 | Bacteria | 1248 |
| 584 | Ga0207660_10504940 | 3300025917 | Bacteria | 981 |
| 585 | Ga0207660_10871599 | 3300025917 | Bacteria | 735 |
| 586 | Ga0207660_11358589 | 3300025917 | Bacteria | 576 |
| 587 | Ga0207662_10012124 | 3300025918 | Bacteria | 4797 |
| 588 | Ga0207662_10012576 | 3300025918 | Bacteria | 4715 |
| 589 | Ga0207662_10073909 | 3300025918 | Bacteria | 2069 |
| 590 | Ga0207662_10178187 | 3300025918 | Bacteria | 1366 |
| 591 | Ga0207662_10290548 | 3300025918 | Bacteria | 1084 |
| 592 | Ga0207662_10314016 | 3300025918 | Bacteria | 1045 |
| 593 | Ga0207662_10709232 | 3300025918 | Bacteria | 705 |
| 594 | Ga0207657_10010857 | 3300025919 | Bacteria | 9060 |
| 595 | Ga0207657_10086697 | 3300025919 | Bacteria | 2620 |
| 596 | Ga0207657_10119705 | 3300025919 | Bacteria | 2167 |
| 597 | Ga0207657_10240566 | 3300025919 | Bacteria | 1445 |
| 598 | Ga0207657_10480692 | 3300025919 | Bacteria | 974 |
| 599 | Ga0207657_10588065 | 3300025919 | Bacteria | 869 |
| 600 | Ga0207649_10303873 | 3300025920 | Bacteria | 1167 |
| 601 | Ga0207649_10732492 | 3300025920 | Bacteria | 768 |
| 602 | Ga0207649_11188910 | 3300025920 | Bacteria | 602 |
| 603 | Ga0207652_10035128 | 3300025921 | Bacteria | 4229 |
| 604 | Ga0207652_10130550 | 3300025921 | Bacteria | 2241 |
| 605 | Ga0207652_10383719 | 3300025921 | Bacteria | 1268 |
| 606 | Ga0207652_10457008 | 3300025921 | Bacteria | 1151 |
| 607 | Ga0207652_10545492 | 3300025921 | Bacteria | 1042 |
| 608 | Ga0207652_11072276 | 3300025921 | Bacteria | 706 |
| 609 | Ga0207694_10419362 | 3300025924 | Bacteria | 1115 |
| 610 | Ga0207694_10434353 | 3300025924 | Bacteria | 1095 |
| 611 | Ga0207694_10959882 | 3300025924 | Bacteria | 723 |
| 612 | Ga0207650_10221288 | 3300025925 | Bacteria | 1524 |
| 613 | Ga0207650_11484926 | 3300025925 | Bacteria | 576 |
| 614 | Ga0207659_10075587 | 3300025926 | Bacteria | 2472 |
| 615 | Ga0207687_10000025 | 3300025927 | Bacteria | 175177 |
| 616 | Ga0207687_10097367 | 3300025927 | Bacteria | 2158 |
| 617 | Ga0207687_10149376 | 3300025927 | Bacteria | 1781 |
| 618 | Ga0207687_10167257 | 3300025927 | Bacteria | 1693 |
| 619 | Ga0207687_10263470 | 3300025927 | Bacteria | 1375 |
| 620 | Ga0207687_10760920 | 3300025927 | Bacteria | 825 |
| 621 | Ga0207687_11258670 | 3300025927 | Bacteria | 636 |
| 622 | Ga0207664_10176362 | 3300025929 | Bacteria | 1833 |
| 623 | Ga0207664_10305464 | 3300025929 | Bacteria | 1401 |
| 624 | Ga0207644_10672219 | 3300025931 | Bacteria | 863 |
| 625 | Ga0207644_11098874 | 3300025931 | Bacteria | 668 |
| 626 | Ga0207690_10055403 | 3300025932 | Bacteria | 2670 |
| 627 | Ga0207690_10142127 | 3300025932 | Bacteria | 1770 |
| 628 | Ga0207690_10327141 | 3300025932 | Bacteria | 1206 |
| 629 | Ga0207690_10355275 | 3300025932 | Bacteria | 1160 |
| 630 | Ga0207690_11411966 | 3300025932 | Bacteria | 582 |
| 631 | Ga0207706_10056627 | 3300025933 | Bacteria | 3456 |
| 632 | Ga0207706_10272226 | 3300025933 | Bacteria | 1478 |
| 633 | Ga0207706_10274417 | 3300025933 | Bacteria | 1471 |
| 634 | Ga0207706_10625895 | 3300025933 | Bacteria | 923 |
| 635 | Ga0207706_11494648 | 3300025933 | Bacteria | 551 |
| 636 | Ga0207686_10001614 | 3300025934 | Bacteria | 12622 |
| 637 | Ga0207686_10967217 | 3300025934 | Bacteria | 690 |
| 638 | Ga0207709_10052519 | 3300025935 | Bacteria | 2504 |
| 639 | Ga0207709_10097825 | 3300025935 | Bacteria | 1934 |
| 640 | Ga0207709_10300316 | 3300025935 | Bacteria | 1194 |
| 641 | Ga0207709_10328423 | 3300025935 | Bacteria | 1147 |
| 642 | Ga0207709_10679271 | 3300025935 | Bacteria | 822 |
| 643 | Ga0207670_10040259 | 3300025936 | Bacteria | 3067 |
| 644 | Ga0207670_10197632 | 3300025936 | Bacteria | 1526 |
| 645 | Ga0207670_10440251 | 3300025936 | Bacteria | 1049 |
| 646 | Ga0207669_10041848 | 3300025937 | Bacteria | 2670 |
| 647 | Ga0207669_10564845 | 3300025937 | Bacteria | 920 |
| 648 | Ga0207669_10605580 | 3300025937 | Bacteria | 891 |
| 649 | Ga0207704_10281705 | 3300025938 | Bacteria | 1264 |
| 650 | Ga0207704_10489642 | 3300025938 | Bacteria | 989 |
| 651 | Ga0207704_10504860 | 3300025938 | Bacteria | 975 |
| 652 | Ga0207704_10743348 | 3300025938 | Bacteria | 815 |
| 653 | Ga0207665_10178516 | 3300025939 | Bacteria | 1537 |
| 654 | Ga0207665_10191422 | 3300025939 | Bacteria | 1486 |
| 655 | Ga0207665_10762533 | 3300025939 | Bacteria | 763 |
| 656 | Ga0207665_11255041 | 3300025939 | Bacteria | 591 |
| 657 | Ga0207691_10170989 | 3300025940 | Bacteria | 1903 |
| 658 | Ga0207691_10325442 | 3300025940 | Bacteria | 1317 |
| 659 | Ga0207711_10369155 | 3300025941 | Bacteria | 1331 |
| 660 | Ga0207711_10610825 | 3300025941 | Bacteria | 1017 |
| 661 | Ga0207711_11287322 | 3300025941 | Bacteria | 673 |
| 662 | Ga0207689_10013833 | 3300025942 | Bacteria | 6875 |
| 663 | Ga0207689_10264484 | 3300025942 | Bacteria | 1423 |
| 664 | Ga0207689_10273876 | 3300025942 | Bacteria | 1397 |
| 665 | Ga0207689_10278642 | 3300025942 | Bacteria | 1385 |
| 666 | Ga0207661_10045956 | 3300025944 | Bacteria | 3460 |
| 667 | Ga0207661_10126242 | 3300025944 | Bacteria | 2185 |
| 668 | Ga0207661_10150775 | 3300025944 | Bacteria | 2009 |
| 669 | Ga0207661_10429873 | 3300025944 | Bacteria | 1200 |
| 670 | Ga0207661_11683660 | 3300025944 | Bacteria | 579 |
| 671 | Ga0207679_10073821 | 3300025945 | Bacteria | 2582 |
| 672 | Ga0207679_10345969 | 3300025945 | Bacteria | 1294 |
| 673 | Ga0207679_10485459 | 3300025945 | Bacteria | 1100 |
| 674 | Ga0207679_10696535 | 3300025945 | Bacteria | 922 |
| 675 | Ga0207667_10237666 | 3300025949 | Bacteria | 1865 |
| 676 | Ga0207667_11131185 | 3300025949 | Bacteria | 765 |
| 677 | Ga0207651_11255239 | 3300025960 | Bacteria | 666 |
| 678 | Ga0207712_10056246 | 3300025961 | Bacteria | 2771 |
| 679 | Ga0207712_10438549 | 3300025961 | Bacteria | 1105 |
| 680 | Ga0207712_11007244 | 3300025961 | Bacteria | 739 |
| 681 | Ga0207712_11086161 | 3300025961 | Bacteria | 712 |
| 682 | Ga0207712_11196174 | 3300025961 | Bacteria | 678 |
| 683 | Ga0207712_11361899 | 3300025961 | Bacteria | 635 |
| 684 | Ga0207668_10049888 | 3300025972 | Bacteria | 2880 |
| 685 | Ga0207668_10114278 | 3300025972 | Bacteria | 2032 |
| 686 | Ga0207668_10385218 | 3300025972 | Bacteria | 1181 |
| 687 | Ga0207668_10542070 | 3300025972 | Bacteria | 1007 |
| 688 | Ga0207668_10631785 | 3300025972 | Bacteria | 935 |
| 689 | Ga0207668_10718649 | 3300025972 | Bacteria | 879 |
| 690 | Ga0207668_10967723 | 3300025972 | Bacteria | 760 |
| 691 | Ga0207640_10123688 | 3300025981 | Bacteria | 1858 |
| 692 | Ga0207640_10135995 | 3300025981 | Bacteria | 1784 |
| 693 | Ga0207640_10555145 | 3300025981 | Bacteria | 966 |
| 694 | Ga0207640_10907629 | 3300025981 | Bacteria | 770 |
| 695 | Ga0207640_11074355 | 3300025981 | Bacteria | 711 |
| 696 | Ga0207658_10148842 | 3300025986 | Bacteria | 1905 |
| 697 | Ga0207658_10367480 | 3300025986 | Bacteria | 1257 |
| 698 | Ga0207658_11374086 | 3300025986 | Bacteria | 646 |
| 699 | Ga0207677_10067197 | 3300026023 | Bacteria | 2510 |
| 700 | Ga0207677_10118219 | 3300026023 | Bacteria | 1988 |
| 701 | Ga0207677_10181177 | 3300026023 | Bacteria | 1657 |
| 702 | Ga0207703_10229042 | 3300026035 | Bacteria | 1665 |
| 703 | Ga0207703_10268366 | 3300026035 | Bacteria | 1545 |
| 704 | Ga0207703_10303136 | 3300026035 | Bacteria | 1458 |
| 705 | Ga0207703_10548517 | 3300026035 | Bacteria | 1090 |
| 706 | Ga0207639_10037689 | 3300026041 | Bacteria | 3592 |
| 707 | Ga0207639_10392748 | 3300026041 | Bacteria | 1248 |
| 708 | Ga0207639_10648702 | 3300026041 | Bacteria | 976 |
| 709 | Ga0207678_10022375 | 3300026067 | Bacteria | 5537 |
| 710 | Ga0207678_10639574 | 3300026067 | Bacteria | 934 |
| 711 | Ga0207678_10971943 | 3300026067 | Bacteria | 751 |
| 712 | Ga0207678_11806138 | 3300026067 | Bacteria | 535 |
| 713 | Ga0207708_10008513 | 3300026075 | Bacteria | 7595 |
| 714 | Ga0207708_10025712 | 3300026075 | Bacteria | 4455 |
| 715 | Ga0207708_10156614 | 3300026075 | Bacteria | 1796 |
| 716 | Ga0207708_10160426 | 3300026075 | Bacteria | 1775 |
| 717 | Ga0207708_10200996 | 3300026075 | Bacteria | 1590 |
| 718 | Ga0207708_10211554 | 3300026075 | Bacteria | 1550 |
| 719 | Ga0207708_10577552 | 3300026075 | Bacteria | 950 |
| 720 | Ga0207708_10665828 | 3300026075 | Bacteria | 887 |
| 721 | Ga0207702_10069350 | 3300026078 | Bacteria | 3031 |
| 722 | Ga0207702_10090640 | 3300026078 | Bacteria | 2675 |
| 723 | Ga0207702_10497876 | 3300026078 | Bacteria | 1188 |
| 724 | Ga0207702_10835944 | 3300026078 | Bacteria | 911 |
| 725 | Ga0207641_10612313 | 3300026088 | Unclassified | 1067 |
| 726 | Ga0207641_10899230 | 3300026088 | Bacteria | 879 |
| 727 | Ga0207641_11218650 | 3300026088 | Bacteria | 752 |
| 728 | Ga0207641_11670822 | 3300026088 | Unclassified | 639 |
| 729 | Ga0207648_10132395 | 3300026089 | Bacteria | 2195 |
| 730 | Ga0207648_10188365 | 3300026089 | Bacteria | 1828 |
| 731 | Ga0207648_10266533 | 3300026089 | Bacteria | 1529 |
| 732 | Ga0207648_11484598 | 3300026089 | Bacteria | 637 |
| 733 | Ga0207676_10428470 | 3300026095 | Bacteria | 1242 |
| 734 | Ga0207676_10449587 | 3300026095 | Bacteria | 1214 |
| 735 | Ga0207676_11056908 | 3300026095 | Bacteria | 801 |
| 736 | Ga0207676_11177026 | 3300026095 | Bacteria | 759 |
| 737 | Ga0207676_12096599 | 3300026095 | Bacteria | 564 |
| 738 | Ga0207674_10059872 | 3300026116 | Bacteria | 3853 |
| 739 | Ga0207674_10207862 | 3300026116 | Bacteria | 1907 |
| 740 | Ga0207674_11752306 | 3300026116 | Bacteria | 589 |
| 741 | Ga0207674_11793271 | 3300026116 | Bacteria | 581 |
| 742 | Ga0207675_100024485 | 3300026118 | Bacteria | 5612 |
| 743 | Ga0207675_100071876 | 3300026118 | Bacteria | 3235 |
| 744 | Ga0207675_100284710 | 3300026118 | Bacteria | 1607 |
| 745 | Ga0207675_100318748 | 3300026118 | Bacteria | 1517 |
| 746 | Ga0207675_100485795 | 3300026118 | Bacteria | 1228 |
| 747 | Ga0207675_100498973 | 3300026118 | Bacteria | 1211 |
| 748 | Ga0207675_101110281 | 3300026118 | Bacteria | 811 |
| 749 | Ga0207683_10025472 | 3300026121 | Bacteria | 5104 |
| 750 | Ga0207683_10034774 | 3300026121 | Bacteria | 4381 |
| 751 | Ga0207683_10408180 | 3300026121 | Bacteria | 1250 |
| 752 | Ga0207683_10443152 | 3300026121 | Bacteria | 1197 |
| 753 | Ga0207683_11128168 | 3300026121 | Bacteria | 727 |
| 754 | Ga0207683_11605734 | 3300026121 | Bacteria | 600 |
| 755 | Ga0207698_10151614 | 3300026142 | Bacteria | 2013 |
| 756 | Ga0207698_10464413 | 3300026142 | Bacteria | 1225 |
| 757 | Ga0207698_10657921 | 3300026142 | Bacteria | 1038 |
| 758 | Ga0209998_10020598 | 3300027717 | Bacteria | 1412 |
| 759 | Ga0207428_10120383 | 3300027907 | Bacteria | 2013 |
| 760 | Ga0207428_10234728 | 3300027907 | Bacteria | 1372 |
| 761 | Ga0268266_10104816 | 3300028379 | Bacteria | 2497 |
| 762 | Ga0268266_10889140 | 3300028379 | Bacteria | 861 |
| 763 | Ga0268266_10960170 | 3300028379 | Bacteria | 827 |
| 764 | Ga0268266_12164523 | 3300028379 | Bacteria | 528 |
| 765 | Ga0268265_10208156 | 3300028380 | Bacteria | 1702 |
| 766 | Ga0268265_10411284 | 3300028380 | Bacteria | 1253 |
| 767 | Ga0268265_10681929 | 3300028380 | Bacteria | 991 |
| 768 | Ga0268265_11192463 | 3300028380 | Bacteria | 759 |
| 769 | Ga0268264_10705856 | 3300028381 | Bacteria | 1002 |
| 770 | Ga0268264_11894812 | 3300028381 | Bacteria | 606 |
| 771 | Ga0265337_1000032 | 3300028556 | Bacteria | 61342 |
| 772 | Ga0265326_10000040 | 3300028558 | Bacteria | 85624 |
| 773 | Ga0265319_1000030 | 3300028563 | Bacteria | 129742 |
| 774 | Ga0265319_1134426 | 3300028563 | Bacteria | 768 |
| 775 | Ga0265323_10164080 | 3300028653 | Bacteria | 708 |
| 776 | Ga0265322_10000012 | 3300028654 | Bacteria | 152373 |
| 777 | Ga0265322_10010968 | 3300028654 | Bacteria | 2628 |
| 778 | Ga0265336_10034584 | 3300028666 | Bacteria | 1561 |
| 779 | Ga0307517_10533215 | 3300028786 | Bacteria | 590 |
| 780 | Ga0307515_10050803 | 3300028794 | Bacteria | 6200 |
| 781 | Ga0265338_10000156 | 3300028800 | Bacteria | 125065 |
| 782 | Ga0265338_10059335 | 3300028800 | Bacteria | 3371 |
| 783 | Ga0265338_10231483 | 3300028800 | Bacteria | 1374 |
| 784 | Ga0265324_10017099 | 3300029957 | Bacteria | 2638 |
| 785 | Ga0265324_10039877 | 3300029957 | Bacteria | 1628 |
| 786 | Ga0307511_10115653 | 3300030521 | Bacteria | 1684 |
| 787 | Ga0265332_10020220 | 3300031238 | Bacteria | 2939 |
| 788 | Ga0265332_10025924 | 3300031238 | Bacteria | 2572 |
| 789 | Ga0265328_10002899 | 3300031239 | Bacteria | 7647 |
| 790 | Ga0265328_10029619 | 3300031239 | Bacteria | 2043 |
| 791 | Ga0265320_10000001 | 3300031240 | Bacteria | 847191 |
| 792 | Ga0265325_10024792 | 3300031241 | Bacteria | 3259 |
| 793 | Ga0265329_10000919 | 3300031242 | Bacteria | 14805 |
| 794 | Ga0265339_10008172 | 3300031249 | Bacteria | 6677 |
| 795 | Ga0265339_10225767 | 3300031249 | Bacteria | 914 |
| 796 | Ga0265331_10001467 | 3300031250 | Bacteria | 17360 |
| 797 | Ga0265327_10000003 | 3300031251 | Bacteria | 852750 |
| 798 | Ga0265327_10031033 | 3300031251 | Bacteria | 3009 |
| 799 | Ga0265316_10003567 | 3300031344 | Bacteria | 15692 |
| 800 | Ga0265316_10069538 | 3300031344 | Bacteria | 2717 |
| 801 | Ga0265316_10143256 | 3300031344 | Bacteria | 1794 |
| 802 | Ga0265316_10610282 | 3300031344 | Bacteria | 773 |
| 803 | Ga0307513_10011625 | 3300031456 | Bacteria | 10928 |
| 804 | Ga0307509_10000112 | 3300031507 | Bacteria | 117028 |
| 805 | Ga0307509_10011836 | 3300031507 | Bacteria | 10500 |
| 806 | Ga0307509_10342089 | 3300031507 | Bacteria | 1223 |
| 807 | Ga0307509_10567741 | 3300031507 | Bacteria | 810 |
| 808 | Ga0307408_100814173 | 3300031548 | Bacteria | 849 |
| 809 | Ga0307408_101114411 | 3300031548 | Bacteria | 733 |
| 810 | Ga0307408_102154780 | 3300031548 | Bacteria | 538 |
| 811 | Ga0307408_102517028 | 3300031548 | Bacteria | 501 |
| 812 | Ga0265313_10055372 | 3300031595 | Bacteria | 1879 |
| 813 | Ga0307508_10019824 | 3300031616 | Bacteria | 6113 |
| 814 | Ga0316579_10287984 | 3300031691 | Bacteria | 794 |
| 815 | Ga0265314_10000178 | 3300031711 | Bacteria | 94070 |
| 816 | Ga0265342_10000027 | 3300031712 | Bacteria | 158835 |
| 817 | Ga0265342_10232963 | 3300031712 | Bacteria | 988 |
| 818 | Ga0316576_10799457 | 3300031727 | Bacteria | 679 |
| 819 | Ga0316578_10414904 | 3300031728 | Bacteria | 797 |
| 820 | Ga0307516_10029367 | 3300031730 | Bacteria | 5559 |
| 821 | Ga0307405_10033428 | 3300031731 | Bacteria | 3050 |
| 822 | Ga0307405_10280288 | 3300031731 | Bacteria | 1254 |
| 823 | Ga0307405_10716697 | 3300031731 | Bacteria | 830 |
| 824 | Ga0307413_10044661 | 3300031824 | Bacteria | 2621 |
| 825 | Ga0307413_10082713 | 3300031824 | Bacteria | 2063 |
| 826 | Ga0307413_10151556 | 3300031824 | Bacteria | 1616 |
| 827 | Ga0307413_10328433 | 3300031824 | Bacteria | 1171 |
| 828 | Ga0307413_10821925 | 3300031824 | Bacteria | 783 |
| 829 | Ga0307413_11114826 | 3300031824 | Bacteria | 682 |
| 830 | Ga0307413_11334761 | 3300031824 | Bacteria | 629 |
| 831 | Ga0307410_10044469 | 3300031852 | Bacteria | 2950 |
| 832 | Ga0307410_10258101 | 3300031852 | Bacteria | 1358 |
| 833 | Ga0307410_10266745 | 3300031852 | Bacteria | 1337 |
| 834 | Ga0307410_10545719 | 3300031852 | Bacteria | 960 |
| 835 | Ga0307410_10567990 | 3300031852 | Bacteria | 942 |
| 836 | Ga0307410_11081542 | 3300031852 | Bacteria | 694 |
| 837 | Ga0307410_11236762 | 3300031852 | Bacteria | 651 |
| 838 | Ga0307410_11300851 | 3300031852 | Bacteria | 636 |
| 839 | Ga0326468_10002313 | 3300031889 | Bacteria | 1590 |
| 840 | Ga0326468_10018305 | 3300031889 | Bacteria | 808 |
| 841 | Ga0307406_10000446 | 3300031901 | Bacteria | 24118 |
| 842 | Ga0307406_10139417 | 3300031901 | Bacteria | 1714 |
| 843 | Ga0307406_10159532 | 3300031901 | Bacteria | 1619 |
| 844 | Ga0307406_10224195 | 3300031901 | Bacteria | 1399 |
| 845 | Ga0307406_10265638 | 3300031901 | Bacteria | 1301 |
| 846 | Ga0307406_10372485 | 3300031901 | Bacteria | 1123 |
| 847 | Ga0307406_10708689 | 3300031901 | Bacteria | 841 |
| 848 | Ga0307406_10783199 | 3300031901 | Bacteria | 803 |
| 849 | Ga0307406_10993242 | 3300031901 | Bacteria | 720 |
| 850 | Ga0307406_11177499 | 3300031901 | Bacteria | 665 |
| 851 | Ga0307406_11847597 | 3300031901 | Bacteria | 538 |
| 852 | Ga0307406_11867453 | 3300031901 | Bacteria | 535 |
| 853 | Ga0307407_10039964 | 3300031903 | Bacteria | 2612 |
| 854 | Ga0307407_10175869 | 3300031903 | Bacteria | 1414 |
| 855 | Ga0307407_10232560 | 3300031903 | Bacteria | 1253 |
| 856 | Ga0307407_10293767 | 3300031903 | Bacteria | 1130 |
| 857 | Ga0307407_10419521 | 3300031903 | Bacteria | 964 |
| 858 | Ga0307407_10709844 | 3300031903 | Bacteria | 758 |
| 859 | Ga0307407_10767567 | 3300031903 | Bacteria | 731 |
| 860 | Ga0307412_10253099 | 3300031911 | Bacteria | 1369 |
| 861 | Ga0307412_10407525 | 3300031911 | Bacteria | 1109 |
| 862 | Ga0307412_11257010 | 3300031911 | Bacteria | 665 |
| 863 | Ga0307412_11941369 | 3300031911 | Bacteria | 544 |
| 864 | Ga0307409_100128659 | 3300031995 | Bacteria | 2159 |
| 865 | Ga0307409_100156161 | 3300031995 | Bacteria | 1988 |
| 866 | Ga0307409_100179831 | 3300031995 | Bacteria | 1871 |
| 867 | Ga0307409_100274970 | 3300031995 | Bacteria | 1553 |
| 868 | Ga0307409_100278582 | 3300031995 | Bacteria | 1544 |
| 869 | Ga0307409_100486157 | 3300031995 | Bacteria | 1199 |
| 870 | Ga0307409_100695631 | 3300031995 | Bacteria | 1015 |
| 871 | Ga0307409_100887963 | 3300031995 | Bacteria | 904 |
| 872 | Ga0307409_100982899 | 3300031995 | Bacteria | 861 |
| 873 | Ga0307409_101020673 | 3300031995 | Bacteria | 846 |
| 874 | Ga0307409_101129999 | 3300031995 | Bacteria | 805 |
| 875 | Ga0307409_101367888 | 3300031995 | Bacteria | 734 |
| 876 | Ga0307409_102002568 | 3300031995 | Bacteria | 609 |
| 877 | Ga0307416_100028261 | 3300032002 | Bacteria | 4167 |
| 878 | Ga0307416_100365960 | 3300032002 | Bacteria | 1466 |
| 879 | Ga0307416_100480353 | 3300032002 | Bacteria | 1302 |
| 880 | Ga0307416_100556809 | 3300032002 | Bacteria | 1221 |
| 881 | Ga0307416_100928300 | 3300032002 | Bacteria | 971 |
| 882 | Ga0307416_101249613 | 3300032002 | Bacteria | 848 |
| 883 | Ga0307416_102138600 | 3300032002 | Bacteria | 661 |
| 884 | Ga0307416_102293180 | 3300032002 | Bacteria | 640 |
| 885 | Ga0307414_10157137 | 3300032004 | Bacteria | 1802 |
| 886 | Ga0307414_10227687 | 3300032004 | Bacteria | 1535 |
| 887 | Ga0307414_10346983 | 3300032004 | Bacteria | 1273 |
| 888 | Ga0307414_10560133 | 3300032004 | Bacteria | 1020 |
| 889 | Ga0307414_10688168 | 3300032004 | Bacteria | 925 |
| 890 | Ga0307414_10715807 | 3300032004 | Bacteria | 907 |
| 891 | Ga0307414_10881573 | 3300032004 | Bacteria | 820 |
| 892 | Ga0307414_10985361 | 3300032004 | Bacteria | 775 |
| 893 | Ga0307411_10047285 | 3300032005 | Bacteria | 2781 |
| 894 | Ga0307411_10228428 | 3300032005 | Bacteria | 1449 |
| 895 | Ga0307411_10969451 | 3300032005 | Bacteria | 759 |
| 896 | Ga0307411_11245521 | 3300032005 | Bacteria | 676 |
| 897 | Ga0307411_11254122 | 3300032005 | Bacteria | 674 |
| 898 | Ga0307411_12338354 | 3300032005 | Bacteria | 502 |
| 899 | Ga0307415_100013486 | 3300032126 | Bacteria | 4772 |
| 900 | Ga0307415_100042962 | 3300032126 | Bacteria | 3012 |
| 901 | Ga0307415_100069318 | 3300032126 | Bacteria | 2472 |
| 902 | Ga0307415_100103043 | 3300032126 | Bacteria | 2098 |
| 903 | Ga0307415_100315083 | 3300032126 | Bacteria | 1302 |
| 904 | Ga0307415_100733400 | 3300032126 | Bacteria | 895 |
| 905 | Ga0307415_101190469 | 3300032126 | Bacteria | 717 |
| 906 | Ga0307415_101318536 | 3300032126 | Bacteria | 684 |
| 907 | Ga0307415_101883455 | 3300032126 | Unclassified | 580 |
| 908 | Ga0316583_10235943 | 3300032133 | Bacteria | 634 |
| 909 | Ga0307507_10213939 | 3300033179 | Bacteria | 1309 |
| 910 | Ga0373958_0069772 | 3300034819 | Bacteria | 778 |
| 911 | Ga0373959_0010441 | 3300034820 | Bacteria | 1622 |
| 912 | Ga0373928_0083552 | 3300035084 | Bacteria | 809 |
| 913 | Ga0373940_0172431 | 3300035088 | Bacteria | 700 |
| 914 | Ga0373944_0144151 | 3300035089 | Bacteria | 835 |
| 915 | Ga0373949_0000042 | 3300035090 | Bacteria | 46169 |
| 916 | Ga0373952_0141808 | 3300035092 | Bacteria | 668 |
| 917 | Ga0373936_0000006 | 3300035113 | Bacteria | 318697 |
| 918 | Ga0373941_0026675 | 3300035115 | Bacteria | 1680 |
| 919 | Ga0373941_0104248 | 3300035115 | Bacteria | 991 |
| 920 | Ga0373954_0054565 | 3300035118 | Bacteria | 1879 |
| 921 | Ga0373954_0186452 | 3300035118 | Bacteria | 1018 |
| 922 | Ga0373956_0188630 | 3300035119 | Bacteria | 976 |
| 923 | Ga0373961_0000015 | 3300035241 | Bacteria | 111392 |
| 924 | Ga0316574_0033631 | 3300035398 | Bacteria | 3121 |
| 925 | Ga0316574_0408493 | 3300035398 | Bacteria | 854 |
| 926 | Ga0373931_0350671 | 3300035691 | Bacteria | 924 |
| 927 | Ga0373931_0690626 | 3300035691 | Bacteria | 673 |
| 928 | Ga0373935_0083638 | 3300035692 | Bacteria | 2078 |
| 929 | Ga0373933_0600388 | 3300035724 | Bacteria | 723 |
| 930 | Ga0373933_0946005 | 3300035724 | Bacteria | 567 |
| 931 | Ga0373947_0773182 | 3300035725 | Bacteria | 655 |
| 932 | Ga0373937_1686366 | 3300036401 | Bacteria | 581 |
| 933 | Ga0265778_052958 | 3300036457 | Bacteria | 558 |
| 934 | Ga0316582_0390143 | 3300036647 | Bacteria | 959 |
| 935 | Ga0316584_0028035 | 3300036712 | Bacteria | 4149 |
| 936 | Ga0373925_0143662 | 3300037068 | Bacteria | 1869 |
| 937 | Ga0373925_0205941 | 3300037068 | Bacteria | 1566 |
| 938 | Ga0395899_0234080 | 3300037312 | Bacteria | 1267 |
| 939 | Ga0395899_0474264 | 3300037312 | Bacteria | 816 |
| 940 | Ga0395900_0129946 | 3300037418 | Bacteria | 2582 |
| 941 | Ga0395900_1173528 | 3300037418 | Bacteria | 684 |
| 942 | Ga0395898_0255428 | 3300037466 | Bacteria | 1671 |
| 943 | Ga0395898_0296456 | 3300037466 | Bacteria | 1543 |
| 944 | Ga0395898_0426716 | 3300037466 | Bacteria | 1263 |
| 945 | Ga0395898_0607110 | 3300037466 | Bacteria | 1037 |
| 946 | Ga0395898_0730487 | 3300037466 | Bacteria | 932 |
| 947 | Ga0395905_0225550 | 3300037471 | Bacteria | 1753 |
| 948 | Ga0395905_0309184 | 3300037471 | Bacteria | 1469 |
| 949 | Ga0436364_1395085 | 3300037853 | Bacteria | 738 |
| 950 | Ga0395901_0124285 | 3300038443 | Bacteria | 2711 |
| 951 | Ga0395901_1130784 | 3300038443 | Bacteria | 752 |
| 952 | Ga0395901_1646832 | 3300038443 | Bacteria | 594 |
| 953 | Ga0436365_0954496 | 3300039437 | Unclassified | 856 |
| 954 | Ga0436365_1838581 | 3300039437 | Bacteria | 738 |
| 955 | Ga0436361_0938094 | 3300039447 | Bacteria | 500 |
| 956 | Ga0436363_0584301 | 3300039450 | Bacteria | 764 |
| 957 | Ga0436363_0783584 | 3300039450 | Bacteria | 1168 |
| 958 | Ga0436363_0986073 | 3300039450 | Bacteria | 964 |
| 959 | Ga0439439_0222361 | 3300041406 | Bacteria | 554 |
| 960 | Ga0439465_0086957 | 3300041413 | Bacteria | 1066 |
| 961 | Ga0451789_0091105 | 3300041443 | Bacteria | 1199 |
| 962 | Ga0451791_1353119 | 3300041451 | Bacteria | 3242 |
| 963 | Ga0451793_0152428 | 3300041452 | Unclassified | 699 |
| 964 | Ga0451797_0011443 | 3300041453 | Bacteria | 2103 |
| 965 | Ga0451795_0406964 | 3300041456 | Bacteria | 1007 |
| 966 | Ga0451800_0362132 | 3300041459 | Bacteria | 821 |
| 967 | Ga0451802_0857638 | 3300041460 | Bacteria | 733 |
| 968 | Ga0451807_1972304 | 3300041486 | Bacteria | 642 |
| 969 | Ga0451833_0506572 | 3300041491 | Bacteria | 857 |
| 970 | Ga0451837_0354457 | 3300041494 | Bacteria | 2586 |
| 971 | Ga0451839_0224422 | 3300041496 | Bacteria | 677 |
| 972 | Ga0451839_1373717 | 3300041496 | Bacteria | 848 |
| 973 | Ga0451841_1193332 | 3300041498 | Bacteria | 1251 |
| 974 | Ga0451847_0709139 | 3300041503 | Bacteria | 757 |
| 975 | Ga0451843_0771766 | 3300041509 | Bacteria | 993 |
| 976 | Ga0451853_0777436 | 3300041512 | Bacteria | 1101 |
| 977 | Ga0451853_2037896 | 3300041512 | Bacteria | 2012 |
| 978 | Ga0439450_058704 | 3300042008 | Bacteria | 926 |
| 979 | Ga0439451_061574 | 3300042009 | Bacteria | 751 |
| 980 | Ga0439455_0127718 | 3300042012 | Bacteria | 715 |
| 981 | Ga0439463_017891 | 3300042016 | Bacteria | 1761 |
| 982 | Ga0450914_002915 | 3300042118 | Bacteria | 1269 |
| 983 | Ga0450905_054786 | 3300042142 | Bacteria | 657 |
| 984 | Ga0439444_0001353 | 3300042437 | Bacteria | 3151 |
| 985 | Ga0439459_0111886 | 3300042438 | Bacteria | 679 |
| 986 | Ga0439459_0175930 | 3300042438 | Bacteria | 573 |
| 987 | Ga0439459_0224239 | 3300042438 | Bacteria | 522 |
| 988 | Ga0439464_0012839 | 3300042439 | Bacteria | 2235 |
| 989 | Ga0450893_0048351 | 3300042532 | Bacteria | 793 |
| 990 | Ga0451577_0179447 | 3300042876 | Bacteria | 1909 |
| 991 | Ga0439440_0004989 | 3300042993 | Bacteria | 2620 |
| 992 | Ga0466972_0287972 | 3300044658 | Bacteria | 768 |
| 993 | Ga0466965_0146782 | 3300044683 | Bacteria | 1231 |
| 994 | Ga0466965_0154339 | 3300044683 | Bacteria | 1201 |
| 995 | Ga0466965_0160930 | 3300044683 | Bacteria | 1177 |
| 996 | Ga0466965_0212249 | 3300044683 | Bacteria | 1029 |
| 997 | Ga0466965_0367471 | 3300044683 | Bacteria | 790 |
| 998 | Ga0466966_0093740 | 3300044684 | Bacteria | 1862 |
| 999 | Ga0466966_0124012 | 3300044684 | Bacteria | 1585 |
| 1000 | Ga0466961_0037057 | 3300044693 | Bacteria | 3130 |
| 1001 | Ga0466961_0043779 | 3300044693 | Bacteria | 2866 |
| 1002 | Ga0466961_0085337 | 3300044693 | Bacteria | 1997 |
| 1003 | Ga0466961_0143493 | 3300044693 | Bacteria | 1494 |
| 1004 | Ga0466961_0237936 | 3300044693 | Bacteria | 1120 |
| 1005 | Ga0466961_0476411 | 3300044693 | Bacteria | 755 |
| 1006 | Ga0466963_0031126 | 3300044694 | Bacteria | 3447 |
| 1007 | Ga0466963_0089212 | 3300044694 | Bacteria | 2097 |
| 1008 | Ga0466963_0096517 | 3300044694 | Bacteria | 2019 |
| 1009 | Ga0466963_0157732 | 3300044694 | Bacteria | 1578 |
| 1010 | Ga0466963_0231007 | 3300044694 | Bacteria | 1296 |
| 1011 | Ga0466963_0352209 | 3300044694 | Bacteria | 1037 |
| 1012 | Ga0466963_0399690 | 3300044694 | Bacteria | 969 |
| 1013 | Ga0466963_0435733 | 3300044694 | Bacteria | 924 |
| 1014 | Ga0466963_0651368 | 3300044694 | Bacteria | 743 |
| 1015 | Ga0466963_1158883 | 3300044694 | Bacteria | 543 |
| 1016 | Ga0466963_1182892 | 3300044694 | Bacteria | 537 |
| 1017 | Ga0466964_0129233 | 3300044706 | Bacteria | 1148 |
| 1018 | Ga0466964_0142785 | 3300044706 | Bacteria | 1102 |
| 1019 | Ga0466964_0194842 | 3300044706 | Bacteria | 969 |
| 1020 | Ga0466964_0245374 | 3300044706 | Bacteria | 880 |
| 1021 | Ga0466964_0672203 | 3300044706 | Bacteria | 575 |
| 1022 | Ga0453684_0048627 | 3300044712 | Bacteria | 5603 |
| 1023 | Ga0466971_0002843 | 3300044719 | Bacteria | 7338 |
| 1024 | Ga0466971_0029438 | 3300044719 | Bacteria | 2456 |
| 1025 | Ga0466970_0191972 | 3300044765 | Bacteria | 1135 |
| 1026 | Ga0466957_0061797 | 3300044842 | Bacteria | 2300 |
| 1027 | Ga0466957_0068004 | 3300044842 | Bacteria | 2198 |
| 1028 | Ga0466957_0165341 | 3300044842 | Bacteria | 1439 |
| 1029 | Ga0466957_0195507 | 3300044842 | Bacteria | 1326 |
| 1030 | Ga0466957_0214270 | 3300044842 | Bacteria | 1269 |
| 1031 | Ga0466957_0365487 | 3300044842 | Bacteria | 981 |
| 1032 | Ga0466957_0648431 | 3300044842 | Bacteria | 742 |
| 1033 | Ga0466957_0940620 | 3300044842 | Bacteria | 619 |
| 1034 | Ga0466957_1034381 | 3300044842 | Bacteria | 591 |
| 1035 | Ga0466960_0047777 | 3300044901 | Bacteria | 2054 |
| 1036 | Ga0466960_0059111 | 3300044901 | Bacteria | 1874 |
| 1037 | Ga0466960_0063633 | 3300044901 | Bacteria | 1816 |
| 1038 | Ga0466960_0128550 | 3300044901 | Bacteria | 1335 |
| 1039 | Ga0466960_0272230 | 3300044901 | Unclassified | 947 |
| 1040 | Ga0466960_0279688 | 3300044901 | Bacteria | 935 |
| 1041 | Ga0466960_0324561 | 3300044901 | Bacteria | 873 |
| 1042 | Ga0466959_0002215 | 3300045049 | Bacteria | 12379 |
| 1043 | Ga0466959_0379434 | 3300045049 | Bacteria | 962 |
| 1044 | Ga0466959_0473289 | 3300045049 | Bacteria | 848 |
| 1045 | Ga0466958_0009429 | 3300045836 | Bacteria | 5439 |
| 1046 | Ga0466958_0036236 | 3300045836 | Bacteria | 2952 |
| 1047 | Ga0466958_0149264 | 3300045836 | Bacteria | 1474 |
| 1048 | Ga0466958_0218590 | 3300045836 | Bacteria | 1215 |
| 1049 | Ga0466958_0324134 | 3300045836 | Bacteria | 990 |
| 1050 | Ga0466958_0397663 | 3300045836 | Bacteria | 889 |
| 1051 | Ga0466967_0051187 | 3300045976 | Bacteria | 3618 |
| 1052 | Ga0466967_0063703 | 3300045976 | Bacteria | 3277 |
| 1053 | Ga0466967_0195274 | 3300045976 | Bacteria | 1914 |
| 1054 | Ga0466967_0195449 | 3300045976 | Bacteria | 1913 |
| 1055 | Ga0466967_0237690 | 3300045976 | Bacteria | 1736 |
| 1056 | Ga0466967_0299080 | 3300045976 | Bacteria | 1548 |
| 1057 | Ga0466967_0347328 | 3300045976 | Bacteria | 1435 |
| 1058 | Ga0466967_0473383 | 3300045976 | Bacteria | 1226 |
| 1059 | Ga0466967_0509116 | 3300045976 | Bacteria | 1182 |
| 1060 | Ga0466967_0629057 | 3300045976 | Bacteria | 1060 |
| 1061 | Ga0466967_0873946 | 3300045976 | Bacteria | 894 |
| 1062 | Ga0466967_1543660 | 3300045976 | Bacteria | 661 |
| 1063 | Ga0466967_1655969 | 3300045976 | Unclassified | 637 |
| 1064 | Ga0466967_1736603 | 3300045976 | Bacteria | 621 |
| 1065 | Ga0495592_0156082 | 3300046454 | Bacteria | 1574 |
| 1066 | Ga0495592_0278055 | 3300046454 | Bacteria | 1096 |
| 1067 | Ga0495603_0001557 | 3300046455 | Bacteria | 13416 |
| 1068 | Ga0495603_0121963 | 3300046455 | Bacteria | 1519 |
| 1069 | Ga0495603_0660462 | 3300046455 | Bacteria | 598 |
| 1070 | Ga0495629_0228749 | 3300046459 | Bacteria | 1282 |
| 1071 | Ga0495641_0550194 | 3300046461 | Bacteria | 527 |
| 1072 | Ga0495651_0208618 | 3300046462 | Bacteria | 1361 |
| 1073 | Ga0495651_0273325 | 3300046462 | Bacteria | 1145 |
| 1074 | Ga0495651_0290830 | 3300046462 | Bacteria | 1099 |
| 1075 | Ga0495653_0038646 | 3300046463 | Bacteria | 3745 |
| 1076 | Ga0495653_0048075 | 3300046463 | Bacteria | 3296 |
| 1077 | Ga0495653_0244336 | 3300046463 | Bacteria | 1194 |
| 1078 | Ga0495639_0277131 | 3300046475 | Bacteria | 833 |
| 1079 | Ga0495664_0000007 | 3300046477 | Bacteria | 386710 |
| 1080 | Ga0495584_0415339 | 3300046491 | Bacteria | 684 |
| 1081 | Ga0495594_0371583 | 3300046499 | Bacteria | 814 |
| 1082 | Ga0495596_0209206 | 3300046500 | Bacteria | 758 |
| 1083 | Ga0495608_0482999 | 3300046511 | Bacteria | 751 |
| 1084 | Ga0495608_0630679 | 3300046511 | Bacteria | 642 |
| 1085 | Ga0495616_0459792 | 3300046513 | Bacteria | 514 |
| 1086 | Ga0495618_0000035 | 3300046514 | Bacteria | 102739 |
| 1087 | Ga0495620_0072092 | 3300046515 | Bacteria | 1411 |
| 1088 | Ga0495628_0443878 | 3300046516 | Bacteria | 943 |
| 1089 | Ga0495630_0000610 | 3300046517 | Bacteria | 25880 |
| 1090 | Ga0495630_0286116 | 3300046517 | Bacteria | 1260 |
| 1091 | Ga0495631_0264249 | 3300046518 | Bacteria | 733 |
| 1092 | Ga0495631_0433624 | 3300046518 | Bacteria | 560 |
| 1093 | Ga0495632_0049233 | 3300046519 | Bacteria | 2084 |
| 1094 | Ga0495632_0333435 | 3300046519 | Bacteria | 669 |
| 1095 | Ga0495652_0395835 | 3300046529 | Bacteria | 979 |
| 1096 | Ga0495640_0391021 | 3300046533 | Bacteria | 855 |
| 1097 | Ga0495587_0068002 | 3300046536 | Bacteria | 2076 |
| 1098 | Ga0495609_0237259 | 3300046538 | Bacteria | 754 |
| 1099 | Ga0495645_0000033 | 3300046543 | Bacteria | 105930 |
| 1100 | Ga0495645_0056355 | 3300046543 | Bacteria | 2854 |
| 1101 | Ga0495622_0275289 | 3300046557 | Bacteria | 737 |
| 1102 | Ga0495667_0000067 | 3300046559 | Bacteria | 81751 |
| 1103 | Ga0495667_0750782 | 3300046559 | Bacteria | 603 |
| 1104 | Ga0495656_0101624 | 3300046615 | Bacteria | 1331 |
| 1105 | Ga0495656_0599253 | 3300046615 | Bacteria | 590 |
| 1106 | Ga0495625_0206025 | 3300046660 | Bacteria | 1295 |
| 1107 | Ga0495635_0041495 | 3300046663 | Bacteria | 3178 |
| 1108 | Ga0495635_0458442 | 3300046663 | Bacteria | 842 |
| 1109 | Ga0495635_0557190 | 3300046663 | Bacteria | 751 |
| 1110 | Ga0495635_0862179 | 3300046663 | Bacteria | 581 |
| 1111 | Ga0495588_0166115 | 3300046674 | Bacteria | 1167 |
| 1112 | Ga0495588_0499820 | 3300046674 | Bacteria | 637 |
| 1113 | Ga0495657_0000027 | 3300046675 | Bacteria | 131421 |
| 1114 | Ga0495623_0205792 | 3300046679 | Bacteria | 1129 |
| 1115 | Ga0495646_0375651 | 3300046680 | Bacteria | 742 |
| 1116 | Ga0495647_0193224 | 3300046681 | Bacteria | 890 |
| 1117 | Ga0495658_0330886 | 3300046683 | Bacteria | 967 |
| 1118 | Ga0495613_0278464 | 3300046689 | Bacteria | 1162 |
| 1119 | Ga0495624_0053715 | 3300046690 | Bacteria | 2543 |
| 1120 | Ga0495624_0442408 | 3300046690 | Bacteria | 779 |
| 1121 | Ga0495649_0024919 | 3300046694 | Bacteria | 3333 |
| 1122 | Ga0495649_0120320 | 3300046694 | Bacteria | 1389 |
| 1123 | Ga0495649_0425579 | 3300046694 | Bacteria | 665 |
| 1124 | Ga0495589_0219446 | 3300046794 | Bacteria | 894 |
| 1125 | Ga0495589_0273092 | 3300046794 | Bacteria | 787 |
| 1126 | Ga0495581_0182687 | 3300047315 | Bacteria | 1227 |
| 1127 | Ga0495604_0139930 | 3300047317 | Bacteria | 1730 |
| 1128 | Ga0495604_0555324 | 3300047317 | Bacteria | 740 |
| 1129 | Ga0495674_0100939 | 3300047319 | Bacteria | 2455 |
| 1130 | Ga0495674_0141365 | 3300047319 | Bacteria | 2023 |
| 1131 | Ga0495676_0099183 | 3300047321 | Bacteria | 2159 |
| 1132 | Ga0495676_1018818 | 3300047321 | Bacteria | 528 |
| 1133 | Ga0495680_0009089 | 3300047322 | Bacteria | 8968 |
| 1134 | Ga0495680_0009545 | 3300047322 | Bacteria | 8718 |
| 1135 | Ga0495680_0165161 | 3300047322 | Bacteria | 1606 |
| 1136 | Ga0495680_0294664 | 3300047322 | Bacteria | 1140 |
| 1137 | Ga0495683_0335953 | 3300047323 | Bacteria | 641 |
| 1138 | Ga0495675_0094566 | 3300047444 | Bacteria | 1874 |
| 1139 | Ga0495677_0334785 | 3300047445 | Bacteria | 597 |
| 1140 | Ga0495684_0066049 | 3300047471 | Bacteria | 2751 |
| 1141 | Ga0495684_0388357 | 3300047471 | Bacteria | 983 |
| 1142 | Ga0495684_0900927 | 3300047471 | Bacteria | 570 |
| 1143 | Ga0495686_0016492 | 3300047472 | Bacteria | 5009 |
| 1144 | Ga0495593_0211509 | 3300047673 | Bacteria | 974 |
| 1145 | Ga0495602_0160403 | 3300048088 | Bacteria | 1756 |
| 1146 | Ga0495602_0227893 | 3300048088 | Bacteria | 1402 |
| 1147 | Ga0495602_0959830 | 3300048088 | Unclassified | 566 |
| 1148 | Ga0495615_0165358 | 3300048090 | Bacteria | 667 |
| 1149 | Ga0496100_0024347 | 3300048903 | Bacteria | 3692 |
| 1150 | Ga0496100_0436162 | 3300048903 | Bacteria | 1002 |
| 1151 | Ga0496100_0486014 | 3300048903 | Bacteria | 950 |
| 1152 | Ga0496100_0505230 | 3300048903 | Bacteria | 932 |
| 1153 | Ga0496101_0100575 | 3300048904 | Bacteria | 2163 |
| 1154 | Ga0496101_0354842 | 3300048904 | Bacteria | 1153 |
| 1155 | Ga0496102_0000002 | 3300048905 | Bacteria | 814588 |
| 1156 | Ga0496102_0162820 | 3300048905 | Bacteria | 2099 |
| 1157 | Ga0496102_0240481 | 3300048905 | Bacteria | 1707 |
| 1158 | Ga0496102_0545251 | 3300048905 | Bacteria | 1082 |
| 1159 | Ga0496102_0652788 | 3300048905 | Bacteria | 975 |
| 1160 | Ga0496102_0787944 | 3300048905 | Bacteria | 873 |
| 1161 | Ga0496102_0851097 | 3300048905 | Bacteria | 834 |
| 1162 | Ga0496103_0000017 | 3300048906 | Bacteria | 244768 |
| 1163 | Ga0496103_0033430 | 3300048906 | Bacteria | 3142 |
| 1164 | Ga0496103_0818316 | 3300048906 | Bacteria | 587 |
| 1165 | Ga0496104_0000001 | 3300048907 | Bacteria | 711867 |
| 1166 | Ga0496104_0000029 | 3300048907 | Bacteria | 202968 |
| 1167 | Ga0496104_0036497 | 3300048907 | Bacteria | 4595 |
| 1168 | Ga0496104_0040221 | 3300048907 | Bacteria | 4382 |
| 1169 | Ga0496104_0043241 | 3300048907 | Bacteria | 4231 |
| 1170 | Ga0496104_0065631 | 3300048907 | Bacteria | 3445 |
| 1171 | Ga0496104_0143826 | 3300048907 | Bacteria | 2291 |
| 1172 | Ga0496104_0769375 | 3300048907 | Bacteria | 869 |
| 1173 | Ga0496104_0871828 | 3300048907 | Bacteria | 805 |
| 1174 | Ga0496105_0000002 | 3300048908 | Bacteria | 753215 |
| 1175 | Ga0496105_0000070 | 3300048908 | Bacteria | 80117 |
| 1176 | Ga0496105_0083463 | 3300048908 | Bacteria | 2638 |
| 1177 | Ga0496105_0086869 | 3300048908 | Bacteria | 2584 |
| 1178 | Ga0496105_0501721 | 3300048908 | Bacteria | 952 |
| 1179 | Ga0496106_0147663 | 3300048909 | Bacteria | 1853 |
| 1180 | Ga0496106_0162838 | 3300048909 | Bacteria | 1765 |
| 1181 | Ga0496106_0253408 | 3300048909 | Bacteria | 1407 |
| 1182 | Ga0496106_0511564 | 3300048909 | Bacteria | 964 |
| 1183 | Ga0496106_1058730 | 3300048909 | Unclassified | 637 |
| 1184 | Ga0496107_0133809 | 3300048910 | Bacteria | 1831 |
| 1185 | Ga0496107_0251996 | 3300048910 | Bacteria | 1313 |
| 1186 | Ga0496107_0370494 | 3300048910 | Bacteria | 1065 |
| 1187 | Ga0496107_0951566 | 3300048910 | Bacteria | 625 |
| 1188 | Ga0496107_1381042 | 3300048910 | Unclassified | 502 |
| 1189 | Ga0496108_0169624 | 3300048911 | Bacteria | 1888 |
| 1190 | Ga0496108_0211148 | 3300048911 | Bacteria | 1685 |
| 1191 | Ga0496108_0259653 | 3300048911 | Bacteria | 1512 |
| 1192 | Ga0496108_0263273 | 3300048911 | Bacteria | 1501 |
| 1193 | Ga0496108_0464789 | 3300048911 | Bacteria | 1105 |
| 1194 | Ga0496108_0740512 | 3300048911 | Bacteria | 851 |
| 1195 | Ga0496108_1415106 | 3300048911 | Bacteria | 581 |
| 1196 | Ga0496108_1443855 | 3300048911 | Bacteria | 574 |
| 1197 | Ga0496109_0169840 | 3300048912 | Bacteria | 2045 |
| 1198 | Ga0496109_0272183 | 3300048912 | Bacteria | 1596 |
| 1199 | Ga0496109_0375278 | 3300048912 | Bacteria | 1343 |
| 1200 | Ga0496109_0509979 | 3300048912 | Bacteria | 1135 |
| 1201 | Ga0496109_0882821 | 3300048912 | Bacteria | 832 |
| 1202 | Ga0496109_0886616 | 3300048912 | Bacteria | 830 |
| 1203 | Ga0496109_1760197 | 3300048912 | Bacteria | 553 |
| 1204 | Ga0496110_0000152 | 3300048913 | Bacteria | 41561 |
| 1205 | Ga0496110_0052009 | 3300048913 | Bacteria | 3600 |
| 1206 | Ga0496110_0060868 | 3300048913 | Bacteria | 3331 |
| 1207 | Ga0496110_0122036 | 3300048913 | Bacteria | 2348 |
| 1208 | Ga0496110_0232030 | 3300048913 | Bacteria | 1679 |
| 1209 | Ga0496110_0279924 | 3300048913 | Bacteria | 1519 |
| 1210 | Ga0496110_0690997 | 3300048913 | Bacteria | 921 |
| 1211 | Ga0496110_1393244 | 3300048913 | Bacteria | 610 |
| 1212 | Ga0496110_1608591 | 3300048913 | Bacteria | 560 |
| 1213 | Ga0496111_0000123 | 3300048914 | Bacteria | 33765 |
| 1214 | Ga0496111_0103230 | 3300048914 | Bacteria | 2096 |
| 1215 | Ga0496111_0140920 | 3300048914 | Bacteria | 1786 |
| 1216 | Ga0496111_0470284 | 3300048914 | Bacteria | 927 |
| 1217 | Ga0496111_1053826 | 3300048914 | Bacteria | 581 |
| 1218 | Ga0496112_0005170 | 3300048915 | Bacteria | 11216 |
| 1219 | Ga0496112_0024276 | 3300048915 | Bacteria | 5803 |
| 1220 | Ga0496112_0037175 | 3300048915 | Bacteria | 4753 |
| 1221 | Ga0496112_0193955 | 3300048915 | Bacteria | 1992 |
| 1222 | Ga0496112_0562304 | 3300048915 | Bacteria | 1074 |
| 1223 | Ga0496112_0964105 | 3300048915 | Bacteria | 773 |
| 1224 | Ga0496112_1170335 | 3300048915 | Bacteria | 686 |
| 1225 | Ga0496113_0042204 | 3300048916 | Bacteria | 3369 |
| 1226 | Ga0496113_0079994 | 3300048916 | Bacteria | 2502 |
| 1227 | Ga0496113_0218770 | 3300048916 | Bacteria | 1518 |
| 1228 | Ga0496113_0306181 | 3300048916 | Bacteria | 1273 |
| 1229 | Ga0496113_0590688 | 3300048916 | Bacteria | 889 |
| 1230 | Ga0496113_0663916 | 3300048916 | Bacteria | 833 |
| 1231 | Ga0496113_0965049 | 3300048916 | Bacteria | 672 |
| 1232 | Ga0496114_0018473 | 3300048917 | Bacteria | 5637 |
| 1233 | Ga0496114_0191299 | 3300048917 | Bacteria | 1790 |
| 1234 | Ga0496114_0714998 | 3300048917 | Bacteria | 878 |
| 1235 | Ga0496114_0916565 | 3300048917 | Bacteria | 758 |
| 1236 | Ga0496114_1392193 | 3300048917 | Bacteria | 589 |
| 1237 | Ga0496115_0002589 | 3300048918 | Bacteria | 12979 |
| 1238 | Ga0496115_0338767 | 3300048918 | Bacteria | 1228 |
| 1239 | Ga0496115_0554612 | 3300048918 | Bacteria | 918 |
| 1240 | Ga0496115_1001885 | 3300048918 | Bacteria | 638 |
| 1241 | Ga0496115_1234758 | 3300048918 | Bacteria | 560 |
| 1242 | Ga0496119_0008336 | 3300048922 | Bacteria | 9135 |
| 1243 | Ga0496126_1310790 | 3300048929 | Bacteria | 527 |
| 1244 | Ga0501306_001374 | 3300049127 | Bacteria | 2273 |
| 1245 | Ga0501306_099357 | 3300049127 | Bacteria | 519 |
| 1246 | Ga0501306_106457 | 3300049127 | Bacteria | 506 |
| 1247 | Ga0501308_010483 | 3300049128 | Bacteria | 1030 |
| 1248 | Ga0501308_015639 | 3300049128 | Bacteria | 901 |
| 1249 | Ga0501309_025922 | 3300049129 | Bacteria | 845 |
| 1250 | Ga0501310_020346 | 3300049130 | Bacteria | 823 |
| 1251 | Ga0501310_022222 | 3300049130 | Bacteria | 799 |
| 1252 | Ga0501310_039267 | 3300049130 | Bacteria | 654 |
| 1253 | Ga0501310_081916 | 3300049130 | Bacteria | 508 |
| 1254 | Ga0501304_033043 | 3300049160 | Bacteria | 557 |
| 1255 | Ga0501305_026589 | 3300049161 | Bacteria | 883 |
| 1256 | Ga0501305_031867 | 3300049161 | Unclassified | 825 |
| 1257 | Ga0501305_065671 | 3300049161 | Bacteria | 631 |
| 1258 | Ga0501307_010596 | 3300049162 | Bacteria | 1069 |
| 1259 | Ga0501307_068861 | 3300049162 | Bacteria | 561 |
| 1260 | Ga0501307_074433 | 3300049162 | Bacteria | 546 |
| 1261 | Ga0501311_031990 | 3300049527 | Bacteria | 766 |
| 1262 | Ga0501311_034039 | 3300049527 | Bacteria | 749 |
| 1263 | Ga0501311_048303 | 3300049527 | Bacteria | 662 |
| 1264 | Ga0501311_067482 | 3300049527 | Bacteria | 588 |
| 1265 | Ga0501311_080347 | 3300049527 | Bacteria | 554 |
| 1266 | Ga0501312_080589 | 3300049528 | Bacteria | 589 |
| 1267 | Ga0501313_016784 | 3300049529 | Bacteria | 881 |
| 1268 | Ga0501313_018715 | 3300049529 | Bacteria | 843 |
| 1269 | Ga0501314_016823 | 3300049530 | Bacteria | 732 |
| 1270 | Ga0501315_057939 | 3300049531 | Bacteria | 621 |
| 1271 | Ga0501316_070799 | 3300049532 | Bacteria | 528 |
| 1272 | Ga0501317_008122 | 3300049533 | Bacteria | 1202 |
| 1273 | Ga0501317_032247 | 3300049533 | Bacteria | 766 |
| 1274 | Ga0501317_043034 | 3300049533 | Bacteria | 696 |
| 1275 | Ga0501317_051676 | 3300049533 | Bacteria | 655 |
| 1276 | Ga0501318_005041 | 3300049534 | Bacteria | 1294 |
| 1277 | Ga0501318_045465 | 3300049534 | Bacteria | 639 |
| 1278 | Ga0501318_048258 | 3300049534 | Bacteria | 627 |
| 1279 | Ga0501318_049778 | 3300049534 | Bacteria | 620 |
| 1280 | Ga0501318_054445 | 3300049534 | Bacteria | 601 |
| 1281 | Ga0501318_068568 | 3300049534 | Bacteria | 556 |
| 1282 | Ga0501318_072171 | 3300049534 | Bacteria | 547 |
| 1283 | Ga0501318_077689 | 3300049534 | Unclassified | 533 |
| 1284 | Ga0501318_092093 | 3300049534 | Bacteria | 503 |
| 1285 | Ga0501319_010979 | 3300049535 | Bacteria | 727 |
| 1286 | Ga0501319_012645 | 3300049535 | Bacteria | 693 |
| 1287 | Ga0501319_016493 | 3300049535 | Bacteria | 635 |
| 1288 | Ga0501320_004510 | 3300049536 | Bacteria | 1232 |
| 1289 | Ga0501320_055114 | 3300049536 | Bacteria | 549 |
| 1290 | Ga0501321_035885 | 3300049537 | Bacteria | 681 |
| 1291 | Ga0501323_003329 | 3300049539 | Bacteria | 1637 |
| 1292 | Ga0501323_020376 | 3300049539 | Bacteria | 871 |
| 1293 | Ga0501323_021398 | 3300049539 | Bacteria | 855 |
| 1294 | Ga0501323_041310 | 3300049539 | Bacteria | 677 |
| 1295 | Ga0501323_050893 | 3300049539 | Bacteria | 628 |
| 1296 | Ga0501323_056816 | 3300049539 | Bacteria | 604 |
| 1297 | Ga0501324_005127 | 3300049540 | Bacteria | 1066 |
| 1298 | Ga0501324_021188 | 3300049540 | Bacteria | 665 |
| 1299 | Ga0501325_015874 | 3300049541 | Bacteria | 747 |
| 1300 | Ga0501325_025100 | 3300049541 | Bacteria | 652 |
| 1301 | Ga0501325_026039 | 3300049541 | Bacteria | 645 |
| 1302 | Ga0501326_04670 | 3300049542 | Bacteria | 730 |
| 1303 | Ga0501332_06041 | 3300049548 | Unclassified | 751 |
| 1304 | Ga0501333_005400 | 3300049549 | Bacteria | 828 |
| 1305 | Ga0501336_011089 | 3300049552 | Bacteria | 730 |
| 1306 | Ga0501340_013035 | 3300049556 | Bacteria | 636 |
| 1307 | Ga0501031_0045032 | 3300049568 | Bacteria | 2879 |
| 1308 | Ga0501031_0241734 | 3300049568 | Bacteria | 1174 |
| 1309 | Ga0501031_0668653 | 3300049568 | Bacteria | 667 |
| 1310 | Ga0501031_0809550 | 3300049568 | Bacteria | 600 |
| 1311 | Ga0501032_0348779 | 3300049569 | Bacteria | 954 |
| 1312 | Ga0501033_0369756 | 3300049570 | Bacteria | 1003 |
| 1313 | Ga0501033_0538860 | 3300049570 | Bacteria | 805 |
| 1314 | Ga0501033_0963606 | 3300049570 | Bacteria | 571 |
| 1315 | Ga0501034_0157313 | 3300049571 | Bacteria | 2246 |
| 1316 | Ga0501034_0204107 | 3300049571 | Bacteria | 1933 |
| 1317 | Ga0501034_0312070 | 3300049571 | Bacteria | 1507 |
| 1318 | Ga0501036_0224890 | 3300049572 | Bacteria | 1575 |
| 1319 | Ga0501036_0259796 | 3300049572 | Bacteria | 1455 |
| 1320 | Ga0501036_0460193 | 3300049572 | Bacteria | 1060 |
| 1321 | Ga0501036_1454859 | 3300049572 | Bacteria | 555 |
| 1322 | Ga0501037_0890738 | 3300049573 | Bacteria | 584 |
| 1323 | Ga0501037_1130128 | 3300049573 | Bacteria | 507 |
| 1324 | Ga0501038_0064358 | 3300049574 | Bacteria | 3127 |
| 1325 | Ga0501038_0236800 | 3300049574 | Bacteria | 1451 |
| 1326 | Ga0501038_0251709 | 3300049574 | Bacteria | 1399 |
| 1327 | Ga0501039_0834539 | 3300049575 | Bacteria | 718 |
| 1328 | Ga0501039_1051204 | 3300049575 | Unclassified | 632 |
| 1329 | Ga0501040_0476507 | 3300049576 | Bacteria | 899 |
| 1330 | Ga0501040_1005508 | 3300049576 | Bacteria | 604 |
| 1331 | Ga0501040_1269103 | 3300049576 | Bacteria | 534 |
| 1332 | Ga0501041_0101653 | 3300049577 | Bacteria | 1780 |
| 1333 | Ga0501041_0355174 | 3300049577 | Bacteria | 926 |
| 1334 | Ga0501041_0630780 | 3300049577 | Bacteria | 685 |
| 1335 | Ga0501041_0969940 | 3300049577 | Bacteria | 547 |
| 1336 | Ga0501042_0123976 | 3300049578 | Bacteria | 1860 |
| 1337 | Ga0501046_0370010 | 3300049580 | Bacteria | 1038 |
| 1338 | Ga0501046_1273382 | 3300049580 | Bacteria | 503 |
| 1339 | Ga0501047_0064838 | 3300049581 | Bacteria | 3523 |
| 1340 | Ga0501047_0245971 | 3300049581 | Bacteria | 1638 |
| 1341 | Ga0501047_0608361 | 3300049581 | Bacteria | 914 |
| 1342 | Ga0501048_0114451 | 3300049582 | Bacteria | 1905 |
| 1343 | Ga0501048_0129715 | 3300049582 | Bacteria | 1783 |
| 1344 | Ga0501067_0103473 | 3300049583 | Bacteria | 1582 |
| 1345 | Ga0501067_0205228 | 3300049583 | Bacteria | 1098 |
| 1346 | Ga0501067_0303084 | 3300049583 | Bacteria | 890 |
| 1347 | Ga0501067_0353157 | 3300049583 | Bacteria | 820 |
| 1348 | Ga0501067_0844086 | 3300049583 | Bacteria | 516 |
| 1349 | Ga0501068_0436743 | 3300049584 | Bacteria | 846 |
| 1350 | Ga0501069_0008335 | 3300049585 | Bacteria | 5443 |
| 1351 | Ga0501069_0335301 | 3300049585 | Bacteria | 890 |
| 1352 | Ga0501070_0257541 | 3300049586 | Bacteria | 1427 |
| 1353 | Ga0501070_1002555 | 3300049586 | Bacteria | 648 |
| 1354 | Ga0501070_1265138 | 3300049586 | Unclassified | 564 |
| 1355 | Ga0501071_0446459 | 3300049587 | Bacteria | 990 |
| 1356 | Ga0501071_0732412 | 3300049587 | Bacteria | 762 |
| 1357 | Ga0501071_0901864 | 3300049587 | Bacteria | 682 |
| 1358 | Ga0501072_0022407 | 3300049588 | Bacteria | 4901 |
| 1359 | Ga0501072_0164404 | 3300049588 | Bacteria | 1770 |
| 1360 | Ga0501073_1073292 | 3300049589 | Bacteria | 554 |
| 1361 | Ga0501074_0235240 | 3300049590 | Bacteria | 1304 |
| 1362 | Ga0501074_0345981 | 3300049590 | Bacteria | 1055 |
| 1363 | Ga0501074_0589332 | 3300049590 | Bacteria | 786 |
| 1364 | Ga0501075_0259986 | 3300049591 | Bacteria | 1323 |
| 1365 | Ga0501076_0185295 | 3300049592 | Bacteria | 1697 |
| 1366 | Ga0501076_0376060 | 3300049592 | Bacteria | 1167 |
| 1367 | Ga0501076_0629695 | 3300049592 | Bacteria | 885 |
| 1368 | Ga0501076_0755445 | 3300049592 | Bacteria | 802 |
| 1369 | Ga0501077_0082333 | 3300049593 | Bacteria | 2039 |
| 1370 | Ga0501209_177865 | 3300049656 | Bacteria | 649 |
| 1371 | Ga0501079_0111889 | 3300049741 | Bacteria | 2122 |
| 1372 | Ga0501080_0051340 | 3300049742 | Bacteria | 3837 |
| 1373 | Ga0501080_0192882 | 3300049742 | Bacteria | 1872 |
| 1374 | Ga0501080_1080077 | 3300049742 | Bacteria | 693 |
| 1375 | Ga0501081_0339785 | 3300049743 | Bacteria | 1105 |
| 1376 | Ga0501081_0953734 | 3300049743 | Bacteria | 648 |
| 1377 | Ga0501083_0306065 | 3300049744 | Bacteria | 1034 |
| 1378 | Ga0501083_0768191 | 3300049744 | Bacteria | 627 |
| 1379 | Ga0501265_053120 | 3300049762 | Bacteria | 643 |
| 1380 | Ga0501035_0774111 | 3300049822 | Bacteria | 768 |
| 1381 | Ga0501044_0095711 | 3300049823 | Bacteria | 2992 |
| 1382 | Ga0501044_0340937 | 3300049823 | Bacteria | 1420 |
| 1383 | Ga0501044_0497092 | 3300049823 | Bacteria | 1121 |
| 1384 | Ga0501045_0236958 | 3300049824 | Bacteria | 1358 |
| 1385 | Ga0501204_032177 | 3300049850 | Bacteria | 734 |
| 1386 | nmdc:mga00v17_287450_c1 | 3300050491 | Bacteria | 1068 |
| 1387 | nmdc:mga00v17_295790_c1 | 3300050491 | Bacteria | 1051 |
| 1388 | nmdc:mga00v17_536524_c1 | 3300050491 | Bacteria | 757 |
| 1389 | nmdc:mga0yw44_10371_c1 | 3300050492 | Bacteria | 4757 |
| 1390 | nmdc:mga0yw44_473461_c1 | 3300050492 | Bacteria | 849 |
| 1391 | nmdc:mga0yw44_89792_c1 | 3300050492 | Bacteria | 1940 |
| 1392 | nmdc:mga0yw44_90414_c1 | 3300050492 | Bacteria | 1934 |
| 1393 | nmdc:mga06z11_16397_c1 | 3300050494 | Bacteria | 3336 |
| 1394 | nmdc:mga06z11_232003_c1 | 3300050494 | Bacteria | 1081 |
| 1395 | nmdc:mga05p37_281818_c1 | 3300050507 | Bacteria | 1982 |
| 1396 | nmdc:mga05p37_536441_c1 | 3300050507 | Bacteria | 1335 |
| 1397 | nmdc:mga09592_279953_c1 | 3300050508 | Bacteria | 1447 |
| 1398 | nmdc:mga0qj67_12200_c1 | 3300050509 | Bacteria | 6467 |
| 1399 | nmdc:mga0qj67_675251_c1 | 3300050509 | Bacteria | 823 |
| 1400 | nmdc:mga0qj67_754676_c1 | 3300050509 | Bacteria | 772 |
| 1401 | nmdc:mga06r32_551663_c1 | 3300050510 | Bacteria | 1126 |
| 1402 | nmdc:mga08y16_166926_c1 | 3300050511 | Bacteria | 2287 |
| 1403 | nmdc:mga08y16_1798830_c1 | 3300050511 | Bacteria | 566 |
| 1404 | nmdc:mga08y16_44244_c1 | 3300050511 | Bacteria | 4664 |
| 1405 | nmdc:mga08y16_690375_c1 | 3300050511 | Bacteria | 1022 |
| 1406 | nmdc:mga08y16_883194_c1 | 3300050511 | Bacteria | 881 |
| 1407 | nmdc:mga0n895_108333_c1 | 3300050512 | Bacteria | 2792 |
| 1408 | nmdc:mga0n895_11252_c1 | 3300050512 | Bacteria | 7970 |
| 1409 | nmdc:mga0rr50_490015_c1 | 3300050513 | Bacteria | 1044 |
| 1410 | nmdc:mga0rr50_8805_c1 | 3300050513 | Bacteria | 6297 |
| 1411 | nmdc:mga08x19_263580_c1 | 3300050514 | Bacteria | 1192 |
| 1412 | nmdc:mga0a205_422107_c1 | 3300050515 | Bacteria | 1195 |
| 1413 | nmdc:mga0a205_437186_c1 | 3300050515 | Bacteria | 1169 |
| 1414 | nmdc:mga0a205_45460_c1 | 3300050515 | Bacteria | 4233 |
| 1415 | nmdc:mga0a205_79219_c1 | 3300050515 | Bacteria | 3174 |
| 1416 | Ga0495601_0012404 | 3300053077 | Bacteria | 5113 |
| 1417 | Ga0495601_0802424 | 3300053077 | Bacteria | 597 |
| 1418 | Ga0495612_0000369 | 3300053078 | Bacteria | 18070 |
| 1419 | Ga0495612_0206867 | 3300053078 | Bacteria | 867 |
| 1420 | Ga0500635_0043732 | 3300053080 | Bacteria | 1508 |
| 1421 | Ga0495655_0013664 | 3300053083 | Bacteria | 1685 |
| 1422 | Ga0495655_0070854 | 3300053083 | Bacteria | 974 |
| 1423 | Ga0495655_0076526 | 3300053083 | Bacteria | 947 |
| 1424 | Ga0495655_0081252 | 3300053083 | Bacteria | 927 |
| 1425 | Ga0495655_0184972 | 3300053083 | Bacteria | 674 |
| 1426 | Ga0495619_0520861 | 3300053085 | Bacteria | 817 |
| 1427 | Ga0495619_0850472 | 3300053085 | Bacteria | 615 |
| 1428 | Ga0500578_0031166 | 3300053086 | Bacteria | 3427 |
| 1429 | Ga0500646_0001595 | 3300053090 | Bacteria | 5980 |
| 1430 | Ga0500647_0134902 | 3300053091 | Bacteria | 1162 |
| 1431 | Ga0500583_0494023 | 3300053092 | Bacteria | 576 |
| 1432 | Ga0500566_0013377 | 3300053094 | Bacteria | 4833 |
| 1433 | Ga0500566_0019815 | 3300053094 | Bacteria | 3950 |
| 1434 | Ga0500640_001894 | 3300053095 | Bacteria | 6655 |
| 1435 | Ga0500554_000753 | 3300053102 | Bacteria | 6518 |
| 1436 | Ga0500562_177093 | 3300053108 | Bacteria | 579 |
| 1437 | Ga0500572_001298 | 3300053111 | Bacteria | 6986 |
| 1438 | Ga0500595_001095 | 3300053119 | Bacteria | 15031 |
| 1439 | Ga0500597_104891 | 3300053120 | Bacteria | 1228 |
| 1440 | Ga0500597_316777 | 3300053120 | Bacteria | 617 |
| 1441 | Ga0500607_119755 | 3300053121 | Bacteria | 1276 |
| 1442 | Ga0500614_002285 | 3300053123 | Bacteria | 4308 |
| 1443 | Ga0500614_010281 | 3300053123 | Bacteria | 2007 |
| 1444 | Ga0500642_0010056 | 3300053130 | Bacteria | 3319 |
| 1445 | Ga0500559_0045200 | 3300053136 | Bacteria | 1927 |
| 1446 | Ga0500568_0019599 | 3300053139 | Bacteria | 2937 |
| 1447 | Ga0500588_0024168 | 3300053146 | Bacteria | 1675 |
| 1448 | Ga0500603_005211 | 3300053150 | Bacteria | 2790 |
| 1449 | Ga0500637_0137478 | 3300053178 | Bacteria | 1415 |
| 1450 | Ga0500601_003661 | 3300053737 | Bacteria | 1667 |
| 1451 | Ga0501084_0199550 | 3300054114 | Bacteria | 1688 |
| 1452 | Ga0500661_050840 | 3300055283 | Unclassified | 740 |
| 1453 | Ga0590074_024028 | 3300059423 | Bacteria | 1059 |
| 1454 | Ga0590075_042752 | 3300059424 | Bacteria | 1159 |
| 1455 | Ga0590077_155958 | 3300059426 | Bacteria | 547 |
| 1456 | Ga0587084_044913 | 3300059477 | Bacteria | 764 |
| 1457 | Ga0587084_046473 | 3300059477 | Bacteria | 755 |
| 1458 | Ga0587084_092526 | 3300059477 | Bacteria | 602 |
| 1459 | Ga0587084_093019 | 3300059477 | Bacteria | 601 |
| 1460 | Ga0587093_037022 | 3300059478 | Bacteria | 726 |
| 1461 | Ga0587066_016158 | 3300059490 | Bacteria | 1172 |
| 1462 | Ga0587066_211811 | 3300059490 | Bacteria | 515 |
| 1463 | Ga0587070_065532 | 3300059491 | Bacteria | 762 |
| 1464 | Ga0587070_095022 | 3300059491 | Bacteria | 677 |
| 1465 | Ga0587070_125430 | 3300059491 | Bacteria | 618 |
| 1466 | Ga0587070_128994 | 3300059491 | Bacteria | 613 |
| 1467 | Ga0587070_140264 | 3300059491 | Bacteria | 596 |
| 1468 | Ga0587073_0069057 | 3300059492 | Bacteria | 849 |
| 1469 | Ga0587073_0094173 | 3300059492 | Bacteria | 767 |
| 1470 | Ga0587073_0159272 | 3300059492 | Bacteria | 646 |
| 1471 | Ga0587073_0173419 | 3300059492 | Bacteria | 628 |
| 1472 | Ga0587073_0261005 | 3300059492 | Bacteria | 548 |
| 1473 | Ga0587077_030979 | 3300059493 | Bacteria | 1019 |
| 1474 | Ga0587077_145331 | 3300059493 | Bacteria | 615 |
| 1475 | Ga0587077_233956 | 3300059493 | Bacteria | 524 |
| 1476 | Ga0587077_240351 | 3300059493 | Bacteria | 519 |
| 1477 | Ga0587080_071212 | 3300059503 | Bacteria | 696 |
| 1478 | Ga0587082_058848 | 3300059504 | Bacteria | 753 |
| 1479 | Ga0587082_098908 | 3300059504 | Bacteria | 633 |
| 1480 | Ga0587082_106949 | 3300059504 | Bacteria | 617 |
| 1481 | Ga0587082_131332 | 3300059504 | Bacteria | 575 |
| 1482 | Ga0587082_142610 | 3300059504 | Bacteria | 560 |
| 1483 | Ga0587083_0018038 | 3300059505 | Bacteria | 1271 |
| 1484 | Ga0587083_0033850 | 3300059505 | Bacteria | 1033 |
| 1485 | Ga0587083_0096572 | 3300059505 | Bacteria | 729 |
| 1486 | Ga0587083_0110869 | 3300059505 | Bacteria | 697 |
| 1487 | Ga0587083_0149597 | 3300059505 | Bacteria | 629 |
| 1488 | Ga0587083_0222296 | 3300059505 | Unclassified | 550 |
| 1489 | Ga0587085_015683 | 3300059506 | Bacteria | 1086 |
| 1490 | Ga0587085_091739 | 3300059506 | Bacteria | 628 |
| 1491 | Ga0587085_135702 | 3300059506 | Bacteria | 554 |
| 1492 | Ga0587085_145523 | 3300059506 | Bacteria | 542 |
| 1493 | Ga0587088_026663 | 3300059508 | Bacteria | 1005 |
| 1494 | Ga0587088_028995 | 3300059508 | Bacteria | 977 |
| 1495 | Ga0587088_045695 | 3300059508 | Unclassified | 841 |
| 1496 | Ga0587088_181181 | 3300059508 | Bacteria | 528 |
| 1497 | Ga0587089_068176 | 3300059509 | Bacteria | 600 |
| 1498 | Ga0587090_054846 | 3300059510 | Bacteria | 741 |
| 1499 | Ga0587090_081700 | 3300059510 | Bacteria | 648 |
| 1500 | Ga0587090_169179 | 3300059510 | Unclassified | 506 |
| 1501 | Ga0587091_077589 | 3300059511 | Bacteria | 739 |
| 1502 | Ga0587091_103448 | 3300059511 | Bacteria | 671 |
| 1503 | Ga0587091_126610 | 3300059511 | Bacteria | 626 |
| 1504 | Ga0587091_169527 | 3300059511 | Bacteria | 567 |
| 1505 | Ga0587092_065416 | 3300059512 | Bacteria | 689 |
| 1506 | Ga0587092_165766 | 3300059512 | Bacteria | 502 |
| 1507 | Ga0587094_089861 | 3300059513 | Bacteria | 580 |
| 1508 | Ga0587095_018844 | 3300059514 | Bacteria | 649 |
| 1509 | Ga0587097_05180 | 3300059603 | Bacteria | 606 |
| 1510 | Ga0587098_018025 | 3300059604 | Bacteria | 871 |
| 1511 | Ga0587098_020782 | 3300059604 | Bacteria | 832 |
| 1512 | Ga0587106_023859 | 3300059605 | Bacteria | 931 |
| 1513 | Ga0587106_081286 | 3300059605 | Bacteria | 632 |
| 1514 | Ga0587106_089576 | 3300059605 | Bacteria | 612 |
| 1515 | Ga0587106_112462 | 3300059605 | Bacteria | 569 |
| 1516 | Ga0587106_121566 | 3300059605 | Bacteria | 555 |
| 1517 | Ga0587106_129945 | 3300059605 | Bacteria | 543 |
| 1518 | Ga0587129_017342 | 3300059608 | Bacteria | 614 |
| 1519 | Ga0587099_007630 | 3300059622 | Bacteria | 1026 |
| 1520 | Ga0587101_050694 | 3300059623 | Bacteria | 714 |
| 1521 | Ga0587115_116519 | 3300059626 | Bacteria | 510 |
| 1522 | Ga0587117_052156 | 3300059627 | Bacteria | 682 |
| 1523 | Ga0587122_004333 | 3300059628 | Bacteria | 1142 |
| 1524 | Ga0587122_020432 | 3300059628 | Bacteria | 716 |
| 1525 | Ga0587128_026561 | 3300059630 | Bacteria | 930 |
| 1526 | Ga0587128_029373 | 3300059630 | Bacteria | 901 |
| 1527 | Ga0587128_044943 | 3300059630 | Bacteria | 786 |
| 1528 | Ga0587128_079359 | 3300059630 | Bacteria | 654 |
| 1529 | Ga0587128_105903 | 3300059630 | Bacteria | 595 |
| 1530 | Ga0587130_054665 | 3300059631 | Bacteria | 506 |
| 1531 | Ga0587062_057141 | 3300059639 | Bacteria | 675 |
| 1532 | Ga0587062_059546 | 3300059639 | Bacteria | 667 |
| 1533 | Ga0587067_010025 | 3300059640 | Bacteria | 1427 |
| 1534 | Ga0587067_051321 | 3300059640 | Bacteria | 835 |
| 1535 | Ga0587067_055304 | 3300059640 | Bacteria | 816 |
| 1536 | Ga0587067_097813 | 3300059640 | Bacteria | 675 |
| 1537 | Ga0587067_122607 | 3300059640 | Bacteria | 626 |
| 1538 | Ga0587067_122738 | 3300059640 | Bacteria | 625 |
| 1539 | Ga0587067_135607 | 3300059640 | Bacteria | 605 |
| 1540 | Ga0587067_148294 | 3300059640 | Bacteria | 587 |
| 1541 | Ga0587067_221353 | 3300059640 | Bacteria | 513 |
| 1542 | Ga0587068_067249 | 3300059641 | Bacteria | 700 |
| 1543 | Ga0587068_077366 | 3300059641 | Bacteria | 666 |
| 1544 | Ga0587068_097582 | 3300059641 | Bacteria | 613 |
| 1545 | Ga0587068_163235 | 3300059641 | Bacteria | 511 |
| 1546 | Ga0587068_166675 | 3300059641 | Bacteria | 507 |
| 1547 | Ga0587069_015201 | 3300059642 | Bacteria | 1084 |
| 1548 | Ga0587069_063646 | 3300059642 | Bacteria | 685 |
| 1549 | Ga0587069_073056 | 3300059642 | Bacteria | 655 |
| 1550 | Ga0587072_060947 | 3300059643 | Bacteria | 777 |
| 1551 | Ga0587072_062989 | 3300059643 | Bacteria | 768 |
| 1552 | Ga0587072_112016 | 3300059643 | Bacteria | 624 |
| 1553 | Ga0587075_068501 | 3300059644 | Bacteria | 655 |
| 1554 | Ga0587076_091573 | 3300059645 | Bacteria | 665 |
| 1555 | Ga0587076_164397 | 3300059645 | Bacteria | 548 |
| 1556 | Ga0587076_201425 | 3300059645 | Bacteria | 512 |
| 1557 | Ga0587079_047232 | 3300059647 | Bacteria | 891 |
| 1558 | Ga0587079_053478 | 3300059647 | Bacteria | 854 |
| 1559 | Ga0587079_067618 | 3300059647 | Bacteria | 789 |
| 1560 | Ga0587079_080061 | 3300059647 | Bacteria | 745 |
| 1561 | Ga0587079_187115 | 3300059647 | Bacteria | 558 |
| 1562 | Ga0587079_225766 | 3300059647 | Bacteria | 522 |
| 1563 | Ga0587102_026339 | 3300059649 | Bacteria | 687 |
| 1564 | Ga0587102_029372 | 3300059649 | Bacteria | 664 |
| 1565 | Ga0587105_012645 | 3300059651 | Bacteria | 664 |
| 1566 | Ga0587107_027459 | 3300059652 | Bacteria | 843 |
| 1567 | Ga0587107_039534 | 3300059652 | Bacteria | 756 |
| 1568 | Ga0587114_045530 | 3300059655 | Bacteria | 726 |
| 1569 | Ga0587114_114909 | 3300059655 | Bacteria | 539 |
| 1570 | Ga0587111_0057452 | 3300060346 | Bacteria | 875 |
| 1571 | Ga0587111_0108606 | 3300060346 | Bacteria | 700 |
| 1572 | Ga0587111_0122459 | 3300060346 | Bacteria | 671 |
| 1573 | Ga0587111_0262553 | 3300060346 | Bacteria | 515 |
| 1574 | Ga0501082_0293905 | 3300060353 | Bacteria | 1414 |
| 1575 | Ga0501082_1757257 | 3300060353 | Bacteria | 541 |
| 1576 | Ga0466962_0009693 | 3300061719 | Bacteria | 4620 |
| 1577 | Ga0466962_0095353 | 3300061719 | Bacteria | 1426 |
| 1578 | Ga0530510_0018622 | 3300061734 | Bacteria | 4923 |
| 1579 | Ga0530510_0539437 | 3300061734 | Bacteria | 885 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049535 | Ga0501319_010979 | Ga0501319_010979_291_638 | 104 |
| 2 | 3300047673 | Ga0495593_0211509 | Ga0495593_0211509_629_949 | 106 |
| 3 | 3300048088 | Ga0495602_0227893 | Ga0495602_0227893_1069_1389 | 106 |
| 4 | 3300037068 | Ga0373925_0205941 | Ga0373925_0205941_17_343 | 108 |
| 5 | 3300048918 | Ga0496115_1001885 | Ga0496115_1001885_17_343 | 108 |
| 6 | 3300049130 | Ga0501310_081916 | Ga0501310_081916_19_348 | 109 |
| 7 | 3300049549 | Ga0501333_005400 | Ga0501333_005400_465_800 | 111 |
| 8 | 3300011119 | Ga0105246_11188359 | Ga0105246_111883592 | 113 |
| 9 | 3300001990 | JGI24737J22298_10084652 | JGI24737J22298_100846522 | 114 |
| 10 | 3300044683 | Ga0466965_0367471 | Ga0466965_0367471_420_764 | 114 |
| 11 | 3300009553 | Ga0105249_11172973 | Ga0105249_111729732 | 117 |
| 12 | 3300025901 | Ga0207688_10765419 | Ga0207688_107654192 | 117 |
| 13 | 3300041496 | Ga0451839_0224422 | Ga0451839_0224422_10_363 | 117 |
| 14 | 3300044683 | Ga0466965_0160930 | Ga0466965_0160930_809_1162 | 117 |
| 15 | 3300049527 | Ga0501311_067482 | Ga0501311_067482_220_573 | 117 |
| 16 | 3300049534 | Ga0501318_045465 | Ga0501318_045465_271_624 | 117 |
| 17 | 3300049534 | Ga0501318_072171 | Ga0501318_072171_13_366 | 117 |
| 18 | 3300049568 | Ga0501031_0809550 | Ga0501031_0809550_20_373 | 117 |
| 19 | 3300049573 | Ga0501037_0890738 | Ga0501037_0890738_13_366 | 117 |
| 20 | 3300049586 | Ga0501070_1265138 | Ga0501070_1265138_200_553 | 117 |
| 21 | 3300048909 | Ga0496106_0253408 | Ga0496106_0253408_1025_1396 | 122 |
| 22 | 3300013297 | Ga0157378_10098811 | Ga0157378_100988115 | 123 |
| 23 | 3300014745 | Ga0157377_11083124 | Ga0157377_110831242 | 123 |
| 24 | 3300039450 | Ga0436363_0783584 | Ga0436363_0783584_614_985 | 123 |
| 25 | 3300041496 | Ga0451839_1373717 | Ga0451839_1373717_153_524 | 123 |
| 26 | 3300045049 | Ga0466959_0379434 | Ga0466959_0379434_310_681 | 123 |
| 27 | 3300046454 | Ga0495592_0278055 | Ga0495592_0278055_313_684 | 123 |
| 28 | 3300046459 | Ga0495629_0228749 | Ga0495629_0228749_174_545 | 123 |
| 29 | 3300046462 | Ga0495651_0208618 | Ga0495651_0208618_29_400 | 123 |
| 30 | 3300046462 | Ga0495651_0290830 | Ga0495651_0290830_600_971 | 123 |
| 31 | 3300046511 | Ga0495608_0482999 | Ga0495608_0482999_300_671 | 123 |
| 32 | 3300046533 | Ga0495640_0391021 | Ga0495640_0391021_61_432 | 123 |
| 33 | 3300046536 | Ga0495587_0068002 | Ga0495587_0068002_762_1133 | 123 |
| 34 | 3300046543 | Ga0495645_0056355 | Ga0495645_0056355_2287_2658 | 123 |
| 35 | 3300046559 | Ga0495667_0750782 | Ga0495667_0750782_116_487 | 123 |
| 36 | 3300046663 | Ga0495635_0458442 | Ga0495635_0458442_159_530 | 123 |
| 37 | 3300046663 | Ga0495635_0862179 | Ga0495635_0862179_140_511 | 123 |
| 38 | 3300046679 | Ga0495623_0205792 | Ga0495623_0205792_90_461 | 123 |
| 39 | 3300047317 | Ga0495604_0139930 | Ga0495604_0139930_489_860 | 123 |
| 40 | 3300047444 | Ga0495675_0094566 | Ga0495675_0094566_1254_1625 | 123 |
| 41 | 3300047471 | Ga0495684_0388357 | Ga0495684_0388357_580_951 | 123 |
| 42 | 3300048088 | Ga0495602_0160403 | Ga0495602_0160403_253_624 | 123 |
| 43 | 3300004799 | Ga0058863_10080674 | Ga0058863_100806742 | 130 |
| 44 | 3300004799 | Ga0058863_11960175 | Ga0058863_119601753 | 130 |
| 45 | 3300004799 | Ga0058863_11973879 | Ga0058863_119738793 | 130 |
| 46 | 3300004800 | Ga0058861_12059017 | Ga0058861_120590172 | 130 |
| 47 | 3300004803 | Ga0058862_10148086 | Ga0058862_101480863 | 130 |
| 48 | 3300004803 | Ga0058862_10173070 | Ga0058862_101730702 | 130 |
| 49 | 3300004803 | Ga0058862_12848635 | Ga0058862_128486351 | 130 |
| 50 | 3300005329 | Ga0070683_100052331 | Ga0070683_1000523317 | 130 |
| 51 | 3300005330 | Ga0070690_100626478 | Ga0070690_1006264782 | 130 |
| 52 | 3300005335 | Ga0070666_11480973 | Ga0070666_114809731 | 130 |
| 53 | 3300005336 | Ga0070680_100571527 | Ga0070680_1005715273 | 130 |
| 54 | 3300005456 | Ga0070678_100104611 | Ga0070678_1001046112 | 130 |
| 55 | 3300005458 | Ga0070681_10167503 | Ga0070681_101675035 | 130 |
| 56 | 3300005458 | Ga0070681_10263195 | Ga0070681_102631953 | 130 |
| 57 | 3300005530 | Ga0070679_100061371 | Ga0070679_1000613712 | 130 |
| 58 | 3300005530 | Ga0070679_100281248 | Ga0070679_1002812482 | 130 |
| 59 | 3300005530 | Ga0070679_100854135 | Ga0070679_1008541352 | 130 |
| 60 | 3300005530 | Ga0070679_101105160 | Ga0070679_1011051602 | 130 |
| 61 | 3300005535 | Ga0070684_100056012 | Ga0070684_1000560123 | 130 |
| 62 | 3300005539 | Ga0068853_102212591 | Ga0068853_1022125911 | 130 |
| 63 | 3300005544 | Ga0070686_100134832 | Ga0070686_1001348324 | 130 |
| 64 | 3300005563 | Ga0068855_100253211 | Ga0068855_1002532113 | 130 |
| 65 | 3300005577 | Ga0068857_100229760 | Ga0068857_1002297603 | 130 |
| 66 | 3300005614 | Ga0068856_100299899 | Ga0068856_1002998993 | 130 |
| 67 | 3300005618 | Ga0068864_100502352 | Ga0068864_1005023523 | 130 |
| 68 | 3300005718 | Ga0068866_10085681 | Ga0068866_100856814 | 130 |
| 69 | 3300006175 | Ga0070712_101806742 | Ga0070712_1018067421 | 130 |
| 70 | 3300006871 | Ga0075434_100037786 | Ga0075434_1000377868 | 130 |
| 71 | 3300006881 | Ga0068865_101783039 | Ga0068865_1017830392 | 130 |
| 72 | 3300006914 | Ga0075436_100068380 | Ga0075436_1000683802 | 130 |
| 73 | 3300007076 | Ga0075435_100124548 | Ga0075435_1001245484 | 130 |
| 74 | 3300009093 | Ga0105240_10653742 | Ga0105240_106537422 | 130 |
| 75 | 3300009098 | Ga0105245_12179872 | Ga0105245_121798722 | 130 |
| 76 | 3300009147 | Ga0114129_10069437 | Ga0114129_100694371 | 130 |
| 77 | 3300009545 | Ga0105237_10727930 | Ga0105237_107279302 | 130 |
| 78 | 3300010375 | Ga0105239_10670675 | Ga0105239_106706753 | 130 |
| 79 | 3300013105 | Ga0157369_10273564 | Ga0157369_102735643 | 130 |
| 80 | 3300014325 | Ga0163163_10207803 | Ga0163163_102078032 | 130 |
| 81 | 3300020070 | Ga0206356_10919035 | Ga0206356_109190351 | 130 |
| 82 | 3300020078 | Ga0206352_10502868 | Ga0206352_105028682 | 130 |
| 83 | 3300020082 | Ga0206353_10441693 | Ga0206353_104416933 | 130 |
| 84 | 3300025909 | Ga0207705_10121307 | Ga0207705_101213073 | 130 |
| 85 | 3300025912 | Ga0207707_10778780 | Ga0207707_107787802 | 130 |
| 86 | 3300025917 | Ga0207660_10263503 | Ga0207660_102635033 | 130 |
| 87 | 3300025917 | Ga0207660_10504940 | Ga0207660_105049403 | 130 |
| 88 | 3300025921 | Ga0207652_10035128 | Ga0207652_100351282 | 130 |
| 89 | 3300025921 | Ga0207652_10130550 | Ga0207652_101305503 | 130 |
| 90 | 3300025921 | Ga0207652_10545492 | Ga0207652_105454922 | 130 |
| 91 | 3300025944 | Ga0207661_10045956 | Ga0207661_100459567 | 130 |
| 92 | 3300025949 | Ga0207667_10237666 | Ga0207667_102376663 | 130 |
| 93 | 3300026078 | Ga0207702_10090640 | Ga0207702_100906405 | 130 |
| 94 | 3300026095 | Ga0207676_10449587 | Ga0207676_104495873 | 130 |
| 95 | 3300026116 | Ga0207674_10059872 | Ga0207674_100598723 | 130 |
| 96 | 3300026121 | Ga0207683_10034774 | Ga0207683_100347747 | 130 |
| 97 | 3300036457 | Ga0265778_052958 | Ga0265778_052958_49_441 | 130 |
| 98 | 3300039447 | Ga0436361_0938094 | Ga0436361_0938094_32_424 | 130 |
| 99 | 3300041456 | Ga0451795_0406964 | Ga0451795_0406964_236_628 | 130 |
| 100 | 3300044693 | Ga0466961_0237936 | Ga0466961_0237936_164_556 | 130 |
| 101 | 3300044693 | Ga0466961_0476411 | Ga0466961_0476411_309_701 | 130 |
| 102 | 3300044842 | Ga0466957_0365487 | Ga0466957_0365487_546_938 | 130 |
| 103 | 3300046516 | Ga0495628_0443878 | Ga0495628_0443878_73_465 | 130 |
| 104 | 3300046680 | Ga0495646_0375651 | Ga0495646_0375651_54_446 | 130 |
| 105 | 3300048911 | Ga0496108_1415106 | Ga0496108_1415106_40_432 | 130 |
| 106 | 3300048911 | Ga0496108_1443855 | Ga0496108_1443855_38_430 | 130 |
| 107 | 3300048916 | Ga0496113_0965049 | Ga0496113_0965049_33_425 | 130 |
| 108 | 3300048918 | Ga0496115_1234758 | Ga0496115_1234758_134_526 | 130 |
| 109 | 3300050507 | nmdc:mga05p37_281818_c1 | nmdc:mga05p37_281818_c1_27_419 | 130 |
| 110 | 3300050512 | nmdc:mga0n895_11252_c1 | nmdc:mga0n895_11252_c1_402_794 | 130 |
| 111 | 3300050513 | nmdc:mga0rr50_8805_c1 | nmdc:mga0rr50_8805_c1_1708_2100 | 130 |
| 112 | 3300050514 | nmdc:mga08x19_263580_c1 | nmdc:mga08x19_263580_c1_371_763 | 130 |
| 113 | 3300050515 | nmdc:mga0a205_45460_c1 | nmdc:mga0a205_45460_c1_70_462 | 130 |
| 114 | 3300001979 | JGI24740J21852_10002914 | JGI24740J21852_1000291412 | 131 |
| 115 | 3300002076 | JGI24749J21850_1034758 | JGI24749J21850_10347583 | 131 |
| 116 | 3300005354 | Ga0070675_100049635 | Ga0070675_1000496355 | 131 |
| 117 | 3300005365 | Ga0070688_100011350 | Ga0070688_1000113504 | 131 |
| 118 | 3300005367 | Ga0070667_100456329 | Ga0070667_1004563291 | 131 |
| 119 | 3300005437 | Ga0070710_10113037 | Ga0070710_101130372 | 131 |
| 120 | 3300005440 | Ga0070705_101041823 | Ga0070705_1010418232 | 131 |
| 121 | 3300005441 | Ga0070700_102015478 | Ga0070700_1020154781 | 131 |
| 122 | 3300005466 | Ga0070685_10001772 | Ga0070685_1000177218 | 131 |
| 123 | 3300005577 | Ga0068857_102158402 | Ga0068857_1021584022 | 131 |
| 124 | 3300005617 | Ga0068859_100857652 | Ga0068859_1008576522 | 131 |
| 125 | 3300005840 | Ga0068870_11233735 | Ga0068870_112337352 | 131 |
| 126 | 3300005981 | Ga0081538_10134898 | Ga0081538_101348982 | 131 |
| 127 | 3300006038 | Ga0075365_10112993 | Ga0075365_101129932 | 131 |
| 128 | 3300006038 | Ga0075365_10426387 | Ga0075365_104263872 | 131 |
| 129 | 3300006038 | Ga0075365_10934141 | Ga0075365_109341411 | 131 |
| 130 | 3300006048 | Ga0075363_100041450 | Ga0075363_1000414504 | 131 |
| 131 | 3300006051 | Ga0075364_10093604 | Ga0075364_100936043 | 131 |
| 132 | 3300006051 | Ga0075364_10744486 | Ga0075364_107444862 | 131 |
| 133 | 3300006051 | Ga0075364_11053629 | Ga0075364_110536291 | 131 |
| 134 | 3300006178 | Ga0075367_10035159 | Ga0075367_100351597 | 131 |
| 135 | 3300006881 | Ga0068865_100820322 | Ga0068865_1008203222 | 131 |
| 136 | 3300006931 | Ga0097620_100857797 | Ga0097620_1008577972 | 131 |
| 137 | 3300009094 | Ga0111539_10091686 | Ga0111539_100916863 | 131 |
| 138 | 3300009098 | Ga0105245_10000528 | Ga0105245_1000052832 | 131 |
| 139 | 3300009101 | Ga0105247_10000064 | Ga0105247_10000064117 | 131 |
| 140 | 3300009176 | Ga0105242_10003277 | Ga0105242_100032779 | 131 |
| 141 | 3300010375 | Ga0105239_10189923 | Ga0105239_101899233 | 131 |
| 142 | 3300013105 | Ga0157369_10000068 | Ga0157369_10000068140 | 131 |
| 143 | 3300013297 | Ga0157378_10087024 | Ga0157378_100870244 | 131 |
| 144 | 3300014969 | Ga0157376_10187306 | Ga0157376_101873062 | 131 |
| 145 | 3300014969 | Ga0157376_10347270 | Ga0157376_103472703 | 131 |
| 146 | 3300025898 | Ga0207692_10082034 | Ga0207692_100820344 | 131 |
| 147 | 3300025900 | Ga0207710_10000220 | Ga0207710_1000022043 | 131 |
| 148 | 3300025926 | Ga0207659_10075587 | Ga0207659_100755874 | 131 |
| 149 | 3300025927 | Ga0207687_10000025 | Ga0207687_1000002524 | 131 |
| 150 | 3300025934 | Ga0207686_10001614 | Ga0207686_1000161416 | 131 |
| 151 | 3300025938 | Ga0207704_10489642 | Ga0207704_104896422 | 131 |
| 152 | 3300025986 | Ga0207658_10367480 | Ga0207658_103674802 | 131 |
| 153 | 3300028556 | Ga0265337_1000032 | Ga0265337_100003222 | 131 |
| 154 | 3300028558 | Ga0265326_10000040 | Ga0265326_1000004019 | 131 |
| 155 | 3300028563 | Ga0265319_1000030 | Ga0265319_100003048 | 131 |
| 156 | 3300028563 | Ga0265319_1134426 | Ga0265319_11344262 | 131 |
| 157 | 3300028653 | Ga0265323_10164080 | Ga0265323_101640801 | 131 |
| 158 | 3300028654 | Ga0265322_10000012 | Ga0265322_1000001242 | 131 |
| 159 | 3300028654 | Ga0265322_10010968 | Ga0265322_100109684 | 131 |
| 160 | 3300028666 | Ga0265336_10034584 | Ga0265336_100345842 | 131 |
| 161 | 3300028800 | Ga0265338_10000156 | Ga0265338_1000015648 | 131 |
| 162 | 3300028800 | Ga0265338_10231483 | Ga0265338_102314832 | 131 |
| 163 | 3300029957 | Ga0265324_10017099 | Ga0265324_100170996 | 131 |
| 164 | 3300029957 | Ga0265324_10039877 | Ga0265324_100398774 | 131 |
| 165 | 3300031238 | Ga0265332_10020220 | Ga0265332_100202203 | 131 |
| 166 | 3300031239 | Ga0265328_10002899 | Ga0265328_1000289912 | 131 |
| 167 | 3300031240 | Ga0265320_10000001 | Ga0265320_10000001742 | 131 |
| 168 | 3300031241 | Ga0265325_10024792 | Ga0265325_100247926 | 131 |
| 169 | 3300031242 | Ga0265329_10000919 | Ga0265329_1000091918 | 131 |
| 170 | 3300031249 | Ga0265339_10008172 | Ga0265339_1000817210 | 131 |
| 171 | 3300031249 | Ga0265339_10225767 | Ga0265339_102257671 | 131 |
| 172 | 3300031250 | Ga0265331_10001467 | Ga0265331_1000146718 | 131 |
| 173 | 3300031251 | Ga0265327_10000003 | Ga0265327_10000003742 | 131 |
| 174 | 3300031344 | Ga0265316_10003567 | Ga0265316_1000356711 | 131 |
| 175 | 3300031595 | Ga0265313_10055372 | Ga0265313_100553722 | 131 |
| 176 | 3300031691 | Ga0316579_10287984 | Ga0316579_102879841 | 131 |
| 177 | 3300031711 | Ga0265314_10000178 | Ga0265314_1000017849 | 131 |
| 178 | 3300031712 | Ga0265342_10000027 | Ga0265342_10000027142 | 131 |
| 179 | 3300031712 | Ga0265342_10232963 | Ga0265342_102329632 | 131 |
| 180 | 3300031727 | Ga0316576_10799457 | Ga0316576_107994572 | 131 |
| 181 | 3300031728 | Ga0316578_10414904 | Ga0316578_104149043 | 131 |
| 182 | 3300032133 | Ga0316583_10235943 | Ga0316583_102359432 | 131 |
| 183 | 3300035398 | Ga0316574_0033631 | Ga0316574_0033631_1525_1920 | 131 |
| 184 | 3300035398 | Ga0316574_0408493 | Ga0316574_0408493_50_445 | 131 |
| 185 | 3300036647 | Ga0316582_0390143 | Ga0316582_0390143_554_949 | 131 |
| 186 | 3300036712 | Ga0316584_0028035 | Ga0316584_0028035_1138_1533 | 131 |
| 187 | 3300042876 | Ga0451577_0179447 | Ga0451577_0179447_475_870 | 131 |
| 188 | 3300044712 | Ga0453684_0048627 | Ga0453684_0048627_2076_2471 | 131 |
| 189 | 3300046455 | Ga0495603_0001557 | Ga0495603_0001557_12939_13334 | 131 |
| 190 | 3300046463 | Ga0495653_0048075 | Ga0495653_0048075_1374_1769 | 131 |
| 191 | 3300046463 | Ga0495653_0244336 | Ga0495653_0244336_650_1045 | 131 |
| 192 | 3300046529 | Ga0495652_0395835 | Ga0495652_0395835_300_695 | 131 |
| 193 | 3300046559 | Ga0495667_0000067 | Ga0495667_0000067_46494_46889 | 131 |
| 194 | 3300046689 | Ga0495613_0278464 | Ga0495613_0278464_387_782 | 131 |
| 195 | 3300047322 | Ga0495680_0009089 | Ga0495680_0009089_7421_7816 | 131 |
| 196 | 3300047322 | Ga0495680_0009545 | Ga0495680_0009545_1454_1849 | 131 |
| 197 | 3300048907 | Ga0496104_0000029 | Ga0496104_0000029_187698_188093 | 131 |
| 198 | 3300048907 | Ga0496104_0043241 | Ga0496104_0043241_208_603 | 131 |
| 199 | 3300048908 | Ga0496105_0000002 | Ga0496105_0000002_187698_188093 | 131 |
| 200 | 3300048908 | Ga0496105_0000070 | Ga0496105_0000070_61455_61850 | 131 |
| 201 | 3300048918 | Ga0496115_0002589 | Ga0496115_0002589_3828_4223 | 131 |
| 202 | 3300048922 | Ga0496119_0008336 | Ga0496119_0008336_8438_8833 | 131 |
| 203 | 3300049569 | Ga0501032_0348779 | Ga0501032_0348779_235_630 | 131 |
| 204 | 3300049571 | Ga0501034_0204107 | Ga0501034_0204107_135_530 | 131 |
| 205 | 3300049572 | Ga0501036_0259796 | Ga0501036_0259796_924_1319 | 131 |
| 206 | 3300049574 | Ga0501038_0251709 | Ga0501038_0251709_351_746 | 131 |
| 207 | 3300049581 | Ga0501047_0245971 | Ga0501047_0245971_446_841 | 131 |
| 208 | 3300049823 | Ga0501044_0095711 | Ga0501044_0095711_1625_2020 | 131 |
| 209 | 3300050491 | nmdc:mga00v17_287450_c1 | nmdc:mga00v17_287450_c1_428_823 | 131 |
| 210 | 3300050491 | nmdc:mga00v17_536524_c1 | nmdc:mga00v17_536524_c1_330_725 | 131 |
| 211 | 3300050492 | nmdc:mga0yw44_10371_c1 | nmdc:mga0yw44_10371_c1_1441_1836 | 131 |
| 212 | 3300050492 | nmdc:mga0yw44_89792_c1 | nmdc:mga0yw44_89792_c1_282_677 | 131 |
| 213 | 3300050492 | nmdc:mga0yw44_90414_c1 | nmdc:mga0yw44_90414_c1_1371_1766 | 131 |
| 214 | 3300050494 | nmdc:mga06z11_16397_c1 | nmdc:mga06z11_16397_c1_415_810 | 131 |
| 215 | 3300050511 | nmdc:mga08y16_44244_c1 | nmdc:mga08y16_44244_c1_3543_3938 | 131 |
| 216 | 3300050515 | nmdc:mga0a205_437186_c1 | nmdc:mga0a205_437186_c1_558_953 | 131 |
| 217 | 3300053077 | Ga0495601_0012404 | Ga0495601_0012404_1000_1395 | 131 |
| 218 | 3300053077 | Ga0495601_0802424 | Ga0495601_0802424_185_580 | 131 |
| 219 | 3300003577 | Ga0007416J51690_1053647 | Ga0007416J51690_10536473 | 132 |
| 220 | 3300004798 | Ga0058859_10022019 | Ga0058859_100220192 | 132 |
| 221 | 3300004798 | Ga0058859_10049905 | Ga0058859_100499054 | 132 |
| 222 | 3300004798 | Ga0058859_10122077 | Ga0058859_101220771 | 132 |
| 223 | 3300004799 | Ga0058863_11849541 | Ga0058863_118495413 | 132 |
| 224 | 3300004801 | Ga0058860_10014153 | Ga0058860_100141532 | 132 |
| 225 | 3300004801 | Ga0058860_10174803 | Ga0058860_101748033 | 132 |
| 226 | 3300005330 | Ga0070690_100010654 | Ga0070690_1000106542 | 132 |
| 227 | 3300005330 | Ga0070690_100163789 | Ga0070690_1001637893 | 132 |
| 228 | 3300005334 | Ga0068869_100128198 | Ga0068869_1001281982 | 132 |
| 229 | 3300005337 | Ga0070682_101395667 | Ga0070682_1013956671 | 132 |
| 230 | 3300005340 | Ga0070689_100068670 | Ga0070689_1000686702 | 132 |
| 231 | 3300005340 | Ga0070689_100133287 | Ga0070689_1001332873 | 132 |
| 232 | 3300005343 | Ga0070687_100211976 | Ga0070687_1002119763 | 132 |
| 233 | 3300005343 | Ga0070687_100263666 | Ga0070687_1002636662 | 132 |
| 234 | 3300005345 | Ga0070692_10308495 | Ga0070692_103084953 | 132 |
| 235 | 3300005365 | Ga0070688_100201224 | Ga0070688_1002012242 | 132 |
| 236 | 3300005365 | Ga0070688_101588534 | Ga0070688_1015885341 | 132 |
| 237 | 3300005436 | Ga0070713_101745789 | Ga0070713_1017457891 | 132 |
| 238 | 3300005438 | Ga0070701_10612165 | Ga0070701_106121652 | 132 |
| 239 | 3300005440 | Ga0070705_100692028 | Ga0070705_1006920281 | 132 |
| 240 | 3300005441 | Ga0070700_100476139 | Ga0070700_1004761392 | 132 |
| 241 | 3300005535 | Ga0070684_100284704 | Ga0070684_1002847042 | 132 |
| 242 | 3300005549 | Ga0070704_100535073 | Ga0070704_1005350731 | 132 |
| 243 | 3300005615 | Ga0070702_100170116 | Ga0070702_1001701163 | 132 |
| 244 | 3300005615 | Ga0070702_100912812 | Ga0070702_1009128122 | 132 |
| 245 | 3300005618 | Ga0068864_100352015 | Ga0068864_1003520153 | 132 |
| 246 | 3300005719 | Ga0068861_100267705 | Ga0068861_1002677053 | 132 |
| 247 | 3300005840 | Ga0068870_10195990 | Ga0068870_101959902 | 132 |
| 248 | 3300005841 | Ga0068863_100869449 | Ga0068863_1008694493 | 132 |
| 249 | 3300005842 | Ga0068858_100581217 | Ga0068858_1005812171 | 132 |
| 250 | 3300005842 | Ga0068858_101339832 | Ga0068858_1013398322 | 132 |
| 251 | 3300005843 | Ga0068860_101889726 | Ga0068860_1018897261 | 132 |
| 252 | 3300005843 | Ga0068860_102778411 | Ga0068860_1027784111 | 132 |
| 253 | 3300005844 | Ga0068862_100628815 | Ga0068862_1006288152 | 132 |
| 254 | 3300005937 | Ga0081455_10143774 | Ga0081455_101437742 | 132 |
| 255 | 3300006028 | Ga0070717_10012633 | Ga0070717_1001263312 | 132 |
| 256 | 3300006028 | Ga0070717_10177795 | Ga0070717_101777951 | 132 |
| 257 | 3300006237 | Ga0097621_100233018 | Ga0097621_1002330182 | 132 |
| 258 | 3300006237 | Ga0097621_100749330 | Ga0097621_1007493302 | 132 |
| 259 | 3300006881 | Ga0068865_100107285 | Ga0068865_1001072853 | 132 |
| 260 | 3300007076 | Ga0075435_100890484 | Ga0075435_1008904842 | 132 |
| 261 | 3300007788 | Ga0099795_10066844 | Ga0099795_100668442 | 132 |
| 262 | 3300009098 | Ga0105245_11295828 | Ga0105245_112958283 | 132 |
| 263 | 3300009148 | Ga0105243_10698320 | Ga0105243_106983202 | 132 |
| 264 | 3300009177 | Ga0105248_11497626 | Ga0105248_114976262 | 132 |
| 265 | 3300009177 | Ga0105248_11680721 | Ga0105248_116807213 | 132 |
| 266 | 3300009553 | Ga0105249_10010014 | Ga0105249_1001001413 | 132 |
| 267 | 3300009553 | Ga0105249_10027935 | Ga0105249_100279357 | 132 |
| 268 | 3300010375 | Ga0105239_12320804 | Ga0105239_123208042 | 132 |
| 269 | 3300011119 | Ga0105246_10488611 | Ga0105246_104886112 | 132 |
| 270 | 3300013296 | Ga0157374_10129448 | Ga0157374_101294484 | 132 |
| 271 | 3300013296 | Ga0157374_10200275 | Ga0157374_102002753 | 132 |
| 272 | 3300013297 | Ga0157378_10093534 | Ga0157378_100935344 | 132 |
| 273 | 3300013297 | Ga0157378_11173485 | Ga0157378_111734852 | 132 |
| 274 | 3300013306 | Ga0163162_11452811 | Ga0163162_114528111 | 132 |
| 275 | 3300013306 | Ga0163162_12625921 | Ga0163162_126259211 | 132 |
| 276 | 3300014325 | Ga0163163_10275798 | Ga0163163_102757982 | 132 |
| 277 | 3300014325 | Ga0163163_10568416 | Ga0163163_105684162 | 132 |
| 278 | 3300014745 | Ga0157377_11408772 | Ga0157377_114087721 | 132 |
| 279 | 3300014968 | Ga0157379_10595549 | Ga0157379_105955491 | 132 |
| 280 | 3300014969 | Ga0157376_10696859 | Ga0157376_106968592 | 132 |
| 281 | 3300025908 | Ga0207643_10085658 | Ga0207643_100856583 | 132 |
| 282 | 3300025916 | Ga0207663_11631421 | Ga0207663_116314211 | 132 |
| 283 | 3300025918 | Ga0207662_10073909 | Ga0207662_100739094 | 132 |
| 284 | 3300025918 | Ga0207662_10290548 | Ga0207662_102905483 | 132 |
| 285 | 3300025918 | Ga0207662_10709232 | Ga0207662_107092322 | 132 |
| 286 | 3300025927 | Ga0207687_11258670 | Ga0207687_112586701 | 132 |
| 287 | 3300025935 | Ga0207709_10679271 | Ga0207709_106792711 | 132 |
| 288 | 3300025936 | Ga0207670_10040259 | Ga0207670_100402592 | 132 |
| 289 | 3300025936 | Ga0207670_10440251 | Ga0207670_104402512 | 132 |
| 290 | 3300025941 | Ga0207711_10369155 | Ga0207711_103691552 | 132 |
| 291 | 3300025941 | Ga0207711_10610825 | Ga0207711_106108253 | 132 |
| 292 | 3300025942 | Ga0207689_10273876 | Ga0207689_102738763 | 132 |
| 293 | 3300025961 | Ga0207712_10056246 | Ga0207712_100562462 | 132 |
| 294 | 3300025961 | Ga0207712_10438549 | Ga0207712_104385493 | 132 |
| 295 | 3300026035 | Ga0207703_10548517 | Ga0207703_105485171 | 132 |
| 296 | 3300026075 | Ga0207708_10160426 | Ga0207708_101604263 | 132 |
| 297 | 3300026088 | Ga0207641_10612313 | Ga0207641_106123132 | 132 |
| 298 | 3300026088 | Ga0207641_11218650 | Ga0207641_112186501 | 132 |
| 299 | 3300026088 | Ga0207641_11670822 | Ga0207641_116708221 | 132 |
| 300 | 3300026118 | Ga0207675_100284710 | Ga0207675_1002847103 | 132 |
| 301 | 3300026118 | Ga0207675_101110281 | Ga0207675_1011102812 | 132 |
| 302 | 3300028379 | Ga0268266_10960170 | Ga0268266_109601702 | 132 |
| 303 | 3300028380 | Ga0268265_10411284 | Ga0268265_104112843 | 132 |
| 304 | 3300028786 | Ga0307517_10533215 | Ga0307517_105332151 | 132 |
| 305 | 3300028794 | Ga0307515_10050803 | Ga0307515_100508036 | 132 |
| 306 | 3300030521 | Ga0307511_10115653 | Ga0307511_101156532 | 132 |
| 307 | 3300031238 | Ga0265332_10025924 | Ga0265332_100259242 | 132 |
| 308 | 3300031239 | Ga0265328_10029619 | Ga0265328_100296193 | 132 |
| 309 | 3300031344 | Ga0265316_10069538 | Ga0265316_100695385 | 132 |
| 310 | 3300031456 | Ga0307513_10011625 | Ga0307513_100116257 | 132 |
| 311 | 3300031507 | Ga0307509_10000112 | Ga0307509_1000011298 | 132 |
| 312 | 3300031507 | Ga0307509_10011836 | Ga0307509_100118366 | 132 |
| 313 | 3300031507 | Ga0307509_10342089 | Ga0307509_103420893 | 132 |
| 314 | 3300031507 | Ga0307509_10567741 | Ga0307509_105677412 | 132 |
| 315 | 3300031616 | Ga0307508_10019824 | Ga0307508_1001982414 | 132 |
| 316 | 3300031730 | Ga0307516_10029367 | Ga0307516_100293678 | 132 |
| 317 | 3300031901 | Ga0307406_10000446 | Ga0307406_1000044615 | 132 |
| 318 | 3300031901 | Ga0307406_10224195 | Ga0307406_102241952 | 132 |
| 319 | 3300031911 | Ga0307412_11257010 | Ga0307412_112570102 | 132 |
| 320 | 3300032002 | Ga0307416_100556809 | Ga0307416_1005568092 | 132 |
| 321 | 3300032126 | Ga0307415_100042962 | Ga0307415_1000429625 | 132 |
| 322 | 3300033179 | Ga0307507_10213939 | Ga0307507_102139392 | 132 |
| 323 | 3300034819 | Ga0373958_0069772 | Ga0373958_0069772_129_533 | 132 |
| 324 | 3300035089 | Ga0373944_0144151 | Ga0373944_0144151_346_750 | 132 |
| 325 | 3300035090 | Ga0373949_0000042 | Ga0373949_0000042_3961_4365 | 132 |
| 326 | 3300035113 | Ga0373936_0000006 | Ga0373936_0000006_126749_127153 | 132 |
| 327 | 3300035115 | Ga0373941_0104248 | Ga0373941_0104248_60_464 | 132 |
| 328 | 3300035118 | Ga0373954_0054565 | Ga0373954_0054565_352_756 | 132 |
| 329 | 3300035118 | Ga0373954_0186452 | Ga0373954_0186452_33_440 | 132 |
| 330 | 3300035119 | Ga0373956_0188630 | Ga0373956_0188630_232_636 | 132 |
| 331 | 3300035241 | Ga0373961_0000015 | Ga0373961_0000015_104506_104910 | 132 |
| 332 | 3300041503 | Ga0451847_0709139 | Ga0451847_0709139_231_629 | 132 |
| 333 | 3300044683 | Ga0466965_0146782 | Ga0466965_0146782_462_860 | 132 |
| 334 | 3300044693 | Ga0466961_0143493 | Ga0466961_0143493_709_1107 | 132 |
| 335 | 3300044694 | Ga0466963_1182892 | Ga0466963_1182892_21_419 | 132 |
| 336 | 3300044842 | Ga0466957_0068004 | Ga0466957_0068004_1373_1771 | 132 |
| 337 | 3300044842 | Ga0466957_1034381 | Ga0466957_1034381_131_529 | 132 |
| 338 | 3300045836 | Ga0466958_0218590 | Ga0466958_0218590_296_694 | 132 |
| 339 | 3300045976 | Ga0466967_0347328 | Ga0466967_0347328_359_757 | 132 |
| 340 | 3300046455 | Ga0495603_0660462 | Ga0495603_0660462_133_537 | 132 |
| 341 | 3300046519 | Ga0495632_0049233 | Ga0495632_0049233_1141_1545 | 132 |
| 342 | 3300046557 | Ga0495622_0275289 | Ga0495622_0275289_314_718 | 132 |
| 343 | 3300046660 | Ga0495625_0206025 | Ga0495625_0206025_671_1075 | 132 |
| 344 | 3300046694 | Ga0495649_0024919 | Ga0495649_0024919_737_1141 | 132 |
| 345 | 3300046694 | Ga0495649_0120320 | Ga0495649_0120320_451_855 | 132 |
| 346 | 3300047472 | Ga0495686_0016492 | Ga0495686_0016492_2668_3075 | 132 |
| 347 | 3300048088 | Ga0495602_0959830 | Ga0495602_0959830_27_425 | 132 |
| 348 | 3300048905 | Ga0496102_0162820 | Ga0496102_0162820_1095_1493 | 132 |
| 349 | 3300048911 | Ga0496108_0740512 | Ga0496108_0740512_182_580 | 132 |
| 350 | 3300049128 | Ga0501308_015639 | Ga0501308_015639_355_762 | 132 |
| 351 | 3300049571 | Ga0501034_0157313 | Ga0501034_0157313_422_826 | 132 |
| 352 | 3300049581 | Ga0501047_0608361 | Ga0501047_0608361_122_526 | 132 |
| 353 | 3300050513 | nmdc:mga0rr50_490015_c1 | nmdc:mga0rr50_490015_c1_117_521 | 132 |
| 354 | 3300053080 | Ga0500635_0043732 | Ga0500635_0043732_881_1285 | 132 |
| 355 | 3300053085 | Ga0495619_0850472 | Ga0495619_0850472_72_479 | 132 |
| 356 | 3300053086 | Ga0500578_0031166 | Ga0500578_0031166_883_1287 | 132 |
| 357 | 3300053090 | Ga0500646_0001595 | Ga0500646_0001595_3336_3740 | 132 |
| 358 | 3300053091 | Ga0500647_0134902 | Ga0500647_0134902_727_1131 | 132 |
| 359 | 3300053092 | Ga0500583_0494023 | Ga0500583_0494023_41_445 | 132 |
| 360 | 3300053094 | Ga0500566_0013377 | Ga0500566_0013377_4409_4813 | 132 |
| 361 | 3300053094 | Ga0500566_0019815 | Ga0500566_0019815_295_699 | 132 |
| 362 | 3300053095 | Ga0500640_001894 | Ga0500640_001894_368_772 | 132 |
| 363 | 3300053102 | Ga0500554_000753 | Ga0500554_000753_471_875 | 132 |
| 364 | 3300053108 | Ga0500562_177093 | Ga0500562_177093_127_531 | 132 |
| 365 | 3300053111 | Ga0500572_001298 | Ga0500572_001298_311_715 | 132 |
| 366 | 3300053119 | Ga0500595_001095 | Ga0500595_001095_7162_7566 | 132 |
| 367 | 3300053120 | Ga0500597_104891 | Ga0500597_104891_423_827 | 132 |
| 368 | 3300053120 | Ga0500597_316777 | Ga0500597_316777_151_555 | 132 |
| 369 | 3300053121 | Ga0500607_119755 | Ga0500607_119755_772_1176 | 132 |
| 370 | 3300053123 | Ga0500614_002285 | Ga0500614_002285_327_731 | 132 |
| 371 | 3300053123 | Ga0500614_010281 | Ga0500614_010281_990_1394 | 132 |
| 372 | 3300053130 | Ga0500642_0010056 | Ga0500642_0010056_637_1041 | 132 |
| 373 | 3300053136 | Ga0500559_0045200 | Ga0500559_0045200_1221_1625 | 132 |
| 374 | 3300053150 | Ga0500603_005211 | Ga0500603_005211_172_576 | 132 |
| 375 | 3300053178 | Ga0500637_0137478 | Ga0500637_0137478_117_521 | 132 |
| 376 | 3300053737 | Ga0500601_003661 | Ga0500601_003661_489_893 | 132 |
| 377 | 3300055283 | Ga0500661_050840 | Ga0500661_050840_102_506 | 132 |
| 378 | 3300059511 | Ga0587091_077589 | Ga0587091_077589_161_559 | 132 |
| 379 | 3300059641 | Ga0587068_097582 | Ga0587068_097582_38_436 | 132 |
| 380 | 3300061719 | Ga0466962_0095353 | Ga0466962_0095353_1007_1405 | 132 |
| 381 | 3300003203 | JGI25406J46586_10005035 | JGI25406J46586_1000503510 | 133 |
| 382 | 3300005334 | Ga0068869_101317082 | Ga0068869_1013170821 | 133 |
| 383 | 3300005458 | Ga0070681_10301885 | Ga0070681_103018852 | 133 |
| 384 | 3300005718 | Ga0068866_10997026 | Ga0068866_109970261 | 133 |
| 385 | 3300005985 | Ga0081539_10001787 | Ga0081539_1000178728 | 133 |
| 386 | 3300006237 | Ga0097621_102371210 | Ga0097621_1023712101 | 133 |
| 387 | 3300006881 | Ga0068865_100521375 | Ga0068865_1005213752 | 133 |
| 388 | 3300009553 | Ga0105249_11314175 | Ga0105249_113141752 | 133 |
| 389 | 3300012492 | Ga0157335_1016465 | Ga0157335_10164651 | 133 |
| 390 | 3300013307 | Ga0157372_10085083 | Ga0157372_100850835 | 133 |
| 391 | 3300013307 | Ga0157372_10779128 | Ga0157372_107791282 | 133 |
| 392 | 3300013308 | Ga0157375_11400967 | Ga0157375_114009672 | 133 |
| 393 | 3300014326 | Ga0157380_12680162 | Ga0157380_126801622 | 133 |
| 394 | 3300020070 | Ga0206356_10459118 | Ga0206356_104591181 | 133 |
| 395 | 3300021377 | Ga0213874_10425682 | Ga0213874_104256821 | 133 |
| 396 | 3300025899 | Ga0207642_10128502 | Ga0207642_101285023 | 133 |
| 397 | 3300025912 | Ga0207707_10343294 | Ga0207707_103432942 | 133 |
| 398 | 3300025919 | Ga0207657_10588065 | Ga0207657_105880652 | 133 |
| 399 | 3300025921 | Ga0207652_10383719 | Ga0207652_103837193 | 133 |
| 400 | 3300025921 | Ga0207652_11072276 | Ga0207652_110722761 | 133 |
| 401 | 3300025938 | Ga0207704_10281705 | Ga0207704_102817052 | 133 |
| 402 | 3300028379 | Ga0268266_12164523 | Ga0268266_121645231 | 133 |
| 403 | 3300031548 | Ga0307408_102154780 | Ga0307408_1021547801 | 133 |
| 404 | 3300031824 | Ga0307413_10082713 | Ga0307413_100827132 | 133 |
| 405 | 3300031852 | Ga0307410_10266745 | Ga0307410_102667452 | 133 |
| 406 | 3300031901 | Ga0307406_10139417 | Ga0307406_101394172 | 133 |
| 407 | 3300031901 | Ga0307406_10993242 | Ga0307406_109932422 | 133 |
| 408 | 3300031903 | Ga0307407_10039964 | Ga0307407_100399642 | 133 |
| 409 | 3300031995 | Ga0307409_100128659 | Ga0307409_1001286594 | 133 |
| 410 | 3300032004 | Ga0307414_10227687 | Ga0307414_102276873 | 133 |
| 411 | 3300032005 | Ga0307411_10047285 | Ga0307411_100472853 | 133 |
| 412 | 3300032126 | Ga0307415_100103043 | Ga0307415_1001030435 | 133 |
| 413 | 3300035692 | Ga0373935_0083638 | Ga0373935_0083638_1664_2068 | 133 |
| 414 | 3300036401 | Ga0373937_1686366 | Ga0373937_1686366_104_505 | 133 |
| 415 | 3300037312 | Ga0395899_0474264 | Ga0395899_0474264_203_604 | 133 |
| 416 | 3300044694 | Ga0466963_0031126 | Ga0466963_0031126_1331_1732 | 133 |
| 417 | 3300044694 | Ga0466963_0157732 | Ga0466963_0157732_449_850 | 133 |
| 418 | 3300044706 | Ga0466964_0672203 | Ga0466964_0672203_103_504 | 133 |
| 419 | 3300044842 | Ga0466957_0214270 | Ga0466957_0214270_343_744 | 133 |
| 420 | 3300044901 | Ga0466960_0279688 | Ga0466960_0279688_522_923 | 133 |
| 421 | 3300045836 | Ga0466958_0036236 | Ga0466958_0036236_729_1130 | 133 |
| 422 | 3300045976 | Ga0466967_1543660 | Ga0466967_1543660_79_480 | 133 |
| 423 | 3300045976 | Ga0466967_1655969 | Ga0466967_1655969_38_439 | 133 |
| 424 | 3300046477 | Ga0495664_0000007 | Ga0495664_0000007_130243_130644 | 133 |
| 425 | 3300046500 | Ga0495596_0209206 | Ga0495596_0209206_254_655 | 133 |
| 426 | 3300046663 | Ga0495635_0041495 | Ga0495635_0041495_957_1358 | 133 |
| 427 | 3300047323 | Ga0495683_0335953 | Ga0495683_0335953_75_476 | 133 |
| 428 | 3300048905 | Ga0496102_0000002 | Ga0496102_0000002_641019_641420 | 133 |
| 429 | 3300048906 | Ga0496103_0000017 | Ga0496103_0000017_234236_234637 | 133 |
| 430 | 3300048912 | Ga0496109_0375278 | Ga0496109_0375278_667_1071 | 133 |
| 431 | 3300048913 | Ga0496110_0232030 | Ga0496110_0232030_527_931 | 133 |
| 432 | 3300048913 | Ga0496110_0690997 | Ga0496110_0690997_357_758 | 133 |
| 433 | 3300049533 | Ga0501317_032247 | Ga0501317_032247_327_728 | 133 |
| 434 | 3300049534 | Ga0501318_092093 | Ga0501318_092093_40_441 | 133 |
| 435 | 3300049850 | Ga0501204_032177 | Ga0501204_032177_72_473 | 133 |
| 436 | 3300053078 | Ga0495612_0206867 | Ga0495612_0206867_27_428 | 133 |
| 437 | 3300053083 | Ga0495655_0184972 | Ga0495655_0184972_130_534 | 133 |
| 438 | 3300005535 | Ga0070684_100459211 | Ga0070684_1004592112 | 134 |
| 439 | 3300005937 | Ga0081455_10074703 | Ga0081455_100747032 | 134 |
| 440 | 3300013308 | Ga0157375_12160949 | Ga0157375_121609492 | 134 |
| 441 | 3300054114 | Ga0501084_0199550 | Ga0501084_0199550_688_1092 | 134 |
| 442 | 3300000531 | CNBas_1001136 | CNBas_10011363 | 135 |
| 443 | 3300000532 | CNAas_1007538 | CNAas_10075382 | 135 |
| 444 | 3300000546 | LJNas_1021309 | LJNas_10213092 | 135 |
| 445 | 3300000546 | LJNas_1023594 | LJNas_10235942 | 135 |
| 446 | 3300001977 | JGI24746J21847_1049549 | JGI24746J21847_10495491 | 135 |
| 447 | 3300001978 | JGI24747J21853_1009491 | JGI24747J21853_10094911 | 135 |
| 448 | 3300001989 | JGI24739J22299_10186775 | JGI24739J22299_101867751 | 135 |
| 449 | 3300001991 | JGI24743J22301_10030734 | JGI24743J22301_100307342 | 135 |
| 450 | 3300002075 | JGI24738J21930_10023484 | JGI24738J21930_100234843 | 135 |
| 451 | 3300002075 | JGI24738J21930_10117691 | JGI24738J21930_101176911 | 135 |
| 452 | 3300002077 | JGI24744J21845_10029145 | JGI24744J21845_100291452 | 135 |
| 453 | 3300002244 | JGI24742J22300_10064244 | JGI24742J22300_100642442 | 135 |
| 454 | 3300003373 | JGI25407J50210_10154854 | JGI25407J50210_101548541 | 135 |
| 455 | 3300003579 | Ga0007429J51699_1087349 | Ga0007429J51699_10873491 | 135 |
| 456 | 3300004799 | Ga0058863_11733789 | Ga0058863_117337892 | 135 |
| 457 | 3300004800 | Ga0058861_11880043 | Ga0058861_118800431 | 135 |
| 458 | 3300005327 | Ga0070658_10501997 | Ga0070658_105019973 | 135 |
| 459 | 3300005327 | Ga0070658_10687635 | Ga0070658_106876351 | 135 |
| 460 | 3300005328 | Ga0070676_10260169 | Ga0070676_102601692 | 135 |
| 461 | 3300005329 | Ga0070683_100116514 | Ga0070683_1001165145 | 135 |
| 462 | 3300005329 | Ga0070683_100461992 | Ga0070683_1004619922 | 135 |
| 463 | 3300005329 | Ga0070683_100736310 | Ga0070683_1007363102 | 135 |
| 464 | 3300005329 | Ga0070683_101167809 | Ga0070683_1011678092 | 135 |
| 465 | 3300005330 | Ga0070690_100075543 | Ga0070690_1000755431 | 135 |
| 466 | 3300005330 | Ga0070690_100764046 | Ga0070690_1007640462 | 135 |
| 467 | 3300005330 | Ga0070690_101167670 | Ga0070690_1011676702 | 135 |
| 468 | 3300005331 | Ga0070670_100213810 | Ga0070670_1002138104 | 135 |
| 469 | 3300005331 | Ga0070670_101090686 | Ga0070670_1010906862 | 135 |
| 470 | 3300005331 | Ga0070670_101311990 | Ga0070670_1013119901 | 135 |
| 471 | 3300005333 | Ga0070677_10160298 | Ga0070677_101602981 | 135 |
| 472 | 3300005333 | Ga0070677_10287340 | Ga0070677_102873401 | 135 |
| 473 | 3300005334 | Ga0068869_100240686 | Ga0068869_1002406862 | 135 |
| 474 | 3300005334 | Ga0068869_100387514 | Ga0068869_1003875143 | 135 |
| 475 | 3300005334 | Ga0068869_100903103 | Ga0068869_1009031032 | 135 |
| 476 | 3300005336 | Ga0070680_100763451 | Ga0070680_1007634512 | 135 |
| 477 | 3300005337 | Ga0070682_100059998 | Ga0070682_1000599983 | 135 |
| 478 | 3300005337 | Ga0070682_100100622 | Ga0070682_1001006224 | 135 |
| 479 | 3300005337 | Ga0070682_100996786 | Ga0070682_1009967862 | 135 |
| 480 | 3300005337 | Ga0070682_101835336 | Ga0070682_1018353361 | 135 |
| 481 | 3300005338 | Ga0068868_100048880 | Ga0068868_1000488808 | 135 |
| 482 | 3300005338 | Ga0068868_100064173 | Ga0068868_1000641736 | 135 |
| 483 | 3300005338 | Ga0068868_100165391 | Ga0068868_1001653911 | 135 |
| 484 | 3300005338 | Ga0068868_100254888 | Ga0068868_1002548882 | 135 |
| 485 | 3300005338 | Ga0068868_100269267 | Ga0068868_1002692673 | 135 |
| 486 | 3300005338 | Ga0068868_100470831 | Ga0068868_1004708313 | 135 |
| 487 | 3300005338 | Ga0068868_100578536 | Ga0068868_1005785363 | 135 |
| 488 | 3300005339 | Ga0070660_100008632 | Ga0070660_1000086328 | 135 |
| 489 | 3300005339 | Ga0070660_100288131 | Ga0070660_1002881312 | 135 |
| 490 | 3300005339 | Ga0070660_100356793 | Ga0070660_1003567932 | 135 |
| 491 | 3300005339 | Ga0070660_100751585 | Ga0070660_1007515852 | 135 |
| 492 | 3300005340 | Ga0070689_100108691 | Ga0070689_1001086915 | 135 |
| 493 | 3300005340 | Ga0070689_100643561 | Ga0070689_1006435613 | 135 |
| 494 | 3300005340 | Ga0070689_100683432 | Ga0070689_1006834322 | 135 |
| 495 | 3300005341 | Ga0070691_10036588 | Ga0070691_100365882 | 135 |
| 496 | 3300005341 | Ga0070691_10110512 | Ga0070691_101105122 | 135 |
| 497 | 3300005341 | Ga0070691_10128530 | Ga0070691_101285303 | 135 |
| 498 | 3300005343 | Ga0070687_100024182 | Ga0070687_1000241823 | 135 |
| 499 | 3300005343 | Ga0070687_100183573 | Ga0070687_1001835733 | 135 |
| 500 | 3300005343 | Ga0070687_100338030 | Ga0070687_1003380303 | 135 |
| 501 | 3300005344 | Ga0070661_100218035 | Ga0070661_1002180354 | 135 |
| 502 | 3300005344 | Ga0070661_100295514 | Ga0070661_1002955141 | 135 |
| 503 | 3300005344 | Ga0070661_100379628 | Ga0070661_1003796281 | 135 |
| 504 | 3300005345 | Ga0070692_10035876 | Ga0070692_100358763 | 135 |
| 505 | 3300005345 | Ga0070692_10093594 | Ga0070692_100935943 | 135 |
| 506 | 3300005345 | Ga0070692_10463542 | Ga0070692_104635422 | 135 |
| 507 | 3300005345 | Ga0070692_10641545 | Ga0070692_106415451 | 135 |
| 508 | 3300005347 | Ga0070668_100058208 | Ga0070668_1000582084 | 135 |
| 509 | 3300005347 | Ga0070668_100254569 | Ga0070668_1002545693 | 135 |
| 510 | 3300005353 | Ga0070669_100355636 | Ga0070669_1003556362 | 135 |
| 511 | 3300005353 | Ga0070669_100376888 | Ga0070669_1003768882 | 135 |
| 512 | 3300005354 | Ga0070675_100148038 | Ga0070675_1001480382 | 135 |
| 513 | 3300005354 | Ga0070675_100814463 | Ga0070675_1008144632 | 135 |
| 514 | 3300005354 | Ga0070675_100926955 | Ga0070675_1009269552 | 135 |
| 515 | 3300005354 | Ga0070675_101472929 | Ga0070675_1014729291 | 135 |
| 516 | 3300005355 | Ga0070671_100171217 | Ga0070671_1001712171 | 135 |
| 517 | 3300005355 | Ga0070671_100837907 | Ga0070671_1008379072 | 135 |
| 518 | 3300005356 | Ga0070674_100439922 | Ga0070674_1004399222 | 135 |
| 519 | 3300005356 | Ga0070674_100957954 | Ga0070674_1009579541 | 135 |
| 520 | 3300005356 | Ga0070674_101127228 | Ga0070674_1011272282 | 135 |
| 521 | 3300005364 | Ga0070673_100135457 | Ga0070673_1001354573 | 135 |
| 522 | 3300005364 | Ga0070673_100541607 | Ga0070673_1005416072 | 135 |
| 523 | 3300005365 | Ga0070688_100058478 | Ga0070688_1000584783 | 135 |
| 524 | 3300005365 | Ga0070688_100331614 | Ga0070688_1003316142 | 135 |
| 525 | 3300005365 | Ga0070688_101697073 | Ga0070688_1016970731 | 135 |
| 526 | 3300005366 | Ga0070659_100226398 | Ga0070659_1002263984 | 135 |
| 527 | 3300005366 | Ga0070659_100309709 | Ga0070659_1003097093 | 135 |
| 528 | 3300005366 | Ga0070659_100705415 | Ga0070659_1007054152 | 135 |
| 529 | 3300005366 | Ga0070659_101176641 | Ga0070659_1011766411 | 135 |
| 530 | 3300005367 | Ga0070667_100417554 | Ga0070667_1004175543 | 135 |
| 531 | 3300005367 | Ga0070667_101599054 | Ga0070667_1015990541 | 135 |
| 532 | 3300005434 | Ga0070709_11036618 | Ga0070709_110366181 | 135 |
| 533 | 3300005435 | Ga0070714_100126135 | Ga0070714_1001261353 | 135 |
| 534 | 3300005435 | Ga0070714_100737126 | Ga0070714_1007371262 | 135 |
| 535 | 3300005435 | Ga0070714_101695932 | Ga0070714_1016959322 | 135 |
| 536 | 3300005436 | Ga0070713_101424794 | Ga0070713_1014247942 | 135 |
| 537 | 3300005437 | Ga0070710_10075464 | Ga0070710_100754645 | 135 |
| 538 | 3300005437 | Ga0070710_10408617 | Ga0070710_104086171 | 135 |
| 539 | 3300005438 | Ga0070701_10045375 | Ga0070701_100453753 | 135 |
| 540 | 3300005438 | Ga0070701_10794425 | Ga0070701_107944251 | 135 |
| 541 | 3300005439 | Ga0070711_100002145 | Ga0070711_1000021453 | 135 |
| 542 | 3300005439 | Ga0070711_100388833 | Ga0070711_1003888333 | 135 |
| 543 | 3300005439 | Ga0070711_100431513 | Ga0070711_1004315132 | 135 |
| 544 | 3300005439 | Ga0070711_100949338 | Ga0070711_1009493382 | 135 |
| 545 | 3300005440 | Ga0070705_100081071 | Ga0070705_1000810714 | 135 |
| 546 | 3300005440 | Ga0070705_100810702 | Ga0070705_1008107022 | 135 |
| 547 | 3300005441 | Ga0070700_100014625 | Ga0070700_1000146252 | 135 |
| 548 | 3300005441 | Ga0070700_100239406 | Ga0070700_1002394062 | 135 |
| 549 | 3300005441 | Ga0070700_100373086 | Ga0070700_1003730862 | 135 |
| 550 | 3300005441 | Ga0070700_100491668 | Ga0070700_1004916681 | 135 |
| 551 | 3300005441 | Ga0070700_100843368 | Ga0070700_1008433682 | 135 |
| 552 | 3300005441 | Ga0070700_101123187 | Ga0070700_1011231872 | 135 |
| 553 | 3300005441 | Ga0070700_101502058 | Ga0070700_1015020582 | 135 |
| 554 | 3300005444 | Ga0070694_100373262 | Ga0070694_1003732622 | 135 |
| 555 | 3300005444 | Ga0070694_100980481 | Ga0070694_1009804811 | 135 |
| 556 | 3300005444 | Ga0070694_101203633 | Ga0070694_1012036331 | 135 |
| 557 | 3300005445 | Ga0070708_101348895 | Ga0070708_1013488952 | 135 |
| 558 | 3300005455 | Ga0070663_100178784 | Ga0070663_1001787841 | 135 |
| 559 | 3300005456 | Ga0070678_100688805 | Ga0070678_1006888052 | 135 |
| 560 | 3300005456 | Ga0070678_100719654 | Ga0070678_1007196542 | 135 |
| 561 | 3300005456 | Ga0070678_100853820 | Ga0070678_1008538202 | 135 |
| 562 | 3300005457 | Ga0070662_100020737 | Ga0070662_1000207376 | 135 |
| 563 | 3300005457 | Ga0070662_100631379 | Ga0070662_1006313792 | 135 |
| 564 | 3300005457 | Ga0070662_100631411 | Ga0070662_1006314112 | 135 |
| 565 | 3300005457 | Ga0070662_101200231 | Ga0070662_1012002312 | 135 |
| 566 | 3300005457 | Ga0070662_101257807 | Ga0070662_1012578072 | 135 |
| 567 | 3300005458 | Ga0070681_11193968 | Ga0070681_111939681 | 135 |
| 568 | 3300005459 | Ga0068867_100053386 | Ga0068867_1000533861 | 135 |
| 569 | 3300005459 | Ga0068867_101171712 | Ga0068867_1011717121 | 135 |
| 570 | 3300005459 | Ga0068867_101376040 | Ga0068867_1013760402 | 135 |
| 571 | 3300005466 | Ga0070685_10023094 | Ga0070685_100230944 | 135 |
| 572 | 3300005466 | Ga0070685_10107992 | Ga0070685_101079924 | 135 |
| 573 | 3300005466 | Ga0070685_10214336 | Ga0070685_102143363 | 135 |
| 574 | 3300005466 | Ga0070685_10329969 | Ga0070685_103299692 | 135 |
| 575 | 3300005467 | Ga0070706_101171058 | Ga0070706_1011710582 | 135 |
| 576 | 3300005530 | Ga0070679_100434053 | Ga0070679_1004340533 | 135 |
| 577 | 3300005530 | Ga0070679_100859131 | Ga0070679_1008591311 | 135 |
| 578 | 3300005530 | Ga0070679_101088965 | Ga0070679_1010889651 | 135 |
| 579 | 3300005535 | Ga0070684_100036894 | Ga0070684_1000368948 | 135 |
| 580 | 3300005535 | Ga0070684_100038986 | Ga0070684_1000389867 | 135 |
| 581 | 3300005535 | Ga0070684_100073453 | Ga0070684_1000734534 | 135 |
| 582 | 3300005535 | Ga0070684_100666851 | Ga0070684_1006668513 | 135 |
| 583 | 3300005535 | Ga0070684_101738042 | Ga0070684_1017380422 | 135 |
| 584 | 3300005539 | Ga0068853_100635959 | Ga0068853_1006359593 | 135 |
| 585 | 3300005539 | Ga0068853_100767835 | Ga0068853_1007678352 | 135 |
| 586 | 3300005543 | Ga0070672_100119315 | Ga0070672_1001193153 | 135 |
| 587 | 3300005543 | Ga0070672_100159691 | Ga0070672_1001596914 | 135 |
| 588 | 3300005543 | Ga0070672_100366786 | Ga0070672_1003667863 | 135 |
| 589 | 3300005544 | Ga0070686_100068990 | Ga0070686_1000689903 | 135 |
| 590 | 3300005544 | Ga0070686_100179547 | Ga0070686_1001795472 | 135 |
| 591 | 3300005544 | Ga0070686_101012684 | Ga0070686_1010126842 | 135 |
| 592 | 3300005546 | Ga0070696_100245985 | Ga0070696_1002459851 | 135 |
| 593 | 3300005548 | Ga0070665_100090116 | Ga0070665_1000901164 | 135 |
| 594 | 3300005548 | Ga0070665_100681997 | Ga0070665_1006819973 | 135 |
| 595 | 3300005548 | Ga0070665_100841054 | Ga0070665_1008410543 | 135 |
| 596 | 3300005548 | Ga0070665_101452599 | Ga0070665_1014525992 | 135 |
| 597 | 3300005549 | Ga0070704_100198834 | Ga0070704_1001988343 | 135 |
| 598 | 3300005549 | Ga0070704_100334782 | Ga0070704_1003347823 | 135 |
| 599 | 3300005549 | Ga0070704_100813022 | Ga0070704_1008130223 | 135 |
| 600 | 3300005563 | Ga0068855_100497070 | Ga0068855_1004970703 | 135 |
| 601 | 3300005564 | Ga0070664_100038200 | Ga0070664_1000382007 | 135 |
| 602 | 3300005564 | Ga0070664_100104636 | Ga0070664_1001046363 | 135 |
| 603 | 3300005564 | Ga0070664_100136855 | Ga0070664_1001368553 | 135 |
| 604 | 3300005564 | Ga0070664_100163037 | Ga0070664_1001630374 | 135 |
| 605 | 3300005564 | Ga0070664_100255965 | Ga0070664_1002559653 | 135 |
| 606 | 3300005564 | Ga0070664_101131440 | Ga0070664_1011314403 | 135 |
| 607 | 3300005577 | Ga0068857_100472271 | Ga0068857_1004722712 | 135 |
| 608 | 3300005577 | Ga0068857_101491634 | Ga0068857_1014916342 | 135 |
| 609 | 3300005578 | Ga0068854_100211908 | Ga0068854_1002119082 | 135 |
| 610 | 3300005578 | Ga0068854_100276299 | Ga0068854_1002762992 | 135 |
| 611 | 3300005578 | Ga0068854_101440939 | Ga0068854_1014409392 | 135 |
| 612 | 3300005578 | Ga0068854_102075383 | Ga0068854_1020753832 | 135 |
| 613 | 3300005614 | Ga0068856_100682409 | Ga0068856_1006824092 | 135 |
| 614 | 3300005614 | Ga0068856_101347288 | Ga0068856_1013472882 | 135 |
| 615 | 3300005615 | Ga0070702_100064234 | Ga0070702_1000642342 | 135 |
| 616 | 3300005615 | Ga0070702_100078971 | Ga0070702_1000789712 | 135 |
| 617 | 3300005615 | Ga0070702_100100832 | Ga0070702_1001008321 | 135 |
| 618 | 3300005615 | Ga0070702_100128944 | Ga0070702_1001289443 | 135 |
| 619 | 3300005615 | Ga0070702_100168715 | Ga0070702_1001687151 | 135 |
| 620 | 3300005615 | Ga0070702_100257237 | Ga0070702_1002572372 | 135 |
| 621 | 3300005616 | Ga0068852_100058425 | Ga0068852_1000584256 | 135 |
| 622 | 3300005616 | Ga0068852_100599629 | Ga0068852_1005996292 | 135 |
| 623 | 3300005616 | Ga0068852_100896738 | Ga0068852_1008967382 | 135 |
| 624 | 3300005616 | Ga0068852_101356646 | Ga0068852_1013566462 | 135 |
| 625 | 3300005617 | Ga0068859_100378791 | Ga0068859_1003787913 | 135 |
| 626 | 3300005617 | Ga0068859_100682304 | Ga0068859_1006823043 | 135 |
| 627 | 3300005618 | Ga0068864_100037025 | Ga0068864_1000370256 | 135 |
| 628 | 3300005618 | Ga0068864_100310300 | Ga0068864_1003103004 | 135 |
| 629 | 3300005718 | Ga0068866_10036975 | Ga0068866_100369753 | 135 |
| 630 | 3300005718 | Ga0068866_10147966 | Ga0068866_101479662 | 135 |
| 631 | 3300005719 | Ga0068861_100047582 | Ga0068861_1000475824 | 135 |
| 632 | 3300005719 | Ga0068861_100294672 | Ga0068861_1002946722 | 135 |
| 633 | 3300005719 | Ga0068861_100305573 | Ga0068861_1003055733 | 135 |
| 634 | 3300005834 | Ga0068851_10097895 | Ga0068851_100978953 | 135 |
| 635 | 3300005834 | Ga0068851_10118258 | Ga0068851_101182582 | 135 |
| 636 | 3300005834 | Ga0068851_10465960 | Ga0068851_104659602 | 135 |
| 637 | 3300005840 | Ga0068870_10171657 | Ga0068870_101716572 | 135 |
| 638 | 3300005840 | Ga0068870_10317657 | Ga0068870_103176572 | 135 |
| 639 | 3300005840 | Ga0068870_10624912 | Ga0068870_106249122 | 135 |
| 640 | 3300005840 | Ga0068870_10757944 | Ga0068870_107579442 | 135 |
| 641 | 3300005840 | Ga0068870_10843130 | Ga0068870_108431302 | 135 |
| 642 | 3300005841 | Ga0068863_100472171 | Ga0068863_1004721712 | 135 |
| 643 | 3300005841 | Ga0068863_100975030 | Ga0068863_1009750302 | 135 |
| 644 | 3300005842 | Ga0068858_100119037 | Ga0068858_1001190372 | 135 |
| 645 | 3300005842 | Ga0068858_100170708 | Ga0068858_1001707083 | 135 |
| 646 | 3300005842 | Ga0068858_100790000 | Ga0068858_1007900002 | 135 |
| 647 | 3300005842 | Ga0068858_100838519 | Ga0068858_1008385193 | 135 |
| 648 | 3300005843 | Ga0068860_100194759 | Ga0068860_1001947593 | 135 |
| 649 | 3300005844 | Ga0068862_100125512 | Ga0068862_1001255122 | 135 |
| 650 | 3300005844 | Ga0068862_100738553 | Ga0068862_1007385533 | 135 |
| 651 | 3300005937 | Ga0081455_10023793 | Ga0081455_100237938 | 135 |
| 652 | 3300005937 | Ga0081455_10049901 | Ga0081455_100499014 | 135 |
| 653 | 3300005981 | Ga0081538_10005811 | Ga0081538_100058117 | 135 |
| 654 | 3300005981 | Ga0081538_10012937 | Ga0081538_100129379 | 135 |
| 655 | 3300005981 | Ga0081538_10018887 | Ga0081538_100188872 | 135 |
| 656 | 3300005981 | Ga0081538_10344944 | Ga0081538_103449441 | 135 |
| 657 | 3300005983 | Ga0081540_1016109 | Ga0081540_10161095 | 135 |
| 658 | 3300005983 | Ga0081540_1054747 | Ga0081540_10547474 | 135 |
| 659 | 3300005985 | Ga0081539_10099531 | Ga0081539_100995313 | 135 |
| 660 | 3300006038 | Ga0075365_10122363 | Ga0075365_101223632 | 135 |
| 661 | 3300006058 | Ga0075432_10128863 | Ga0075432_101288632 | 135 |
| 662 | 3300006173 | Ga0070716_100336972 | Ga0070716_1003369722 | 135 |
| 663 | 3300006173 | Ga0070716_100479465 | Ga0070716_1004794653 | 135 |
| 664 | 3300006175 | Ga0070712_100012973 | Ga0070712_1000129739 | 135 |
| 665 | 3300006175 | Ga0070712_100063431 | Ga0070712_1000634313 | 135 |
| 666 | 3300006175 | Ga0070712_100102308 | Ga0070712_1001023083 | 135 |
| 667 | 3300006175 | Ga0070712_100130781 | Ga0070712_1001307814 | 135 |
| 668 | 3300006237 | Ga0097621_101422411 | Ga0097621_1014224112 | 135 |
| 669 | 3300006358 | Ga0068871_100046531 | Ga0068871_1000465314 | 135 |
| 670 | 3300006358 | Ga0068871_100787265 | Ga0068871_1007872651 | 135 |
| 671 | 3300006358 | Ga0068871_101051587 | Ga0068871_1010515872 | 135 |
| 672 | 3300006844 | Ga0075428_100254576 | Ga0075428_1002545764 | 135 |
| 673 | 3300006844 | Ga0075428_101672818 | Ga0075428_1016728182 | 135 |
| 674 | 3300006846 | Ga0075430_100021314 | Ga0075430_1000213142 | 135 |
| 675 | 3300006846 | Ga0075430_100557860 | Ga0075430_1005578602 | 135 |
| 676 | 3300006846 | Ga0075430_100578407 | Ga0075430_1005784073 | 135 |
| 677 | 3300006847 | Ga0075431_102060875 | Ga0075431_1020608751 | 135 |
| 678 | 3300006852 | Ga0075433_10061451 | Ga0075433_100614515 | 135 |
| 679 | 3300006880 | Ga0075429_101619717 | Ga0075429_1016197171 | 135 |
| 680 | 3300006881 | Ga0068865_100157423 | Ga0068865_1001574232 | 135 |
| 681 | 3300006881 | Ga0068865_101329792 | Ga0068865_1013297922 | 135 |
| 682 | 3300006931 | Ga0097620_100378789 | Ga0097620_1003787893 | 135 |
| 683 | 3300006931 | Ga0097620_100682330 | Ga0097620_1006823303 | 135 |
| 684 | 3300009093 | Ga0105240_10006736 | Ga0105240_1000673612 | 135 |
| 685 | 3300009093 | Ga0105240_10658346 | Ga0105240_106583463 | 135 |
| 686 | 3300009093 | Ga0105240_10724132 | Ga0105240_107241323 | 135 |
| 687 | 3300009094 | Ga0111539_10269084 | Ga0111539_102690842 | 135 |
| 688 | 3300009094 | Ga0111539_10867289 | Ga0111539_108672892 | 135 |
| 689 | 3300009094 | Ga0111539_11553093 | Ga0111539_115530932 | 135 |
| 690 | 3300009094 | Ga0111539_12442123 | Ga0111539_124421232 | 135 |
| 691 | 3300009094 | Ga0111539_12482805 | Ga0111539_124828052 | 135 |
| 692 | 3300009094 | Ga0111539_12642813 | Ga0111539_126428132 | 135 |
| 693 | 3300009098 | Ga0105245_10133984 | Ga0105245_101339845 | 135 |
| 694 | 3300009098 | Ga0105245_10271349 | Ga0105245_102713493 | 135 |
| 695 | 3300009098 | Ga0105245_10287401 | Ga0105245_102874012 | 135 |
| 696 | 3300009098 | Ga0105245_10664590 | Ga0105245_106645902 | 135 |
| 697 | 3300009098 | Ga0105245_11223389 | Ga0105245_112233891 | 135 |
| 698 | 3300009098 | Ga0105245_11754941 | Ga0105245_117549412 | 135 |
| 699 | 3300009098 | Ga0105245_11922020 | Ga0105245_119220202 | 135 |
| 700 | 3300009101 | Ga0105247_10829816 | Ga0105247_108298163 | 135 |
| 701 | 3300009101 | Ga0105247_10966366 | Ga0105247_109663662 | 135 |
| 702 | 3300009147 | Ga0114129_11181798 | Ga0114129_111817982 | 135 |
| 703 | 3300009147 | Ga0114129_11453555 | Ga0114129_114535552 | 135 |
| 704 | 3300009147 | Ga0114129_12152298 | Ga0114129_121522981 | 135 |
| 705 | 3300009148 | Ga0105243_10051478 | Ga0105243_100514783 | 135 |
| 706 | 3300009148 | Ga0105243_10203167 | Ga0105243_102031674 | 135 |
| 707 | 3300009148 | Ga0105243_10215376 | Ga0105243_102153762 | 135 |
| 708 | 3300009148 | Ga0105243_10346988 | Ga0105243_103469883 | 135 |
| 709 | 3300009148 | Ga0105243_10695140 | Ga0105243_106951403 | 135 |
| 710 | 3300009148 | Ga0105243_11304383 | Ga0105243_113043832 | 135 |
| 711 | 3300009148 | Ga0105243_12056873 | Ga0105243_120568732 | 135 |
| 712 | 3300009174 | Ga0105241_10128163 | Ga0105241_101281633 | 135 |
| 713 | 3300009174 | Ga0105241_10347375 | Ga0105241_103473753 | 135 |
| 714 | 3300009174 | Ga0105241_10724900 | Ga0105241_107249003 | 135 |
| 715 | 3300009174 | Ga0105241_11028271 | Ga0105241_110282713 | 135 |
| 716 | 3300009176 | Ga0105242_10183321 | Ga0105242_101833214 | 135 |
| 717 | 3300009176 | Ga0105242_11162749 | Ga0105242_111627492 | 135 |
| 718 | 3300009176 | Ga0105242_11395880 | Ga0105242_113958802 | 135 |
| 719 | 3300009177 | Ga0105248_10182568 | Ga0105248_101825686 | 135 |
| 720 | 3300009177 | Ga0105248_10427647 | Ga0105248_104276472 | 135 |
| 721 | 3300009177 | Ga0105248_10877181 | Ga0105248_108771811 | 135 |
| 722 | 3300009177 | Ga0105248_11105198 | Ga0105248_111051982 | 135 |
| 723 | 3300009545 | Ga0105237_10000795 | Ga0105237_1000079526 | 135 |
| 724 | 3300009545 | Ga0105237_10037314 | Ga0105237_100373146 | 135 |
| 725 | 3300009545 | Ga0105237_10703485 | Ga0105237_107034852 | 135 |
| 726 | 3300009551 | Ga0105238_10159249 | Ga0105238_101592495 | 135 |
| 727 | 3300009551 | Ga0105238_10599601 | Ga0105238_105996013 | 135 |
| 728 | 3300009551 | Ga0105238_10689752 | Ga0105238_106897522 | 135 |
| 729 | 3300009551 | Ga0105238_10787619 | Ga0105238_107876192 | 135 |
| 730 | 3300009551 | Ga0105238_10985094 | Ga0105238_109850941 | 135 |
| 731 | 3300009551 | Ga0105238_11062052 | Ga0105238_110620522 | 135 |
| 732 | 3300009553 | Ga0105249_10472886 | Ga0105249_104728863 | 135 |
| 733 | 3300009553 | Ga0105249_10651314 | Ga0105249_106513142 | 135 |
| 734 | 3300009553 | Ga0105249_11257564 | Ga0105249_112575642 | 135 |
| 735 | 3300009553 | Ga0105249_11363762 | Ga0105249_113637622 | 135 |
| 736 | 3300010375 | Ga0105239_10344229 | Ga0105239_103442292 | 135 |
| 737 | 3300010375 | Ga0105239_10395555 | Ga0105239_103955553 | 135 |
| 738 | 3300010375 | Ga0105239_11198363 | Ga0105239_111983632 | 135 |
| 739 | 3300010375 | Ga0105239_11312312 | Ga0105239_113123122 | 135 |
| 740 | 3300011119 | Ga0105246_10252569 | Ga0105246_102525692 | 135 |
| 741 | 3300011119 | Ga0105246_10310273 | Ga0105246_103102732 | 135 |
| 742 | 3300011119 | Ga0105246_10951919 | Ga0105246_109519192 | 135 |
| 743 | 3300012490 | Ga0157322_1003805 | Ga0157322_10038052 | 135 |
| 744 | 3300013100 | Ga0157373_10109642 | Ga0157373_101096424 | 135 |
| 745 | 3300013102 | Ga0157371_10324864 | Ga0157371_103248642 | 135 |
| 746 | 3300013102 | Ga0157371_11609083 | Ga0157371_116090831 | 135 |
| 747 | 3300013104 | Ga0157370_11191915 | Ga0157370_111919152 | 135 |
| 748 | 3300013104 | Ga0157370_11197106 | Ga0157370_111971062 | 135 |
| 749 | 3300013105 | Ga0157369_10475474 | Ga0157369_104754743 | 135 |
| 750 | 3300013105 | Ga0157369_10589793 | Ga0157369_105897933 | 135 |
| 751 | 3300013105 | Ga0157369_11183365 | Ga0157369_111833652 | 135 |
| 752 | 3300013105 | Ga0157369_11879110 | Ga0157369_118791101 | 135 |
| 753 | 3300013296 | Ga0157374_10442804 | Ga0157374_104428043 | 135 |
| 754 | 3300013296 | Ga0157374_10761911 | Ga0157374_107619111 | 135 |
| 755 | 3300013296 | Ga0157374_11820053 | Ga0157374_118200531 | 135 |
| 756 | 3300013296 | Ga0157374_12858385 | Ga0157374_128583851 | 135 |
| 757 | 3300013297 | Ga0157378_12191975 | Ga0157378_121919752 | 135 |
| 758 | 3300013306 | Ga0163162_10408973 | Ga0163162_104089733 | 135 |
| 759 | 3300013306 | Ga0163162_10442697 | Ga0163162_104426973 | 135 |
| 760 | 3300013306 | Ga0163162_10617802 | Ga0163162_106178023 | 135 |
| 761 | 3300013306 | Ga0163162_10894844 | Ga0163162_108948443 | 135 |
| 762 | 3300013307 | Ga0157372_10274420 | Ga0157372_102744201 | 135 |
| 763 | 3300013307 | Ga0157372_10553882 | Ga0157372_105538823 | 135 |
| 764 | 3300013307 | Ga0157372_10927850 | Ga0157372_109278502 | 135 |
| 765 | 3300013307 | Ga0157372_11708082 | Ga0157372_117080821 | 135 |
| 766 | 3300013307 | Ga0157372_12598440 | Ga0157372_125984401 | 135 |
| 767 | 3300013307 | Ga0157372_12974731 | Ga0157372_129747311 | 135 |
| 768 | 3300013308 | Ga0157375_10260991 | Ga0157375_102609911 | 135 |
| 769 | 3300013308 | Ga0157375_10902761 | Ga0157375_109027612 | 135 |
| 770 | 3300013308 | Ga0157375_12103571 | Ga0157375_121035711 | 135 |
| 771 | 3300014325 | Ga0163163_10338021 | Ga0163163_103380214 | 135 |
| 772 | 3300014325 | Ga0163163_10689529 | Ga0163163_106895293 | 135 |
| 773 | 3300014326 | Ga0157380_10796907 | Ga0157380_107969072 | 135 |
| 774 | 3300014326 | Ga0157380_11023414 | Ga0157380_110234141 | 135 |
| 775 | 3300014326 | Ga0157380_11027663 | Ga0157380_110276633 | 135 |
| 776 | 3300014326 | Ga0157380_11731749 | Ga0157380_117317491 | 135 |
| 777 | 3300014326 | Ga0157380_12945135 | Ga0157380_129451351 | 135 |
| 778 | 3300014745 | Ga0157377_10347050 | Ga0157377_103470503 | 135 |
| 779 | 3300014745 | Ga0157377_10887749 | Ga0157377_108877492 | 135 |
| 780 | 3300014968 | Ga0157379_10689748 | Ga0157379_106897482 | 135 |
| 781 | 3300014968 | Ga0157379_11509206 | Ga0157379_115092062 | 135 |
| 782 | 3300014969 | Ga0157376_10332356 | Ga0157376_103323563 | 135 |
| 783 | 3300014969 | Ga0157376_10745563 | Ga0157376_107455632 | 135 |
| 784 | 3300014969 | Ga0157376_12029854 | Ga0157376_120298542 | 135 |
| 785 | 3300014969 | Ga0157376_12232786 | Ga0157376_122327862 | 135 |
| 786 | 3300017792 | Ga0163161_10166675 | Ga0163161_101666752 | 135 |
| 787 | 3300017792 | Ga0163161_10260041 | Ga0163161_102600413 | 135 |
| 788 | 3300017792 | Ga0163161_10690939 | Ga0163161_106909391 | 135 |
| 789 | 3300020069 | Ga0197907_10260649 | Ga0197907_102606492 | 135 |
| 790 | 3300020069 | Ga0197907_11160759 | Ga0197907_111607592 | 135 |
| 791 | 3300020070 | Ga0206356_10156694 | Ga0206356_101566941 | 135 |
| 792 | 3300020070 | Ga0206356_10527733 | Ga0206356_105277332 | 135 |
| 793 | 3300020070 | Ga0206356_11545250 | Ga0206356_115452502 | 135 |
| 794 | 3300020076 | Ga0206355_1550264 | Ga0206355_15502641 | 135 |
| 795 | 3300020077 | Ga0206351_10035649 | Ga0206351_100356492 | 135 |
| 796 | 3300020078 | Ga0206352_10895791 | Ga0206352_108957911 | 135 |
| 797 | 3300020080 | Ga0206350_10403330 | Ga0206350_104033302 | 135 |
| 798 | 3300020080 | Ga0206350_11621122 | Ga0206350_116211222 | 135 |
| 799 | 3300020081 | Ga0206354_10395992 | Ga0206354_103959921 | 135 |
| 800 | 3300020081 | Ga0206354_10577140 | Ga0206354_105771402 | 135 |
| 801 | 3300020081 | Ga0206354_10729251 | Ga0206354_107292511 | 135 |
| 802 | 3300020081 | Ga0206354_10754954 | Ga0206354_107549542 | 135 |
| 803 | 3300020082 | Ga0206353_10349727 | Ga0206353_103497272 | 135 |
| 804 | 3300020082 | Ga0206353_10938401 | Ga0206353_109384011 | 135 |
| 805 | 3300020082 | Ga0206353_11230023 | Ga0206353_112300232 | 135 |
| 806 | 3300022467 | Ga0224712_10175186 | Ga0224712_101751862 | 135 |
| 807 | 3300022467 | Ga0224712_10179169 | Ga0224712_101791692 | 135 |
| 808 | 3300022467 | Ga0224712_10209681 | Ga0224712_102096813 | 135 |
| 809 | 3300022467 | Ga0224712_10329666 | Ga0224712_103296662 | 135 |
| 810 | 3300025302 | Ga0207426_1105583 | Ga0207426_11055832 | 135 |
| 811 | 3300025321 | Ga0207656_10491943 | Ga0207656_104919432 | 135 |
| 812 | 3300025893 | Ga0207682_10218795 | Ga0207682_102187952 | 135 |
| 813 | 3300025893 | Ga0207682_10272464 | Ga0207682_102724641 | 135 |
| 814 | 3300025898 | Ga0207692_10100092 | Ga0207692_101000921 | 135 |
| 815 | 3300025899 | Ga0207642_10328675 | Ga0207642_103286752 | 135 |
| 816 | 3300025899 | Ga0207642_10386233 | Ga0207642_103862332 | 135 |
| 817 | 3300025899 | Ga0207642_10803733 | Ga0207642_108037331 | 135 |
| 818 | 3300025900 | Ga0207710_10346056 | Ga0207710_103460563 | 135 |
| 819 | 3300025901 | Ga0207688_10014487 | Ga0207688_100144874 | 135 |
| 820 | 3300025901 | Ga0207688_10077880 | Ga0207688_100778803 | 135 |
| 821 | 3300025901 | Ga0207688_10098651 | Ga0207688_100986514 | 135 |
| 822 | 3300025901 | Ga0207688_10427456 | Ga0207688_104274562 | 135 |
| 823 | 3300025901 | Ga0207688_10578383 | Ga0207688_105783832 | 135 |
| 824 | 3300025903 | Ga0207680_10217566 | Ga0207680_102175662 | 135 |
| 825 | 3300025904 | Ga0207647_10037449 | Ga0207647_100374496 | 135 |
| 826 | 3300025904 | Ga0207647_10785528 | Ga0207647_107855281 | 135 |
| 827 | 3300025906 | Ga0207699_10412654 | Ga0207699_104126542 | 135 |
| 828 | 3300025906 | Ga0207699_10640395 | Ga0207699_106403952 | 135 |
| 829 | 3300025906 | Ga0207699_10839350 | Ga0207699_108393502 | 135 |
| 830 | 3300025907 | Ga0207645_10194319 | Ga0207645_101943193 | 135 |
| 831 | 3300025908 | Ga0207643_10056455 | Ga0207643_100564554 | 135 |
| 832 | 3300025908 | Ga0207643_10060045 | Ga0207643_100600452 | 135 |
| 833 | 3300025908 | Ga0207643_10067248 | Ga0207643_100672482 | 135 |
| 834 | 3300025908 | Ga0207643_10130984 | Ga0207643_101309842 | 135 |
| 835 | 3300025908 | Ga0207643_10620487 | Ga0207643_106204872 | 135 |
| 836 | 3300025908 | Ga0207643_10910315 | Ga0207643_109103152 | 135 |
| 837 | 3300025909 | Ga0207705_10278631 | Ga0207705_102786311 | 135 |
| 838 | 3300025909 | Ga0207705_10861482 | Ga0207705_108614822 | 135 |
| 839 | 3300025911 | Ga0207654_10112077 | Ga0207654_101120773 | 135 |
| 840 | 3300025911 | Ga0207654_10345644 | Ga0207654_103456442 | 135 |
| 841 | 3300025911 | Ga0207654_10940969 | Ga0207654_109409691 | 135 |
| 842 | 3300025912 | Ga0207707_10120608 | Ga0207707_101206083 | 135 |
| 843 | 3300025912 | Ga0207707_11014908 | Ga0207707_110149081 | 135 |
| 844 | 3300025912 | Ga0207707_11111053 | Ga0207707_111110531 | 135 |
| 845 | 3300025913 | Ga0207695_10024364 | Ga0207695_100243644 | 135 |
| 846 | 3300025914 | Ga0207671_10007459 | Ga0207671_1000745913 | 135 |
| 847 | 3300025914 | Ga0207671_10756199 | Ga0207671_107561992 | 135 |
| 848 | 3300025915 | Ga0207693_10042371 | Ga0207693_100423714 | 135 |
| 849 | 3300025915 | Ga0207693_10128045 | Ga0207693_101280451 | 135 |
| 850 | 3300025915 | Ga0207693_10401087 | Ga0207693_104010872 | 135 |
| 851 | 3300025916 | Ga0207663_10043259 | Ga0207663_100432594 | 135 |
| 852 | 3300025916 | Ga0207663_10148493 | Ga0207663_101484933 | 135 |
| 853 | 3300025916 | Ga0207663_10163174 | Ga0207663_101631743 | 135 |
| 854 | 3300025916 | Ga0207663_10237231 | Ga0207663_102372312 | 135 |
| 855 | 3300025916 | Ga0207663_10467160 | Ga0207663_104671602 | 135 |
| 856 | 3300025917 | Ga0207660_10314975 | Ga0207660_103149752 | 135 |
| 857 | 3300025917 | Ga0207660_10871599 | Ga0207660_108715992 | 135 |
| 858 | 3300025917 | Ga0207660_11358589 | Ga0207660_113585892 | 135 |
| 859 | 3300025918 | Ga0207662_10012124 | Ga0207662_100121243 | 135 |
| 860 | 3300025918 | Ga0207662_10012576 | Ga0207662_1001257610 | 135 |
| 861 | 3300025918 | Ga0207662_10178187 | Ga0207662_101781873 | 135 |
| 862 | 3300025918 | Ga0207662_10314016 | Ga0207662_103140162 | 135 |
| 863 | 3300025919 | Ga0207657_10010857 | Ga0207657_1001085712 | 135 |
| 864 | 3300025919 | Ga0207657_10086697 | Ga0207657_100866975 | 135 |
| 865 | 3300025919 | Ga0207657_10119705 | Ga0207657_101197052 | 135 |
| 866 | 3300025919 | Ga0207657_10240566 | Ga0207657_102405661 | 135 |
| 867 | 3300025919 | Ga0207657_10480692 | Ga0207657_104806922 | 135 |
| 868 | 3300025920 | Ga0207649_10303873 | Ga0207649_103038732 | 135 |
| 869 | 3300025920 | Ga0207649_10732492 | Ga0207649_107324921 | 135 |
| 870 | 3300025920 | Ga0207649_11188910 | Ga0207649_111889102 | 135 |
| 871 | 3300025921 | Ga0207652_10457008 | Ga0207652_104570082 | 135 |
| 872 | 3300025924 | Ga0207694_10419362 | Ga0207694_104193623 | 135 |
| 873 | 3300025924 | Ga0207694_10434353 | Ga0207694_104343532 | 135 |
| 874 | 3300025924 | Ga0207694_10959882 | Ga0207694_109598822 | 135 |
| 875 | 3300025925 | Ga0207650_10221288 | Ga0207650_102212883 | 135 |
| 876 | 3300025925 | Ga0207650_11484926 | Ga0207650_114849262 | 135 |
| 877 | 3300025927 | Ga0207687_10097367 | Ga0207687_100973673 | 135 |
| 878 | 3300025927 | Ga0207687_10149376 | Ga0207687_101493763 | 135 |
| 879 | 3300025927 | Ga0207687_10167257 | Ga0207687_101672572 | 135 |
| 880 | 3300025927 | Ga0207687_10263470 | Ga0207687_102634703 | 135 |
| 881 | 3300025927 | Ga0207687_10760920 | Ga0207687_107609203 | 135 |
| 882 | 3300025929 | Ga0207664_10176362 | Ga0207664_101763623 | 135 |
| 883 | 3300025929 | Ga0207664_10305464 | Ga0207664_103054643 | 135 |
| 884 | 3300025931 | Ga0207644_10672219 | Ga0207644_106722192 | 135 |
| 885 | 3300025931 | Ga0207644_11098874 | Ga0207644_110988742 | 135 |
| 886 | 3300025932 | Ga0207690_10055403 | Ga0207690_100554033 | 135 |
| 887 | 3300025932 | Ga0207690_10142127 | Ga0207690_101421272 | 135 |
| 888 | 3300025932 | Ga0207690_10327141 | Ga0207690_103271413 | 135 |
| 889 | 3300025932 | Ga0207690_10355275 | Ga0207690_103552751 | 135 |
| 890 | 3300025932 | Ga0207690_11411966 | Ga0207690_114119661 | 135 |
| 891 | 3300025933 | Ga0207706_10056627 | Ga0207706_100566277 | 135 |
| 892 | 3300025933 | Ga0207706_10272226 | Ga0207706_102722264 | 135 |
| 893 | 3300025933 | Ga0207706_10274417 | Ga0207706_102744172 | 135 |
| 894 | 3300025933 | Ga0207706_10625895 | Ga0207706_106258952 | 135 |
| 895 | 3300025933 | Ga0207706_11494648 | Ga0207706_114946482 | 135 |
| 896 | 3300025934 | Ga0207686_10967217 | Ga0207686_109672171 | 135 |
| 897 | 3300025935 | Ga0207709_10052519 | Ga0207709_100525193 | 135 |
| 898 | 3300025935 | Ga0207709_10097825 | Ga0207709_100978255 | 135 |
| 899 | 3300025935 | Ga0207709_10300316 | Ga0207709_103003161 | 135 |
| 900 | 3300025935 | Ga0207709_10328423 | Ga0207709_103284232 | 135 |
| 901 | 3300025936 | Ga0207670_10197632 | Ga0207670_101976323 | 135 |
| 902 | 3300025937 | Ga0207669_10041848 | Ga0207669_100418485 | 135 |
| 903 | 3300025937 | Ga0207669_10564845 | Ga0207669_105648453 | 135 |
| 904 | 3300025937 | Ga0207669_10605580 | Ga0207669_106055801 | 135 |
| 905 | 3300025938 | Ga0207704_10504860 | Ga0207704_105048602 | 135 |
| 906 | 3300025938 | Ga0207704_10743348 | Ga0207704_107433482 | 135 |
| 907 | 3300025939 | Ga0207665_10178516 | Ga0207665_101785163 | 135 |
| 908 | 3300025939 | Ga0207665_10191422 | Ga0207665_101914223 | 135 |
| 909 | 3300025939 | Ga0207665_10762533 | Ga0207665_107625331 | 135 |
| 910 | 3300025939 | Ga0207665_11255041 | Ga0207665_112550411 | 135 |
| 911 | 3300025940 | Ga0207691_10170989 | Ga0207691_101709892 | 135 |
| 912 | 3300025940 | Ga0207691_10325442 | Ga0207691_103254423 | 135 |
| 913 | 3300025941 | Ga0207711_11287322 | Ga0207711_112873221 | 135 |
| 914 | 3300025942 | Ga0207689_10013833 | Ga0207689_100138339 | 135 |
| 915 | 3300025942 | Ga0207689_10264484 | Ga0207689_102644843 | 135 |
| 916 | 3300025942 | Ga0207689_10278642 | Ga0207689_102786422 | 135 |
| 917 | 3300025944 | Ga0207661_10126242 | Ga0207661_101262422 | 135 |
| 918 | 3300025944 | Ga0207661_10150775 | Ga0207661_101507753 | 135 |
| 919 | 3300025944 | Ga0207661_10429873 | Ga0207661_104298732 | 135 |
| 920 | 3300025944 | Ga0207661_11683660 | Ga0207661_116836601 | 135 |
| 921 | 3300025945 | Ga0207679_10073821 | Ga0207679_100738214 | 135 |
| 922 | 3300025945 | Ga0207679_10345969 | Ga0207679_103459693 | 135 |
| 923 | 3300025945 | Ga0207679_10485459 | Ga0207679_104854591 | 135 |
| 924 | 3300025945 | Ga0207679_10696535 | Ga0207679_106965352 | 135 |
| 925 | 3300025949 | Ga0207667_11131185 | Ga0207667_111311852 | 135 |
| 926 | 3300025960 | Ga0207651_11255239 | Ga0207651_112552391 | 135 |
| 927 | 3300025961 | Ga0207712_11007244 | Ga0207712_110072442 | 135 |
| 928 | 3300025961 | Ga0207712_11086161 | Ga0207712_110861611 | 135 |
| 929 | 3300025961 | Ga0207712_11196174 | Ga0207712_111961742 | 135 |
| 930 | 3300025961 | Ga0207712_11361899 | Ga0207712_113618992 | 135 |
| 931 | 3300025972 | Ga0207668_10049888 | Ga0207668_100498884 | 135 |
| 932 | 3300025972 | Ga0207668_10114278 | Ga0207668_101142783 | 135 |
| 933 | 3300025972 | Ga0207668_10385218 | Ga0207668_103852183 | 135 |
| 934 | 3300025972 | Ga0207668_10542070 | Ga0207668_105420702 | 135 |
| 935 | 3300025972 | Ga0207668_10631785 | Ga0207668_106317852 | 135 |
| 936 | 3300025972 | Ga0207668_10718649 | Ga0207668_107186491 | 135 |
| 937 | 3300025972 | Ga0207668_10967723 | Ga0207668_109677231 | 135 |
| 938 | 3300025981 | Ga0207640_10123688 | Ga0207640_101236883 | 135 |
| 939 | 3300025981 | Ga0207640_10135995 | Ga0207640_101359955 | 135 |
| 940 | 3300025981 | Ga0207640_10555145 | Ga0207640_105551453 | 135 |
| 941 | 3300025981 | Ga0207640_10907629 | Ga0207640_109076291 | 135 |
| 942 | 3300025981 | Ga0207640_11074355 | Ga0207640_110743551 | 135 |
| 943 | 3300025986 | Ga0207658_10148842 | Ga0207658_101488422 | 135 |
| 944 | 3300025986 | Ga0207658_11374086 | Ga0207658_113740861 | 135 |
| 945 | 3300026023 | Ga0207677_10067197 | Ga0207677_100671973 | 135 |
| 946 | 3300026023 | Ga0207677_10118219 | Ga0207677_101182194 | 135 |
| 947 | 3300026023 | Ga0207677_10181177 | Ga0207677_101811774 | 135 |
| 948 | 3300026035 | Ga0207703_10229042 | Ga0207703_102290423 | 135 |
| 949 | 3300026035 | Ga0207703_10268366 | Ga0207703_102683662 | 135 |
| 950 | 3300026035 | Ga0207703_10303136 | Ga0207703_103031362 | 135 |
| 951 | 3300026041 | Ga0207639_10037689 | Ga0207639_100376892 | 135 |
| 952 | 3300026041 | Ga0207639_10392748 | Ga0207639_103927482 | 135 |
| 953 | 3300026041 | Ga0207639_10648702 | Ga0207639_106487021 | 135 |
| 954 | 3300026067 | Ga0207678_10022375 | Ga0207678_1002237510 | 135 |
| 955 | 3300026067 | Ga0207678_10639574 | Ga0207678_106395742 | 135 |
| 956 | 3300026067 | Ga0207678_10971943 | Ga0207678_109719432 | 135 |
| 957 | 3300026067 | Ga0207678_11806138 | Ga0207678_118061381 | 135 |
| 958 | 3300026075 | Ga0207708_10008513 | Ga0207708_100085134 | 135 |
| 959 | 3300026075 | Ga0207708_10025712 | Ga0207708_100257128 | 135 |
| 960 | 3300026075 | Ga0207708_10156614 | Ga0207708_101566141 | 135 |
| 961 | 3300026075 | Ga0207708_10200996 | Ga0207708_102009964 | 135 |
| 962 | 3300026075 | Ga0207708_10211554 | Ga0207708_102115543 | 135 |
| 963 | 3300026075 | Ga0207708_10577552 | Ga0207708_105775522 | 135 |
| 964 | 3300026075 | Ga0207708_10665828 | Ga0207708_106658282 | 135 |
| 965 | 3300026078 | Ga0207702_10069350 | Ga0207702_100693508 | 135 |
| 966 | 3300026078 | Ga0207702_10497876 | Ga0207702_104978763 | 135 |
| 967 | 3300026078 | Ga0207702_10835944 | Ga0207702_108359441 | 135 |
| 968 | 3300026088 | Ga0207641_10899230 | Ga0207641_108992301 | 135 |
| 969 | 3300026089 | Ga0207648_10132395 | Ga0207648_101323955 | 135 |
| 970 | 3300026089 | Ga0207648_10188365 | Ga0207648_101883653 | 135 |
| 971 | 3300026089 | Ga0207648_10266533 | Ga0207648_102665333 | 135 |
| 972 | 3300026089 | Ga0207648_11484598 | Ga0207648_114845982 | 135 |
| 973 | 3300026095 | Ga0207676_10428470 | Ga0207676_104284703 | 135 |
| 974 | 3300026095 | Ga0207676_11056908 | Ga0207676_110569082 | 135 |
| 975 | 3300026095 | Ga0207676_11177026 | Ga0207676_111770261 | 135 |
| 976 | 3300026095 | Ga0207676_12096599 | Ga0207676_120965991 | 135 |
| 977 | 3300026116 | Ga0207674_10207862 | Ga0207674_102078622 | 135 |
| 978 | 3300026116 | Ga0207674_11752306 | Ga0207674_117523061 | 135 |
| 979 | 3300026116 | Ga0207674_11793271 | Ga0207674_117932712 | 135 |
| 980 | 3300026118 | Ga0207675_100024485 | Ga0207675_1000244856 | 135 |
| 981 | 3300026118 | Ga0207675_100071876 | Ga0207675_1000718764 | 135 |
| 982 | 3300026118 | Ga0207675_100318748 | Ga0207675_1003187483 | 135 |
| 983 | 3300026118 | Ga0207675_100485795 | Ga0207675_1004857952 | 135 |
| 984 | 3300026118 | Ga0207675_100498973 | Ga0207675_1004989733 | 135 |
| 985 | 3300026121 | Ga0207683_10025472 | Ga0207683_100254729 | 135 |
| 986 | 3300026121 | Ga0207683_10408180 | Ga0207683_104081803 | 135 |
| 987 | 3300026121 | Ga0207683_10443152 | Ga0207683_104431522 | 135 |
| 988 | 3300026121 | Ga0207683_11128168 | Ga0207683_111281682 | 135 |
| 989 | 3300026121 | Ga0207683_11605734 | Ga0207683_116057342 | 135 |
| 990 | 3300026142 | Ga0207698_10151614 | Ga0207698_101516143 | 135 |
| 991 | 3300026142 | Ga0207698_10464413 | Ga0207698_104644132 | 135 |
| 992 | 3300026142 | Ga0207698_10657921 | Ga0207698_106579212 | 135 |
| 993 | 3300027717 | Ga0209998_10020598 | Ga0209998_100205983 | 135 |
| 994 | 3300027907 | Ga0207428_10120383 | Ga0207428_101203834 | 135 |
| 995 | 3300027907 | Ga0207428_10234728 | Ga0207428_102347283 | 135 |
| 996 | 3300028379 | Ga0268266_10104816 | Ga0268266_101048163 | 135 |
| 997 | 3300028379 | Ga0268266_10889140 | Ga0268266_108891402 | 135 |
| 998 | 3300028380 | Ga0268265_10208156 | Ga0268265_102081562 | 135 |
| 999 | 3300028380 | Ga0268265_10681929 | Ga0268265_106819292 | 135 |
| 1000 | 3300028380 | Ga0268265_11192463 | Ga0268265_111924632 | 135 |
| 1001 | 3300028381 | Ga0268264_10705856 | Ga0268264_107058563 | 135 |
| 1002 | 3300028381 | Ga0268264_11894812 | Ga0268264_118948121 | 135 |
| 1003 | 3300028800 | Ga0265338_10059335 | Ga0265338_100593353 | 135 |
| 1004 | 3300031251 | Ga0265327_10031033 | Ga0265327_100310335 | 135 |
| 1005 | 3300031344 | Ga0265316_10143256 | Ga0265316_101432562 | 135 |
| 1006 | 3300031344 | Ga0265316_10610282 | Ga0265316_106102821 | 135 |
| 1007 | 3300031548 | Ga0307408_100814173 | Ga0307408_1008141732 | 135 |
| 1008 | 3300031548 | Ga0307408_101114411 | Ga0307408_1011144112 | 135 |
| 1009 | 3300031548 | Ga0307408_102517028 | Ga0307408_1025170281 | 135 |
| 1010 | 3300031731 | Ga0307405_10033428 | Ga0307405_100334288 | 135 |
| 1011 | 3300031731 | Ga0307405_10280288 | Ga0307405_102802882 | 135 |
| 1012 | 3300031731 | Ga0307405_10716697 | Ga0307405_107166972 | 135 |
| 1013 | 3300031824 | Ga0307413_10044661 | Ga0307413_100446612 | 135 |
| 1014 | 3300031824 | Ga0307413_10151556 | Ga0307413_101515564 | 135 |
| 1015 | 3300031824 | Ga0307413_10328433 | Ga0307413_103284333 | 135 |
| 1016 | 3300031824 | Ga0307413_10821925 | Ga0307413_108219252 | 135 |
| 1017 | 3300031824 | Ga0307413_11114826 | Ga0307413_111148262 | 135 |
| 1018 | 3300031824 | Ga0307413_11334761 | Ga0307413_113347611 | 135 |
| 1019 | 3300031852 | Ga0307410_10044469 | Ga0307410_100444694 | 135 |
| 1020 | 3300031852 | Ga0307410_10258101 | Ga0307410_102581013 | 135 |
| 1021 | 3300031852 | Ga0307410_10545719 | Ga0307410_105457193 | 135 |
| 1022 | 3300031852 | Ga0307410_10567990 | Ga0307410_105679901 | 135 |
| 1023 | 3300031852 | Ga0307410_11081542 | Ga0307410_110815422 | 135 |
| 1024 | 3300031852 | Ga0307410_11236762 | Ga0307410_112367621 | 135 |
| 1025 | 3300031852 | Ga0307410_11300851 | Ga0307410_113008511 | 135 |
| 1026 | 3300031889 | Ga0326468_10002313 | Ga0326468_100023133 | 135 |
| 1027 | 3300031889 | Ga0326468_10018305 | Ga0326468_100183051 | 135 |
| 1028 | 3300031901 | Ga0307406_10159532 | Ga0307406_101595322 | 135 |
| 1029 | 3300031901 | Ga0307406_10265638 | Ga0307406_102656382 | 135 |
| 1030 | 3300031901 | Ga0307406_10372485 | Ga0307406_103724852 | 135 |
| 1031 | 3300031901 | Ga0307406_10708689 | Ga0307406_107086893 | 135 |
| 1032 | 3300031901 | Ga0307406_10783199 | Ga0307406_107831992 | 135 |
| 1033 | 3300031901 | Ga0307406_11177499 | Ga0307406_111774991 | 135 |
| 1034 | 3300031901 | Ga0307406_11847597 | Ga0307406_118475971 | 135 |
| 1035 | 3300031901 | Ga0307406_11867453 | Ga0307406_118674531 | 135 |
| 1036 | 3300031903 | Ga0307407_10175869 | Ga0307407_101758692 | 135 |
| 1037 | 3300031903 | Ga0307407_10232560 | Ga0307407_102325603 | 135 |
| 1038 | 3300031903 | Ga0307407_10293767 | Ga0307407_102937672 | 135 |
| 1039 | 3300031903 | Ga0307407_10419521 | Ga0307407_104195212 | 135 |
| 1040 | 3300031903 | Ga0307407_10709844 | Ga0307407_107098441 | 135 |
| 1041 | 3300031903 | Ga0307407_10767567 | Ga0307407_107675671 | 135 |
| 1042 | 3300031911 | Ga0307412_10253099 | Ga0307412_102530993 | 135 |
| 1043 | 3300031911 | Ga0307412_10407525 | Ga0307412_104075252 | 135 |
| 1044 | 3300031911 | Ga0307412_11941369 | Ga0307412_119413691 | 135 |
| 1045 | 3300031995 | Ga0307409_100156161 | Ga0307409_1001561613 | 135 |
| 1046 | 3300031995 | Ga0307409_100179831 | Ga0307409_1001798315 | 135 |
| 1047 | 3300031995 | Ga0307409_100274970 | Ga0307409_1002749702 | 135 |
| 1048 | 3300031995 | Ga0307409_100278582 | Ga0307409_1002785824 | 135 |
| 1049 | 3300031995 | Ga0307409_100486157 | Ga0307409_1004861573 | 135 |
| 1050 | 3300031995 | Ga0307409_100695631 | Ga0307409_1006956312 | 135 |
| 1051 | 3300031995 | Ga0307409_100887963 | Ga0307409_1008879632 | 135 |
| 1052 | 3300031995 | Ga0307409_100982899 | Ga0307409_1009828991 | 135 |
| 1053 | 3300031995 | Ga0307409_101020673 | Ga0307409_1010206731 | 135 |
| 1054 | 3300031995 | Ga0307409_101129999 | Ga0307409_1011299993 | 135 |
| 1055 | 3300031995 | Ga0307409_101367888 | Ga0307409_1013678881 | 135 |
| 1056 | 3300031995 | Ga0307409_102002568 | Ga0307409_1020025681 | 135 |
| 1057 | 3300032002 | Ga0307416_100028261 | Ga0307416_1000282616 | 135 |
| 1058 | 3300032002 | Ga0307416_100365960 | Ga0307416_1003659602 | 135 |
| 1059 | 3300032002 | Ga0307416_100480353 | Ga0307416_1004803533 | 135 |
| 1060 | 3300032002 | Ga0307416_100928300 | Ga0307416_1009283002 | 135 |
| 1061 | 3300032002 | Ga0307416_101249613 | Ga0307416_1012496133 | 135 |
| 1062 | 3300032002 | Ga0307416_102138600 | Ga0307416_1021386002 | 135 |
| 1063 | 3300032002 | Ga0307416_102293180 | Ga0307416_1022931801 | 135 |
| 1064 | 3300032004 | Ga0307414_10157137 | Ga0307414_101571375 | 135 |
| 1065 | 3300032004 | Ga0307414_10346983 | Ga0307414_103469832 | 135 |
| 1066 | 3300032004 | Ga0307414_10560133 | Ga0307414_105601331 | 135 |
| 1067 | 3300032004 | Ga0307414_10688168 | Ga0307414_106881683 | 135 |
| 1068 | 3300032004 | Ga0307414_10715807 | Ga0307414_107158073 | 135 |
| 1069 | 3300032004 | Ga0307414_10881573 | Ga0307414_108815732 | 135 |
| 1070 | 3300032004 | Ga0307414_10985361 | Ga0307414_109853612 | 135 |
| 1071 | 3300032005 | Ga0307411_10228428 | Ga0307411_102284283 | 135 |
| 1072 | 3300032005 | Ga0307411_10969451 | Ga0307411_109694512 | 135 |
| 1073 | 3300032005 | Ga0307411_11245521 | Ga0307411_112455211 | 135 |
| 1074 | 3300032005 | Ga0307411_11254122 | Ga0307411_112541221 | 135 |
| 1075 | 3300032005 | Ga0307411_12338354 | Ga0307411_123383541 | 135 |
| 1076 | 3300032126 | Ga0307415_100013486 | Ga0307415_1000134865 | 135 |
| 1077 | 3300032126 | Ga0307415_100069318 | Ga0307415_1000693184 | 135 |
| 1078 | 3300032126 | Ga0307415_100315083 | Ga0307415_1003150832 | 135 |
| 1079 | 3300032126 | Ga0307415_100733400 | Ga0307415_1007334002 | 135 |
| 1080 | 3300032126 | Ga0307415_101190469 | Ga0307415_1011904692 | 135 |
| 1081 | 3300032126 | Ga0307415_101318536 | Ga0307415_1013185361 | 135 |
| 1082 | 3300032126 | Ga0307415_101883455 | Ga0307415_1018834552 | 135 |
| 1083 | 3300034820 | Ga0373959_0010441 | Ga0373959_0010441_1164_1574 | 135 |
| 1084 | 3300035084 | Ga0373928_0083552 | Ga0373928_0083552_227_637 | 135 |
| 1085 | 3300035088 | Ga0373940_0172431 | Ga0373940_0172431_111_521 | 135 |
| 1086 | 3300035092 | Ga0373952_0141808 | Ga0373952_0141808_137_547 | 135 |
| 1087 | 3300035115 | Ga0373941_0026675 | Ga0373941_0026675_433_843 | 135 |
| 1088 | 3300035691 | Ga0373931_0350671 | Ga0373931_0350671_412_819 | 135 |
| 1089 | 3300035691 | Ga0373931_0690626 | Ga0373931_0690626_208_618 | 135 |
| 1090 | 3300035724 | Ga0373933_0600388 | Ga0373933_0600388_34_441 | 135 |
| 1091 | 3300035724 | Ga0373933_0946005 | Ga0373933_0946005_94_501 | 135 |
| 1092 | 3300035725 | Ga0373947_0773182 | Ga0373947_0773182_74_481 | 135 |
| 1093 | 3300037068 | Ga0373925_0143662 | Ga0373925_0143662_192_599 | 135 |
| 1094 | 3300037312 | Ga0395899_0234080 | Ga0395899_0234080_592_999 | 135 |
| 1095 | 3300037418 | Ga0395900_0129946 | Ga0395900_0129946_1685_2092 | 135 |
| 1096 | 3300037418 | Ga0395900_1173528 | Ga0395900_1173528_248_655 | 135 |
| 1097 | 3300037466 | Ga0395898_0255428 | Ga0395898_0255428_887_1294 | 135 |
| 1098 | 3300037466 | Ga0395898_0296456 | Ga0395898_0296456_1124_1531 | 135 |
| 1099 | 3300037466 | Ga0395898_0426716 | Ga0395898_0426716_318_725 | 135 |
| 1100 | 3300037466 | Ga0395898_0607110 | Ga0395898_0607110_385_792 | 135 |
| 1101 | 3300037466 | Ga0395898_0730487 | Ga0395898_0730487_78_485 | 135 |
| 1102 | 3300037471 | Ga0395905_0225550 | Ga0395905_0225550_374_781 | 135 |
| 1103 | 3300037471 | Ga0395905_0309184 | Ga0395905_0309184_746_1153 | 135 |
| 1104 | 3300037853 | Ga0436364_1395085 | Ga0436364_1395085_14_421 | 135 |
| 1105 | 3300038443 | Ga0395901_0124285 | Ga0395901_0124285_1624_2031 | 135 |
| 1106 | 3300038443 | Ga0395901_1130784 | Ga0395901_1130784_205_612 | 135 |
| 1107 | 3300038443 | Ga0395901_1646832 | Ga0395901_1646832_13_420 | 135 |
| 1108 | 3300039437 | Ga0436365_0954496 | Ga0436365_0954496_378_785 | 135 |
| 1109 | 3300039437 | Ga0436365_1838581 | Ga0436365_1838581_186_593 | 135 |
| 1110 | 3300039450 | Ga0436363_0584301 | Ga0436363_0584301_112_519 | 135 |
| 1111 | 3300039450 | Ga0436363_0986073 | Ga0436363_0986073_484_891 | 135 |
| 1112 | 3300041406 | Ga0439439_0222361 | Ga0439439_0222361_73_480 | 135 |
| 1113 | 3300041413 | Ga0439465_0086957 | Ga0439465_0086957_528_935 | 135 |
| 1114 | 3300041443 | Ga0451789_0091105 | Ga0451789_0091105_781_1188 | 135 |
| 1115 | 3300041451 | Ga0451791_1353119 | Ga0451791_1353119_1809_2216 | 135 |
| 1116 | 3300041452 | Ga0451793_0152428 | Ga0451793_0152428_71_478 | 135 |
| 1117 | 3300041453 | Ga0451797_0011443 | Ga0451797_0011443_1006_1413 | 135 |
| 1118 | 3300041459 | Ga0451800_0362132 | Ga0451800_0362132_361_768 | 135 |
| 1119 | 3300041460 | Ga0451802_0857638 | Ga0451802_0857638_36_443 | 135 |
| 1120 | 3300041486 | Ga0451807_1972304 | Ga0451807_1972304_155_562 | 135 |
| 1121 | 3300041491 | Ga0451833_0506572 | Ga0451833_0506572_301_708 | 135 |
| 1122 | 3300041494 | Ga0451837_0354457 | Ga0451837_0354457_1954_2361 | 135 |
| 1123 | 3300041498 | Ga0451841_1193332 | Ga0451841_1193332_661_1068 | 135 |
| 1124 | 3300041509 | Ga0451843_0771766 | Ga0451843_0771766_410_817 | 135 |
| 1125 | 3300041512 | Ga0451853_0777436 | Ga0451853_0777436_378_785 | 135 |
| 1126 | 3300041512 | Ga0451853_2037896 | Ga0451853_2037896_1569_1976 | 135 |
| 1127 | 3300042008 | Ga0439450_058704 | Ga0439450_058704_402_809 | 135 |
| 1128 | 3300042009 | Ga0439451_061574 | Ga0439451_061574_74_481 | 135 |
| 1129 | 3300042012 | Ga0439455_0127718 | Ga0439455_0127718_105_512 | 135 |
| 1130 | 3300042016 | Ga0439463_017891 | Ga0439463_017891_942_1349 | 135 |
| 1131 | 3300042118 | Ga0450914_002915 | Ga0450914_002915_11_418 | 135 |
| 1132 | 3300042142 | Ga0450905_054786 | Ga0450905_054786_131_538 | 135 |
| 1133 | 3300042437 | Ga0439444_0001353 | Ga0439444_0001353_1898_2305 | 135 |
| 1134 | 3300042438 | Ga0439459_0111886 | Ga0439459_0111886_30_437 | 135 |
| 1135 | 3300042438 | Ga0439459_0175930 | Ga0439459_0175930_138_545 | 135 |
| 1136 | 3300042438 | Ga0439459_0224239 | Ga0439459_0224239_68_475 | 135 |
| 1137 | 3300042439 | Ga0439464_0012839 | Ga0439464_0012839_149_556 | 135 |
| 1138 | 3300042532 | Ga0450893_0048351 | Ga0450893_0048351_64_471 | 135 |
| 1139 | 3300042993 | Ga0439440_0004989 | Ga0439440_0004989_1264_1671 | 135 |
| 1140 | 3300044658 | Ga0466972_0287972 | Ga0466972_0287972_73_480 | 135 |
| 1141 | 3300044683 | Ga0466965_0154339 | Ga0466965_0154339_497_904 | 135 |
| 1142 | 3300044683 | Ga0466965_0212249 | Ga0466965_0212249_386_793 | 135 |
| 1143 | 3300044684 | Ga0466966_0093740 | Ga0466966_0093740_442_849 | 135 |
| 1144 | 3300044684 | Ga0466966_0124012 | Ga0466966_0124012_1060_1467 | 135 |
| 1145 | 3300044693 | Ga0466961_0037057 | Ga0466961_0037057_1155_1562 | 135 |
| 1146 | 3300044693 | Ga0466961_0043779 | Ga0466961_0043779_2276_2683 | 135 |
| 1147 | 3300044693 | Ga0466961_0085337 | Ga0466961_0085337_1467_1874 | 135 |
| 1148 | 3300044694 | Ga0466963_0089212 | Ga0466963_0089212_35_442 | 135 |
| 1149 | 3300044694 | Ga0466963_0096517 | Ga0466963_0096517_389_796 | 135 |
| 1150 | 3300044694 | Ga0466963_0231007 | Ga0466963_0231007_476_883 | 135 |
| 1151 | 3300044694 | Ga0466963_0352209 | Ga0466963_0352209_511_918 | 135 |
| 1152 | 3300044694 | Ga0466963_0399690 | Ga0466963_0399690_493_900 | 135 |
| 1153 | 3300044694 | Ga0466963_0435733 | Ga0466963_0435733_45_452 | 135 |
| 1154 | 3300044694 | Ga0466963_0651368 | Ga0466963_0651368_45_452 | 135 |
| 1155 | 3300044694 | Ga0466963_1158883 | Ga0466963_1158883_58_465 | 135 |
| 1156 | 3300044706 | Ga0466964_0129233 | Ga0466964_0129233_546_953 | 135 |
| 1157 | 3300044706 | Ga0466964_0142785 | Ga0466964_0142785_456_866 | 135 |
| 1158 | 3300044706 | Ga0466964_0194842 | Ga0466964_0194842_312_719 | 135 |
| 1159 | 3300044706 | Ga0466964_0245374 | Ga0466964_0245374_44_454 | 135 |
| 1160 | 3300044719 | Ga0466971_0002843 | Ga0466971_0002843_6044_6451 | 135 |
| 1161 | 3300044719 | Ga0466971_0029438 | Ga0466971_0029438_1963_2370 | 135 |
| 1162 | 3300044765 | Ga0466970_0191972 | Ga0466970_0191972_696_1103 | 135 |
| 1163 | 3300044842 | Ga0466957_0061797 | Ga0466957_0061797_734_1141 | 135 |
| 1164 | 3300044842 | Ga0466957_0165341 | Ga0466957_0165341_338_745 | 135 |
| 1165 | 3300044842 | Ga0466957_0195507 | Ga0466957_0195507_904_1311 | 135 |
| 1166 | 3300044842 | Ga0466957_0648431 | Ga0466957_0648431_67_474 | 135 |
| 1167 | 3300044842 | Ga0466957_0940620 | Ga0466957_0940620_95_502 | 135 |
| 1168 | 3300044901 | Ga0466960_0047777 | Ga0466960_0047777_179_586 | 135 |
| 1169 | 3300044901 | Ga0466960_0059111 | Ga0466960_0059111_41_448 | 135 |
| 1170 | 3300044901 | Ga0466960_0063633 | Ga0466960_0063633_1170_1580 | 135 |
| 1171 | 3300044901 | Ga0466960_0128550 | Ga0466960_0128550_593_1000 | 135 |
| 1172 | 3300044901 | Ga0466960_0272230 | Ga0466960_0272230_150_557 | 135 |
| 1173 | 3300044901 | Ga0466960_0324561 | Ga0466960_0324561_78_485 | 135 |
| 1174 | 3300045049 | Ga0466959_0002215 | Ga0466959_0002215_8840_9247 | 135 |
| 1175 | 3300045049 | Ga0466959_0473289 | Ga0466959_0473289_379_786 | 135 |
| 1176 | 3300045836 | Ga0466958_0009429 | Ga0466958_0009429_4283_4690 | 135 |
| 1177 | 3300045836 | Ga0466958_0149264 | Ga0466958_0149264_695_1102 | 135 |
| 1178 | 3300045836 | Ga0466958_0324134 | Ga0466958_0324134_26_433 | 135 |
| 1179 | 3300045836 | Ga0466958_0397663 | Ga0466958_0397663_109_516 | 135 |
| 1180 | 3300045976 | Ga0466967_0051187 | Ga0466967_0051187_2484_2891 | 135 |
| 1181 | 3300045976 | Ga0466967_0063703 | Ga0466967_0063703_916_1323 | 135 |
| 1182 | 3300045976 | Ga0466967_0195274 | Ga0466967_0195274_457_867 | 135 |
| 1183 | 3300045976 | Ga0466967_0195449 | Ga0466967_0195449_1108_1515 | 135 |
| 1184 | 3300045976 | Ga0466967_0237690 | Ga0466967_0237690_946_1353 | 135 |
| 1185 | 3300045976 | Ga0466967_0299080 | Ga0466967_0299080_285_692 | 135 |
| 1186 | 3300045976 | Ga0466967_0473383 | Ga0466967_0473383_764_1171 | 135 |
| 1187 | 3300045976 | Ga0466967_0509116 | Ga0466967_0509116_429_839 | 135 |
| 1188 | 3300045976 | Ga0466967_0629057 | Ga0466967_0629057_514_921 | 135 |
| 1189 | 3300045976 | Ga0466967_0873946 | Ga0466967_0873946_253_660 | 135 |
| 1190 | 3300045976 | Ga0466967_1736603 | Ga0466967_1736603_11_421 | 135 |
| 1191 | 3300046454 | Ga0495592_0156082 | Ga0495592_0156082_495_902 | 135 |
| 1192 | 3300046455 | Ga0495603_0121963 | Ga0495603_0121963_1025_1432 | 135 |
| 1193 | 3300046461 | Ga0495641_0550194 | Ga0495641_0550194_30_437 | 135 |
| 1194 | 3300046462 | Ga0495651_0273325 | Ga0495651_0273325_546_953 | 135 |
| 1195 | 3300046463 | Ga0495653_0038646 | Ga0495653_0038646_1941_2348 | 135 |
| 1196 | 3300046475 | Ga0495639_0277131 | Ga0495639_0277131_167_574 | 135 |
| 1197 | 3300046491 | Ga0495584_0415339 | Ga0495584_0415339_40_447 | 135 |
| 1198 | 3300046499 | Ga0495594_0371583 | Ga0495594_0371583_188_595 | 135 |
| 1199 | 3300046511 | Ga0495608_0630679 | Ga0495608_0630679_118_525 | 135 |
| 1200 | 3300046513 | Ga0495616_0459792 | Ga0495616_0459792_93_500 | 135 |
| 1201 | 3300046514 | Ga0495618_0000035 | Ga0495618_0000035_74100_74507 | 135 |
| 1202 | 3300046515 | Ga0495620_0072092 | Ga0495620_0072092_439_846 | 135 |
| 1203 | 3300046517 | Ga0495630_0000610 | Ga0495630_0000610_15856_16263 | 135 |
| 1204 | 3300046517 | Ga0495630_0286116 | Ga0495630_0286116_764_1171 | 135 |
| 1205 | 3300046518 | Ga0495631_0264249 | Ga0495631_0264249_37_444 | 135 |
| 1206 | 3300046518 | Ga0495631_0433624 | Ga0495631_0433624_51_458 | 135 |
| 1207 | 3300046519 | Ga0495632_0333435 | Ga0495632_0333435_72_479 | 135 |
| 1208 | 3300046538 | Ga0495609_0237259 | Ga0495609_0237259_133_540 | 135 |
| 1209 | 3300046543 | Ga0495645_0000033 | Ga0495645_0000033_28801_29208 | 135 |
| 1210 | 3300046615 | Ga0495656_0101624 | Ga0495656_0101624_621_1028 | 135 |
| 1211 | 3300046615 | Ga0495656_0599253 | Ga0495656_0599253_57_464 | 135 |
| 1212 | 3300046663 | Ga0495635_0557190 | Ga0495635_0557190_187_594 | 135 |
| 1213 | 3300046674 | Ga0495588_0166115 | Ga0495588_0166115_229_636 | 135 |
| 1214 | 3300046674 | Ga0495588_0499820 | Ga0495588_0499820_179_586 | 135 |
| 1215 | 3300046675 | Ga0495657_0000027 | Ga0495657_0000027_100978_101385 | 135 |
| 1216 | 3300046681 | Ga0495647_0193224 | Ga0495647_0193224_365_772 | 135 |
| 1217 | 3300046683 | Ga0495658_0330886 | Ga0495658_0330886_546_953 | 135 |
| 1218 | 3300046690 | Ga0495624_0053715 | Ga0495624_0053715_810_1217 | 135 |
| 1219 | 3300046690 | Ga0495624_0442408 | Ga0495624_0442408_330_737 | 135 |
| 1220 | 3300046694 | Ga0495649_0425579 | Ga0495649_0425579_85_492 | 135 |
| 1221 | 3300046794 | Ga0495589_0219446 | Ga0495589_0219446_291_698 | 135 |
| 1222 | 3300046794 | Ga0495589_0273092 | Ga0495589_0273092_119_526 | 135 |
| 1223 | 3300047315 | Ga0495581_0182687 | Ga0495581_0182687_696_1103 | 135 |
| 1224 | 3300047317 | Ga0495604_0555324 | Ga0495604_0555324_36_443 | 135 |
| 1225 | 3300047319 | Ga0495674_0100939 | Ga0495674_0100939_421_828 | 135 |
| 1226 | 3300047319 | Ga0495674_0141365 | Ga0495674_0141365_58_465 | 135 |
| 1227 | 3300047321 | Ga0495676_0099183 | Ga0495676_0099183_1406_1813 | 135 |
| 1228 | 3300047321 | Ga0495676_1018818 | Ga0495676_1018818_22_429 | 135 |
| 1229 | 3300047322 | Ga0495680_0165161 | Ga0495680_0165161_284_691 | 135 |
| 1230 | 3300047322 | Ga0495680_0294664 | Ga0495680_0294664_669_1076 | 135 |
| 1231 | 3300047445 | Ga0495677_0334785 | Ga0495677_0334785_104_514 | 135 |
| 1232 | 3300047471 | Ga0495684_0066049 | Ga0495684_0066049_1104_1511 | 135 |
| 1233 | 3300047471 | Ga0495684_0900927 | Ga0495684_0900927_73_480 | 135 |
| 1234 | 3300048090 | Ga0495615_0165358 | Ga0495615_0165358_133_540 | 135 |
| 1235 | 3300048903 | Ga0496100_0024347 | Ga0496100_0024347_1944_2354 | 135 |
| 1236 | 3300048903 | Ga0496100_0436162 | Ga0496100_0436162_519_926 | 135 |
| 1237 | 3300048903 | Ga0496100_0486014 | Ga0496100_0486014_209_619 | 135 |
| 1238 | 3300048903 | Ga0496100_0505230 | Ga0496100_0505230_203_613 | 135 |
| 1239 | 3300048904 | Ga0496101_0100575 | Ga0496101_0100575_355_762 | 135 |
| 1240 | 3300048904 | Ga0496101_0354842 | Ga0496101_0354842_480_887 | 135 |
| 1241 | 3300048905 | Ga0496102_0240481 | Ga0496102_0240481_426_833 | 135 |
| 1242 | 3300048905 | Ga0496102_0545251 | Ga0496102_0545251_320_730 | 135 |
| 1243 | 3300048905 | Ga0496102_0652788 | Ga0496102_0652788_384_791 | 135 |
| 1244 | 3300048905 | Ga0496102_0787944 | Ga0496102_0787944_32_439 | 135 |
| 1245 | 3300048905 | Ga0496102_0851097 | Ga0496102_0851097_333_740 | 135 |
| 1246 | 3300048906 | Ga0496103_0033430 | Ga0496103_0033430_910_1317 | 135 |
| 1247 | 3300048906 | Ga0496103_0818316 | Ga0496103_0818316_28_435 | 135 |
| 1248 | 3300048907 | Ga0496104_0000001 | Ga0496104_0000001_326925_327332 | 135 |
| 1249 | 3300048907 | Ga0496104_0036497 | Ga0496104_0036497_2640_3050 | 135 |
| 1250 | 3300048907 | Ga0496104_0040221 | Ga0496104_0040221_366_773 | 135 |
| 1251 | 3300048907 | Ga0496104_0065631 | Ga0496104_0065631_2509_2916 | 135 |
| 1252 | 3300048907 | Ga0496104_0143826 | Ga0496104_0143826_310_717 | 135 |
| 1253 | 3300048907 | Ga0496104_0769375 | Ga0496104_0769375_104_511 | 135 |
| 1254 | 3300048907 | Ga0496104_0871828 | Ga0496104_0871828_381_791 | 135 |
| 1255 | 3300048908 | Ga0496105_0083463 | Ga0496105_0083463_803_1213 | 135 |
| 1256 | 3300048908 | Ga0496105_0086869 | Ga0496105_0086869_1733_2140 | 135 |
| 1257 | 3300048908 | Ga0496105_0501721 | Ga0496105_0501721_234_641 | 135 |
| 1258 | 3300048909 | Ga0496106_0147663 | Ga0496106_0147663_1330_1740 | 135 |
| 1259 | 3300048909 | Ga0496106_0162838 | Ga0496106_0162838_479_886 | 135 |
| 1260 | 3300048909 | Ga0496106_0511564 | Ga0496106_0511564_49_456 | 135 |
| 1261 | 3300048909 | Ga0496106_1058730 | Ga0496106_1058730_21_428 | 135 |
| 1262 | 3300048910 | Ga0496107_0133809 | Ga0496107_0133809_1096_1503 | 135 |
| 1263 | 3300048910 | Ga0496107_0251996 | Ga0496107_0251996_550_960 | 135 |
| 1264 | 3300048910 | Ga0496107_0370494 | Ga0496107_0370494_293_703 | 135 |
| 1265 | 3300048910 | Ga0496107_0951566 | Ga0496107_0951566_21_428 | 135 |
| 1266 | 3300048910 | Ga0496107_1381042 | Ga0496107_1381042_58_465 | 135 |
| 1267 | 3300048911 | Ga0496108_0169624 | Ga0496108_0169624_304_711 | 135 |
| 1268 | 3300048911 | Ga0496108_0211148 | Ga0496108_0211148_198_605 | 135 |
| 1269 | 3300048911 | Ga0496108_0259653 | Ga0496108_0259653_21_428 | 135 |
| 1270 | 3300048911 | Ga0496108_0263273 | Ga0496108_0263273_906_1313 | 135 |
| 1271 | 3300048911 | Ga0496108_0464789 | Ga0496108_0464789_370_777 | 135 |
| 1272 | 3300048912 | Ga0496109_0169840 | Ga0496109_0169840_1572_1982 | 135 |
| 1273 | 3300048912 | Ga0496109_0272183 | Ga0496109_0272183_494_901 | 135 |
| 1274 | 3300048912 | Ga0496109_0509979 | Ga0496109_0509979_523_930 | 135 |
| 1275 | 3300048912 | Ga0496109_0882821 | Ga0496109_0882821_324_731 | 135 |
| 1276 | 3300048912 | Ga0496109_0886616 | Ga0496109_0886616_317_724 | 135 |
| 1277 | 3300048912 | Ga0496109_1760197 | Ga0496109_1760197_55_462 | 135 |
| 1278 | 3300048913 | Ga0496110_0000152 | Ga0496110_0000152_26764_27171 | 135 |
| 1279 | 3300048913 | Ga0496110_0052009 | Ga0496110_0052009_1420_1827 | 135 |
| 1280 | 3300048913 | Ga0496110_0060868 | Ga0496110_0060868_2820_3227 | 135 |
| 1281 | 3300048913 | Ga0496110_0122036 | Ga0496110_0122036_1611_2018 | 135 |
| 1282 | 3300048913 | Ga0496110_0279924 | Ga0496110_0279924_572_979 | 135 |
| 1283 | 3300048913 | Ga0496110_1393244 | Ga0496110_1393244_123_533 | 135 |
| 1284 | 3300048913 | Ga0496110_1608591 | Ga0496110_1608591_35_442 | 135 |
| 1285 | 3300048914 | Ga0496111_0000123 | Ga0496111_0000123_11504_11911 | 135 |
| 1286 | 3300048914 | Ga0496111_0103230 | Ga0496111_0103230_256_663 | 135 |
| 1287 | 3300048914 | Ga0496111_0140920 | Ga0496111_0140920_1343_1750 | 135 |
| 1288 | 3300048914 | Ga0496111_0470284 | Ga0496111_0470284_392_799 | 135 |
| 1289 | 3300048914 | Ga0496111_1053826 | Ga0496111_1053826_92_499 | 135 |
| 1290 | 3300048915 | Ga0496112_0005170 | Ga0496112_0005170_6842_7249 | 135 |
| 1291 | 3300048915 | Ga0496112_0024276 | Ga0496112_0024276_2892_3299 | 135 |
| 1292 | 3300048915 | Ga0496112_0037175 | Ga0496112_0037175_244_651 | 135 |
| 1293 | 3300048915 | Ga0496112_0193955 | Ga0496112_0193955_1227_1637 | 135 |
| 1294 | 3300048915 | Ga0496112_0562304 | Ga0496112_0562304_87_494 | 135 |
| 1295 | 3300048915 | Ga0496112_0964105 | Ga0496112_0964105_71_478 | 135 |
| 1296 | 3300048915 | Ga0496112_1170335 | Ga0496112_1170335_173_580 | 135 |
| 1297 | 3300048916 | Ga0496113_0042204 | Ga0496113_0042204_2827_3234 | 135 |
| 1298 | 3300048916 | Ga0496113_0079994 | Ga0496113_0079994_1805_2215 | 135 |
| 1299 | 3300048916 | Ga0496113_0218770 | Ga0496113_0218770_498_905 | 135 |
| 1300 | 3300048916 | Ga0496113_0306181 | Ga0496113_0306181_348_755 | 135 |
| 1301 | 3300048916 | Ga0496113_0590688 | Ga0496113_0590688_383_790 | 135 |
| 1302 | 3300048916 | Ga0496113_0663916 | Ga0496113_0663916_275_682 | 135 |
| 1303 | 3300048917 | Ga0496114_0018473 | Ga0496114_0018473_4276_4686 | 135 |
| 1304 | 3300048917 | Ga0496114_0191299 | Ga0496114_0191299_56_463 | 135 |
| 1305 | 3300048917 | Ga0496114_0714998 | Ga0496114_0714998_437_844 | 135 |
| 1306 | 3300048917 | Ga0496114_0916565 | Ga0496114_0916565_230_637 | 135 |
| 1307 | 3300048917 | Ga0496114_1392193 | Ga0496114_1392193_137_544 | 135 |
| 1308 | 3300048918 | Ga0496115_0338767 | Ga0496115_0338767_446_853 | 135 |
| 1309 | 3300048918 | Ga0496115_0554612 | Ga0496115_0554612_174_581 | 135 |
| 1310 | 3300048929 | Ga0496126_1310790 | Ga0496126_1310790_41_448 | 135 |
| 1311 | 3300049127 | Ga0501306_001374 | Ga0501306_001374_1784_2191 | 135 |
| 1312 | 3300049127 | Ga0501306_099357 | Ga0501306_099357_73_480 | 135 |
| 1313 | 3300049127 | Ga0501306_106457 | Ga0501306_106457_17_424 | 135 |
| 1314 | 3300049128 | Ga0501308_010483 | Ga0501308_010483_609_1016 | 135 |
| 1315 | 3300049129 | Ga0501309_025922 | Ga0501309_025922_213_620 | 135 |
| 1316 | 3300049130 | Ga0501310_020346 | Ga0501310_020346_369_776 | 135 |
| 1317 | 3300049130 | Ga0501310_022222 | Ga0501310_022222_27_434 | 135 |
| 1318 | 3300049130 | Ga0501310_039267 | Ga0501310_039267_61_468 | 135 |
| 1319 | 3300049160 | Ga0501304_033043 | Ga0501304_033043_100_507 | 135 |
| 1320 | 3300049161 | Ga0501305_026589 | Ga0501305_026589_172_579 | 135 |
| 1321 | 3300049161 | Ga0501305_031867 | Ga0501305_031867_14_421 | 135 |
| 1322 | 3300049161 | Ga0501305_065671 | Ga0501305_065671_60_467 | 135 |
| 1323 | 3300049162 | Ga0501307_010596 | Ga0501307_010596_49_456 | 135 |
| 1324 | 3300049162 | Ga0501307_068861 | Ga0501307_068861_19_426 | 135 |
| 1325 | 3300049162 | Ga0501307_074433 | Ga0501307_074433_48_455 | 135 |
| 1326 | 3300049527 | Ga0501311_031990 | Ga0501311_031990_298_705 | 135 |
| 1327 | 3300049527 | Ga0501311_034039 | Ga0501311_034039_14_421 | 135 |
| 1328 | 3300049527 | Ga0501311_048303 | Ga0501311_048303_30_437 | 135 |
| 1329 | 3300049527 | Ga0501311_080347 | Ga0501311_080347_21_428 | 135 |
| 1330 | 3300049528 | Ga0501312_080589 | Ga0501312_080589_89_496 | 135 |
| 1331 | 3300049529 | Ga0501313_016784 | Ga0501313_016784_428_835 | 135 |
| 1332 | 3300049529 | Ga0501313_018715 | Ga0501313_018715_406_813 | 135 |
| 1333 | 3300049530 | Ga0501314_016823 | Ga0501314_016823_12_419 | 135 |
| 1334 | 3300049531 | Ga0501315_057939 | Ga0501315_057939_90_497 | 135 |
| 1335 | 3300049532 | Ga0501316_070799 | Ga0501316_070799_70_477 | 135 |
| 1336 | 3300049533 | Ga0501317_008122 | Ga0501317_008122_436_843 | 135 |
| 1337 | 3300049533 | Ga0501317_043034 | Ga0501317_043034_256_663 | 135 |
| 1338 | 3300049533 | Ga0501317_051676 | Ga0501317_051676_58_468 | 135 |
| 1339 | 3300049534 | Ga0501318_005041 | Ga0501318_005041_453_860 | 135 |
| 1340 | 3300049534 | Ga0501318_048258 | Ga0501318_048258_45_455 | 135 |
| 1341 | 3300049534 | Ga0501318_049778 | Ga0501318_049778_173_580 | 135 |
| 1342 | 3300049534 | Ga0501318_054445 | Ga0501318_054445_15_422 | 135 |
| 1343 | 3300049534 | Ga0501318_068568 | Ga0501318_068568_68_475 | 135 |
| 1344 | 3300049534 | Ga0501318_077689 | Ga0501318_077689_27_434 | 135 |
| 1345 | 3300049535 | Ga0501319_012645 | Ga0501319_012645_165_572 | 135 |
| 1346 | 3300049535 | Ga0501319_016493 | Ga0501319_016493_70_477 | 135 |
| 1347 | 3300049536 | Ga0501320_004510 | Ga0501320_004510_744_1151 | 135 |
| 1348 | 3300049536 | Ga0501320_055114 | Ga0501320_055114_113_520 | 135 |
| 1349 | 3300049537 | Ga0501321_035885 | Ga0501321_035885_91_501 | 135 |
| 1350 | 3300049539 | Ga0501323_003329 | Ga0501323_003329_931_1338 | 135 |
| 1351 | 3300049539 | Ga0501323_020376 | Ga0501323_020376_441_848 | 135 |
| 1352 | 3300049539 | Ga0501323_021398 | Ga0501323_021398_26_433 | 135 |
| 1353 | 3300049539 | Ga0501323_041310 | Ga0501323_041310_129_536 | 135 |
| 1354 | 3300049539 | Ga0501323_050893 | Ga0501323_050893_42_449 | 135 |
| 1355 | 3300049539 | Ga0501323_056816 | Ga0501323_056816_113_520 | 135 |
| 1356 | 3300049540 | Ga0501324_005127 | Ga0501324_005127_612_1019 | 135 |
| 1357 | 3300049540 | Ga0501324_021188 | Ga0501324_021188_24_431 | 135 |
| 1358 | 3300049541 | Ga0501325_015874 | Ga0501325_015874_125_532 | 135 |
| 1359 | 3300049541 | Ga0501325_025100 | Ga0501325_025100_179_586 | 135 |
| 1360 | 3300049541 | Ga0501325_026039 | Ga0501325_026039_151_558 | 135 |
| 1361 | 3300049542 | Ga0501326_04670 | Ga0501326_04670_293_700 | 135 |
| 1362 | 3300049548 | Ga0501332_06041 | Ga0501332_06041_308_715 | 135 |
| 1363 | 3300049552 | Ga0501336_011089 | Ga0501336_011089_29_436 | 135 |
| 1364 | 3300049556 | Ga0501340_013035 | Ga0501340_013035_38_445 | 135 |
| 1365 | 3300049568 | Ga0501031_0045032 | Ga0501031_0045032_1044_1451 | 135 |
| 1366 | 3300049568 | Ga0501031_0241734 | Ga0501031_0241734_755_1162 | 135 |
| 1367 | 3300049568 | Ga0501031_0668653 | Ga0501031_0668653_39_446 | 135 |
| 1368 | 3300049570 | Ga0501033_0369756 | Ga0501033_0369756_44_451 | 135 |
| 1369 | 3300049570 | Ga0501033_0538860 | Ga0501033_0538860_101_508 | 135 |
| 1370 | 3300049570 | Ga0501033_0963606 | Ga0501033_0963606_85_492 | 135 |
| 1371 | 3300049571 | Ga0501034_0312070 | Ga0501034_0312070_284_691 | 135 |
| 1372 | 3300049572 | Ga0501036_0224890 | Ga0501036_0224890_383_790 | 135 |
| 1373 | 3300049572 | Ga0501036_0460193 | Ga0501036_0460193_238_645 | 135 |
| 1374 | 3300049572 | Ga0501036_1454859 | Ga0501036_1454859_102_509 | 135 |
| 1375 | 3300049573 | Ga0501037_1130128 | Ga0501037_1130128_52_459 | 135 |
| 1376 | 3300049574 | Ga0501038_0064358 | Ga0501038_0064358_1029_1436 | 135 |
| 1377 | 3300049574 | Ga0501038_0236800 | Ga0501038_0236800_510_917 | 135 |
| 1378 | 3300049575 | Ga0501039_0834539 | Ga0501039_0834539_33_440 | 135 |
| 1379 | 3300049575 | Ga0501039_1051204 | Ga0501039_1051204_212_619 | 135 |
| 1380 | 3300049576 | Ga0501040_0476507 | Ga0501040_0476507_236_643 | 135 |
| 1381 | 3300049576 | Ga0501040_1005508 | Ga0501040_1005508_21_428 | 135 |
| 1382 | 3300049576 | Ga0501040_1269103 | Ga0501040_1269103_41_448 | 135 |
| 1383 | 3300049577 | Ga0501041_0101653 | Ga0501041_0101653_1326_1733 | 135 |
| 1384 | 3300049577 | Ga0501041_0355174 | Ga0501041_0355174_479_886 | 135 |
| 1385 | 3300049577 | Ga0501041_0630780 | Ga0501041_0630780_153_560 | 135 |
| 1386 | 3300049577 | Ga0501041_0969940 | Ga0501041_0969940_126_533 | 135 |
| 1387 | 3300049578 | Ga0501042_0123976 | Ga0501042_0123976_25_432 | 135 |
| 1388 | 3300049580 | Ga0501046_0370010 | Ga0501046_0370010_439_846 | 135 |
| 1389 | 3300049580 | Ga0501046_1273382 | Ga0501046_1273382_25_432 | 135 |
| 1390 | 3300049581 | Ga0501047_0064838 | Ga0501047_0064838_619_1026 | 135 |
| 1391 | 3300049582 | Ga0501048_0114451 | Ga0501048_0114451_273_680 | 135 |
| 1392 | 3300049582 | Ga0501048_0129715 | Ga0501048_0129715_1136_1543 | 135 |
| 1393 | 3300049583 | Ga0501067_0103473 | Ga0501067_0103473_851_1261 | 135 |
| 1394 | 3300049583 | Ga0501067_0205228 | Ga0501067_0205228_257_667 | 135 |
| 1395 | 3300049583 | Ga0501067_0303084 | Ga0501067_0303084_408_815 | 135 |
| 1396 | 3300049583 | Ga0501067_0353157 | Ga0501067_0353157_131_538 | 135 |
| 1397 | 3300049583 | Ga0501067_0844086 | Ga0501067_0844086_27_434 | 135 |
| 1398 | 3300049584 | Ga0501068_0436743 | Ga0501068_0436743_102_509 | 135 |
| 1399 | 3300049585 | Ga0501069_0008335 | Ga0501069_0008335_1436_1843 | 135 |
| 1400 | 3300049585 | Ga0501069_0335301 | Ga0501069_0335301_284_691 | 135 |
| 1401 | 3300049586 | Ga0501070_0257541 | Ga0501070_0257541_488_898 | 135 |
| 1402 | 3300049586 | Ga0501070_1002555 | Ga0501070_1002555_41_448 | 135 |
| 1403 | 3300049587 | Ga0501071_0446459 | Ga0501071_0446459_134_541 | 135 |
| 1404 | 3300049587 | Ga0501071_0732412 | Ga0501071_0732412_116_523 | 135 |
| 1405 | 3300049587 | Ga0501071_0901864 | Ga0501071_0901864_167_574 | 135 |
| 1406 | 3300049588 | Ga0501072_0022407 | Ga0501072_0022407_82_489 | 135 |
| 1407 | 3300049588 | Ga0501072_0164404 | Ga0501072_0164404_681_1088 | 135 |
| 1408 | 3300049589 | Ga0501073_1073292 | Ga0501073_1073292_37_444 | 135 |
| 1409 | 3300049590 | Ga0501074_0235240 | Ga0501074_0235240_527_934 | 135 |
| 1410 | 3300049590 | Ga0501074_0345981 | Ga0501074_0345981_72_479 | 135 |
| 1411 | 3300049590 | Ga0501074_0589332 | Ga0501074_0589332_176_583 | 135 |
| 1412 | 3300049591 | Ga0501075_0259986 | Ga0501075_0259986_480_887 | 135 |
| 1413 | 3300049592 | Ga0501076_0185295 | Ga0501076_0185295_1048_1455 | 135 |
| 1414 | 3300049592 | Ga0501076_0376060 | Ga0501076_0376060_648_1055 | 135 |
| 1415 | 3300049592 | Ga0501076_0629695 | Ga0501076_0629695_302_709 | 135 |
| 1416 | 3300049592 | Ga0501076_0755445 | Ga0501076_0755445_79_486 | 135 |
| 1417 | 3300049593 | Ga0501077_0082333 | Ga0501077_0082333_198_605 | 135 |
| 1418 | 3300049656 | Ga0501209_177865 | Ga0501209_177865_226_636 | 135 |
| 1419 | 3300049741 | Ga0501079_0111889 | Ga0501079_0111889_1054_1461 | 135 |
| 1420 | 3300049742 | Ga0501080_0051340 | Ga0501080_0051340_715_1122 | 135 |
| 1421 | 3300049742 | Ga0501080_0192882 | Ga0501080_0192882_576_983 | 135 |
| 1422 | 3300049742 | Ga0501080_1080077 | Ga0501080_1080077_56_463 | 135 |
| 1423 | 3300049743 | Ga0501081_0339785 | Ga0501081_0339785_614_1021 | 135 |
| 1424 | 3300049743 | Ga0501081_0953734 | Ga0501081_0953734_90_497 | 135 |
| 1425 | 3300049744 | Ga0501083_0306065 | Ga0501083_0306065_381_788 | 135 |
| 1426 | 3300049744 | Ga0501083_0768191 | Ga0501083_0768191_13_420 | 135 |
| 1427 | 3300049762 | Ga0501265_053120 | Ga0501265_053120_22_429 | 135 |
| 1428 | 3300049822 | Ga0501035_0774111 | Ga0501035_0774111_112_519 | 135 |
| 1429 | 3300049823 | Ga0501044_0340937 | Ga0501044_0340937_936_1343 | 135 |
| 1430 | 3300049823 | Ga0501044_0497092 | Ga0501044_0497092_400_807 | 135 |
| 1431 | 3300049824 | Ga0501045_0236958 | Ga0501045_0236958_91_498 | 135 |
| 1432 | 3300050491 | nmdc:mga00v17_295790_c1 | nmdc:mga00v17_295790_c1_180_587 | 135 |
| 1433 | 3300050492 | nmdc:mga0yw44_473461_c1 | nmdc:mga0yw44_473461_c1_256_663 | 135 |
| 1434 | 3300050494 | nmdc:mga06z11_232003_c1 | nmdc:mga06z11_232003_c1_260_667 | 135 |
| 1435 | 3300050507 | nmdc:mga05p37_536441_c1 | nmdc:mga05p37_536441_c1_261_668 | 135 |
| 1436 | 3300050508 | nmdc:mga09592_279953_c1 | nmdc:mga09592_279953_c1_605_1012 | 135 |
| 1437 | 3300050509 | nmdc:mga0qj67_12200_c1 | nmdc:mga0qj67_12200_c1_295_702 | 135 |
| 1438 | 3300050509 | nmdc:mga0qj67_675251_c1 | nmdc:mga0qj67_675251_c1_230_637 | 135 |
| 1439 | 3300050509 | nmdc:mga0qj67_754676_c1 | nmdc:mga0qj67_754676_c1_38_445 | 135 |
| 1440 | 3300050510 | nmdc:mga06r32_551663_c1 | nmdc:mga06r32_551663_c1_395_802 | 135 |
| 1441 | 3300050511 | nmdc:mga08y16_166926_c1 | nmdc:mga08y16_166926_c1_1040_1447 | 135 |
| 1442 | 3300050511 | nmdc:mga08y16_1798830_c1 | nmdc:mga08y16_1798830_c1_57_467 | 135 |
| 1443 | 3300050511 | nmdc:mga08y16_690375_c1 | nmdc:mga08y16_690375_c1_517_924 | 135 |
| 1444 | 3300050511 | nmdc:mga08y16_883194_c1 | nmdc:mga08y16_883194_c1_464_871 | 135 |
| 1445 | 3300050512 | nmdc:mga0n895_108333_c1 | nmdc:mga0n895_108333_c1_1768_2178 | 135 |
| 1446 | 3300050515 | nmdc:mga0a205_422107_c1 | nmdc:mga0a205_422107_c1_500_907 | 135 |
| 1447 | 3300050515 | nmdc:mga0a205_79219_c1 | nmdc:mga0a205_79219_c1_1155_1565 | 135 |
| 1448 | 3300053078 | Ga0495612_0000369 | Ga0495612_0000369_4114_4521 | 135 |
| 1449 | 3300053083 | Ga0495655_0013664 | Ga0495655_0013664_922_1329 | 135 |
| 1450 | 3300053083 | Ga0495655_0070854 | Ga0495655_0070854_473_880 | 135 |
| 1451 | 3300053083 | Ga0495655_0076526 | Ga0495655_0076526_257_664 | 135 |
| 1452 | 3300053083 | Ga0495655_0081252 | Ga0495655_0081252_300_707 | 135 |
| 1453 | 3300053085 | Ga0495619_0520861 | Ga0495619_0520861_332_739 | 135 |
| 1454 | 3300053139 | Ga0500568_0019599 | Ga0500568_0019599_1009_1416 | 135 |
| 1455 | 3300053146 | Ga0500588_0024168 | Ga0500588_0024168_249_656 | 135 |
| 1456 | 3300059423 | Ga0590074_024028 | Ga0590074_024028_41_448 | 135 |
| 1457 | 3300059424 | Ga0590075_042752 | Ga0590075_042752_47_454 | 135 |
| 1458 | 3300059426 | Ga0590077_155958 | Ga0590077_155958_110_517 | 135 |
| 1459 | 3300059477 | Ga0587084_044913 | Ga0587084_044913_177_587 | 135 |
| 1460 | 3300059477 | Ga0587084_046473 | Ga0587084_046473_264_671 | 135 |
| 1461 | 3300059477 | Ga0587084_092526 | Ga0587084_092526_23_430 | 135 |
| 1462 | 3300059477 | Ga0587084_093019 | Ga0587084_093019_34_441 | 135 |
| 1463 | 3300059478 | Ga0587093_037022 | Ga0587093_037022_85_492 | 135 |
| 1464 | 3300059490 | Ga0587066_016158 | Ga0587066_016158_728_1135 | 135 |
| 1465 | 3300059490 | Ga0587066_211811 | Ga0587066_211811_69_476 | 135 |
| 1466 | 3300059491 | Ga0587070_065532 | Ga0587070_065532_284_691 | 135 |
| 1467 | 3300059491 | Ga0587070_095022 | Ga0587070_095022_27_434 | 135 |
| 1468 | 3300059491 | Ga0587070_125430 | Ga0587070_125430_51_458 | 135 |
| 1469 | 3300059491 | Ga0587070_128994 | Ga0587070_128994_172_579 | 135 |
| 1470 | 3300059491 | Ga0587070_140264 | Ga0587070_140264_29_436 | 135 |
| 1471 | 3300059492 | Ga0587073_0069057 | Ga0587073_0069057_58_465 | 135 |
| 1472 | 3300059492 | Ga0587073_0094173 | Ga0587073_0094173_147_554 | 135 |
| 1473 | 3300059492 | Ga0587073_0159272 | Ga0587073_0159272_168_575 | 135 |
| 1474 | 3300059492 | Ga0587073_0173419 | Ga0587073_0173419_191_598 | 135 |
| 1475 | 3300059492 | Ga0587073_0261005 | Ga0587073_0261005_38_445 | 135 |
| 1476 | 3300059493 | Ga0587077_030979 | Ga0587077_030979_530_937 | 135 |
| 1477 | 3300059493 | Ga0587077_145331 | Ga0587077_145331_48_455 | 135 |
| 1478 | 3300059493 | Ga0587077_233956 | Ga0587077_233956_87_494 | 135 |
| 1479 | 3300059493 | Ga0587077_240351 | Ga0587077_240351_93_500 | 135 |
| 1480 | 3300059503 | Ga0587080_071212 | Ga0587080_071212_124_531 | 135 |
| 1481 | 3300059504 | Ga0587082_058848 | Ga0587082_058848_38_445 | 135 |
| 1482 | 3300059504 | Ga0587082_098908 | Ga0587082_098908_168_575 | 135 |
| 1483 | 3300059504 | Ga0587082_106949 | Ga0587082_106949_41_448 | 135 |
| 1484 | 3300059504 | Ga0587082_131332 | Ga0587082_131332_132_539 | 135 |
| 1485 | 3300059504 | Ga0587082_142610 | Ga0587082_142610_63_473 | 135 |
| 1486 | 3300059505 | Ga0587083_0018038 | Ga0587083_0018038_291_698 | 135 |
| 1487 | 3300059505 | Ga0587083_0033850 | Ga0587083_0033850_598_1005 | 135 |
| 1488 | 3300059505 | Ga0587083_0096572 | Ga0587083_0096572_90_497 | 135 |
| 1489 | 3300059505 | Ga0587083_0110869 | Ga0587083_0110869_38_445 | 135 |
| 1490 | 3300059505 | Ga0587083_0149597 | Ga0587083_0149597_19_426 | 135 |
| 1491 | 3300059505 | Ga0587083_0222296 | Ga0587083_0222296_107_514 | 135 |
| 1492 | 3300059506 | Ga0587085_015683 | Ga0587085_015683_255_662 | 135 |
| 1493 | 3300059506 | Ga0587085_091739 | Ga0587085_091739_22_429 | 135 |
| 1494 | 3300059506 | Ga0587085_135702 | Ga0587085_135702_58_465 | 135 |
| 1495 | 3300059506 | Ga0587085_145523 | Ga0587085_145523_18_425 | 135 |
| 1496 | 3300059508 | Ga0587088_026663 | Ga0587088_026663_552_959 | 135 |
| 1497 | 3300059508 | Ga0587088_028995 | Ga0587088_028995_229_636 | 135 |
| 1498 | 3300059508 | Ga0587088_045695 | Ga0587088_045695_272_679 | 135 |
| 1499 | 3300059508 | Ga0587088_181181 | Ga0587088_181181_38_445 | 135 |
| 1500 | 3300059509 | Ga0587089_068176 | Ga0587089_068176_28_435 | 135 |
| 1501 | 3300059510 | Ga0587090_054846 | Ga0587090_054846_89_496 | 135 |
| 1502 | 3300059510 | Ga0587090_081700 | Ga0587090_081700_182_589 | 135 |
| 1503 | 3300059510 | Ga0587090_169179 | Ga0587090_169179_45_455 | 135 |
| 1504 | 3300059511 | Ga0587091_103448 | Ga0587091_103448_226_633 | 135 |
| 1505 | 3300059511 | Ga0587091_126610 | Ga0587091_126610_185_592 | 135 |
| 1506 | 3300059511 | Ga0587091_169527 | Ga0587091_169527_88_495 | 135 |
| 1507 | 3300059512 | Ga0587092_065416 | Ga0587092_065416_247_654 | 135 |
| 1508 | 3300059512 | Ga0587092_165766 | Ga0587092_165766_81_488 | 135 |
| 1509 | 3300059513 | Ga0587094_089861 | Ga0587094_089861_35_442 | 135 |
| 1510 | 3300059514 | Ga0587095_018844 | Ga0587095_018844_57_464 | 135 |
| 1511 | 3300059603 | Ga0587097_05180 | Ga0587097_05180_153_560 | 135 |
| 1512 | 3300059604 | Ga0587098_018025 | Ga0587098_018025_380_787 | 135 |
| 1513 | 3300059604 | Ga0587098_020782 | Ga0587098_020782_386_796 | 135 |
| 1514 | 3300059605 | Ga0587106_023859 | Ga0587106_023859_378_785 | 135 |
| 1515 | 3300059605 | Ga0587106_081286 | Ga0587106_081286_23_430 | 135 |
| 1516 | 3300059605 | Ga0587106_089576 | Ga0587106_089576_185_592 | 135 |
| 1517 | 3300059605 | Ga0587106_112462 | Ga0587106_112462_47_454 | 135 |
| 1518 | 3300059605 | Ga0587106_121566 | Ga0587106_121566_126_533 | 135 |
| 1519 | 3300059605 | Ga0587106_129945 | Ga0587106_129945_66_473 | 135 |
| 1520 | 3300059608 | Ga0587129_017342 | Ga0587129_017342_184_591 | 135 |
| 1521 | 3300059622 | Ga0587099_007630 | Ga0587099_007630_596_1003 | 135 |
| 1522 | 3300059623 | Ga0587101_050694 | Ga0587101_050694_175_585 | 135 |
| 1523 | 3300059626 | Ga0587115_116519 | Ga0587115_116519_33_440 | 135 |
| 1524 | 3300059627 | Ga0587117_052156 | Ga0587117_052156_38_445 | 135 |
| 1525 | 3300059628 | Ga0587122_004333 | Ga0587122_004333_282_689 | 135 |
| 1526 | 3300059628 | Ga0587122_020432 | Ga0587122_020432_279_686 | 135 |
| 1527 | 3300059630 | Ga0587128_026561 | Ga0587128_026561_384_791 | 135 |
| 1528 | 3300059630 | Ga0587128_029373 | Ga0587128_029373_120_527 | 135 |
| 1529 | 3300059630 | Ga0587128_044943 | Ga0587128_044943_202_612 | 135 |
| 1530 | 3300059630 | Ga0587128_079359 | Ga0587128_079359_45_452 | 135 |
| 1531 | 3300059630 | Ga0587128_105903 | Ga0587128_105903_157_564 | 135 |
| 1532 | 3300059631 | Ga0587130_054665 | Ga0587130_054665_65_472 | 135 |
| 1533 | 3300059639 | Ga0587062_057141 | Ga0587062_057141_24_431 | 135 |
| 1534 | 3300059639 | Ga0587062_059546 | Ga0587062_059546_79_486 | 135 |
| 1535 | 3300059640 | Ga0587067_010025 | Ga0587067_010025_58_465 | 135 |
| 1536 | 3300059640 | Ga0587067_051321 | Ga0587067_051321_214_621 | 135 |
| 1537 | 3300059640 | Ga0587067_055304 | Ga0587067_055304_362_769 | 135 |
| 1538 | 3300059640 | Ga0587067_097813 | Ga0587067_097813_184_591 | 135 |
| 1539 | 3300059640 | Ga0587067_122607 | Ga0587067_122607_14_421 | 135 |
| 1540 | 3300059640 | Ga0587067_122738 | Ga0587067_122738_158_568 | 135 |
| 1541 | 3300059640 | Ga0587067_135607 | Ga0587067_135607_41_448 | 135 |
| 1542 | 3300059640 | Ga0587067_148294 | Ga0587067_148294_45_455 | 135 |
| 1543 | 3300059640 | Ga0587067_221353 | Ga0587067_221353_59_466 | 135 |
| 1544 | 3300059641 | Ga0587068_067249 | Ga0587068_067249_208_618 | 135 |
| 1545 | 3300059641 | Ga0587068_077366 | Ga0587068_077366_18_425 | 135 |
| 1546 | 3300059641 | Ga0587068_163235 | Ga0587068_163235_58_468 | 135 |
| 1547 | 3300059641 | Ga0587068_166675 | Ga0587068_166675_66_473 | 135 |
| 1548 | 3300059642 | Ga0587069_015201 | Ga0587069_015201_89_496 | 135 |
| 1549 | 3300059642 | Ga0587069_063646 | Ga0587069_063646_35_442 | 135 |
| 1550 | 3300059642 | Ga0587069_073056 | Ga0587069_073056_180_587 | 135 |
| 1551 | 3300059643 | Ga0587072_060947 | Ga0587072_060947_327_734 | 135 |
| 1552 | 3300059643 | Ga0587072_062989 | Ga0587072_062989_309_716 | 135 |
| 1553 | 3300059643 | Ga0587072_112016 | Ga0587072_112016_89_496 | 135 |
| 1554 | 3300059644 | Ga0587075_068501 | Ga0587075_068501_225_632 | 135 |
| 1555 | 3300059645 | Ga0587076_091573 | Ga0587076_091573_211_618 | 135 |
| 1556 | 3300059645 | Ga0587076_164397 | Ga0587076_164397_51_458 | 135 |
| 1557 | 3300059645 | Ga0587076_201425 | Ga0587076_201425_59_466 | 135 |
| 1558 | 3300059647 | Ga0587079_047232 | Ga0587079_047232_439_846 | 135 |
| 1559 | 3300059647 | Ga0587079_053478 | Ga0587079_053478_51_458 | 135 |
| 1560 | 3300059647 | Ga0587079_067618 | Ga0587079_067618_68_475 | 135 |
| 1561 | 3300059647 | Ga0587079_080061 | Ga0587079_080061_273_683 | 135 |
| 1562 | 3300059647 | Ga0587079_187115 | Ga0587079_187115_13_420 | 135 |
| 1563 | 3300059647 | Ga0587079_225766 | Ga0587079_225766_26_433 | 135 |
| 1564 | 3300059649 | Ga0587102_026339 | Ga0587102_026339_68_478 | 135 |
| 1565 | 3300059649 | Ga0587102_029372 | Ga0587102_029372_38_445 | 135 |
| 1566 | 3300059651 | Ga0587105_012645 | Ga0587105_012645_234_641 | 135 |
| 1567 | 3300059652 | Ga0587107_027459 | Ga0587107_027459_210_617 | 135 |
| 1568 | 3300059652 | Ga0587107_039534 | Ga0587107_039534_296_703 | 135 |
| 1569 | 3300059655 | Ga0587114_045530 | Ga0587114_045530_247_654 | 135 |
| 1570 | 3300059655 | Ga0587114_114909 | Ga0587114_114909_89_496 | 135 |
| 1571 | 3300060346 | Ga0587111_0057452 | Ga0587111_0057452_207_617 | 135 |
| 1572 | 3300060346 | Ga0587111_0108606 | Ga0587111_0108606_29_436 | 135 |
| 1573 | 3300060346 | Ga0587111_0122459 | Ga0587111_0122459_167_574 | 135 |
| 1574 | 3300060346 | Ga0587111_0262553 | Ga0587111_0262553_38_445 | 135 |
| 1575 | 3300060353 | Ga0501082_0293905 | Ga0501082_0293905_67_474 | 135 |
| 1576 | 3300060353 | Ga0501082_1757257 | Ga0501082_1757257_18_425 | 135 |
| 1577 | 3300061719 | Ga0466962_0009693 | Ga0466962_0009693_2791_3198 | 135 |
| 1578 | 3300061734 | Ga0530510_0018622 | Ga0530510_0018622_3301_3708 | 135 |
| 1579 | 3300061734 | Ga0530510_0539437 | Ga0530510_0539437_449_856 | 135 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5zeb-assembly1.cif.gz_h | m. smegmatis p/p state 70s ribosome structure | 0.9738 | 3 | 135 |
| 4pdb-assembly1.cif.gz_A | crystal structure of bacillus anthracis ribosomal protein s8 in complex with an rna aptamer | 0.9725 | 4 | 135 |
| 5xyu-assembly1.cif.gz_H | small subunit of mycobacterium smegmatis ribosome | 0.9712 | 2 | 135 |
| 8cwo-assembly1.cif.gz_H | cutibacterium acnes 30s ribosomal subunit with sarecycline bound, body domain only in the local refined map | 0.9695 | 2 | 135 |
| 7nhn-assembly1.cif.gz_i | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9667 | 3 | 135 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ofpH02 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; | 0.978 | 78 | 135 | 3.30.1490.10 |
| 3uz6K02 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; | 0.9753 | 79 | 135 | 3.30.1490.10 |
| 3ofpH02 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; | 0.9619 | 78 | 135 | 3.30.1490.10 |
| 4pdbA01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; | 0.9475 | 4 | 77 | 3.30.1370.30 |
| 3uz6K02 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; | 0.9431 | 79 | 135 | 3.30.1490.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K0F3I4-F1-model_v4 | deleted | 1.003 | 76 | 135 |
|
| AF-A0A218L615-F1-model_v4 | Small ribosomal subunit protein uS8c (30S ribosomal protein S8, chloroplastic) | 1.003 | 79 | 135 |
GO:0003735
GO:0005840 GO:0006412 GO:0009507 GO:0019843 GO:1990904 |
| AF-A0A2V7XB09-F1-model_v4 | Small ribosomal subunit protein uS8 (30S ribosomal protein S8) | 1 | 75 | 135 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7W1CCK0-F1-model_v4 | Small ribosomal subunit protein uS8 (30S ribosomal protein S8) | 0.9988 | 67 | 135 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-W1U493-F1-model_v4 | deleted | 0.9938 | 76 | 135 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar