F494880

General Info

Members Datasets Scaffolds Average Seq Length
1579 559 1579 134

Family's Representative Sequence

Representative Sequence 3300001977|JGI24746J21847_1049549|JGI24746J21847_10495491
Length 136
Sequence MSMTDPVADFLTRVRNAIQASHETVEIPASKLKIEMARILREQGYINAYELEDPNPDHPGSLIRITLKYAESDRRSAISGLKRVSRPGQRSYVGHGEIPKVLGGMGTAIVSTSHGVMTGHEARDAGVGGEVVAHVW

Samples

Sample ID Description Type Environment
1 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
19 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
22 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
93 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
94 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
95 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
96 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
97 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
98 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
99 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
100 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
101 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
105 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
106 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
107 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
108 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
109 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
110 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
111 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
112 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
115 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
119 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
120 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
125 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
126 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
127 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
130 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
131 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
132 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
133 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
134 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
135 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
136 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
137 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
140 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
141 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
142 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
143 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
144 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
145 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
146 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
147 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
150 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
156 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
158 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
221 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
225 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
226 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
227 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
228 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
229 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
230 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
231 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
232 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
233 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
234 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
235 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
236 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
237 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
238 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
239 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
240 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
241 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
242 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
243 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
244 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
245 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
246 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
247 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
248 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
249 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
250 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
251 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
252 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
253 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
254 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
255 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
256 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
257 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
258 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
259 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
260 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
261 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
262 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
263 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
264 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
265 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
266 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
267 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
268 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
269 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
270 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
271 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
272 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
273 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
274 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
275 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
276 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
277 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
278 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
279 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
280 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
281 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
282 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
283 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
284 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
285 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
286 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
287 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
289 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
290 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
291 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
292 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
293 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
294 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
295 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
296 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
297 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
298 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
299 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
300 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
301 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
302 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
303 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
304 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
305 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
306 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
307 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
308 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
309 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
310 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
311 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
312 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
313 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
314 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
315 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
316 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
317 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
318 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
319 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
320 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
321 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
322 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
323 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
324 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
325 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
326 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
327 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
328 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
329 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
330 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
331 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
332 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
333 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
334 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
335 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
336 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
337 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
338 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
339 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
340 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
341 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
342 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
343 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
344 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
345 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
346 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
347 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
348 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
349 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
350 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
351 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
352 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
353 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
354 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
355 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
356 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
357 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
358 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
359 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
360 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
361 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
362 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
363 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
364 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
365 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
366 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
367 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
368 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
369 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
370 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
371 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
372 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
373 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
374 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
375 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
376 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
377 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
378 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
379 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
380 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
381 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
382 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
383 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
384 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
385 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
386 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
387 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
388 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
389 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
390 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
391 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
392 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
393 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
394 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
395 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
396 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
397 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
398 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
399 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
400 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
401 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
402 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
403 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
404 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
405 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
406 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
407 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
408 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
409 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
410 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
411 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
412 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
413 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
442 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
447 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
448 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
449 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
450 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
453 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
454 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
455 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
456 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
457 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
458 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
459 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
460 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
461 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
462 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
463 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
464 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
465 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
466 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
467 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
468 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
469 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
470 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
471 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
472 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
473 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
474 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
475 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
476 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
477 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
478 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
479 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
480 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
481 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
482 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
483 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
484 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
485 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
486 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
487 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
488 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
489 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
490 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
491 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
492 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
493 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
494 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
495 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
496 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
497 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
498 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
499 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
500 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
501 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
502 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
503 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
504 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
505 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
506 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
507 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
508 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
509 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
510 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
511 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
512 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
513 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
514 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
515 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
516 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
517 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
518 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
519 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
520 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
521 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
522 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
523 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
524 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
525 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
526 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
527 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
528 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
529 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
530 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
531 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
532 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
533 3300059603 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
534 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
535 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
536 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
537 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
538 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
539 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
542 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
543 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
544 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
545 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
546 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
547 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
548 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
549 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
550 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
551 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
552 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
553 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
554 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
555 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
556 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
557 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
558 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
559 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.81
Metatranscriptomes 14.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.79
Nodule 0
Rhizoplane 6.4
Rhizosphere 88.66
Stem 0
Stem Tuber 0
Unclassified 2.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNBas_1001136 3300000531 Bacteria 1364
2 CNAas_1007538 3300000532 Bacteria 708
3 LJNas_1021309 3300000546 Bacteria 691
4 LJNas_1023594 3300000546 Unclassified 657
5 JGI24746J21847_1049549 3300001977 Bacteria 590
6 JGI24747J21853_1009491 3300001978 Bacteria 963
7 JGI24740J21852_10002914 3300001979 Bacteria 7630
8 JGI24739J22299_10186775 3300001989 Unclassified 609
9 JGI24737J22298_10084652 3300001990 Unclassified 942
10 JGI24743J22301_10030734 3300001991 Unclassified 1057
11 JGI24738J21930_10023484 3300002075 Bacteria 1270
12 JGI24738J21930_10117691 3300002075 Bacteria 576
13 JGI24749J21850_1034758 3300002076 Bacteria 730
14 JGI24744J21845_10029145 3300002077 Unclassified 1061
15 JGI24742J22300_10064244 3300002244 Bacteria 678
16 JGI25406J46586_10005035 3300003203 Bacteria 6138
17 JGI25407J50210_10154854 3300003373 Bacteria 564
18 Ga0007416J51690_1053647 3300003577 Bacteria 2822
19 Ga0007429J51699_1087349 3300003579 Bacteria 527
20 Ga0058859_10022019 3300004798 Bacteria 1452
21 Ga0058859_10049905 3300004798 Bacteria 1986
22 Ga0058859_10122077 3300004798 Unclassified 712
23 Ga0058863_10080674 3300004799 Bacteria 1617
24 Ga0058863_11733789 3300004799 Bacteria 758
25 Ga0058863_11849541 3300004799 Bacteria 1772
26 Ga0058863_11960175 3300004799 Bacteria 1086
27 Ga0058863_11973879 3300004799 Bacteria 1531
28 Ga0058861_11880043 3300004800 Bacteria 1029
29 Ga0058861_12059017 3300004800 Bacteria 779
30 Ga0058860_10014153 3300004801 Bacteria 978
31 Ga0058860_10174803 3300004801 Bacteria 2316
32 Ga0058862_10148086 3300004803 Bacteria 1067
33 Ga0058862_10173070 3300004803 Bacteria 775
34 Ga0058862_12848635 3300004803 Bacteria 957
35 Ga0070658_10501997 3300005327 Bacteria 1048
36 Ga0070658_10687635 3300005327 Bacteria 888
37 Ga0070676_10260169 3300005328 Bacteria 1162
38 Ga0070683_100052331 3300005329 Bacteria 3782
39 Ga0070683_100116514 3300005329 Bacteria 2522
40 Ga0070683_100461992 3300005329 Bacteria 1212
41 Ga0070683_100736310 3300005329 Bacteria 944
42 Ga0070683_101167809 3300005329 Bacteria 740
43 Ga0070690_100010654 3300005330 Bacteria 5356
44 Ga0070690_100075543 3300005330 Bacteria 2197
45 Ga0070690_100163789 3300005330 Bacteria 1526
46 Ga0070690_100626478 3300005330 Bacteria 819
47 Ga0070690_100764046 3300005330 Bacteria 747
48 Ga0070690_101167670 3300005330 Bacteria 613
49 Ga0070670_100213810 3300005331 Bacteria 1677
50 Ga0070670_101090686 3300005331 Bacteria 728
51 Ga0070670_101311990 3300005331 Bacteria 663
52 Ga0070677_10160298 3300005333 Bacteria 1055
53 Ga0070677_10287340 3300005333 Bacteria 831
54 Ga0068869_100128198 3300005334 Bacteria 1948
55 Ga0068869_100240686 3300005334 Bacteria 1442
56 Ga0068869_100387514 3300005334 Bacteria 1147
57 Ga0068869_100903103 3300005334 Bacteria 764
58 Ga0068869_101317082 3300005334 Bacteria 637
59 Ga0070666_11480973 3300005335 Bacteria 508
60 Ga0070680_100571527 3300005336 Bacteria 970
61 Ga0070680_100763451 3300005336 Bacteria 833
62 Ga0070682_100059998 3300005337 Bacteria 2404
63 Ga0070682_100100622 3300005337 Bacteria 1907
64 Ga0070682_100996786 3300005337 Bacteria 695
65 Ga0070682_101395667 3300005337 Bacteria 599
66 Ga0070682_101835336 3300005337 Unclassified 530
67 Ga0068868_100048880 3300005338 Bacteria 3319
68 Ga0068868_100064173 3300005338 Bacteria 2915
69 Ga0068868_100165391 3300005338 Bacteria 1829
70 Ga0068868_100254888 3300005338 Bacteria 1478
71 Ga0068868_100269267 3300005338 Bacteria 1439
72 Ga0068868_100470831 3300005338 Bacteria 1096
73 Ga0068868_100578536 3300005338 Bacteria 993
74 Ga0070660_100008632 3300005339 Bacteria 7135
75 Ga0070660_100288131 3300005339 Bacteria 1344
76 Ga0070660_100356793 3300005339 Bacteria 1204
77 Ga0070660_100751585 3300005339 Bacteria 819
78 Ga0070689_100068670 3300005340 Bacteria 2764
79 Ga0070689_100108691 3300005340 Bacteria 2203
80 Ga0070689_100133287 3300005340 Bacteria 1993
81 Ga0070689_100643561 3300005340 Bacteria 922
82 Ga0070689_100683432 3300005340 Bacteria 895
83 Ga0070691_10036588 3300005341 Bacteria 2314
84 Ga0070691_10110512 3300005341 Bacteria 1374
85 Ga0070691_10128530 3300005341 Bacteria 1282
86 Ga0070687_100024182 3300005343 Bacteria 2896
87 Ga0070687_100183573 3300005343 Bacteria 1255
88 Ga0070687_100211976 3300005343 Bacteria 1181
89 Ga0070687_100263666 3300005343 Bacteria 1076
90 Ga0070687_100338030 3300005343 Bacteria 967
91 Ga0070661_100218035 3300005344 Bacteria 1463
92 Ga0070661_100295514 3300005344 Bacteria 1260
93 Ga0070661_100379628 3300005344 Bacteria 1114
94 Ga0070692_10035876 3300005345 Bacteria 2513
95 Ga0070692_10093594 3300005345 Bacteria 1637
96 Ga0070692_10308495 3300005345 Bacteria 969
97 Ga0070692_10463542 3300005345 Bacteria 814
98 Ga0070692_10641545 3300005345 Bacteria 708
99 Ga0070668_100058208 3300005347 Bacteria 2989
100 Ga0070668_100254569 3300005347 Bacteria 1458
101 Ga0070669_100355636 3300005353 Bacteria 1190
102 Ga0070669_100376888 3300005353 Bacteria 1156
103 Ga0070675_100049635 3300005354 Bacteria 3445
104 Ga0070675_100148038 3300005354 Bacteria 2011
105 Ga0070675_100814463 3300005354 Bacteria 854
106 Ga0070675_100926955 3300005354 Bacteria 799
107 Ga0070675_101472929 3300005354 Bacteria 628
108 Ga0070671_100171217 3300005355 Bacteria 1836
109 Ga0070671_100837907 3300005355 Bacteria 802
110 Ga0070674_100439922 3300005356 Bacteria 1074
111 Ga0070674_100957954 3300005356 Bacteria 749
112 Ga0070674_101127228 3300005356 Bacteria 694
113 Ga0070673_100135457 3300005364 Bacteria 2072
114 Ga0070673_100541607 3300005364 Bacteria 1057
115 Ga0070688_100011350 3300005365 Bacteria 4949
116 Ga0070688_100058478 3300005365 Bacteria 2427
117 Ga0070688_100201224 3300005365 Bacteria 1393
118 Ga0070688_100331614 3300005365 Bacteria 1109
119 Ga0070688_101588534 3300005365 Bacteria 534
120 Ga0070688_101697073 3300005365 Bacteria 517
121 Ga0070659_100226398 3300005366 Bacteria 1544
122 Ga0070659_100309709 3300005366 Bacteria 1318
123 Ga0070659_100705415 3300005366 Bacteria 873
124 Ga0070659_101176641 3300005366 Bacteria 677
125 Ga0070667_100417554 3300005367 Bacteria 1223
126 Ga0070667_100456329 3300005367 Bacteria 1168
127 Ga0070667_101599054 3300005367 Bacteria 613
128 Ga0070709_11036618 3300005434 Bacteria 654
129 Ga0070714_100126135 3300005435 Bacteria 2282
130 Ga0070714_100737126 3300005435 Bacteria 952
131 Ga0070714_101695932 3300005435 Bacteria 617
132 Ga0070713_101424794 3300005436 Bacteria 672
133 Ga0070713_101745789 3300005436 Bacteria 604
134 Ga0070710_10075464 3300005437 Bacteria 1954
135 Ga0070710_10113037 3300005437 Bacteria 1634
136 Ga0070710_10408617 3300005437 Bacteria 912
137 Ga0070701_10045375 3300005438 Bacteria 2255
138 Ga0070701_10612165 3300005438 Bacteria 723
139 Ga0070701_10794425 3300005438 Bacteria 645
140 Ga0070711_100002145 3300005439 Bacteria 11183
141 Ga0070711_100388833 3300005439 Bacteria 1130
142 Ga0070711_100431513 3300005439 Bacteria 1076
143 Ga0070711_100949338 3300005439 Bacteria 736
144 Ga0070705_100081071 3300005440 Bacteria 1992
145 Ga0070705_100692028 3300005440 Bacteria 800
146 Ga0070705_100810702 3300005440 Bacteria 746
147 Ga0070705_101041823 3300005440 Bacteria 666
148 Ga0070700_100014625 3300005441 Bacteria 4434
149 Ga0070700_100239406 3300005441 Bacteria 1296
150 Ga0070700_100373086 3300005441 Bacteria 1065
151 Ga0070700_100476139 3300005441 Unclassified 955
152 Ga0070700_100491668 3300005441 Bacteria 942
153 Ga0070700_100843368 3300005441 Bacteria 742
154 Ga0070700_101123187 3300005441 Bacteria 653
155 Ga0070700_101502058 3300005441 Bacteria 573
156 Ga0070700_102015478 3300005441 Bacteria 501
157 Ga0070694_100373262 3300005444 Bacteria 1111
158 Ga0070694_100980481 3300005444 Bacteria 701
159 Ga0070694_101203633 3300005444 Bacteria 635
160 Ga0070708_101348895 3300005445 Bacteria 666
161 Ga0070663_100178784 3300005455 Bacteria 1644
162 Ga0070678_100104611 3300005456 Bacteria 2202
163 Ga0070678_100688805 3300005456 Bacteria 920
164 Ga0070678_100719654 3300005456 Bacteria 901
165 Ga0070678_100853820 3300005456 Bacteria 830
166 Ga0070662_100020737 3300005457 Bacteria 4481
167 Ga0070662_100631379 3300005457 Bacteria 902
168 Ga0070662_100631411 3300005457 Bacteria 902
169 Ga0070662_101200231 3300005457 Bacteria 652
170 Ga0070662_101257807 3300005457 Bacteria 637
171 Ga0070681_10167503 3300005458 Bacteria 2119
172 Ga0070681_10263195 3300005458 Bacteria 1636
173 Ga0070681_10301885 3300005458 Bacteria 1511
174 Ga0070681_11193968 3300005458 Bacteria 683
175 Ga0068867_100053386 3300005459 Bacteria 2985
176 Ga0068867_101171712 3300005459 Bacteria 704
177 Ga0068867_101376040 3300005459 Bacteria 654
178 Ga0070685_10001772 3300005466 Bacteria 11292
179 Ga0070685_10023094 3300005466 Bacteria 3401
180 Ga0070685_10107992 3300005466 Bacteria 1710
181 Ga0070685_10214336 3300005466 Bacteria 1258
182 Ga0070685_10329969 3300005466 Bacteria 1037
183 Ga0070706_101171058 3300005467 Bacteria 707
184 Ga0070679_100061371 3300005530 Bacteria 3747
185 Ga0070679_100281248 3300005530 Bacteria 1616
186 Ga0070679_100434053 3300005530 Bacteria 1258
187 Ga0070679_100854135 3300005530 Bacteria 853
188 Ga0070679_100859131 3300005530 Bacteria 851
189 Ga0070679_101088965 3300005530 Bacteria 744
190 Ga0070679_101105160 3300005530 Bacteria 737
191 Ga0070684_100036894 3300005535 Bacteria 4190
192 Ga0070684_100038986 3300005535 Bacteria 4085
193 Ga0070684_100056012 3300005535 Bacteria 3439
194 Ga0070684_100073453 3300005535 Bacteria 3013
195 Ga0070684_100284704 3300005535 Bacteria 1515
196 Ga0070684_100459211 3300005535 Bacteria 1178
197 Ga0070684_100666851 3300005535 Bacteria 969
198 Ga0070684_101738042 3300005535 Bacteria 589
199 Ga0068853_100635959 3300005539 Bacteria 1015
200 Ga0068853_100767835 3300005539 Bacteria 922
201 Ga0068853_102212591 3300005539 Bacteria 533
202 Ga0070672_100119315 3300005543 Bacteria 2157
203 Ga0070672_100159691 3300005543 Bacteria 1869
204 Ga0070672_100366786 3300005543 Bacteria 1230
205 Ga0070686_100068990 3300005544 Bacteria 2307
206 Ga0070686_100134832 3300005544 Bacteria 1712
207 Ga0070686_100179547 3300005544 Bacteria 1503
208 Ga0070686_101012684 3300005544 Bacteria 682
209 Ga0070696_100245985 3300005546 Bacteria 1351
210 Ga0070665_100090116 3300005548 Bacteria 3073
211 Ga0070665_100681997 3300005548 Bacteria 1040
212 Ga0070665_100841054 3300005548 Bacteria 931
213 Ga0070665_101452599 3300005548 Bacteria 695
214 Ga0070704_100198834 3300005549 Bacteria 1617
215 Ga0070704_100334782 3300005549 Bacteria 1273
216 Ga0070704_100535073 3300005549 Bacteria 1022
217 Ga0070704_100813022 3300005549 Bacteria 836
218 Ga0068855_100253211 3300005563 Bacteria 1964
219 Ga0068855_100497070 3300005563 Bacteria 1326
220 Ga0070664_100038200 3300005564 Bacteria 4040
221 Ga0070664_100104636 3300005564 Bacteria 2464
222 Ga0070664_100136855 3300005564 Bacteria 2154
223 Ga0070664_100163037 3300005564 Bacteria 1973
224 Ga0070664_100255965 3300005564 Bacteria 1575
225 Ga0070664_101131440 3300005564 Bacteria 738
226 Ga0068857_100229760 3300005577 Bacteria 1697
227 Ga0068857_100472271 3300005577 Bacteria 1175
228 Ga0068857_101491634 3300005577 Bacteria 659
229 Ga0068857_102158402 3300005577 Bacteria 547
230 Ga0068854_100211908 3300005578 Bacteria 1528
231 Ga0068854_100276299 3300005578 Bacteria 1351
232 Ga0068854_101440939 3300005578 Bacteria 624
233 Ga0068854_102075383 3300005578 Bacteria 525
234 Ga0068856_100299899 3300005614 Bacteria 1624
235 Ga0068856_100682409 3300005614 Bacteria 1048
236 Ga0068856_101347288 3300005614 Bacteria 728
237 Ga0070702_100064234 3300005615 Bacteria 2147
238 Ga0070702_100078971 3300005615 Bacteria 1966
239 Ga0070702_100100832 3300005615 Bacteria 1770
240 Ga0070702_100128944 3300005615 Bacteria 1594
241 Ga0070702_100168715 3300005615 Bacteria 1422
242 Ga0070702_100170116 3300005615 Bacteria 1417
243 Ga0070702_100257237 3300005615 Bacteria 1187
244 Ga0070702_100912812 3300005615 Bacteria 688
245 Ga0068852_100058425 3300005616 Bacteria 3341
246 Ga0068852_100599629 3300005616 Bacteria 1105
247 Ga0068852_100896738 3300005616 Bacteria 904
248 Ga0068852_101356646 3300005616 Bacteria 733
249 Ga0068859_100378791 3300005617 Bacteria 1510
250 Ga0068859_100682304 3300005617 Bacteria 1118
251 Ga0068859_100857652 3300005617 Bacteria 994
252 Ga0068864_100037025 3300005618 Bacteria 4161
253 Ga0068864_100310300 3300005618 Bacteria 1479
254 Ga0068864_100352015 3300005618 Bacteria 1390
255 Ga0068864_100502352 3300005618 Bacteria 1167
256 Ga0068866_10036975 3300005718 Bacteria 2395
257 Ga0068866_10085681 3300005718 Bacteria 1703
258 Ga0068866_10147966 3300005718 Bacteria 1357
259 Ga0068866_10997026 3300005718 Bacteria 595
260 Ga0068861_100047582 3300005719 Bacteria 3238
261 Ga0068861_100267705 3300005719 Bacteria 1466
262 Ga0068861_100294672 3300005719 Bacteria 1402
263 Ga0068861_100305573 3300005719 Bacteria 1379
264 Ga0068851_10097895 3300005834 Bacteria 1553
265 Ga0068851_10118258 3300005834 Bacteria 1422
266 Ga0068851_10465960 3300005834 Bacteria 753
267 Ga0068870_10171657 3300005840 Bacteria 1294
268 Ga0068870_10195990 3300005840 Bacteria 1222
269 Ga0068870_10317657 3300005840 Bacteria 988
270 Ga0068870_10624912 3300005840 Bacteria 735
271 Ga0068870_10757944 3300005840 Bacteria 675
272 Ga0068870_10843130 3300005840 Bacteria 643
273 Ga0068870_11233735 3300005840 Bacteria 542
274 Ga0068863_100472171 3300005841 Bacteria 1233
275 Ga0068863_100869449 3300005841 Unclassified 901
276 Ga0068863_100975030 3300005841 Bacteria 850
277 Ga0068858_100119037 3300005842 Bacteria 2469
278 Ga0068858_100170708 3300005842 Bacteria 2051
279 Ga0068858_100581217 3300005842 Bacteria 1086
280 Ga0068858_100790000 3300005842 Bacteria 926
281 Ga0068858_100838519 3300005842 Bacteria 898
282 Ga0068858_101339832 3300005842 Bacteria 705
283 Ga0068860_100194759 3300005843 Bacteria 1962
284 Ga0068860_101889726 3300005843 Bacteria 619
285 Ga0068860_102778411 3300005843 Bacteria 508
286 Ga0068862_100125512 3300005844 Bacteria 2266
287 Ga0068862_100628815 3300005844 Bacteria 1033
288 Ga0068862_100738553 3300005844 Bacteria 957
289 Ga0081455_10023793 3300005937 Bacteria 5692
290 Ga0081455_10049901 3300005937 Bacteria 3604
291 Ga0081455_10074703 3300005937 Bacteria 2799
292 Ga0081455_10143774 3300005937 Bacteria 1848
293 Ga0081538_10005811 3300005981 Bacteria 10995
294 Ga0081538_10012937 3300005981 Bacteria 6648
295 Ga0081538_10018887 3300005981 Bacteria 5153
296 Ga0081538_10134898 3300005981 Bacteria 1151
297 Ga0081538_10344944 3300005981 Bacteria 540
298 Ga0081540_1016109 3300005983 Bacteria 4699
299 Ga0081540_1054747 3300005983 Bacteria 1947
300 Ga0081539_10001787 3300005985 Bacteria 34104
301 Ga0081539_10099531 3300005985 Bacteria 1485
302 Ga0070717_10012633 3300006028 Bacteria 6443
303 Ga0070717_10177795 3300006028 Bacteria 1853
304 Ga0075365_10112993 3300006038 Bacteria 1868
305 Ga0075365_10122363 3300006038 Bacteria 1796
306 Ga0075365_10426387 3300006038 Bacteria 936
307 Ga0075365_10934141 3300006038 Bacteria 611
308 Ga0075363_100041450 3300006048 Bacteria 2428
309 Ga0075364_10093604 3300006051 Bacteria 1995
310 Ga0075364_10744486 3300006051 Bacteria 669
311 Ga0075364_11053629 3300006051 Bacteria 552
312 Ga0075432_10128863 3300006058 Bacteria 957
313 Ga0070716_100336972 3300006173 Bacteria 1063
314 Ga0070716_100479465 3300006173 Unclassified 913
315 Ga0070712_100012973 3300006175 Bacteria 5312
316 Ga0070712_100063431 3300006175 Bacteria 2616
317 Ga0070712_100102308 3300006175 Bacteria 2121
318 Ga0070712_100130781 3300006175 Bacteria 1902
319 Ga0070712_101806742 3300006175 Bacteria 535
320 Ga0075367_10035159 3300006178 Bacteria 2899
321 Ga0097621_100233018 3300006237 Bacteria 1608
322 Ga0097621_100749330 3300006237 Bacteria 902
323 Ga0097621_101422411 3300006237 Bacteria 657
324 Ga0097621_102371210 3300006237 Bacteria 508
325 Ga0068871_100046531 3300006358 Bacteria 3495
326 Ga0068871_100787265 3300006358 Bacteria 876
327 Ga0068871_101051587 3300006358 Bacteria 760
328 Ga0075428_100254576 3300006844 Bacteria 1891
329 Ga0075428_101672818 3300006844 Bacteria 664
330 Ga0075430_100021314 3300006846 Bacteria 5509
331 Ga0075430_100557860 3300006846 Bacteria 945
332 Ga0075430_100578407 3300006846 Bacteria 926
333 Ga0075431_102060875 3300006847 Bacteria 525
334 Ga0075433_10061451 3300006852 Bacteria 3291
335 Ga0075434_100037786 3300006871 Bacteria 4780
336 Ga0075429_101619717 3300006880 Bacteria 563
337 Ga0068865_100107285 3300006881 Bacteria 2054
338 Ga0068865_100157423 3300006881 Bacteria 1729
339 Ga0068865_100521375 3300006881 Bacteria 994
340 Ga0068865_100820322 3300006881 Bacteria 804
341 Ga0068865_101329792 3300006881 Bacteria 640
342 Ga0068865_101783039 3300006881 Bacteria 556
343 Ga0075436_100068380 3300006914 Bacteria 2454
344 Ga0097620_100378789 3300006931 Bacteria 1510
345 Ga0097620_100682330 3300006931 Bacteria 1118
346 Ga0097620_100857797 3300006931 Bacteria 994
347 Ga0075435_100124548 3300007076 Bacteria 2153
348 Ga0075435_100890484 3300007076 Bacteria 776
349 Ga0099795_10066844 3300007788 Bacteria 1347
350 Ga0105240_10006736 3300009093 Bacteria 16822
351 Ga0105240_10653742 3300009093 Bacteria 1152
352 Ga0105240_10658346 3300009093 Bacteria 1147
353 Ga0105240_10724132 3300009093 Bacteria 1084
354 Ga0111539_10091686 3300009094 Bacteria 3570
355 Ga0111539_10269084 3300009094 Bacteria 1984
356 Ga0111539_10867289 3300009094 Bacteria 1050
357 Ga0111539_11553093 3300009094 Bacteria 768
358 Ga0111539_12442123 3300009094 Bacteria 606
359 Ga0111539_12482805 3300009094 Bacteria 601
360 Ga0111539_12642813 3300009094 Bacteria 582
361 Ga0105245_10000528 3300009098 Bacteria 35016
362 Ga0105245_10133984 3300009098 Bacteria 2326
363 Ga0105245_10271349 3300009098 Bacteria 1655
364 Ga0105245_10287401 3300009098 Bacteria 1609
365 Ga0105245_10664590 3300009098 Bacteria 1073
366 Ga0105245_11223389 3300009098 Bacteria 799
367 Ga0105245_11295828 3300009098 Unclassified 777
368 Ga0105245_11754941 3300009098 Bacteria 673
369 Ga0105245_11922020 3300009098 Bacteria 645
370 Ga0105245_12179872 3300009098 Bacteria 608
371 Ga0105247_10000064 3300009101 Bacteria 123994
372 Ga0105247_10829816 3300009101 Bacteria 708
373 Ga0105247_10966366 3300009101 Bacteria 663
374 Ga0114129_10069437 3300009147 Bacteria 4911
375 Ga0114129_11181798 3300009147 Bacteria 954
376 Ga0114129_11453555 3300009147 Bacteria 844
377 Ga0114129_12152298 3300009147 Bacteria 672
378 Ga0105243_10051478 3300009148 Bacteria 3257
379 Ga0105243_10203167 3300009148 Bacteria 1739
380 Ga0105243_10215376 3300009148 Bacteria 1694
381 Ga0105243_10346988 3300009148 Bacteria 1362
382 Ga0105243_10695140 3300009148 Bacteria 991
383 Ga0105243_10698320 3300009148 Bacteria 989
384 Ga0105243_11304383 3300009148 Bacteria 743
385 Ga0105243_12056873 3300009148 Bacteria 606
386 Ga0105241_10128163 3300009174 Bacteria 2051
387 Ga0105241_10347375 3300009174 Bacteria 1287
388 Ga0105241_10724900 3300009174 Bacteria 910
389 Ga0105241_11028271 3300009174 Bacteria 772
390 Ga0105242_10003277 3300009176 Bacteria 12618
391 Ga0105242_10183321 3300009176 Bacteria 1848
392 Ga0105242_11162749 3300009176 Bacteria 789
393 Ga0105242_11395880 3300009176 Bacteria 728
394 Ga0105248_10182568 3300009177 Bacteria 2364
395 Ga0105248_10427647 3300009177 Bacteria 1491
396 Ga0105248_10877181 3300009177 Bacteria 1013
397 Ga0105248_11105198 3300009177 Bacteria 896
398 Ga0105248_11497626 3300009177 Unclassified 764
399 Ga0105248_11680721 3300009177 Bacteria 720
400 Ga0105237_10000795 3300009545 Bacteria 43136
401 Ga0105237_10037314 3300009545 Bacteria 4913
402 Ga0105237_10703485 3300009545 Bacteria 1017
403 Ga0105237_10727930 3300009545 Bacteria 998
404 Ga0105238_10159249 3300009551 Bacteria 2233
405 Ga0105238_10599601 3300009551 Bacteria 1109
406 Ga0105238_10689752 3300009551 Bacteria 1033
407 Ga0105238_10787619 3300009551 Bacteria 966
408 Ga0105238_10985094 3300009551 Bacteria 864
409 Ga0105238_11062052 3300009551 Bacteria 832
410 Ga0105249_10010014 3300009553 Bacteria 8319
411 Ga0105249_10027935 3300009553 Bacteria 5092
412 Ga0105249_10472886 3300009553 Bacteria 1295
413 Ga0105249_10651314 3300009553 Bacteria 1111
414 Ga0105249_11172973 3300009553 Bacteria 839
415 Ga0105249_11257564 3300009553 Bacteria 812
416 Ga0105249_11314175 3300009553 Bacteria 795
417 Ga0105249_11363762 3300009553 Bacteria 781
418 Ga0105239_10189923 3300010375 Bacteria 2299
419 Ga0105239_10344229 3300010375 Bacteria 1683
420 Ga0105239_10395555 3300010375 Bacteria 1563
421 Ga0105239_10670675 3300010375 Bacteria 1185
422 Ga0105239_11198363 3300010375 Bacteria 875
423 Ga0105239_11312312 3300010375 Bacteria 835
424 Ga0105239_12320804 3300010375 Unclassified 624
425 Ga0105246_10252569 3300011119 Bacteria 1400
426 Ga0105246_10310273 3300011119 Bacteria 1277
427 Ga0105246_10488611 3300011119 Bacteria 1043
428 Ga0105246_10951919 3300011119 Bacteria 774
429 Ga0105246_11188359 3300011119 Bacteria 701
430 Ga0157322_1003805 3300012490 Bacteria 948
431 Ga0157335_1016465 3300012492 Bacteria 660
432 Ga0157373_10109642 3300013100 Bacteria 1941
433 Ga0157371_10324864 3300013102 Bacteria 1117
434 Ga0157371_11609083 3300013102 Bacteria 509
435 Ga0157370_11191915 3300013104 Bacteria 687
436 Ga0157370_11197106 3300013104 Bacteria 685
437 Ga0157369_10000068 3300013105 Bacteria 144274
438 Ga0157369_10273564 3300013105 Bacteria 1760
439 Ga0157369_10475474 3300013105 Bacteria 1293
440 Ga0157369_10589793 3300013105 Bacteria 1148
441 Ga0157369_11183365 3300013105 Bacteria 780
442 Ga0157369_11879110 3300013105 Bacteria 608
443 Ga0157374_10129448 3300013296 Bacteria 2442
444 Ga0157374_10200275 3300013296 Bacteria 1955
445 Ga0157374_10442804 3300013296 Bacteria 1300
446 Ga0157374_10761911 3300013296 Bacteria 983
447 Ga0157374_11820053 3300013296 Bacteria 634
448 Ga0157374_12858385 3300013296 Bacteria 510
449 Ga0157378_10087024 3300013297 Bacteria 2833
450 Ga0157378_10093534 3300013297 Bacteria 2737
451 Ga0157378_10098811 3300013297 Bacteria 2662
452 Ga0157378_11173485 3300013297 Unclassified 807
453 Ga0157378_12191975 3300013297 Bacteria 604
454 Ga0163162_10408973 3300013306 Bacteria 1490
455 Ga0163162_10442697 3300013306 Bacteria 1432
456 Ga0163162_10617802 3300013306 Bacteria 1209
457 Ga0163162_10894844 3300013306 Bacteria 1001
458 Ga0163162_11452811 3300013306 Bacteria 781
459 Ga0163162_12625921 3300013306 Bacteria 580
460 Ga0157372_10085083 3300013307 Bacteria 3586
461 Ga0157372_10274420 3300013307 Bacteria 1960
462 Ga0157372_10553882 3300013307 Bacteria 1340
463 Ga0157372_10779128 3300013307 Bacteria 1112
464 Ga0157372_10927850 3300013307 Bacteria 1009
465 Ga0157372_11708082 3300013307 Bacteria 724
466 Ga0157372_12598440 3300013307 Bacteria 581
467 Ga0157372_12974731 3300013307 Bacteria 542
468 Ga0157375_10260991 3300013308 Bacteria 1894
469 Ga0157375_10902761 3300013308 Bacteria 1027
470 Ga0157375_11400967 3300013308 Bacteria 823
471 Ga0157375_12103571 3300013308 Bacteria 672
472 Ga0157375_12160949 3300013308 Unclassified 663
473 Ga0163163_10207803 3300014325 Bacteria 2006
474 Ga0163163_10275798 3300014325 Bacteria 1733
475 Ga0163163_10338021 3300014325 Bacteria 1561
476 Ga0163163_10568416 3300014325 Bacteria 1197
477 Ga0163163_10689529 3300014325 Bacteria 1085
478 Ga0157380_10796907 3300014326 Bacteria 961
479 Ga0157380_11023414 3300014326 Bacteria 861
480 Ga0157380_11027663 3300014326 Bacteria 859
481 Ga0157380_11731749 3300014326 Bacteria 683
482 Ga0157380_12680162 3300014326 Bacteria 565
483 Ga0157380_12945135 3300014326 Bacteria 542
484 Ga0157377_10347050 3300014745 Bacteria 995
485 Ga0157377_10887749 3300014745 Bacteria 665
486 Ga0157377_11083124 3300014745 Bacteria 613
487 Ga0157377_11408772 3300014745 Bacteria 550
488 Ga0157379_10595549 3300014968 Unclassified 1032
489 Ga0157379_10689748 3300014968 Bacteria 958
490 Ga0157379_11509206 3300014968 Bacteria 654
491 Ga0157376_10187306 3300014969 Bacteria 1895
492 Ga0157376_10332356 3300014969 Bacteria 1448
493 Ga0157376_10347270 3300014969 Bacteria 1419
494 Ga0157376_10696859 3300014969 Bacteria 1020
495 Ga0157376_10745563 3300014969 Bacteria 988
496 Ga0157376_12029854 3300014969 Bacteria 613
497 Ga0157376_12232786 3300014969 Bacteria 586
498 Ga0163161_10166675 3300017792 Bacteria 1682
499 Ga0163161_10260041 3300017792 Bacteria 1355
500 Ga0163161_10690939 3300017792 Bacteria 849
501 Ga0197907_10260649 3300020069 Bacteria 703
502 Ga0197907_11160759 3300020069 Bacteria 886
503 Ga0206356_10156694 3300020070 Bacteria 771
504 Ga0206356_10459118 3300020070 Bacteria 556
505 Ga0206356_10527733 3300020070 Bacteria 1176
506 Ga0206356_10919035 3300020070 Bacteria 650
507 Ga0206356_11545250 3300020070 Bacteria 561
508 Ga0206355_1550264 3300020076 Bacteria 639
509 Ga0206351_10035649 3300020077 Bacteria 1240
510 Ga0206352_10502868 3300020078 Bacteria 667
511 Ga0206352_10895791 3300020078 Unclassified 904
512 Ga0206350_10403330 3300020080 Bacteria 1107
513 Ga0206350_11621122 3300020080 Bacteria 872
514 Ga0206354_10395992 3300020081 Bacteria 594
515 Ga0206354_10577140 3300020081 Bacteria 1261
516 Ga0206354_10729251 3300020081 Bacteria 557
517 Ga0206354_10754954 3300020081 Bacteria 552
518 Ga0206353_10349727 3300020082 Bacteria 979
519 Ga0206353_10441693 3300020082 Bacteria 1603
520 Ga0206353_10938401 3300020082 Bacteria 1017
521 Ga0206353_11230023 3300020082 Bacteria 937
522 Ga0213874_10425682 3300021377 Bacteria 520
523 Ga0224712_10175186 3300022467 Bacteria 964
524 Ga0224712_10179169 3300022467 Bacteria 954
525 Ga0224712_10209681 3300022467 Bacteria 888
526 Ga0224712_10329666 3300022467 Bacteria 718
527 Ga0207426_1105583 3300025302 Bacteria 719
528 Ga0207656_10491943 3300025321 Bacteria 622
529 Ga0207682_10218795 3300025893 Bacteria 880
530 Ga0207682_10272464 3300025893 Bacteria 790
531 Ga0207692_10082034 3300025898 Bacteria 1727
532 Ga0207692_10100092 3300025898 Bacteria 1589
533 Ga0207642_10128502 3300025899 Bacteria 1319
534 Ga0207642_10328675 3300025899 Bacteria 895
535 Ga0207642_10386233 3300025899 Bacteria 834
536 Ga0207642_10803733 3300025899 Bacteria 598
537 Ga0207710_10000220 3300025900 Bacteria 50023
538 Ga0207710_10346056 3300025900 Bacteria 757
539 Ga0207688_10014487 3300025901 Bacteria 4286
540 Ga0207688_10077880 3300025901 Bacteria 1889
541 Ga0207688_10098651 3300025901 Bacteria 1684
542 Ga0207688_10427456 3300025901 Bacteria 824
543 Ga0207688_10578383 3300025901 Bacteria 707
544 Ga0207688_10765419 3300025901 Bacteria 611
545 Ga0207680_10217566 3300025903 Bacteria 1308
546 Ga0207647_10037449 3300025904 Bacteria 3076
547 Ga0207647_10785528 3300025904 Bacteria 513
548 Ga0207699_10412654 3300025906 Bacteria 963
549 Ga0207699_10640395 3300025906 Unclassified 776
550 Ga0207699_10839350 3300025906 Bacteria 676
551 Ga0207645_10194319 3300025907 Bacteria 1334
552 Ga0207643_10056455 3300025908 Bacteria 2233
553 Ga0207643_10060045 3300025908 Bacteria 2170
554 Ga0207643_10067248 3300025908 Bacteria 2056
555 Ga0207643_10085658 3300025908 Bacteria 1830
556 Ga0207643_10130984 3300025908 Bacteria 1492
557 Ga0207643_10620487 3300025908 Bacteria 697
558 Ga0207643_10910315 3300025908 Bacteria 570
559 Ga0207705_10121307 3300025909 Bacteria 1940
560 Ga0207705_10278631 3300025909 Bacteria 1280
561 Ga0207705_10861482 3300025909 Bacteria 702
562 Ga0207654_10112077 3300025911 Bacteria 1699
563 Ga0207654_10345644 3300025911 Bacteria 1023
564 Ga0207654_10940969 3300025911 Bacteria 627
565 Ga0207707_10120608 3300025912 Bacteria 2293
566 Ga0207707_10343294 3300025912 Bacteria 1287
567 Ga0207707_10778780 3300025912 Bacteria 798
568 Ga0207707_11014908 3300025912 Bacteria 680
569 Ga0207707_11111053 3300025912 Bacteria 644
570 Ga0207695_10024364 3300025913 Bacteria 6812
571 Ga0207671_10007459 3300025914 Bacteria 9487
572 Ga0207671_10756199 3300025914 Bacteria 772
573 Ga0207693_10042371 3300025915 Bacteria 3583
574 Ga0207693_10128045 3300025915 Bacteria 1996
575 Ga0207693_10401087 3300025915 Bacteria 1072
576 Ga0207663_10043259 3300025916 Bacteria 2757
577 Ga0207663_10148493 3300025916 Bacteria 1641
578 Ga0207663_10163174 3300025916 Bacteria 1575
579 Ga0207663_10237231 3300025916 Bacteria 1336
580 Ga0207663_10467160 3300025916 Bacteria 975
581 Ga0207663_11631421 3300025916 Bacteria 519
582 Ga0207660_10263503 3300025917 Bacteria 1364
583 Ga0207660_10314975 3300025917 Bacteria 1248
584 Ga0207660_10504940 3300025917 Bacteria 981
585 Ga0207660_10871599 3300025917 Bacteria 735
586 Ga0207660_11358589 3300025917 Bacteria 576
587 Ga0207662_10012124 3300025918 Bacteria 4797
588 Ga0207662_10012576 3300025918 Bacteria 4715
589 Ga0207662_10073909 3300025918 Bacteria 2069
590 Ga0207662_10178187 3300025918 Bacteria 1366
591 Ga0207662_10290548 3300025918 Bacteria 1084
592 Ga0207662_10314016 3300025918 Bacteria 1045
593 Ga0207662_10709232 3300025918 Bacteria 705
594 Ga0207657_10010857 3300025919 Bacteria 9060
595 Ga0207657_10086697 3300025919 Bacteria 2620
596 Ga0207657_10119705 3300025919 Bacteria 2167
597 Ga0207657_10240566 3300025919 Bacteria 1445
598 Ga0207657_10480692 3300025919 Bacteria 974
599 Ga0207657_10588065 3300025919 Bacteria 869
600 Ga0207649_10303873 3300025920 Bacteria 1167
601 Ga0207649_10732492 3300025920 Bacteria 768
602 Ga0207649_11188910 3300025920 Bacteria 602
603 Ga0207652_10035128 3300025921 Bacteria 4229
604 Ga0207652_10130550 3300025921 Bacteria 2241
605 Ga0207652_10383719 3300025921 Bacteria 1268
606 Ga0207652_10457008 3300025921 Bacteria 1151
607 Ga0207652_10545492 3300025921 Bacteria 1042
608 Ga0207652_11072276 3300025921 Bacteria 706
609 Ga0207694_10419362 3300025924 Bacteria 1115
610 Ga0207694_10434353 3300025924 Bacteria 1095
611 Ga0207694_10959882 3300025924 Bacteria 723
612 Ga0207650_10221288 3300025925 Bacteria 1524
613 Ga0207650_11484926 3300025925 Bacteria 576
614 Ga0207659_10075587 3300025926 Bacteria 2472
615 Ga0207687_10000025 3300025927 Bacteria 175177
616 Ga0207687_10097367 3300025927 Bacteria 2158
617 Ga0207687_10149376 3300025927 Bacteria 1781
618 Ga0207687_10167257 3300025927 Bacteria 1693
619 Ga0207687_10263470 3300025927 Bacteria 1375
620 Ga0207687_10760920 3300025927 Bacteria 825
621 Ga0207687_11258670 3300025927 Bacteria 636
622 Ga0207664_10176362 3300025929 Bacteria 1833
623 Ga0207664_10305464 3300025929 Bacteria 1401
624 Ga0207644_10672219 3300025931 Bacteria 863
625 Ga0207644_11098874 3300025931 Bacteria 668
626 Ga0207690_10055403 3300025932 Bacteria 2670
627 Ga0207690_10142127 3300025932 Bacteria 1770
628 Ga0207690_10327141 3300025932 Bacteria 1206
629 Ga0207690_10355275 3300025932 Bacteria 1160
630 Ga0207690_11411966 3300025932 Bacteria 582
631 Ga0207706_10056627 3300025933 Bacteria 3456
632 Ga0207706_10272226 3300025933 Bacteria 1478
633 Ga0207706_10274417 3300025933 Bacteria 1471
634 Ga0207706_10625895 3300025933 Bacteria 923
635 Ga0207706_11494648 3300025933 Bacteria 551
636 Ga0207686_10001614 3300025934 Bacteria 12622
637 Ga0207686_10967217 3300025934 Bacteria 690
638 Ga0207709_10052519 3300025935 Bacteria 2504
639 Ga0207709_10097825 3300025935 Bacteria 1934
640 Ga0207709_10300316 3300025935 Bacteria 1194
641 Ga0207709_10328423 3300025935 Bacteria 1147
642 Ga0207709_10679271 3300025935 Bacteria 822
643 Ga0207670_10040259 3300025936 Bacteria 3067
644 Ga0207670_10197632 3300025936 Bacteria 1526
645 Ga0207670_10440251 3300025936 Bacteria 1049
646 Ga0207669_10041848 3300025937 Bacteria 2670
647 Ga0207669_10564845 3300025937 Bacteria 920
648 Ga0207669_10605580 3300025937 Bacteria 891
649 Ga0207704_10281705 3300025938 Bacteria 1264
650 Ga0207704_10489642 3300025938 Bacteria 989
651 Ga0207704_10504860 3300025938 Bacteria 975
652 Ga0207704_10743348 3300025938 Bacteria 815
653 Ga0207665_10178516 3300025939 Bacteria 1537
654 Ga0207665_10191422 3300025939 Bacteria 1486
655 Ga0207665_10762533 3300025939 Bacteria 763
656 Ga0207665_11255041 3300025939 Bacteria 591
657 Ga0207691_10170989 3300025940 Bacteria 1903
658 Ga0207691_10325442 3300025940 Bacteria 1317
659 Ga0207711_10369155 3300025941 Bacteria 1331
660 Ga0207711_10610825 3300025941 Bacteria 1017
661 Ga0207711_11287322 3300025941 Bacteria 673
662 Ga0207689_10013833 3300025942 Bacteria 6875
663 Ga0207689_10264484 3300025942 Bacteria 1423
664 Ga0207689_10273876 3300025942 Bacteria 1397
665 Ga0207689_10278642 3300025942 Bacteria 1385
666 Ga0207661_10045956 3300025944 Bacteria 3460
667 Ga0207661_10126242 3300025944 Bacteria 2185
668 Ga0207661_10150775 3300025944 Bacteria 2009
669 Ga0207661_10429873 3300025944 Bacteria 1200
670 Ga0207661_11683660 3300025944 Bacteria 579
671 Ga0207679_10073821 3300025945 Bacteria 2582
672 Ga0207679_10345969 3300025945 Bacteria 1294
673 Ga0207679_10485459 3300025945 Bacteria 1100
674 Ga0207679_10696535 3300025945 Bacteria 922
675 Ga0207667_10237666 3300025949 Bacteria 1865
676 Ga0207667_11131185 3300025949 Bacteria 765
677 Ga0207651_11255239 3300025960 Bacteria 666
678 Ga0207712_10056246 3300025961 Bacteria 2771
679 Ga0207712_10438549 3300025961 Bacteria 1105
680 Ga0207712_11007244 3300025961 Bacteria 739
681 Ga0207712_11086161 3300025961 Bacteria 712
682 Ga0207712_11196174 3300025961 Bacteria 678
683 Ga0207712_11361899 3300025961 Bacteria 635
684 Ga0207668_10049888 3300025972 Bacteria 2880
685 Ga0207668_10114278 3300025972 Bacteria 2032
686 Ga0207668_10385218 3300025972 Bacteria 1181
687 Ga0207668_10542070 3300025972 Bacteria 1007
688 Ga0207668_10631785 3300025972 Bacteria 935
689 Ga0207668_10718649 3300025972 Bacteria 879
690 Ga0207668_10967723 3300025972 Bacteria 760
691 Ga0207640_10123688 3300025981 Bacteria 1858
692 Ga0207640_10135995 3300025981 Bacteria 1784
693 Ga0207640_10555145 3300025981 Bacteria 966
694 Ga0207640_10907629 3300025981 Bacteria 770
695 Ga0207640_11074355 3300025981 Bacteria 711
696 Ga0207658_10148842 3300025986 Bacteria 1905
697 Ga0207658_10367480 3300025986 Bacteria 1257
698 Ga0207658_11374086 3300025986 Bacteria 646
699 Ga0207677_10067197 3300026023 Bacteria 2510
700 Ga0207677_10118219 3300026023 Bacteria 1988
701 Ga0207677_10181177 3300026023 Bacteria 1657
702 Ga0207703_10229042 3300026035 Bacteria 1665
703 Ga0207703_10268366 3300026035 Bacteria 1545
704 Ga0207703_10303136 3300026035 Bacteria 1458
705 Ga0207703_10548517 3300026035 Bacteria 1090
706 Ga0207639_10037689 3300026041 Bacteria 3592
707 Ga0207639_10392748 3300026041 Bacteria 1248
708 Ga0207639_10648702 3300026041 Bacteria 976
709 Ga0207678_10022375 3300026067 Bacteria 5537
710 Ga0207678_10639574 3300026067 Bacteria 934
711 Ga0207678_10971943 3300026067 Bacteria 751
712 Ga0207678_11806138 3300026067 Bacteria 535
713 Ga0207708_10008513 3300026075 Bacteria 7595
714 Ga0207708_10025712 3300026075 Bacteria 4455
715 Ga0207708_10156614 3300026075 Bacteria 1796
716 Ga0207708_10160426 3300026075 Bacteria 1775
717 Ga0207708_10200996 3300026075 Bacteria 1590
718 Ga0207708_10211554 3300026075 Bacteria 1550
719 Ga0207708_10577552 3300026075 Bacteria 950
720 Ga0207708_10665828 3300026075 Bacteria 887
721 Ga0207702_10069350 3300026078 Bacteria 3031
722 Ga0207702_10090640 3300026078 Bacteria 2675
723 Ga0207702_10497876 3300026078 Bacteria 1188
724 Ga0207702_10835944 3300026078 Bacteria 911
725 Ga0207641_10612313 3300026088 Unclassified 1067
726 Ga0207641_10899230 3300026088 Bacteria 879
727 Ga0207641_11218650 3300026088 Bacteria 752
728 Ga0207641_11670822 3300026088 Unclassified 639
729 Ga0207648_10132395 3300026089 Bacteria 2195
730 Ga0207648_10188365 3300026089 Bacteria 1828
731 Ga0207648_10266533 3300026089 Bacteria 1529
732 Ga0207648_11484598 3300026089 Bacteria 637
733 Ga0207676_10428470 3300026095 Bacteria 1242
734 Ga0207676_10449587 3300026095 Bacteria 1214
735 Ga0207676_11056908 3300026095 Bacteria 801
736 Ga0207676_11177026 3300026095 Bacteria 759
737 Ga0207676_12096599 3300026095 Bacteria 564
738 Ga0207674_10059872 3300026116 Bacteria 3853
739 Ga0207674_10207862 3300026116 Bacteria 1907
740 Ga0207674_11752306 3300026116 Bacteria 589
741 Ga0207674_11793271 3300026116 Bacteria 581
742 Ga0207675_100024485 3300026118 Bacteria 5612
743 Ga0207675_100071876 3300026118 Bacteria 3235
744 Ga0207675_100284710 3300026118 Bacteria 1607
745 Ga0207675_100318748 3300026118 Bacteria 1517
746 Ga0207675_100485795 3300026118 Bacteria 1228
747 Ga0207675_100498973 3300026118 Bacteria 1211
748 Ga0207675_101110281 3300026118 Bacteria 811
749 Ga0207683_10025472 3300026121 Bacteria 5104
750 Ga0207683_10034774 3300026121 Bacteria 4381
751 Ga0207683_10408180 3300026121 Bacteria 1250
752 Ga0207683_10443152 3300026121 Bacteria 1197
753 Ga0207683_11128168 3300026121 Bacteria 727
754 Ga0207683_11605734 3300026121 Bacteria 600
755 Ga0207698_10151614 3300026142 Bacteria 2013
756 Ga0207698_10464413 3300026142 Bacteria 1225
757 Ga0207698_10657921 3300026142 Bacteria 1038
758 Ga0209998_10020598 3300027717 Bacteria 1412
759 Ga0207428_10120383 3300027907 Bacteria 2013
760 Ga0207428_10234728 3300027907 Bacteria 1372
761 Ga0268266_10104816 3300028379 Bacteria 2497
762 Ga0268266_10889140 3300028379 Bacteria 861
763 Ga0268266_10960170 3300028379 Bacteria 827
764 Ga0268266_12164523 3300028379 Bacteria 528
765 Ga0268265_10208156 3300028380 Bacteria 1702
766 Ga0268265_10411284 3300028380 Bacteria 1253
767 Ga0268265_10681929 3300028380 Bacteria 991
768 Ga0268265_11192463 3300028380 Bacteria 759
769 Ga0268264_10705856 3300028381 Bacteria 1002
770 Ga0268264_11894812 3300028381 Bacteria 606
771 Ga0265337_1000032 3300028556 Bacteria 61342
772 Ga0265326_10000040 3300028558 Bacteria 85624
773 Ga0265319_1000030 3300028563 Bacteria 129742
774 Ga0265319_1134426 3300028563 Bacteria 768
775 Ga0265323_10164080 3300028653 Bacteria 708
776 Ga0265322_10000012 3300028654 Bacteria 152373
777 Ga0265322_10010968 3300028654 Bacteria 2628
778 Ga0265336_10034584 3300028666 Bacteria 1561
779 Ga0307517_10533215 3300028786 Bacteria 590
780 Ga0307515_10050803 3300028794 Bacteria 6200
781 Ga0265338_10000156 3300028800 Bacteria 125065
782 Ga0265338_10059335 3300028800 Bacteria 3371
783 Ga0265338_10231483 3300028800 Bacteria 1374
784 Ga0265324_10017099 3300029957 Bacteria 2638
785 Ga0265324_10039877 3300029957 Bacteria 1628
786 Ga0307511_10115653 3300030521 Bacteria 1684
787 Ga0265332_10020220 3300031238 Bacteria 2939
788 Ga0265332_10025924 3300031238 Bacteria 2572
789 Ga0265328_10002899 3300031239 Bacteria 7647
790 Ga0265328_10029619 3300031239 Bacteria 2043
791 Ga0265320_10000001 3300031240 Bacteria 847191
792 Ga0265325_10024792 3300031241 Bacteria 3259
793 Ga0265329_10000919 3300031242 Bacteria 14805
794 Ga0265339_10008172 3300031249 Bacteria 6677
795 Ga0265339_10225767 3300031249 Bacteria 914
796 Ga0265331_10001467 3300031250 Bacteria 17360
797 Ga0265327_10000003 3300031251 Bacteria 852750
798 Ga0265327_10031033 3300031251 Bacteria 3009
799 Ga0265316_10003567 3300031344 Bacteria 15692
800 Ga0265316_10069538 3300031344 Bacteria 2717
801 Ga0265316_10143256 3300031344 Bacteria 1794
802 Ga0265316_10610282 3300031344 Bacteria 773
803 Ga0307513_10011625 3300031456 Bacteria 10928
804 Ga0307509_10000112 3300031507 Bacteria 117028
805 Ga0307509_10011836 3300031507 Bacteria 10500
806 Ga0307509_10342089 3300031507 Bacteria 1223
807 Ga0307509_10567741 3300031507 Bacteria 810
808 Ga0307408_100814173 3300031548 Bacteria 849
809 Ga0307408_101114411 3300031548 Bacteria 733
810 Ga0307408_102154780 3300031548 Bacteria 538
811 Ga0307408_102517028 3300031548 Bacteria 501
812 Ga0265313_10055372 3300031595 Bacteria 1879
813 Ga0307508_10019824 3300031616 Bacteria 6113
814 Ga0316579_10287984 3300031691 Bacteria 794
815 Ga0265314_10000178 3300031711 Bacteria 94070
816 Ga0265342_10000027 3300031712 Bacteria 158835
817 Ga0265342_10232963 3300031712 Bacteria 988
818 Ga0316576_10799457 3300031727 Bacteria 679
819 Ga0316578_10414904 3300031728 Bacteria 797
820 Ga0307516_10029367 3300031730 Bacteria 5559
821 Ga0307405_10033428 3300031731 Bacteria 3050
822 Ga0307405_10280288 3300031731 Bacteria 1254
823 Ga0307405_10716697 3300031731 Bacteria 830
824 Ga0307413_10044661 3300031824 Bacteria 2621
825 Ga0307413_10082713 3300031824 Bacteria 2063
826 Ga0307413_10151556 3300031824 Bacteria 1616
827 Ga0307413_10328433 3300031824 Bacteria 1171
828 Ga0307413_10821925 3300031824 Bacteria 783
829 Ga0307413_11114826 3300031824 Bacteria 682
830 Ga0307413_11334761 3300031824 Bacteria 629
831 Ga0307410_10044469 3300031852 Bacteria 2950
832 Ga0307410_10258101 3300031852 Bacteria 1358
833 Ga0307410_10266745 3300031852 Bacteria 1337
834 Ga0307410_10545719 3300031852 Bacteria 960
835 Ga0307410_10567990 3300031852 Bacteria 942
836 Ga0307410_11081542 3300031852 Bacteria 694
837 Ga0307410_11236762 3300031852 Bacteria 651
838 Ga0307410_11300851 3300031852 Bacteria 636
839 Ga0326468_10002313 3300031889 Bacteria 1590
840 Ga0326468_10018305 3300031889 Bacteria 808
841 Ga0307406_10000446 3300031901 Bacteria 24118
842 Ga0307406_10139417 3300031901 Bacteria 1714
843 Ga0307406_10159532 3300031901 Bacteria 1619
844 Ga0307406_10224195 3300031901 Bacteria 1399
845 Ga0307406_10265638 3300031901 Bacteria 1301
846 Ga0307406_10372485 3300031901 Bacteria 1123
847 Ga0307406_10708689 3300031901 Bacteria 841
848 Ga0307406_10783199 3300031901 Bacteria 803
849 Ga0307406_10993242 3300031901 Bacteria 720
850 Ga0307406_11177499 3300031901 Bacteria 665
851 Ga0307406_11847597 3300031901 Bacteria 538
852 Ga0307406_11867453 3300031901 Bacteria 535
853 Ga0307407_10039964 3300031903 Bacteria 2612
854 Ga0307407_10175869 3300031903 Bacteria 1414
855 Ga0307407_10232560 3300031903 Bacteria 1253
856 Ga0307407_10293767 3300031903 Bacteria 1130
857 Ga0307407_10419521 3300031903 Bacteria 964
858 Ga0307407_10709844 3300031903 Bacteria 758
859 Ga0307407_10767567 3300031903 Bacteria 731
860 Ga0307412_10253099 3300031911 Bacteria 1369
861 Ga0307412_10407525 3300031911 Bacteria 1109
862 Ga0307412_11257010 3300031911 Bacteria 665
863 Ga0307412_11941369 3300031911 Bacteria 544
864 Ga0307409_100128659 3300031995 Bacteria 2159
865 Ga0307409_100156161 3300031995 Bacteria 1988
866 Ga0307409_100179831 3300031995 Bacteria 1871
867 Ga0307409_100274970 3300031995 Bacteria 1553
868 Ga0307409_100278582 3300031995 Bacteria 1544
869 Ga0307409_100486157 3300031995 Bacteria 1199
870 Ga0307409_100695631 3300031995 Bacteria 1015
871 Ga0307409_100887963 3300031995 Bacteria 904
872 Ga0307409_100982899 3300031995 Bacteria 861
873 Ga0307409_101020673 3300031995 Bacteria 846
874 Ga0307409_101129999 3300031995 Bacteria 805
875 Ga0307409_101367888 3300031995 Bacteria 734
876 Ga0307409_102002568 3300031995 Bacteria 609
877 Ga0307416_100028261 3300032002 Bacteria 4167
878 Ga0307416_100365960 3300032002 Bacteria 1466
879 Ga0307416_100480353 3300032002 Bacteria 1302
880 Ga0307416_100556809 3300032002 Bacteria 1221
881 Ga0307416_100928300 3300032002 Bacteria 971
882 Ga0307416_101249613 3300032002 Bacteria 848
883 Ga0307416_102138600 3300032002 Bacteria 661
884 Ga0307416_102293180 3300032002 Bacteria 640
885 Ga0307414_10157137 3300032004 Bacteria 1802
886 Ga0307414_10227687 3300032004 Bacteria 1535
887 Ga0307414_10346983 3300032004 Bacteria 1273
888 Ga0307414_10560133 3300032004 Bacteria 1020
889 Ga0307414_10688168 3300032004 Bacteria 925
890 Ga0307414_10715807 3300032004 Bacteria 907
891 Ga0307414_10881573 3300032004 Bacteria 820
892 Ga0307414_10985361 3300032004 Bacteria 775
893 Ga0307411_10047285 3300032005 Bacteria 2781
894 Ga0307411_10228428 3300032005 Bacteria 1449
895 Ga0307411_10969451 3300032005 Bacteria 759
896 Ga0307411_11245521 3300032005 Bacteria 676
897 Ga0307411_11254122 3300032005 Bacteria 674
898 Ga0307411_12338354 3300032005 Bacteria 502
899 Ga0307415_100013486 3300032126 Bacteria 4772
900 Ga0307415_100042962 3300032126 Bacteria 3012
901 Ga0307415_100069318 3300032126 Bacteria 2472
902 Ga0307415_100103043 3300032126 Bacteria 2098
903 Ga0307415_100315083 3300032126 Bacteria 1302
904 Ga0307415_100733400 3300032126 Bacteria 895
905 Ga0307415_101190469 3300032126 Bacteria 717
906 Ga0307415_101318536 3300032126 Bacteria 684
907 Ga0307415_101883455 3300032126 Unclassified 580
908 Ga0316583_10235943 3300032133 Bacteria 634
909 Ga0307507_10213939 3300033179 Bacteria 1309
910 Ga0373958_0069772 3300034819 Bacteria 778
911 Ga0373959_0010441 3300034820 Bacteria 1622
912 Ga0373928_0083552 3300035084 Bacteria 809
913 Ga0373940_0172431 3300035088 Bacteria 700
914 Ga0373944_0144151 3300035089 Bacteria 835
915 Ga0373949_0000042 3300035090 Bacteria 46169
916 Ga0373952_0141808 3300035092 Bacteria 668
917 Ga0373936_0000006 3300035113 Bacteria 318697
918 Ga0373941_0026675 3300035115 Bacteria 1680
919 Ga0373941_0104248 3300035115 Bacteria 991
920 Ga0373954_0054565 3300035118 Bacteria 1879
921 Ga0373954_0186452 3300035118 Bacteria 1018
922 Ga0373956_0188630 3300035119 Bacteria 976
923 Ga0373961_0000015 3300035241 Bacteria 111392
924 Ga0316574_0033631 3300035398 Bacteria 3121
925 Ga0316574_0408493 3300035398 Bacteria 854
926 Ga0373931_0350671 3300035691 Bacteria 924
927 Ga0373931_0690626 3300035691 Bacteria 673
928 Ga0373935_0083638 3300035692 Bacteria 2078
929 Ga0373933_0600388 3300035724 Bacteria 723
930 Ga0373933_0946005 3300035724 Bacteria 567
931 Ga0373947_0773182 3300035725 Bacteria 655
932 Ga0373937_1686366 3300036401 Bacteria 581
933 Ga0265778_052958 3300036457 Bacteria 558
934 Ga0316582_0390143 3300036647 Bacteria 959
935 Ga0316584_0028035 3300036712 Bacteria 4149
936 Ga0373925_0143662 3300037068 Bacteria 1869
937 Ga0373925_0205941 3300037068 Bacteria 1566
938 Ga0395899_0234080 3300037312 Bacteria 1267
939 Ga0395899_0474264 3300037312 Bacteria 816
940 Ga0395900_0129946 3300037418 Bacteria 2582
941 Ga0395900_1173528 3300037418 Bacteria 684
942 Ga0395898_0255428 3300037466 Bacteria 1671
943 Ga0395898_0296456 3300037466 Bacteria 1543
944 Ga0395898_0426716 3300037466 Bacteria 1263
945 Ga0395898_0607110 3300037466 Bacteria 1037
946 Ga0395898_0730487 3300037466 Bacteria 932
947 Ga0395905_0225550 3300037471 Bacteria 1753
948 Ga0395905_0309184 3300037471 Bacteria 1469
949 Ga0436364_1395085 3300037853 Bacteria 738
950 Ga0395901_0124285 3300038443 Bacteria 2711
951 Ga0395901_1130784 3300038443 Bacteria 752
952 Ga0395901_1646832 3300038443 Bacteria 594
953 Ga0436365_0954496 3300039437 Unclassified 856
954 Ga0436365_1838581 3300039437 Bacteria 738
955 Ga0436361_0938094 3300039447 Bacteria 500
956 Ga0436363_0584301 3300039450 Bacteria 764
957 Ga0436363_0783584 3300039450 Bacteria 1168
958 Ga0436363_0986073 3300039450 Bacteria 964
959 Ga0439439_0222361 3300041406 Bacteria 554
960 Ga0439465_0086957 3300041413 Bacteria 1066
961 Ga0451789_0091105 3300041443 Bacteria 1199
962 Ga0451791_1353119 3300041451 Bacteria 3242
963 Ga0451793_0152428 3300041452 Unclassified 699
964 Ga0451797_0011443 3300041453 Bacteria 2103
965 Ga0451795_0406964 3300041456 Bacteria 1007
966 Ga0451800_0362132 3300041459 Bacteria 821
967 Ga0451802_0857638 3300041460 Bacteria 733
968 Ga0451807_1972304 3300041486 Bacteria 642
969 Ga0451833_0506572 3300041491 Bacteria 857
970 Ga0451837_0354457 3300041494 Bacteria 2586
971 Ga0451839_0224422 3300041496 Bacteria 677
972 Ga0451839_1373717 3300041496 Bacteria 848
973 Ga0451841_1193332 3300041498 Bacteria 1251
974 Ga0451847_0709139 3300041503 Bacteria 757
975 Ga0451843_0771766 3300041509 Bacteria 993
976 Ga0451853_0777436 3300041512 Bacteria 1101
977 Ga0451853_2037896 3300041512 Bacteria 2012
978 Ga0439450_058704 3300042008 Bacteria 926
979 Ga0439451_061574 3300042009 Bacteria 751
980 Ga0439455_0127718 3300042012 Bacteria 715
981 Ga0439463_017891 3300042016 Bacteria 1761
982 Ga0450914_002915 3300042118 Bacteria 1269
983 Ga0450905_054786 3300042142 Bacteria 657
984 Ga0439444_0001353 3300042437 Bacteria 3151
985 Ga0439459_0111886 3300042438 Bacteria 679
986 Ga0439459_0175930 3300042438 Bacteria 573
987 Ga0439459_0224239 3300042438 Bacteria 522
988 Ga0439464_0012839 3300042439 Bacteria 2235
989 Ga0450893_0048351 3300042532 Bacteria 793
990 Ga0451577_0179447 3300042876 Bacteria 1909
991 Ga0439440_0004989 3300042993 Bacteria 2620
992 Ga0466972_0287972 3300044658 Bacteria 768
993 Ga0466965_0146782 3300044683 Bacteria 1231
994 Ga0466965_0154339 3300044683 Bacteria 1201
995 Ga0466965_0160930 3300044683 Bacteria 1177
996 Ga0466965_0212249 3300044683 Bacteria 1029
997 Ga0466965_0367471 3300044683 Bacteria 790
998 Ga0466966_0093740 3300044684 Bacteria 1862
999 Ga0466966_0124012 3300044684 Bacteria 1585
1000 Ga0466961_0037057 3300044693 Bacteria 3130
1001 Ga0466961_0043779 3300044693 Bacteria 2866
1002 Ga0466961_0085337 3300044693 Bacteria 1997
1003 Ga0466961_0143493 3300044693 Bacteria 1494
1004 Ga0466961_0237936 3300044693 Bacteria 1120
1005 Ga0466961_0476411 3300044693 Bacteria 755
1006 Ga0466963_0031126 3300044694 Bacteria 3447
1007 Ga0466963_0089212 3300044694 Bacteria 2097
1008 Ga0466963_0096517 3300044694 Bacteria 2019
1009 Ga0466963_0157732 3300044694 Bacteria 1578
1010 Ga0466963_0231007 3300044694 Bacteria 1296
1011 Ga0466963_0352209 3300044694 Bacteria 1037
1012 Ga0466963_0399690 3300044694 Bacteria 969
1013 Ga0466963_0435733 3300044694 Bacteria 924
1014 Ga0466963_0651368 3300044694 Bacteria 743
1015 Ga0466963_1158883 3300044694 Bacteria 543
1016 Ga0466963_1182892 3300044694 Bacteria 537
1017 Ga0466964_0129233 3300044706 Bacteria 1148
1018 Ga0466964_0142785 3300044706 Bacteria 1102
1019 Ga0466964_0194842 3300044706 Bacteria 969
1020 Ga0466964_0245374 3300044706 Bacteria 880
1021 Ga0466964_0672203 3300044706 Bacteria 575
1022 Ga0453684_0048627 3300044712 Bacteria 5603
1023 Ga0466971_0002843 3300044719 Bacteria 7338
1024 Ga0466971_0029438 3300044719 Bacteria 2456
1025 Ga0466970_0191972 3300044765 Bacteria 1135
1026 Ga0466957_0061797 3300044842 Bacteria 2300
1027 Ga0466957_0068004 3300044842 Bacteria 2198
1028 Ga0466957_0165341 3300044842 Bacteria 1439
1029 Ga0466957_0195507 3300044842 Bacteria 1326
1030 Ga0466957_0214270 3300044842 Bacteria 1269
1031 Ga0466957_0365487 3300044842 Bacteria 981
1032 Ga0466957_0648431 3300044842 Bacteria 742
1033 Ga0466957_0940620 3300044842 Bacteria 619
1034 Ga0466957_1034381 3300044842 Bacteria 591
1035 Ga0466960_0047777 3300044901 Bacteria 2054
1036 Ga0466960_0059111 3300044901 Bacteria 1874
1037 Ga0466960_0063633 3300044901 Bacteria 1816
1038 Ga0466960_0128550 3300044901 Bacteria 1335
1039 Ga0466960_0272230 3300044901 Unclassified 947
1040 Ga0466960_0279688 3300044901 Bacteria 935
1041 Ga0466960_0324561 3300044901 Bacteria 873
1042 Ga0466959_0002215 3300045049 Bacteria 12379
1043 Ga0466959_0379434 3300045049 Bacteria 962
1044 Ga0466959_0473289 3300045049 Bacteria 848
1045 Ga0466958_0009429 3300045836 Bacteria 5439
1046 Ga0466958_0036236 3300045836 Bacteria 2952
1047 Ga0466958_0149264 3300045836 Bacteria 1474
1048 Ga0466958_0218590 3300045836 Bacteria 1215
1049 Ga0466958_0324134 3300045836 Bacteria 990
1050 Ga0466958_0397663 3300045836 Bacteria 889
1051 Ga0466967_0051187 3300045976 Bacteria 3618
1052 Ga0466967_0063703 3300045976 Bacteria 3277
1053 Ga0466967_0195274 3300045976 Bacteria 1914
1054 Ga0466967_0195449 3300045976 Bacteria 1913
1055 Ga0466967_0237690 3300045976 Bacteria 1736
1056 Ga0466967_0299080 3300045976 Bacteria 1548
1057 Ga0466967_0347328 3300045976 Bacteria 1435
1058 Ga0466967_0473383 3300045976 Bacteria 1226
1059 Ga0466967_0509116 3300045976 Bacteria 1182
1060 Ga0466967_0629057 3300045976 Bacteria 1060
1061 Ga0466967_0873946 3300045976 Bacteria 894
1062 Ga0466967_1543660 3300045976 Bacteria 661
1063 Ga0466967_1655969 3300045976 Unclassified 637
1064 Ga0466967_1736603 3300045976 Bacteria 621
1065 Ga0495592_0156082 3300046454 Bacteria 1574
1066 Ga0495592_0278055 3300046454 Bacteria 1096
1067 Ga0495603_0001557 3300046455 Bacteria 13416
1068 Ga0495603_0121963 3300046455 Bacteria 1519
1069 Ga0495603_0660462 3300046455 Bacteria 598
1070 Ga0495629_0228749 3300046459 Bacteria 1282
1071 Ga0495641_0550194 3300046461 Bacteria 527
1072 Ga0495651_0208618 3300046462 Bacteria 1361
1073 Ga0495651_0273325 3300046462 Bacteria 1145
1074 Ga0495651_0290830 3300046462 Bacteria 1099
1075 Ga0495653_0038646 3300046463 Bacteria 3745
1076 Ga0495653_0048075 3300046463 Bacteria 3296
1077 Ga0495653_0244336 3300046463 Bacteria 1194
1078 Ga0495639_0277131 3300046475 Bacteria 833
1079 Ga0495664_0000007 3300046477 Bacteria 386710
1080 Ga0495584_0415339 3300046491 Bacteria 684
1081 Ga0495594_0371583 3300046499 Bacteria 814
1082 Ga0495596_0209206 3300046500 Bacteria 758
1083 Ga0495608_0482999 3300046511 Bacteria 751
1084 Ga0495608_0630679 3300046511 Bacteria 642
1085 Ga0495616_0459792 3300046513 Bacteria 514
1086 Ga0495618_0000035 3300046514 Bacteria 102739
1087 Ga0495620_0072092 3300046515 Bacteria 1411
1088 Ga0495628_0443878 3300046516 Bacteria 943
1089 Ga0495630_0000610 3300046517 Bacteria 25880
1090 Ga0495630_0286116 3300046517 Bacteria 1260
1091 Ga0495631_0264249 3300046518 Bacteria 733
1092 Ga0495631_0433624 3300046518 Bacteria 560
1093 Ga0495632_0049233 3300046519 Bacteria 2084
1094 Ga0495632_0333435 3300046519 Bacteria 669
1095 Ga0495652_0395835 3300046529 Bacteria 979
1096 Ga0495640_0391021 3300046533 Bacteria 855
1097 Ga0495587_0068002 3300046536 Bacteria 2076
1098 Ga0495609_0237259 3300046538 Bacteria 754
1099 Ga0495645_0000033 3300046543 Bacteria 105930
1100 Ga0495645_0056355 3300046543 Bacteria 2854
1101 Ga0495622_0275289 3300046557 Bacteria 737
1102 Ga0495667_0000067 3300046559 Bacteria 81751
1103 Ga0495667_0750782 3300046559 Bacteria 603
1104 Ga0495656_0101624 3300046615 Bacteria 1331
1105 Ga0495656_0599253 3300046615 Bacteria 590
1106 Ga0495625_0206025 3300046660 Bacteria 1295
1107 Ga0495635_0041495 3300046663 Bacteria 3178
1108 Ga0495635_0458442 3300046663 Bacteria 842
1109 Ga0495635_0557190 3300046663 Bacteria 751
1110 Ga0495635_0862179 3300046663 Bacteria 581
1111 Ga0495588_0166115 3300046674 Bacteria 1167
1112 Ga0495588_0499820 3300046674 Bacteria 637
1113 Ga0495657_0000027 3300046675 Bacteria 131421
1114 Ga0495623_0205792 3300046679 Bacteria 1129
1115 Ga0495646_0375651 3300046680 Bacteria 742
1116 Ga0495647_0193224 3300046681 Bacteria 890
1117 Ga0495658_0330886 3300046683 Bacteria 967
1118 Ga0495613_0278464 3300046689 Bacteria 1162
1119 Ga0495624_0053715 3300046690 Bacteria 2543
1120 Ga0495624_0442408 3300046690 Bacteria 779
1121 Ga0495649_0024919 3300046694 Bacteria 3333
1122 Ga0495649_0120320 3300046694 Bacteria 1389
1123 Ga0495649_0425579 3300046694 Bacteria 665
1124 Ga0495589_0219446 3300046794 Bacteria 894
1125 Ga0495589_0273092 3300046794 Bacteria 787
1126 Ga0495581_0182687 3300047315 Bacteria 1227
1127 Ga0495604_0139930 3300047317 Bacteria 1730
1128 Ga0495604_0555324 3300047317 Bacteria 740
1129 Ga0495674_0100939 3300047319 Bacteria 2455
1130 Ga0495674_0141365 3300047319 Bacteria 2023
1131 Ga0495676_0099183 3300047321 Bacteria 2159
1132 Ga0495676_1018818 3300047321 Bacteria 528
1133 Ga0495680_0009089 3300047322 Bacteria 8968
1134 Ga0495680_0009545 3300047322 Bacteria 8718
1135 Ga0495680_0165161 3300047322 Bacteria 1606
1136 Ga0495680_0294664 3300047322 Bacteria 1140
1137 Ga0495683_0335953 3300047323 Bacteria 641
1138 Ga0495675_0094566 3300047444 Bacteria 1874
1139 Ga0495677_0334785 3300047445 Bacteria 597
1140 Ga0495684_0066049 3300047471 Bacteria 2751
1141 Ga0495684_0388357 3300047471 Bacteria 983
1142 Ga0495684_0900927 3300047471 Bacteria 570
1143 Ga0495686_0016492 3300047472 Bacteria 5009
1144 Ga0495593_0211509 3300047673 Bacteria 974
1145 Ga0495602_0160403 3300048088 Bacteria 1756
1146 Ga0495602_0227893 3300048088 Bacteria 1402
1147 Ga0495602_0959830 3300048088 Unclassified 566
1148 Ga0495615_0165358 3300048090 Bacteria 667
1149 Ga0496100_0024347 3300048903 Bacteria 3692
1150 Ga0496100_0436162 3300048903 Bacteria 1002
1151 Ga0496100_0486014 3300048903 Bacteria 950
1152 Ga0496100_0505230 3300048903 Bacteria 932
1153 Ga0496101_0100575 3300048904 Bacteria 2163
1154 Ga0496101_0354842 3300048904 Bacteria 1153
1155 Ga0496102_0000002 3300048905 Bacteria 814588
1156 Ga0496102_0162820 3300048905 Bacteria 2099
1157 Ga0496102_0240481 3300048905 Bacteria 1707
1158 Ga0496102_0545251 3300048905 Bacteria 1082
1159 Ga0496102_0652788 3300048905 Bacteria 975
1160 Ga0496102_0787944 3300048905 Bacteria 873
1161 Ga0496102_0851097 3300048905 Bacteria 834
1162 Ga0496103_0000017 3300048906 Bacteria 244768
1163 Ga0496103_0033430 3300048906 Bacteria 3142
1164 Ga0496103_0818316 3300048906 Bacteria 587
1165 Ga0496104_0000001 3300048907 Bacteria 711867
1166 Ga0496104_0000029 3300048907 Bacteria 202968
1167 Ga0496104_0036497 3300048907 Bacteria 4595
1168 Ga0496104_0040221 3300048907 Bacteria 4382
1169 Ga0496104_0043241 3300048907 Bacteria 4231
1170 Ga0496104_0065631 3300048907 Bacteria 3445
1171 Ga0496104_0143826 3300048907 Bacteria 2291
1172 Ga0496104_0769375 3300048907 Bacteria 869
1173 Ga0496104_0871828 3300048907 Bacteria 805
1174 Ga0496105_0000002 3300048908 Bacteria 753215
1175 Ga0496105_0000070 3300048908 Bacteria 80117
1176 Ga0496105_0083463 3300048908 Bacteria 2638
1177 Ga0496105_0086869 3300048908 Bacteria 2584
1178 Ga0496105_0501721 3300048908 Bacteria 952
1179 Ga0496106_0147663 3300048909 Bacteria 1853
1180 Ga0496106_0162838 3300048909 Bacteria 1765
1181 Ga0496106_0253408 3300048909 Bacteria 1407
1182 Ga0496106_0511564 3300048909 Bacteria 964
1183 Ga0496106_1058730 3300048909 Unclassified 637
1184 Ga0496107_0133809 3300048910 Bacteria 1831
1185 Ga0496107_0251996 3300048910 Bacteria 1313
1186 Ga0496107_0370494 3300048910 Bacteria 1065
1187 Ga0496107_0951566 3300048910 Bacteria 625
1188 Ga0496107_1381042 3300048910 Unclassified 502
1189 Ga0496108_0169624 3300048911 Bacteria 1888
1190 Ga0496108_0211148 3300048911 Bacteria 1685
1191 Ga0496108_0259653 3300048911 Bacteria 1512
1192 Ga0496108_0263273 3300048911 Bacteria 1501
1193 Ga0496108_0464789 3300048911 Bacteria 1105
1194 Ga0496108_0740512 3300048911 Bacteria 851
1195 Ga0496108_1415106 3300048911 Bacteria 581
1196 Ga0496108_1443855 3300048911 Bacteria 574
1197 Ga0496109_0169840 3300048912 Bacteria 2045
1198 Ga0496109_0272183 3300048912 Bacteria 1596
1199 Ga0496109_0375278 3300048912 Bacteria 1343
1200 Ga0496109_0509979 3300048912 Bacteria 1135
1201 Ga0496109_0882821 3300048912 Bacteria 832
1202 Ga0496109_0886616 3300048912 Bacteria 830
1203 Ga0496109_1760197 3300048912 Bacteria 553
1204 Ga0496110_0000152 3300048913 Bacteria 41561
1205 Ga0496110_0052009 3300048913 Bacteria 3600
1206 Ga0496110_0060868 3300048913 Bacteria 3331
1207 Ga0496110_0122036 3300048913 Bacteria 2348
1208 Ga0496110_0232030 3300048913 Bacteria 1679
1209 Ga0496110_0279924 3300048913 Bacteria 1519
1210 Ga0496110_0690997 3300048913 Bacteria 921
1211 Ga0496110_1393244 3300048913 Bacteria 610
1212 Ga0496110_1608591 3300048913 Bacteria 560
1213 Ga0496111_0000123 3300048914 Bacteria 33765
1214 Ga0496111_0103230 3300048914 Bacteria 2096
1215 Ga0496111_0140920 3300048914 Bacteria 1786
1216 Ga0496111_0470284 3300048914 Bacteria 927
1217 Ga0496111_1053826 3300048914 Bacteria 581
1218 Ga0496112_0005170 3300048915 Bacteria 11216
1219 Ga0496112_0024276 3300048915 Bacteria 5803
1220 Ga0496112_0037175 3300048915 Bacteria 4753
1221 Ga0496112_0193955 3300048915 Bacteria 1992
1222 Ga0496112_0562304 3300048915 Bacteria 1074
1223 Ga0496112_0964105 3300048915 Bacteria 773
1224 Ga0496112_1170335 3300048915 Bacteria 686
1225 Ga0496113_0042204 3300048916 Bacteria 3369
1226 Ga0496113_0079994 3300048916 Bacteria 2502
1227 Ga0496113_0218770 3300048916 Bacteria 1518
1228 Ga0496113_0306181 3300048916 Bacteria 1273
1229 Ga0496113_0590688 3300048916 Bacteria 889
1230 Ga0496113_0663916 3300048916 Bacteria 833
1231 Ga0496113_0965049 3300048916 Bacteria 672
1232 Ga0496114_0018473 3300048917 Bacteria 5637
1233 Ga0496114_0191299 3300048917 Bacteria 1790
1234 Ga0496114_0714998 3300048917 Bacteria 878
1235 Ga0496114_0916565 3300048917 Bacteria 758
1236 Ga0496114_1392193 3300048917 Bacteria 589
1237 Ga0496115_0002589 3300048918 Bacteria 12979
1238 Ga0496115_0338767 3300048918 Bacteria 1228
1239 Ga0496115_0554612 3300048918 Bacteria 918
1240 Ga0496115_1001885 3300048918 Bacteria 638
1241 Ga0496115_1234758 3300048918 Bacteria 560
1242 Ga0496119_0008336 3300048922 Bacteria 9135
1243 Ga0496126_1310790 3300048929 Bacteria 527
1244 Ga0501306_001374 3300049127 Bacteria 2273
1245 Ga0501306_099357 3300049127 Bacteria 519
1246 Ga0501306_106457 3300049127 Bacteria 506
1247 Ga0501308_010483 3300049128 Bacteria 1030
1248 Ga0501308_015639 3300049128 Bacteria 901
1249 Ga0501309_025922 3300049129 Bacteria 845
1250 Ga0501310_020346 3300049130 Bacteria 823
1251 Ga0501310_022222 3300049130 Bacteria 799
1252 Ga0501310_039267 3300049130 Bacteria 654
1253 Ga0501310_081916 3300049130 Bacteria 508
1254 Ga0501304_033043 3300049160 Bacteria 557
1255 Ga0501305_026589 3300049161 Bacteria 883
1256 Ga0501305_031867 3300049161 Unclassified 825
1257 Ga0501305_065671 3300049161 Bacteria 631
1258 Ga0501307_010596 3300049162 Bacteria 1069
1259 Ga0501307_068861 3300049162 Bacteria 561
1260 Ga0501307_074433 3300049162 Bacteria 546
1261 Ga0501311_031990 3300049527 Bacteria 766
1262 Ga0501311_034039 3300049527 Bacteria 749
1263 Ga0501311_048303 3300049527 Bacteria 662
1264 Ga0501311_067482 3300049527 Bacteria 588
1265 Ga0501311_080347 3300049527 Bacteria 554
1266 Ga0501312_080589 3300049528 Bacteria 589
1267 Ga0501313_016784 3300049529 Bacteria 881
1268 Ga0501313_018715 3300049529 Bacteria 843
1269 Ga0501314_016823 3300049530 Bacteria 732
1270 Ga0501315_057939 3300049531 Bacteria 621
1271 Ga0501316_070799 3300049532 Bacteria 528
1272 Ga0501317_008122 3300049533 Bacteria 1202
1273 Ga0501317_032247 3300049533 Bacteria 766
1274 Ga0501317_043034 3300049533 Bacteria 696
1275 Ga0501317_051676 3300049533 Bacteria 655
1276 Ga0501318_005041 3300049534 Bacteria 1294
1277 Ga0501318_045465 3300049534 Bacteria 639
1278 Ga0501318_048258 3300049534 Bacteria 627
1279 Ga0501318_049778 3300049534 Bacteria 620
1280 Ga0501318_054445 3300049534 Bacteria 601
1281 Ga0501318_068568 3300049534 Bacteria 556
1282 Ga0501318_072171 3300049534 Bacteria 547
1283 Ga0501318_077689 3300049534 Unclassified 533
1284 Ga0501318_092093 3300049534 Bacteria 503
1285 Ga0501319_010979 3300049535 Bacteria 727
1286 Ga0501319_012645 3300049535 Bacteria 693
1287 Ga0501319_016493 3300049535 Bacteria 635
1288 Ga0501320_004510 3300049536 Bacteria 1232
1289 Ga0501320_055114 3300049536 Bacteria 549
1290 Ga0501321_035885 3300049537 Bacteria 681
1291 Ga0501323_003329 3300049539 Bacteria 1637
1292 Ga0501323_020376 3300049539 Bacteria 871
1293 Ga0501323_021398 3300049539 Bacteria 855
1294 Ga0501323_041310 3300049539 Bacteria 677
1295 Ga0501323_050893 3300049539 Bacteria 628
1296 Ga0501323_056816 3300049539 Bacteria 604
1297 Ga0501324_005127 3300049540 Bacteria 1066
1298 Ga0501324_021188 3300049540 Bacteria 665
1299 Ga0501325_015874 3300049541 Bacteria 747
1300 Ga0501325_025100 3300049541 Bacteria 652
1301 Ga0501325_026039 3300049541 Bacteria 645
1302 Ga0501326_04670 3300049542 Bacteria 730
1303 Ga0501332_06041 3300049548 Unclassified 751
1304 Ga0501333_005400 3300049549 Bacteria 828
1305 Ga0501336_011089 3300049552 Bacteria 730
1306 Ga0501340_013035 3300049556 Bacteria 636
1307 Ga0501031_0045032 3300049568 Bacteria 2879
1308 Ga0501031_0241734 3300049568 Bacteria 1174
1309 Ga0501031_0668653 3300049568 Bacteria 667
1310 Ga0501031_0809550 3300049568 Bacteria 600
1311 Ga0501032_0348779 3300049569 Bacteria 954
1312 Ga0501033_0369756 3300049570 Bacteria 1003
1313 Ga0501033_0538860 3300049570 Bacteria 805
1314 Ga0501033_0963606 3300049570 Bacteria 571
1315 Ga0501034_0157313 3300049571 Bacteria 2246
1316 Ga0501034_0204107 3300049571 Bacteria 1933
1317 Ga0501034_0312070 3300049571 Bacteria 1507
1318 Ga0501036_0224890 3300049572 Bacteria 1575
1319 Ga0501036_0259796 3300049572 Bacteria 1455
1320 Ga0501036_0460193 3300049572 Bacteria 1060
1321 Ga0501036_1454859 3300049572 Bacteria 555
1322 Ga0501037_0890738 3300049573 Bacteria 584
1323 Ga0501037_1130128 3300049573 Bacteria 507
1324 Ga0501038_0064358 3300049574 Bacteria 3127
1325 Ga0501038_0236800 3300049574 Bacteria 1451
1326 Ga0501038_0251709 3300049574 Bacteria 1399
1327 Ga0501039_0834539 3300049575 Bacteria 718
1328 Ga0501039_1051204 3300049575 Unclassified 632
1329 Ga0501040_0476507 3300049576 Bacteria 899
1330 Ga0501040_1005508 3300049576 Bacteria 604
1331 Ga0501040_1269103 3300049576 Bacteria 534
1332 Ga0501041_0101653 3300049577 Bacteria 1780
1333 Ga0501041_0355174 3300049577 Bacteria 926
1334 Ga0501041_0630780 3300049577 Bacteria 685
1335 Ga0501041_0969940 3300049577 Bacteria 547
1336 Ga0501042_0123976 3300049578 Bacteria 1860
1337 Ga0501046_0370010 3300049580 Bacteria 1038
1338 Ga0501046_1273382 3300049580 Bacteria 503
1339 Ga0501047_0064838 3300049581 Bacteria 3523
1340 Ga0501047_0245971 3300049581 Bacteria 1638
1341 Ga0501047_0608361 3300049581 Bacteria 914
1342 Ga0501048_0114451 3300049582 Bacteria 1905
1343 Ga0501048_0129715 3300049582 Bacteria 1783
1344 Ga0501067_0103473 3300049583 Bacteria 1582
1345 Ga0501067_0205228 3300049583 Bacteria 1098
1346 Ga0501067_0303084 3300049583 Bacteria 890
1347 Ga0501067_0353157 3300049583 Bacteria 820
1348 Ga0501067_0844086 3300049583 Bacteria 516
1349 Ga0501068_0436743 3300049584 Bacteria 846
1350 Ga0501069_0008335 3300049585 Bacteria 5443
1351 Ga0501069_0335301 3300049585 Bacteria 890
1352 Ga0501070_0257541 3300049586 Bacteria 1427
1353 Ga0501070_1002555 3300049586 Bacteria 648
1354 Ga0501070_1265138 3300049586 Unclassified 564
1355 Ga0501071_0446459 3300049587 Bacteria 990
1356 Ga0501071_0732412 3300049587 Bacteria 762
1357 Ga0501071_0901864 3300049587 Bacteria 682
1358 Ga0501072_0022407 3300049588 Bacteria 4901
1359 Ga0501072_0164404 3300049588 Bacteria 1770
1360 Ga0501073_1073292 3300049589 Bacteria 554
1361 Ga0501074_0235240 3300049590 Bacteria 1304
1362 Ga0501074_0345981 3300049590 Bacteria 1055
1363 Ga0501074_0589332 3300049590 Bacteria 786
1364 Ga0501075_0259986 3300049591 Bacteria 1323
1365 Ga0501076_0185295 3300049592 Bacteria 1697
1366 Ga0501076_0376060 3300049592 Bacteria 1167
1367 Ga0501076_0629695 3300049592 Bacteria 885
1368 Ga0501076_0755445 3300049592 Bacteria 802
1369 Ga0501077_0082333 3300049593 Bacteria 2039
1370 Ga0501209_177865 3300049656 Bacteria 649
1371 Ga0501079_0111889 3300049741 Bacteria 2122
1372 Ga0501080_0051340 3300049742 Bacteria 3837
1373 Ga0501080_0192882 3300049742 Bacteria 1872
1374 Ga0501080_1080077 3300049742 Bacteria 693
1375 Ga0501081_0339785 3300049743 Bacteria 1105
1376 Ga0501081_0953734 3300049743 Bacteria 648
1377 Ga0501083_0306065 3300049744 Bacteria 1034
1378 Ga0501083_0768191 3300049744 Bacteria 627
1379 Ga0501265_053120 3300049762 Bacteria 643
1380 Ga0501035_0774111 3300049822 Bacteria 768
1381 Ga0501044_0095711 3300049823 Bacteria 2992
1382 Ga0501044_0340937 3300049823 Bacteria 1420
1383 Ga0501044_0497092 3300049823 Bacteria 1121
1384 Ga0501045_0236958 3300049824 Bacteria 1358
1385 Ga0501204_032177 3300049850 Bacteria 734
1386 nmdc:mga00v17_287450_c1 3300050491 Bacteria 1068
1387 nmdc:mga00v17_295790_c1 3300050491 Bacteria 1051
1388 nmdc:mga00v17_536524_c1 3300050491 Bacteria 757
1389 nmdc:mga0yw44_10371_c1 3300050492 Bacteria 4757
1390 nmdc:mga0yw44_473461_c1 3300050492 Bacteria 849
1391 nmdc:mga0yw44_89792_c1 3300050492 Bacteria 1940
1392 nmdc:mga0yw44_90414_c1 3300050492 Bacteria 1934
1393 nmdc:mga06z11_16397_c1 3300050494 Bacteria 3336
1394 nmdc:mga06z11_232003_c1 3300050494 Bacteria 1081
1395 nmdc:mga05p37_281818_c1 3300050507 Bacteria 1982
1396 nmdc:mga05p37_536441_c1 3300050507 Bacteria 1335
1397 nmdc:mga09592_279953_c1 3300050508 Bacteria 1447
1398 nmdc:mga0qj67_12200_c1 3300050509 Bacteria 6467
1399 nmdc:mga0qj67_675251_c1 3300050509 Bacteria 823
1400 nmdc:mga0qj67_754676_c1 3300050509 Bacteria 772
1401 nmdc:mga06r32_551663_c1 3300050510 Bacteria 1126
1402 nmdc:mga08y16_166926_c1 3300050511 Bacteria 2287
1403 nmdc:mga08y16_1798830_c1 3300050511 Bacteria 566
1404 nmdc:mga08y16_44244_c1 3300050511 Bacteria 4664
1405 nmdc:mga08y16_690375_c1 3300050511 Bacteria 1022
1406 nmdc:mga08y16_883194_c1 3300050511 Bacteria 881
1407 nmdc:mga0n895_108333_c1 3300050512 Bacteria 2792
1408 nmdc:mga0n895_11252_c1 3300050512 Bacteria 7970
1409 nmdc:mga0rr50_490015_c1 3300050513 Bacteria 1044
1410 nmdc:mga0rr50_8805_c1 3300050513 Bacteria 6297
1411 nmdc:mga08x19_263580_c1 3300050514 Bacteria 1192
1412 nmdc:mga0a205_422107_c1 3300050515 Bacteria 1195
1413 nmdc:mga0a205_437186_c1 3300050515 Bacteria 1169
1414 nmdc:mga0a205_45460_c1 3300050515 Bacteria 4233
1415 nmdc:mga0a205_79219_c1 3300050515 Bacteria 3174
1416 Ga0495601_0012404 3300053077 Bacteria 5113
1417 Ga0495601_0802424 3300053077 Bacteria 597
1418 Ga0495612_0000369 3300053078 Bacteria 18070
1419 Ga0495612_0206867 3300053078 Bacteria 867
1420 Ga0500635_0043732 3300053080 Bacteria 1508
1421 Ga0495655_0013664 3300053083 Bacteria 1685
1422 Ga0495655_0070854 3300053083 Bacteria 974
1423 Ga0495655_0076526 3300053083 Bacteria 947
1424 Ga0495655_0081252 3300053083 Bacteria 927
1425 Ga0495655_0184972 3300053083 Bacteria 674
1426 Ga0495619_0520861 3300053085 Bacteria 817
1427 Ga0495619_0850472 3300053085 Bacteria 615
1428 Ga0500578_0031166 3300053086 Bacteria 3427
1429 Ga0500646_0001595 3300053090 Bacteria 5980
1430 Ga0500647_0134902 3300053091 Bacteria 1162
1431 Ga0500583_0494023 3300053092 Bacteria 576
1432 Ga0500566_0013377 3300053094 Bacteria 4833
1433 Ga0500566_0019815 3300053094 Bacteria 3950
1434 Ga0500640_001894 3300053095 Bacteria 6655
1435 Ga0500554_000753 3300053102 Bacteria 6518
1436 Ga0500562_177093 3300053108 Bacteria 579
1437 Ga0500572_001298 3300053111 Bacteria 6986
1438 Ga0500595_001095 3300053119 Bacteria 15031
1439 Ga0500597_104891 3300053120 Bacteria 1228
1440 Ga0500597_316777 3300053120 Bacteria 617
1441 Ga0500607_119755 3300053121 Bacteria 1276
1442 Ga0500614_002285 3300053123 Bacteria 4308
1443 Ga0500614_010281 3300053123 Bacteria 2007
1444 Ga0500642_0010056 3300053130 Bacteria 3319
1445 Ga0500559_0045200 3300053136 Bacteria 1927
1446 Ga0500568_0019599 3300053139 Bacteria 2937
1447 Ga0500588_0024168 3300053146 Bacteria 1675
1448 Ga0500603_005211 3300053150 Bacteria 2790
1449 Ga0500637_0137478 3300053178 Bacteria 1415
1450 Ga0500601_003661 3300053737 Bacteria 1667
1451 Ga0501084_0199550 3300054114 Bacteria 1688
1452 Ga0500661_050840 3300055283 Unclassified 740
1453 Ga0590074_024028 3300059423 Bacteria 1059
1454 Ga0590075_042752 3300059424 Bacteria 1159
1455 Ga0590077_155958 3300059426 Bacteria 547
1456 Ga0587084_044913 3300059477 Bacteria 764
1457 Ga0587084_046473 3300059477 Bacteria 755
1458 Ga0587084_092526 3300059477 Bacteria 602
1459 Ga0587084_093019 3300059477 Bacteria 601
1460 Ga0587093_037022 3300059478 Bacteria 726
1461 Ga0587066_016158 3300059490 Bacteria 1172
1462 Ga0587066_211811 3300059490 Bacteria 515
1463 Ga0587070_065532 3300059491 Bacteria 762
1464 Ga0587070_095022 3300059491 Bacteria 677
1465 Ga0587070_125430 3300059491 Bacteria 618
1466 Ga0587070_128994 3300059491 Bacteria 613
1467 Ga0587070_140264 3300059491 Bacteria 596
1468 Ga0587073_0069057 3300059492 Bacteria 849
1469 Ga0587073_0094173 3300059492 Bacteria 767
1470 Ga0587073_0159272 3300059492 Bacteria 646
1471 Ga0587073_0173419 3300059492 Bacteria 628
1472 Ga0587073_0261005 3300059492 Bacteria 548
1473 Ga0587077_030979 3300059493 Bacteria 1019
1474 Ga0587077_145331 3300059493 Bacteria 615
1475 Ga0587077_233956 3300059493 Bacteria 524
1476 Ga0587077_240351 3300059493 Bacteria 519
1477 Ga0587080_071212 3300059503 Bacteria 696
1478 Ga0587082_058848 3300059504 Bacteria 753
1479 Ga0587082_098908 3300059504 Bacteria 633
1480 Ga0587082_106949 3300059504 Bacteria 617
1481 Ga0587082_131332 3300059504 Bacteria 575
1482 Ga0587082_142610 3300059504 Bacteria 560
1483 Ga0587083_0018038 3300059505 Bacteria 1271
1484 Ga0587083_0033850 3300059505 Bacteria 1033
1485 Ga0587083_0096572 3300059505 Bacteria 729
1486 Ga0587083_0110869 3300059505 Bacteria 697
1487 Ga0587083_0149597 3300059505 Bacteria 629
1488 Ga0587083_0222296 3300059505 Unclassified 550
1489 Ga0587085_015683 3300059506 Bacteria 1086
1490 Ga0587085_091739 3300059506 Bacteria 628
1491 Ga0587085_135702 3300059506 Bacteria 554
1492 Ga0587085_145523 3300059506 Bacteria 542
1493 Ga0587088_026663 3300059508 Bacteria 1005
1494 Ga0587088_028995 3300059508 Bacteria 977
1495 Ga0587088_045695 3300059508 Unclassified 841
1496 Ga0587088_181181 3300059508 Bacteria 528
1497 Ga0587089_068176 3300059509 Bacteria 600
1498 Ga0587090_054846 3300059510 Bacteria 741
1499 Ga0587090_081700 3300059510 Bacteria 648
1500 Ga0587090_169179 3300059510 Unclassified 506
1501 Ga0587091_077589 3300059511 Bacteria 739
1502 Ga0587091_103448 3300059511 Bacteria 671
1503 Ga0587091_126610 3300059511 Bacteria 626
1504 Ga0587091_169527 3300059511 Bacteria 567
1505 Ga0587092_065416 3300059512 Bacteria 689
1506 Ga0587092_165766 3300059512 Bacteria 502
1507 Ga0587094_089861 3300059513 Bacteria 580
1508 Ga0587095_018844 3300059514 Bacteria 649
1509 Ga0587097_05180 3300059603 Bacteria 606
1510 Ga0587098_018025 3300059604 Bacteria 871
1511 Ga0587098_020782 3300059604 Bacteria 832
1512 Ga0587106_023859 3300059605 Bacteria 931
1513 Ga0587106_081286 3300059605 Bacteria 632
1514 Ga0587106_089576 3300059605 Bacteria 612
1515 Ga0587106_112462 3300059605 Bacteria 569
1516 Ga0587106_121566 3300059605 Bacteria 555
1517 Ga0587106_129945 3300059605 Bacteria 543
1518 Ga0587129_017342 3300059608 Bacteria 614
1519 Ga0587099_007630 3300059622 Bacteria 1026
1520 Ga0587101_050694 3300059623 Bacteria 714
1521 Ga0587115_116519 3300059626 Bacteria 510
1522 Ga0587117_052156 3300059627 Bacteria 682
1523 Ga0587122_004333 3300059628 Bacteria 1142
1524 Ga0587122_020432 3300059628 Bacteria 716
1525 Ga0587128_026561 3300059630 Bacteria 930
1526 Ga0587128_029373 3300059630 Bacteria 901
1527 Ga0587128_044943 3300059630 Bacteria 786
1528 Ga0587128_079359 3300059630 Bacteria 654
1529 Ga0587128_105903 3300059630 Bacteria 595
1530 Ga0587130_054665 3300059631 Bacteria 506
1531 Ga0587062_057141 3300059639 Bacteria 675
1532 Ga0587062_059546 3300059639 Bacteria 667
1533 Ga0587067_010025 3300059640 Bacteria 1427
1534 Ga0587067_051321 3300059640 Bacteria 835
1535 Ga0587067_055304 3300059640 Bacteria 816
1536 Ga0587067_097813 3300059640 Bacteria 675
1537 Ga0587067_122607 3300059640 Bacteria 626
1538 Ga0587067_122738 3300059640 Bacteria 625
1539 Ga0587067_135607 3300059640 Bacteria 605
1540 Ga0587067_148294 3300059640 Bacteria 587
1541 Ga0587067_221353 3300059640 Bacteria 513
1542 Ga0587068_067249 3300059641 Bacteria 700
1543 Ga0587068_077366 3300059641 Bacteria 666
1544 Ga0587068_097582 3300059641 Bacteria 613
1545 Ga0587068_163235 3300059641 Bacteria 511
1546 Ga0587068_166675 3300059641 Bacteria 507
1547 Ga0587069_015201 3300059642 Bacteria 1084
1548 Ga0587069_063646 3300059642 Bacteria 685
1549 Ga0587069_073056 3300059642 Bacteria 655
1550 Ga0587072_060947 3300059643 Bacteria 777
1551 Ga0587072_062989 3300059643 Bacteria 768
1552 Ga0587072_112016 3300059643 Bacteria 624
1553 Ga0587075_068501 3300059644 Bacteria 655
1554 Ga0587076_091573 3300059645 Bacteria 665
1555 Ga0587076_164397 3300059645 Bacteria 548
1556 Ga0587076_201425 3300059645 Bacteria 512
1557 Ga0587079_047232 3300059647 Bacteria 891
1558 Ga0587079_053478 3300059647 Bacteria 854
1559 Ga0587079_067618 3300059647 Bacteria 789
1560 Ga0587079_080061 3300059647 Bacteria 745
1561 Ga0587079_187115 3300059647 Bacteria 558
1562 Ga0587079_225766 3300059647 Bacteria 522
1563 Ga0587102_026339 3300059649 Bacteria 687
1564 Ga0587102_029372 3300059649 Bacteria 664
1565 Ga0587105_012645 3300059651 Bacteria 664
1566 Ga0587107_027459 3300059652 Bacteria 843
1567 Ga0587107_039534 3300059652 Bacteria 756
1568 Ga0587114_045530 3300059655 Bacteria 726
1569 Ga0587114_114909 3300059655 Bacteria 539
1570 Ga0587111_0057452 3300060346 Bacteria 875
1571 Ga0587111_0108606 3300060346 Bacteria 700
1572 Ga0587111_0122459 3300060346 Bacteria 671
1573 Ga0587111_0262553 3300060346 Bacteria 515
1574 Ga0501082_0293905 3300060353 Bacteria 1414
1575 Ga0501082_1757257 3300060353 Bacteria 541
1576 Ga0466962_0009693 3300061719 Bacteria 4620
1577 Ga0466962_0095353 3300061719 Bacteria 1426
1578 Ga0530510_0018622 3300061734 Bacteria 4923
1579 Ga0530510_0539437 3300061734 Bacteria 885

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049535 Ga0501319_010979 Ga0501319_010979_291_638 104
2 3300047673 Ga0495593_0211509 Ga0495593_0211509_629_949 106
3 3300048088 Ga0495602_0227893 Ga0495602_0227893_1069_1389 106
4 3300037068 Ga0373925_0205941 Ga0373925_0205941_17_343 108
5 3300048918 Ga0496115_1001885 Ga0496115_1001885_17_343 108
6 3300049130 Ga0501310_081916 Ga0501310_081916_19_348 109
7 3300049549 Ga0501333_005400 Ga0501333_005400_465_800 111
8 3300011119 Ga0105246_11188359 Ga0105246_111883592 113
9 3300001990 JGI24737J22298_10084652 JGI24737J22298_100846522 114
10 3300044683 Ga0466965_0367471 Ga0466965_0367471_420_764 114
11 3300009553 Ga0105249_11172973 Ga0105249_111729732 117
12 3300025901 Ga0207688_10765419 Ga0207688_107654192 117
13 3300041496 Ga0451839_0224422 Ga0451839_0224422_10_363 117
14 3300044683 Ga0466965_0160930 Ga0466965_0160930_809_1162 117
15 3300049527 Ga0501311_067482 Ga0501311_067482_220_573 117
16 3300049534 Ga0501318_045465 Ga0501318_045465_271_624 117
17 3300049534 Ga0501318_072171 Ga0501318_072171_13_366 117
18 3300049568 Ga0501031_0809550 Ga0501031_0809550_20_373 117
19 3300049573 Ga0501037_0890738 Ga0501037_0890738_13_366 117
20 3300049586 Ga0501070_1265138 Ga0501070_1265138_200_553 117
21 3300048909 Ga0496106_0253408 Ga0496106_0253408_1025_1396 122
22 3300013297 Ga0157378_10098811 Ga0157378_100988115 123
23 3300014745 Ga0157377_11083124 Ga0157377_110831242 123
24 3300039450 Ga0436363_0783584 Ga0436363_0783584_614_985 123
25 3300041496 Ga0451839_1373717 Ga0451839_1373717_153_524 123
26 3300045049 Ga0466959_0379434 Ga0466959_0379434_310_681 123
27 3300046454 Ga0495592_0278055 Ga0495592_0278055_313_684 123
28 3300046459 Ga0495629_0228749 Ga0495629_0228749_174_545 123
29 3300046462 Ga0495651_0208618 Ga0495651_0208618_29_400 123
30 3300046462 Ga0495651_0290830 Ga0495651_0290830_600_971 123
31 3300046511 Ga0495608_0482999 Ga0495608_0482999_300_671 123
32 3300046533 Ga0495640_0391021 Ga0495640_0391021_61_432 123
33 3300046536 Ga0495587_0068002 Ga0495587_0068002_762_1133 123
34 3300046543 Ga0495645_0056355 Ga0495645_0056355_2287_2658 123
35 3300046559 Ga0495667_0750782 Ga0495667_0750782_116_487 123
36 3300046663 Ga0495635_0458442 Ga0495635_0458442_159_530 123
37 3300046663 Ga0495635_0862179 Ga0495635_0862179_140_511 123
38 3300046679 Ga0495623_0205792 Ga0495623_0205792_90_461 123
39 3300047317 Ga0495604_0139930 Ga0495604_0139930_489_860 123
40 3300047444 Ga0495675_0094566 Ga0495675_0094566_1254_1625 123
41 3300047471 Ga0495684_0388357 Ga0495684_0388357_580_951 123
42 3300048088 Ga0495602_0160403 Ga0495602_0160403_253_624 123
43 3300004799 Ga0058863_10080674 Ga0058863_100806742 130
44 3300004799 Ga0058863_11960175 Ga0058863_119601753 130
45 3300004799 Ga0058863_11973879 Ga0058863_119738793 130
46 3300004800 Ga0058861_12059017 Ga0058861_120590172 130
47 3300004803 Ga0058862_10148086 Ga0058862_101480863 130
48 3300004803 Ga0058862_10173070 Ga0058862_101730702 130
49 3300004803 Ga0058862_12848635 Ga0058862_128486351 130
50 3300005329 Ga0070683_100052331 Ga0070683_1000523317 130
51 3300005330 Ga0070690_100626478 Ga0070690_1006264782 130
52 3300005335 Ga0070666_11480973 Ga0070666_114809731 130
53 3300005336 Ga0070680_100571527 Ga0070680_1005715273 130
54 3300005456 Ga0070678_100104611 Ga0070678_1001046112 130
55 3300005458 Ga0070681_10167503 Ga0070681_101675035 130
56 3300005458 Ga0070681_10263195 Ga0070681_102631953 130
57 3300005530 Ga0070679_100061371 Ga0070679_1000613712 130
58 3300005530 Ga0070679_100281248 Ga0070679_1002812482 130
59 3300005530 Ga0070679_100854135 Ga0070679_1008541352 130
60 3300005530 Ga0070679_101105160 Ga0070679_1011051602 130
61 3300005535 Ga0070684_100056012 Ga0070684_1000560123 130
62 3300005539 Ga0068853_102212591 Ga0068853_1022125911 130
63 3300005544 Ga0070686_100134832 Ga0070686_1001348324 130
64 3300005563 Ga0068855_100253211 Ga0068855_1002532113 130
65 3300005577 Ga0068857_100229760 Ga0068857_1002297603 130
66 3300005614 Ga0068856_100299899 Ga0068856_1002998993 130
67 3300005618 Ga0068864_100502352 Ga0068864_1005023523 130
68 3300005718 Ga0068866_10085681 Ga0068866_100856814 130
69 3300006175 Ga0070712_101806742 Ga0070712_1018067421 130
70 3300006871 Ga0075434_100037786 Ga0075434_1000377868 130
71 3300006881 Ga0068865_101783039 Ga0068865_1017830392 130
72 3300006914 Ga0075436_100068380 Ga0075436_1000683802 130
73 3300007076 Ga0075435_100124548 Ga0075435_1001245484 130
74 3300009093 Ga0105240_10653742 Ga0105240_106537422 130
75 3300009098 Ga0105245_12179872 Ga0105245_121798722 130
76 3300009147 Ga0114129_10069437 Ga0114129_100694371 130
77 3300009545 Ga0105237_10727930 Ga0105237_107279302 130
78 3300010375 Ga0105239_10670675 Ga0105239_106706753 130
79 3300013105 Ga0157369_10273564 Ga0157369_102735643 130
80 3300014325 Ga0163163_10207803 Ga0163163_102078032 130
81 3300020070 Ga0206356_10919035 Ga0206356_109190351 130
82 3300020078 Ga0206352_10502868 Ga0206352_105028682 130
83 3300020082 Ga0206353_10441693 Ga0206353_104416933 130
84 3300025909 Ga0207705_10121307 Ga0207705_101213073 130
85 3300025912 Ga0207707_10778780 Ga0207707_107787802 130
86 3300025917 Ga0207660_10263503 Ga0207660_102635033 130
87 3300025917 Ga0207660_10504940 Ga0207660_105049403 130
88 3300025921 Ga0207652_10035128 Ga0207652_100351282 130
89 3300025921 Ga0207652_10130550 Ga0207652_101305503 130
90 3300025921 Ga0207652_10545492 Ga0207652_105454922 130
91 3300025944 Ga0207661_10045956 Ga0207661_100459567 130
92 3300025949 Ga0207667_10237666 Ga0207667_102376663 130
93 3300026078 Ga0207702_10090640 Ga0207702_100906405 130
94 3300026095 Ga0207676_10449587 Ga0207676_104495873 130
95 3300026116 Ga0207674_10059872 Ga0207674_100598723 130
96 3300026121 Ga0207683_10034774 Ga0207683_100347747 130
97 3300036457 Ga0265778_052958 Ga0265778_052958_49_441 130
98 3300039447 Ga0436361_0938094 Ga0436361_0938094_32_424 130
99 3300041456 Ga0451795_0406964 Ga0451795_0406964_236_628 130
100 3300044693 Ga0466961_0237936 Ga0466961_0237936_164_556 130
101 3300044693 Ga0466961_0476411 Ga0466961_0476411_309_701 130
102 3300044842 Ga0466957_0365487 Ga0466957_0365487_546_938 130
103 3300046516 Ga0495628_0443878 Ga0495628_0443878_73_465 130
104 3300046680 Ga0495646_0375651 Ga0495646_0375651_54_446 130
105 3300048911 Ga0496108_1415106 Ga0496108_1415106_40_432 130
106 3300048911 Ga0496108_1443855 Ga0496108_1443855_38_430 130
107 3300048916 Ga0496113_0965049 Ga0496113_0965049_33_425 130
108 3300048918 Ga0496115_1234758 Ga0496115_1234758_134_526 130
109 3300050507 nmdc:mga05p37_281818_c1 nmdc:mga05p37_281818_c1_27_419 130
110 3300050512 nmdc:mga0n895_11252_c1 nmdc:mga0n895_11252_c1_402_794 130
111 3300050513 nmdc:mga0rr50_8805_c1 nmdc:mga0rr50_8805_c1_1708_2100 130
112 3300050514 nmdc:mga08x19_263580_c1 nmdc:mga08x19_263580_c1_371_763 130
113 3300050515 nmdc:mga0a205_45460_c1 nmdc:mga0a205_45460_c1_70_462 130
114 3300001979 JGI24740J21852_10002914 JGI24740J21852_1000291412 131
115 3300002076 JGI24749J21850_1034758 JGI24749J21850_10347583 131
116 3300005354 Ga0070675_100049635 Ga0070675_1000496355 131
117 3300005365 Ga0070688_100011350 Ga0070688_1000113504 131
118 3300005367 Ga0070667_100456329 Ga0070667_1004563291 131
119 3300005437 Ga0070710_10113037 Ga0070710_101130372 131
120 3300005440 Ga0070705_101041823 Ga0070705_1010418232 131
121 3300005441 Ga0070700_102015478 Ga0070700_1020154781 131
122 3300005466 Ga0070685_10001772 Ga0070685_1000177218 131
123 3300005577 Ga0068857_102158402 Ga0068857_1021584022 131
124 3300005617 Ga0068859_100857652 Ga0068859_1008576522 131
125 3300005840 Ga0068870_11233735 Ga0068870_112337352 131
126 3300005981 Ga0081538_10134898 Ga0081538_101348982 131
127 3300006038 Ga0075365_10112993 Ga0075365_101129932 131
128 3300006038 Ga0075365_10426387 Ga0075365_104263872 131
129 3300006038 Ga0075365_10934141 Ga0075365_109341411 131
130 3300006048 Ga0075363_100041450 Ga0075363_1000414504 131
131 3300006051 Ga0075364_10093604 Ga0075364_100936043 131
132 3300006051 Ga0075364_10744486 Ga0075364_107444862 131
133 3300006051 Ga0075364_11053629 Ga0075364_110536291 131
134 3300006178 Ga0075367_10035159 Ga0075367_100351597 131
135 3300006881 Ga0068865_100820322 Ga0068865_1008203222 131
136 3300006931 Ga0097620_100857797 Ga0097620_1008577972 131
137 3300009094 Ga0111539_10091686 Ga0111539_100916863 131
138 3300009098 Ga0105245_10000528 Ga0105245_1000052832 131
139 3300009101 Ga0105247_10000064 Ga0105247_10000064117 131
140 3300009176 Ga0105242_10003277 Ga0105242_100032779 131
141 3300010375 Ga0105239_10189923 Ga0105239_101899233 131
142 3300013105 Ga0157369_10000068 Ga0157369_10000068140 131
143 3300013297 Ga0157378_10087024 Ga0157378_100870244 131
144 3300014969 Ga0157376_10187306 Ga0157376_101873062 131
145 3300014969 Ga0157376_10347270 Ga0157376_103472703 131
146 3300025898 Ga0207692_10082034 Ga0207692_100820344 131
147 3300025900 Ga0207710_10000220 Ga0207710_1000022043 131
148 3300025926 Ga0207659_10075587 Ga0207659_100755874 131
149 3300025927 Ga0207687_10000025 Ga0207687_1000002524 131
150 3300025934 Ga0207686_10001614 Ga0207686_1000161416 131
151 3300025938 Ga0207704_10489642 Ga0207704_104896422 131
152 3300025986 Ga0207658_10367480 Ga0207658_103674802 131
153 3300028556 Ga0265337_1000032 Ga0265337_100003222 131
154 3300028558 Ga0265326_10000040 Ga0265326_1000004019 131
155 3300028563 Ga0265319_1000030 Ga0265319_100003048 131
156 3300028563 Ga0265319_1134426 Ga0265319_11344262 131
157 3300028653 Ga0265323_10164080 Ga0265323_101640801 131
158 3300028654 Ga0265322_10000012 Ga0265322_1000001242 131
159 3300028654 Ga0265322_10010968 Ga0265322_100109684 131
160 3300028666 Ga0265336_10034584 Ga0265336_100345842 131
161 3300028800 Ga0265338_10000156 Ga0265338_1000015648 131
162 3300028800 Ga0265338_10231483 Ga0265338_102314832 131
163 3300029957 Ga0265324_10017099 Ga0265324_100170996 131
164 3300029957 Ga0265324_10039877 Ga0265324_100398774 131
165 3300031238 Ga0265332_10020220 Ga0265332_100202203 131
166 3300031239 Ga0265328_10002899 Ga0265328_1000289912 131
167 3300031240 Ga0265320_10000001 Ga0265320_10000001742 131
168 3300031241 Ga0265325_10024792 Ga0265325_100247926 131
169 3300031242 Ga0265329_10000919 Ga0265329_1000091918 131
170 3300031249 Ga0265339_10008172 Ga0265339_1000817210 131
171 3300031249 Ga0265339_10225767 Ga0265339_102257671 131
172 3300031250 Ga0265331_10001467 Ga0265331_1000146718 131
173 3300031251 Ga0265327_10000003 Ga0265327_10000003742 131
174 3300031344 Ga0265316_10003567 Ga0265316_1000356711 131
175 3300031595 Ga0265313_10055372 Ga0265313_100553722 131
176 3300031691 Ga0316579_10287984 Ga0316579_102879841 131
177 3300031711 Ga0265314_10000178 Ga0265314_1000017849 131
178 3300031712 Ga0265342_10000027 Ga0265342_10000027142 131
179 3300031712 Ga0265342_10232963 Ga0265342_102329632 131
180 3300031727 Ga0316576_10799457 Ga0316576_107994572 131
181 3300031728 Ga0316578_10414904 Ga0316578_104149043 131
182 3300032133 Ga0316583_10235943 Ga0316583_102359432 131
183 3300035398 Ga0316574_0033631 Ga0316574_0033631_1525_1920 131
184 3300035398 Ga0316574_0408493 Ga0316574_0408493_50_445 131
185 3300036647 Ga0316582_0390143 Ga0316582_0390143_554_949 131
186 3300036712 Ga0316584_0028035 Ga0316584_0028035_1138_1533 131
187 3300042876 Ga0451577_0179447 Ga0451577_0179447_475_870 131
188 3300044712 Ga0453684_0048627 Ga0453684_0048627_2076_2471 131
189 3300046455 Ga0495603_0001557 Ga0495603_0001557_12939_13334 131
190 3300046463 Ga0495653_0048075 Ga0495653_0048075_1374_1769 131
191 3300046463 Ga0495653_0244336 Ga0495653_0244336_650_1045 131
192 3300046529 Ga0495652_0395835 Ga0495652_0395835_300_695 131
193 3300046559 Ga0495667_0000067 Ga0495667_0000067_46494_46889 131
194 3300046689 Ga0495613_0278464 Ga0495613_0278464_387_782 131
195 3300047322 Ga0495680_0009089 Ga0495680_0009089_7421_7816 131
196 3300047322 Ga0495680_0009545 Ga0495680_0009545_1454_1849 131
197 3300048907 Ga0496104_0000029 Ga0496104_0000029_187698_188093 131
198 3300048907 Ga0496104_0043241 Ga0496104_0043241_208_603 131
199 3300048908 Ga0496105_0000002 Ga0496105_0000002_187698_188093 131
200 3300048908 Ga0496105_0000070 Ga0496105_0000070_61455_61850 131
201 3300048918 Ga0496115_0002589 Ga0496115_0002589_3828_4223 131
202 3300048922 Ga0496119_0008336 Ga0496119_0008336_8438_8833 131
203 3300049569 Ga0501032_0348779 Ga0501032_0348779_235_630 131
204 3300049571 Ga0501034_0204107 Ga0501034_0204107_135_530 131
205 3300049572 Ga0501036_0259796 Ga0501036_0259796_924_1319 131
206 3300049574 Ga0501038_0251709 Ga0501038_0251709_351_746 131
207 3300049581 Ga0501047_0245971 Ga0501047_0245971_446_841 131
208 3300049823 Ga0501044_0095711 Ga0501044_0095711_1625_2020 131
209 3300050491 nmdc:mga00v17_287450_c1 nmdc:mga00v17_287450_c1_428_823 131
210 3300050491 nmdc:mga00v17_536524_c1 nmdc:mga00v17_536524_c1_330_725 131
211 3300050492 nmdc:mga0yw44_10371_c1 nmdc:mga0yw44_10371_c1_1441_1836 131
212 3300050492 nmdc:mga0yw44_89792_c1 nmdc:mga0yw44_89792_c1_282_677 131
213 3300050492 nmdc:mga0yw44_90414_c1 nmdc:mga0yw44_90414_c1_1371_1766 131
214 3300050494 nmdc:mga06z11_16397_c1 nmdc:mga06z11_16397_c1_415_810 131
215 3300050511 nmdc:mga08y16_44244_c1 nmdc:mga08y16_44244_c1_3543_3938 131
216 3300050515 nmdc:mga0a205_437186_c1 nmdc:mga0a205_437186_c1_558_953 131
217 3300053077 Ga0495601_0012404 Ga0495601_0012404_1000_1395 131
218 3300053077 Ga0495601_0802424 Ga0495601_0802424_185_580 131
219 3300003577 Ga0007416J51690_1053647 Ga0007416J51690_10536473 132
220 3300004798 Ga0058859_10022019 Ga0058859_100220192 132
221 3300004798 Ga0058859_10049905 Ga0058859_100499054 132
222 3300004798 Ga0058859_10122077 Ga0058859_101220771 132
223 3300004799 Ga0058863_11849541 Ga0058863_118495413 132
224 3300004801 Ga0058860_10014153 Ga0058860_100141532 132
225 3300004801 Ga0058860_10174803 Ga0058860_101748033 132
226 3300005330 Ga0070690_100010654 Ga0070690_1000106542 132
227 3300005330 Ga0070690_100163789 Ga0070690_1001637893 132
228 3300005334 Ga0068869_100128198 Ga0068869_1001281982 132
229 3300005337 Ga0070682_101395667 Ga0070682_1013956671 132
230 3300005340 Ga0070689_100068670 Ga0070689_1000686702 132
231 3300005340 Ga0070689_100133287 Ga0070689_1001332873 132
232 3300005343 Ga0070687_100211976 Ga0070687_1002119763 132
233 3300005343 Ga0070687_100263666 Ga0070687_1002636662 132
234 3300005345 Ga0070692_10308495 Ga0070692_103084953 132
235 3300005365 Ga0070688_100201224 Ga0070688_1002012242 132
236 3300005365 Ga0070688_101588534 Ga0070688_1015885341 132
237 3300005436 Ga0070713_101745789 Ga0070713_1017457891 132
238 3300005438 Ga0070701_10612165 Ga0070701_106121652 132
239 3300005440 Ga0070705_100692028 Ga0070705_1006920281 132
240 3300005441 Ga0070700_100476139 Ga0070700_1004761392 132
241 3300005535 Ga0070684_100284704 Ga0070684_1002847042 132
242 3300005549 Ga0070704_100535073 Ga0070704_1005350731 132
243 3300005615 Ga0070702_100170116 Ga0070702_1001701163 132
244 3300005615 Ga0070702_100912812 Ga0070702_1009128122 132
245 3300005618 Ga0068864_100352015 Ga0068864_1003520153 132
246 3300005719 Ga0068861_100267705 Ga0068861_1002677053 132
247 3300005840 Ga0068870_10195990 Ga0068870_101959902 132
248 3300005841 Ga0068863_100869449 Ga0068863_1008694493 132
249 3300005842 Ga0068858_100581217 Ga0068858_1005812171 132
250 3300005842 Ga0068858_101339832 Ga0068858_1013398322 132
251 3300005843 Ga0068860_101889726 Ga0068860_1018897261 132
252 3300005843 Ga0068860_102778411 Ga0068860_1027784111 132
253 3300005844 Ga0068862_100628815 Ga0068862_1006288152 132
254 3300005937 Ga0081455_10143774 Ga0081455_101437742 132
255 3300006028 Ga0070717_10012633 Ga0070717_1001263312 132
256 3300006028 Ga0070717_10177795 Ga0070717_101777951 132
257 3300006237 Ga0097621_100233018 Ga0097621_1002330182 132
258 3300006237 Ga0097621_100749330 Ga0097621_1007493302 132
259 3300006881 Ga0068865_100107285 Ga0068865_1001072853 132
260 3300007076 Ga0075435_100890484 Ga0075435_1008904842 132
261 3300007788 Ga0099795_10066844 Ga0099795_100668442 132
262 3300009098 Ga0105245_11295828 Ga0105245_112958283 132
263 3300009148 Ga0105243_10698320 Ga0105243_106983202 132
264 3300009177 Ga0105248_11497626 Ga0105248_114976262 132
265 3300009177 Ga0105248_11680721 Ga0105248_116807213 132
266 3300009553 Ga0105249_10010014 Ga0105249_1001001413 132
267 3300009553 Ga0105249_10027935 Ga0105249_100279357 132
268 3300010375 Ga0105239_12320804 Ga0105239_123208042 132
269 3300011119 Ga0105246_10488611 Ga0105246_104886112 132
270 3300013296 Ga0157374_10129448 Ga0157374_101294484 132
271 3300013296 Ga0157374_10200275 Ga0157374_102002753 132
272 3300013297 Ga0157378_10093534 Ga0157378_100935344 132
273 3300013297 Ga0157378_11173485 Ga0157378_111734852 132
274 3300013306 Ga0163162_11452811 Ga0163162_114528111 132
275 3300013306 Ga0163162_12625921 Ga0163162_126259211 132
276 3300014325 Ga0163163_10275798 Ga0163163_102757982 132
277 3300014325 Ga0163163_10568416 Ga0163163_105684162 132
278 3300014745 Ga0157377_11408772 Ga0157377_114087721 132
279 3300014968 Ga0157379_10595549 Ga0157379_105955491 132
280 3300014969 Ga0157376_10696859 Ga0157376_106968592 132
281 3300025908 Ga0207643_10085658 Ga0207643_100856583 132
282 3300025916 Ga0207663_11631421 Ga0207663_116314211 132
283 3300025918 Ga0207662_10073909 Ga0207662_100739094 132
284 3300025918 Ga0207662_10290548 Ga0207662_102905483 132
285 3300025918 Ga0207662_10709232 Ga0207662_107092322 132
286 3300025927 Ga0207687_11258670 Ga0207687_112586701 132
287 3300025935 Ga0207709_10679271 Ga0207709_106792711 132
288 3300025936 Ga0207670_10040259 Ga0207670_100402592 132
289 3300025936 Ga0207670_10440251 Ga0207670_104402512 132
290 3300025941 Ga0207711_10369155 Ga0207711_103691552 132
291 3300025941 Ga0207711_10610825 Ga0207711_106108253 132
292 3300025942 Ga0207689_10273876 Ga0207689_102738763 132
293 3300025961 Ga0207712_10056246 Ga0207712_100562462 132
294 3300025961 Ga0207712_10438549 Ga0207712_104385493 132
295 3300026035 Ga0207703_10548517 Ga0207703_105485171 132
296 3300026075 Ga0207708_10160426 Ga0207708_101604263 132
297 3300026088 Ga0207641_10612313 Ga0207641_106123132 132
298 3300026088 Ga0207641_11218650 Ga0207641_112186501 132
299 3300026088 Ga0207641_11670822 Ga0207641_116708221 132
300 3300026118 Ga0207675_100284710 Ga0207675_1002847103 132
301 3300026118 Ga0207675_101110281 Ga0207675_1011102812 132
302 3300028379 Ga0268266_10960170 Ga0268266_109601702 132
303 3300028380 Ga0268265_10411284 Ga0268265_104112843 132
304 3300028786 Ga0307517_10533215 Ga0307517_105332151 132
305 3300028794 Ga0307515_10050803 Ga0307515_100508036 132
306 3300030521 Ga0307511_10115653 Ga0307511_101156532 132
307 3300031238 Ga0265332_10025924 Ga0265332_100259242 132
308 3300031239 Ga0265328_10029619 Ga0265328_100296193 132
309 3300031344 Ga0265316_10069538 Ga0265316_100695385 132
310 3300031456 Ga0307513_10011625 Ga0307513_100116257 132
311 3300031507 Ga0307509_10000112 Ga0307509_1000011298 132
312 3300031507 Ga0307509_10011836 Ga0307509_100118366 132
313 3300031507 Ga0307509_10342089 Ga0307509_103420893 132
314 3300031507 Ga0307509_10567741 Ga0307509_105677412 132
315 3300031616 Ga0307508_10019824 Ga0307508_1001982414 132
316 3300031730 Ga0307516_10029367 Ga0307516_100293678 132
317 3300031901 Ga0307406_10000446 Ga0307406_1000044615 132
318 3300031901 Ga0307406_10224195 Ga0307406_102241952 132
319 3300031911 Ga0307412_11257010 Ga0307412_112570102 132
320 3300032002 Ga0307416_100556809 Ga0307416_1005568092 132
321 3300032126 Ga0307415_100042962 Ga0307415_1000429625 132
322 3300033179 Ga0307507_10213939 Ga0307507_102139392 132
323 3300034819 Ga0373958_0069772 Ga0373958_0069772_129_533 132
324 3300035089 Ga0373944_0144151 Ga0373944_0144151_346_750 132
325 3300035090 Ga0373949_0000042 Ga0373949_0000042_3961_4365 132
326 3300035113 Ga0373936_0000006 Ga0373936_0000006_126749_127153 132
327 3300035115 Ga0373941_0104248 Ga0373941_0104248_60_464 132
328 3300035118 Ga0373954_0054565 Ga0373954_0054565_352_756 132
329 3300035118 Ga0373954_0186452 Ga0373954_0186452_33_440 132
330 3300035119 Ga0373956_0188630 Ga0373956_0188630_232_636 132
331 3300035241 Ga0373961_0000015 Ga0373961_0000015_104506_104910 132
332 3300041503 Ga0451847_0709139 Ga0451847_0709139_231_629 132
333 3300044683 Ga0466965_0146782 Ga0466965_0146782_462_860 132
334 3300044693 Ga0466961_0143493 Ga0466961_0143493_709_1107 132
335 3300044694 Ga0466963_1182892 Ga0466963_1182892_21_419 132
336 3300044842 Ga0466957_0068004 Ga0466957_0068004_1373_1771 132
337 3300044842 Ga0466957_1034381 Ga0466957_1034381_131_529 132
338 3300045836 Ga0466958_0218590 Ga0466958_0218590_296_694 132
339 3300045976 Ga0466967_0347328 Ga0466967_0347328_359_757 132
340 3300046455 Ga0495603_0660462 Ga0495603_0660462_133_537 132
341 3300046519 Ga0495632_0049233 Ga0495632_0049233_1141_1545 132
342 3300046557 Ga0495622_0275289 Ga0495622_0275289_314_718 132
343 3300046660 Ga0495625_0206025 Ga0495625_0206025_671_1075 132
344 3300046694 Ga0495649_0024919 Ga0495649_0024919_737_1141 132
345 3300046694 Ga0495649_0120320 Ga0495649_0120320_451_855 132
346 3300047472 Ga0495686_0016492 Ga0495686_0016492_2668_3075 132
347 3300048088 Ga0495602_0959830 Ga0495602_0959830_27_425 132
348 3300048905 Ga0496102_0162820 Ga0496102_0162820_1095_1493 132
349 3300048911 Ga0496108_0740512 Ga0496108_0740512_182_580 132
350 3300049128 Ga0501308_015639 Ga0501308_015639_355_762 132
351 3300049571 Ga0501034_0157313 Ga0501034_0157313_422_826 132
352 3300049581 Ga0501047_0608361 Ga0501047_0608361_122_526 132
353 3300050513 nmdc:mga0rr50_490015_c1 nmdc:mga0rr50_490015_c1_117_521 132
354 3300053080 Ga0500635_0043732 Ga0500635_0043732_881_1285 132
355 3300053085 Ga0495619_0850472 Ga0495619_0850472_72_479 132
356 3300053086 Ga0500578_0031166 Ga0500578_0031166_883_1287 132
357 3300053090 Ga0500646_0001595 Ga0500646_0001595_3336_3740 132
358 3300053091 Ga0500647_0134902 Ga0500647_0134902_727_1131 132
359 3300053092 Ga0500583_0494023 Ga0500583_0494023_41_445 132
360 3300053094 Ga0500566_0013377 Ga0500566_0013377_4409_4813 132
361 3300053094 Ga0500566_0019815 Ga0500566_0019815_295_699 132
362 3300053095 Ga0500640_001894 Ga0500640_001894_368_772 132
363 3300053102 Ga0500554_000753 Ga0500554_000753_471_875 132
364 3300053108 Ga0500562_177093 Ga0500562_177093_127_531 132
365 3300053111 Ga0500572_001298 Ga0500572_001298_311_715 132
366 3300053119 Ga0500595_001095 Ga0500595_001095_7162_7566 132
367 3300053120 Ga0500597_104891 Ga0500597_104891_423_827 132
368 3300053120 Ga0500597_316777 Ga0500597_316777_151_555 132
369 3300053121 Ga0500607_119755 Ga0500607_119755_772_1176 132
370 3300053123 Ga0500614_002285 Ga0500614_002285_327_731 132
371 3300053123 Ga0500614_010281 Ga0500614_010281_990_1394 132
372 3300053130 Ga0500642_0010056 Ga0500642_0010056_637_1041 132
373 3300053136 Ga0500559_0045200 Ga0500559_0045200_1221_1625 132
374 3300053150 Ga0500603_005211 Ga0500603_005211_172_576 132
375 3300053178 Ga0500637_0137478 Ga0500637_0137478_117_521 132
376 3300053737 Ga0500601_003661 Ga0500601_003661_489_893 132
377 3300055283 Ga0500661_050840 Ga0500661_050840_102_506 132
378 3300059511 Ga0587091_077589 Ga0587091_077589_161_559 132
379 3300059641 Ga0587068_097582 Ga0587068_097582_38_436 132
380 3300061719 Ga0466962_0095353 Ga0466962_0095353_1007_1405 132
381 3300003203 JGI25406J46586_10005035 JGI25406J46586_1000503510 133
382 3300005334 Ga0068869_101317082 Ga0068869_1013170821 133
383 3300005458 Ga0070681_10301885 Ga0070681_103018852 133
384 3300005718 Ga0068866_10997026 Ga0068866_109970261 133
385 3300005985 Ga0081539_10001787 Ga0081539_1000178728 133
386 3300006237 Ga0097621_102371210 Ga0097621_1023712101 133
387 3300006881 Ga0068865_100521375 Ga0068865_1005213752 133
388 3300009553 Ga0105249_11314175 Ga0105249_113141752 133
389 3300012492 Ga0157335_1016465 Ga0157335_10164651 133
390 3300013307 Ga0157372_10085083 Ga0157372_100850835 133
391 3300013307 Ga0157372_10779128 Ga0157372_107791282 133
392 3300013308 Ga0157375_11400967 Ga0157375_114009672 133
393 3300014326 Ga0157380_12680162 Ga0157380_126801622 133
394 3300020070 Ga0206356_10459118 Ga0206356_104591181 133
395 3300021377 Ga0213874_10425682 Ga0213874_104256821 133
396 3300025899 Ga0207642_10128502 Ga0207642_101285023 133
397 3300025912 Ga0207707_10343294 Ga0207707_103432942 133
398 3300025919 Ga0207657_10588065 Ga0207657_105880652 133
399 3300025921 Ga0207652_10383719 Ga0207652_103837193 133
400 3300025921 Ga0207652_11072276 Ga0207652_110722761 133
401 3300025938 Ga0207704_10281705 Ga0207704_102817052 133
402 3300028379 Ga0268266_12164523 Ga0268266_121645231 133
403 3300031548 Ga0307408_102154780 Ga0307408_1021547801 133
404 3300031824 Ga0307413_10082713 Ga0307413_100827132 133
405 3300031852 Ga0307410_10266745 Ga0307410_102667452 133
406 3300031901 Ga0307406_10139417 Ga0307406_101394172 133
407 3300031901 Ga0307406_10993242 Ga0307406_109932422 133
408 3300031903 Ga0307407_10039964 Ga0307407_100399642 133
409 3300031995 Ga0307409_100128659 Ga0307409_1001286594 133
410 3300032004 Ga0307414_10227687 Ga0307414_102276873 133
411 3300032005 Ga0307411_10047285 Ga0307411_100472853 133
412 3300032126 Ga0307415_100103043 Ga0307415_1001030435 133
413 3300035692 Ga0373935_0083638 Ga0373935_0083638_1664_2068 133
414 3300036401 Ga0373937_1686366 Ga0373937_1686366_104_505 133
415 3300037312 Ga0395899_0474264 Ga0395899_0474264_203_604 133
416 3300044694 Ga0466963_0031126 Ga0466963_0031126_1331_1732 133
417 3300044694 Ga0466963_0157732 Ga0466963_0157732_449_850 133
418 3300044706 Ga0466964_0672203 Ga0466964_0672203_103_504 133
419 3300044842 Ga0466957_0214270 Ga0466957_0214270_343_744 133
420 3300044901 Ga0466960_0279688 Ga0466960_0279688_522_923 133
421 3300045836 Ga0466958_0036236 Ga0466958_0036236_729_1130 133
422 3300045976 Ga0466967_1543660 Ga0466967_1543660_79_480 133
423 3300045976 Ga0466967_1655969 Ga0466967_1655969_38_439 133
424 3300046477 Ga0495664_0000007 Ga0495664_0000007_130243_130644 133
425 3300046500 Ga0495596_0209206 Ga0495596_0209206_254_655 133
426 3300046663 Ga0495635_0041495 Ga0495635_0041495_957_1358 133
427 3300047323 Ga0495683_0335953 Ga0495683_0335953_75_476 133
428 3300048905 Ga0496102_0000002 Ga0496102_0000002_641019_641420 133
429 3300048906 Ga0496103_0000017 Ga0496103_0000017_234236_234637 133
430 3300048912 Ga0496109_0375278 Ga0496109_0375278_667_1071 133
431 3300048913 Ga0496110_0232030 Ga0496110_0232030_527_931 133
432 3300048913 Ga0496110_0690997 Ga0496110_0690997_357_758 133
433 3300049533 Ga0501317_032247 Ga0501317_032247_327_728 133
434 3300049534 Ga0501318_092093 Ga0501318_092093_40_441 133
435 3300049850 Ga0501204_032177 Ga0501204_032177_72_473 133
436 3300053078 Ga0495612_0206867 Ga0495612_0206867_27_428 133
437 3300053083 Ga0495655_0184972 Ga0495655_0184972_130_534 133
438 3300005535 Ga0070684_100459211 Ga0070684_1004592112 134
439 3300005937 Ga0081455_10074703 Ga0081455_100747032 134
440 3300013308 Ga0157375_12160949 Ga0157375_121609492 134
441 3300054114 Ga0501084_0199550 Ga0501084_0199550_688_1092 134
442 3300000531 CNBas_1001136 CNBas_10011363 135
443 3300000532 CNAas_1007538 CNAas_10075382 135
444 3300000546 LJNas_1021309 LJNas_10213092 135
445 3300000546 LJNas_1023594 LJNas_10235942 135
446 3300001977 JGI24746J21847_1049549 JGI24746J21847_10495491 135
447 3300001978 JGI24747J21853_1009491 JGI24747J21853_10094911 135
448 3300001989 JGI24739J22299_10186775 JGI24739J22299_101867751 135
449 3300001991 JGI24743J22301_10030734 JGI24743J22301_100307342 135
450 3300002075 JGI24738J21930_10023484 JGI24738J21930_100234843 135
451 3300002075 JGI24738J21930_10117691 JGI24738J21930_101176911 135
452 3300002077 JGI24744J21845_10029145 JGI24744J21845_100291452 135
453 3300002244 JGI24742J22300_10064244 JGI24742J22300_100642442 135
454 3300003373 JGI25407J50210_10154854 JGI25407J50210_101548541 135
455 3300003579 Ga0007429J51699_1087349 Ga0007429J51699_10873491 135
456 3300004799 Ga0058863_11733789 Ga0058863_117337892 135
457 3300004800 Ga0058861_11880043 Ga0058861_118800431 135
458 3300005327 Ga0070658_10501997 Ga0070658_105019973 135
459 3300005327 Ga0070658_10687635 Ga0070658_106876351 135
460 3300005328 Ga0070676_10260169 Ga0070676_102601692 135
461 3300005329 Ga0070683_100116514 Ga0070683_1001165145 135
462 3300005329 Ga0070683_100461992 Ga0070683_1004619922 135
463 3300005329 Ga0070683_100736310 Ga0070683_1007363102 135
464 3300005329 Ga0070683_101167809 Ga0070683_1011678092 135
465 3300005330 Ga0070690_100075543 Ga0070690_1000755431 135
466 3300005330 Ga0070690_100764046 Ga0070690_1007640462 135
467 3300005330 Ga0070690_101167670 Ga0070690_1011676702 135
468 3300005331 Ga0070670_100213810 Ga0070670_1002138104 135
469 3300005331 Ga0070670_101090686 Ga0070670_1010906862 135
470 3300005331 Ga0070670_101311990 Ga0070670_1013119901 135
471 3300005333 Ga0070677_10160298 Ga0070677_101602981 135
472 3300005333 Ga0070677_10287340 Ga0070677_102873401 135
473 3300005334 Ga0068869_100240686 Ga0068869_1002406862 135
474 3300005334 Ga0068869_100387514 Ga0068869_1003875143 135
475 3300005334 Ga0068869_100903103 Ga0068869_1009031032 135
476 3300005336 Ga0070680_100763451 Ga0070680_1007634512 135
477 3300005337 Ga0070682_100059998 Ga0070682_1000599983 135
478 3300005337 Ga0070682_100100622 Ga0070682_1001006224 135
479 3300005337 Ga0070682_100996786 Ga0070682_1009967862 135
480 3300005337 Ga0070682_101835336 Ga0070682_1018353361 135
481 3300005338 Ga0068868_100048880 Ga0068868_1000488808 135
482 3300005338 Ga0068868_100064173 Ga0068868_1000641736 135
483 3300005338 Ga0068868_100165391 Ga0068868_1001653911 135
484 3300005338 Ga0068868_100254888 Ga0068868_1002548882 135
485 3300005338 Ga0068868_100269267 Ga0068868_1002692673 135
486 3300005338 Ga0068868_100470831 Ga0068868_1004708313 135
487 3300005338 Ga0068868_100578536 Ga0068868_1005785363 135
488 3300005339 Ga0070660_100008632 Ga0070660_1000086328 135
489 3300005339 Ga0070660_100288131 Ga0070660_1002881312 135
490 3300005339 Ga0070660_100356793 Ga0070660_1003567932 135
491 3300005339 Ga0070660_100751585 Ga0070660_1007515852 135
492 3300005340 Ga0070689_100108691 Ga0070689_1001086915 135
493 3300005340 Ga0070689_100643561 Ga0070689_1006435613 135
494 3300005340 Ga0070689_100683432 Ga0070689_1006834322 135
495 3300005341 Ga0070691_10036588 Ga0070691_100365882 135
496 3300005341 Ga0070691_10110512 Ga0070691_101105122 135
497 3300005341 Ga0070691_10128530 Ga0070691_101285303 135
498 3300005343 Ga0070687_100024182 Ga0070687_1000241823 135
499 3300005343 Ga0070687_100183573 Ga0070687_1001835733 135
500 3300005343 Ga0070687_100338030 Ga0070687_1003380303 135
501 3300005344 Ga0070661_100218035 Ga0070661_1002180354 135
502 3300005344 Ga0070661_100295514 Ga0070661_1002955141 135
503 3300005344 Ga0070661_100379628 Ga0070661_1003796281 135
504 3300005345 Ga0070692_10035876 Ga0070692_100358763 135
505 3300005345 Ga0070692_10093594 Ga0070692_100935943 135
506 3300005345 Ga0070692_10463542 Ga0070692_104635422 135
507 3300005345 Ga0070692_10641545 Ga0070692_106415451 135
508 3300005347 Ga0070668_100058208 Ga0070668_1000582084 135
509 3300005347 Ga0070668_100254569 Ga0070668_1002545693 135
510 3300005353 Ga0070669_100355636 Ga0070669_1003556362 135
511 3300005353 Ga0070669_100376888 Ga0070669_1003768882 135
512 3300005354 Ga0070675_100148038 Ga0070675_1001480382 135
513 3300005354 Ga0070675_100814463 Ga0070675_1008144632 135
514 3300005354 Ga0070675_100926955 Ga0070675_1009269552 135
515 3300005354 Ga0070675_101472929 Ga0070675_1014729291 135
516 3300005355 Ga0070671_100171217 Ga0070671_1001712171 135
517 3300005355 Ga0070671_100837907 Ga0070671_1008379072 135
518 3300005356 Ga0070674_100439922 Ga0070674_1004399222 135
519 3300005356 Ga0070674_100957954 Ga0070674_1009579541 135
520 3300005356 Ga0070674_101127228 Ga0070674_1011272282 135
521 3300005364 Ga0070673_100135457 Ga0070673_1001354573 135
522 3300005364 Ga0070673_100541607 Ga0070673_1005416072 135
523 3300005365 Ga0070688_100058478 Ga0070688_1000584783 135
524 3300005365 Ga0070688_100331614 Ga0070688_1003316142 135
525 3300005365 Ga0070688_101697073 Ga0070688_1016970731 135
526 3300005366 Ga0070659_100226398 Ga0070659_1002263984 135
527 3300005366 Ga0070659_100309709 Ga0070659_1003097093 135
528 3300005366 Ga0070659_100705415 Ga0070659_1007054152 135
529 3300005366 Ga0070659_101176641 Ga0070659_1011766411 135
530 3300005367 Ga0070667_100417554 Ga0070667_1004175543 135
531 3300005367 Ga0070667_101599054 Ga0070667_1015990541 135
532 3300005434 Ga0070709_11036618 Ga0070709_110366181 135
533 3300005435 Ga0070714_100126135 Ga0070714_1001261353 135
534 3300005435 Ga0070714_100737126 Ga0070714_1007371262 135
535 3300005435 Ga0070714_101695932 Ga0070714_1016959322 135
536 3300005436 Ga0070713_101424794 Ga0070713_1014247942 135
537 3300005437 Ga0070710_10075464 Ga0070710_100754645 135
538 3300005437 Ga0070710_10408617 Ga0070710_104086171 135
539 3300005438 Ga0070701_10045375 Ga0070701_100453753 135
540 3300005438 Ga0070701_10794425 Ga0070701_107944251 135
541 3300005439 Ga0070711_100002145 Ga0070711_1000021453 135
542 3300005439 Ga0070711_100388833 Ga0070711_1003888333 135
543 3300005439 Ga0070711_100431513 Ga0070711_1004315132 135
544 3300005439 Ga0070711_100949338 Ga0070711_1009493382 135
545 3300005440 Ga0070705_100081071 Ga0070705_1000810714 135
546 3300005440 Ga0070705_100810702 Ga0070705_1008107022 135
547 3300005441 Ga0070700_100014625 Ga0070700_1000146252 135
548 3300005441 Ga0070700_100239406 Ga0070700_1002394062 135
549 3300005441 Ga0070700_100373086 Ga0070700_1003730862 135
550 3300005441 Ga0070700_100491668 Ga0070700_1004916681 135
551 3300005441 Ga0070700_100843368 Ga0070700_1008433682 135
552 3300005441 Ga0070700_101123187 Ga0070700_1011231872 135
553 3300005441 Ga0070700_101502058 Ga0070700_1015020582 135
554 3300005444 Ga0070694_100373262 Ga0070694_1003732622 135
555 3300005444 Ga0070694_100980481 Ga0070694_1009804811 135
556 3300005444 Ga0070694_101203633 Ga0070694_1012036331 135
557 3300005445 Ga0070708_101348895 Ga0070708_1013488952 135
558 3300005455 Ga0070663_100178784 Ga0070663_1001787841 135
559 3300005456 Ga0070678_100688805 Ga0070678_1006888052 135
560 3300005456 Ga0070678_100719654 Ga0070678_1007196542 135
561 3300005456 Ga0070678_100853820 Ga0070678_1008538202 135
562 3300005457 Ga0070662_100020737 Ga0070662_1000207376 135
563 3300005457 Ga0070662_100631379 Ga0070662_1006313792 135
564 3300005457 Ga0070662_100631411 Ga0070662_1006314112 135
565 3300005457 Ga0070662_101200231 Ga0070662_1012002312 135
566 3300005457 Ga0070662_101257807 Ga0070662_1012578072 135
567 3300005458 Ga0070681_11193968 Ga0070681_111939681 135
568 3300005459 Ga0068867_100053386 Ga0068867_1000533861 135
569 3300005459 Ga0068867_101171712 Ga0068867_1011717121 135
570 3300005459 Ga0068867_101376040 Ga0068867_1013760402 135
571 3300005466 Ga0070685_10023094 Ga0070685_100230944 135
572 3300005466 Ga0070685_10107992 Ga0070685_101079924 135
573 3300005466 Ga0070685_10214336 Ga0070685_102143363 135
574 3300005466 Ga0070685_10329969 Ga0070685_103299692 135
575 3300005467 Ga0070706_101171058 Ga0070706_1011710582 135
576 3300005530 Ga0070679_100434053 Ga0070679_1004340533 135
577 3300005530 Ga0070679_100859131 Ga0070679_1008591311 135
578 3300005530 Ga0070679_101088965 Ga0070679_1010889651 135
579 3300005535 Ga0070684_100036894 Ga0070684_1000368948 135
580 3300005535 Ga0070684_100038986 Ga0070684_1000389867 135
581 3300005535 Ga0070684_100073453 Ga0070684_1000734534 135
582 3300005535 Ga0070684_100666851 Ga0070684_1006668513 135
583 3300005535 Ga0070684_101738042 Ga0070684_1017380422 135
584 3300005539 Ga0068853_100635959 Ga0068853_1006359593 135
585 3300005539 Ga0068853_100767835 Ga0068853_1007678352 135
586 3300005543 Ga0070672_100119315 Ga0070672_1001193153 135
587 3300005543 Ga0070672_100159691 Ga0070672_1001596914 135
588 3300005543 Ga0070672_100366786 Ga0070672_1003667863 135
589 3300005544 Ga0070686_100068990 Ga0070686_1000689903 135
590 3300005544 Ga0070686_100179547 Ga0070686_1001795472 135
591 3300005544 Ga0070686_101012684 Ga0070686_1010126842 135
592 3300005546 Ga0070696_100245985 Ga0070696_1002459851 135
593 3300005548 Ga0070665_100090116 Ga0070665_1000901164 135
594 3300005548 Ga0070665_100681997 Ga0070665_1006819973 135
595 3300005548 Ga0070665_100841054 Ga0070665_1008410543 135
596 3300005548 Ga0070665_101452599 Ga0070665_1014525992 135
597 3300005549 Ga0070704_100198834 Ga0070704_1001988343 135
598 3300005549 Ga0070704_100334782 Ga0070704_1003347823 135
599 3300005549 Ga0070704_100813022 Ga0070704_1008130223 135
600 3300005563 Ga0068855_100497070 Ga0068855_1004970703 135
601 3300005564 Ga0070664_100038200 Ga0070664_1000382007 135
602 3300005564 Ga0070664_100104636 Ga0070664_1001046363 135
603 3300005564 Ga0070664_100136855 Ga0070664_1001368553 135
604 3300005564 Ga0070664_100163037 Ga0070664_1001630374 135
605 3300005564 Ga0070664_100255965 Ga0070664_1002559653 135
606 3300005564 Ga0070664_101131440 Ga0070664_1011314403 135
607 3300005577 Ga0068857_100472271 Ga0068857_1004722712 135
608 3300005577 Ga0068857_101491634 Ga0068857_1014916342 135
609 3300005578 Ga0068854_100211908 Ga0068854_1002119082 135
610 3300005578 Ga0068854_100276299 Ga0068854_1002762992 135
611 3300005578 Ga0068854_101440939 Ga0068854_1014409392 135
612 3300005578 Ga0068854_102075383 Ga0068854_1020753832 135
613 3300005614 Ga0068856_100682409 Ga0068856_1006824092 135
614 3300005614 Ga0068856_101347288 Ga0068856_1013472882 135
615 3300005615 Ga0070702_100064234 Ga0070702_1000642342 135
616 3300005615 Ga0070702_100078971 Ga0070702_1000789712 135
617 3300005615 Ga0070702_100100832 Ga0070702_1001008321 135
618 3300005615 Ga0070702_100128944 Ga0070702_1001289443 135
619 3300005615 Ga0070702_100168715 Ga0070702_1001687151 135
620 3300005615 Ga0070702_100257237 Ga0070702_1002572372 135
621 3300005616 Ga0068852_100058425 Ga0068852_1000584256 135
622 3300005616 Ga0068852_100599629 Ga0068852_1005996292 135
623 3300005616 Ga0068852_100896738 Ga0068852_1008967382 135
624 3300005616 Ga0068852_101356646 Ga0068852_1013566462 135
625 3300005617 Ga0068859_100378791 Ga0068859_1003787913 135
626 3300005617 Ga0068859_100682304 Ga0068859_1006823043 135
627 3300005618 Ga0068864_100037025 Ga0068864_1000370256 135
628 3300005618 Ga0068864_100310300 Ga0068864_1003103004 135
629 3300005718 Ga0068866_10036975 Ga0068866_100369753 135
630 3300005718 Ga0068866_10147966 Ga0068866_101479662 135
631 3300005719 Ga0068861_100047582 Ga0068861_1000475824 135
632 3300005719 Ga0068861_100294672 Ga0068861_1002946722 135
633 3300005719 Ga0068861_100305573 Ga0068861_1003055733 135
634 3300005834 Ga0068851_10097895 Ga0068851_100978953 135
635 3300005834 Ga0068851_10118258 Ga0068851_101182582 135
636 3300005834 Ga0068851_10465960 Ga0068851_104659602 135
637 3300005840 Ga0068870_10171657 Ga0068870_101716572 135
638 3300005840 Ga0068870_10317657 Ga0068870_103176572 135
639 3300005840 Ga0068870_10624912 Ga0068870_106249122 135
640 3300005840 Ga0068870_10757944 Ga0068870_107579442 135
641 3300005840 Ga0068870_10843130 Ga0068870_108431302 135
642 3300005841 Ga0068863_100472171 Ga0068863_1004721712 135
643 3300005841 Ga0068863_100975030 Ga0068863_1009750302 135
644 3300005842 Ga0068858_100119037 Ga0068858_1001190372 135
645 3300005842 Ga0068858_100170708 Ga0068858_1001707083 135
646 3300005842 Ga0068858_100790000 Ga0068858_1007900002 135
647 3300005842 Ga0068858_100838519 Ga0068858_1008385193 135
648 3300005843 Ga0068860_100194759 Ga0068860_1001947593 135
649 3300005844 Ga0068862_100125512 Ga0068862_1001255122 135
650 3300005844 Ga0068862_100738553 Ga0068862_1007385533 135
651 3300005937 Ga0081455_10023793 Ga0081455_100237938 135
652 3300005937 Ga0081455_10049901 Ga0081455_100499014 135
653 3300005981 Ga0081538_10005811 Ga0081538_100058117 135
654 3300005981 Ga0081538_10012937 Ga0081538_100129379 135
655 3300005981 Ga0081538_10018887 Ga0081538_100188872 135
656 3300005981 Ga0081538_10344944 Ga0081538_103449441 135
657 3300005983 Ga0081540_1016109 Ga0081540_10161095 135
658 3300005983 Ga0081540_1054747 Ga0081540_10547474 135
659 3300005985 Ga0081539_10099531 Ga0081539_100995313 135
660 3300006038 Ga0075365_10122363 Ga0075365_101223632 135
661 3300006058 Ga0075432_10128863 Ga0075432_101288632 135
662 3300006173 Ga0070716_100336972 Ga0070716_1003369722 135
663 3300006173 Ga0070716_100479465 Ga0070716_1004794653 135
664 3300006175 Ga0070712_100012973 Ga0070712_1000129739 135
665 3300006175 Ga0070712_100063431 Ga0070712_1000634313 135
666 3300006175 Ga0070712_100102308 Ga0070712_1001023083 135
667 3300006175 Ga0070712_100130781 Ga0070712_1001307814 135
668 3300006237 Ga0097621_101422411 Ga0097621_1014224112 135
669 3300006358 Ga0068871_100046531 Ga0068871_1000465314 135
670 3300006358 Ga0068871_100787265 Ga0068871_1007872651 135
671 3300006358 Ga0068871_101051587 Ga0068871_1010515872 135
672 3300006844 Ga0075428_100254576 Ga0075428_1002545764 135
673 3300006844 Ga0075428_101672818 Ga0075428_1016728182 135
674 3300006846 Ga0075430_100021314 Ga0075430_1000213142 135
675 3300006846 Ga0075430_100557860 Ga0075430_1005578602 135
676 3300006846 Ga0075430_100578407 Ga0075430_1005784073 135
677 3300006847 Ga0075431_102060875 Ga0075431_1020608751 135
678 3300006852 Ga0075433_10061451 Ga0075433_100614515 135
679 3300006880 Ga0075429_101619717 Ga0075429_1016197171 135
680 3300006881 Ga0068865_100157423 Ga0068865_1001574232 135
681 3300006881 Ga0068865_101329792 Ga0068865_1013297922 135
682 3300006931 Ga0097620_100378789 Ga0097620_1003787893 135
683 3300006931 Ga0097620_100682330 Ga0097620_1006823303 135
684 3300009093 Ga0105240_10006736 Ga0105240_1000673612 135
685 3300009093 Ga0105240_10658346 Ga0105240_106583463 135
686 3300009093 Ga0105240_10724132 Ga0105240_107241323 135
687 3300009094 Ga0111539_10269084 Ga0111539_102690842 135
688 3300009094 Ga0111539_10867289 Ga0111539_108672892 135
689 3300009094 Ga0111539_11553093 Ga0111539_115530932 135
690 3300009094 Ga0111539_12442123 Ga0111539_124421232 135
691 3300009094 Ga0111539_12482805 Ga0111539_124828052 135
692 3300009094 Ga0111539_12642813 Ga0111539_126428132 135
693 3300009098 Ga0105245_10133984 Ga0105245_101339845 135
694 3300009098 Ga0105245_10271349 Ga0105245_102713493 135
695 3300009098 Ga0105245_10287401 Ga0105245_102874012 135
696 3300009098 Ga0105245_10664590 Ga0105245_106645902 135
697 3300009098 Ga0105245_11223389 Ga0105245_112233891 135
698 3300009098 Ga0105245_11754941 Ga0105245_117549412 135
699 3300009098 Ga0105245_11922020 Ga0105245_119220202 135
700 3300009101 Ga0105247_10829816 Ga0105247_108298163 135
701 3300009101 Ga0105247_10966366 Ga0105247_109663662 135
702 3300009147 Ga0114129_11181798 Ga0114129_111817982 135
703 3300009147 Ga0114129_11453555 Ga0114129_114535552 135
704 3300009147 Ga0114129_12152298 Ga0114129_121522981 135
705 3300009148 Ga0105243_10051478 Ga0105243_100514783 135
706 3300009148 Ga0105243_10203167 Ga0105243_102031674 135
707 3300009148 Ga0105243_10215376 Ga0105243_102153762 135
708 3300009148 Ga0105243_10346988 Ga0105243_103469883 135
709 3300009148 Ga0105243_10695140 Ga0105243_106951403 135
710 3300009148 Ga0105243_11304383 Ga0105243_113043832 135
711 3300009148 Ga0105243_12056873 Ga0105243_120568732 135
712 3300009174 Ga0105241_10128163 Ga0105241_101281633 135
713 3300009174 Ga0105241_10347375 Ga0105241_103473753 135
714 3300009174 Ga0105241_10724900 Ga0105241_107249003 135
715 3300009174 Ga0105241_11028271 Ga0105241_110282713 135
716 3300009176 Ga0105242_10183321 Ga0105242_101833214 135
717 3300009176 Ga0105242_11162749 Ga0105242_111627492 135
718 3300009176 Ga0105242_11395880 Ga0105242_113958802 135
719 3300009177 Ga0105248_10182568 Ga0105248_101825686 135
720 3300009177 Ga0105248_10427647 Ga0105248_104276472 135
721 3300009177 Ga0105248_10877181 Ga0105248_108771811 135
722 3300009177 Ga0105248_11105198 Ga0105248_111051982 135
723 3300009545 Ga0105237_10000795 Ga0105237_1000079526 135
724 3300009545 Ga0105237_10037314 Ga0105237_100373146 135
725 3300009545 Ga0105237_10703485 Ga0105237_107034852 135
726 3300009551 Ga0105238_10159249 Ga0105238_101592495 135
727 3300009551 Ga0105238_10599601 Ga0105238_105996013 135
728 3300009551 Ga0105238_10689752 Ga0105238_106897522 135
729 3300009551 Ga0105238_10787619 Ga0105238_107876192 135
730 3300009551 Ga0105238_10985094 Ga0105238_109850941 135
731 3300009551 Ga0105238_11062052 Ga0105238_110620522 135
732 3300009553 Ga0105249_10472886 Ga0105249_104728863 135
733 3300009553 Ga0105249_10651314 Ga0105249_106513142 135
734 3300009553 Ga0105249_11257564 Ga0105249_112575642 135
735 3300009553 Ga0105249_11363762 Ga0105249_113637622 135
736 3300010375 Ga0105239_10344229 Ga0105239_103442292 135
737 3300010375 Ga0105239_10395555 Ga0105239_103955553 135
738 3300010375 Ga0105239_11198363 Ga0105239_111983632 135
739 3300010375 Ga0105239_11312312 Ga0105239_113123122 135
740 3300011119 Ga0105246_10252569 Ga0105246_102525692 135
741 3300011119 Ga0105246_10310273 Ga0105246_103102732 135
742 3300011119 Ga0105246_10951919 Ga0105246_109519192 135
743 3300012490 Ga0157322_1003805 Ga0157322_10038052 135
744 3300013100 Ga0157373_10109642 Ga0157373_101096424 135
745 3300013102 Ga0157371_10324864 Ga0157371_103248642 135
746 3300013102 Ga0157371_11609083 Ga0157371_116090831 135
747 3300013104 Ga0157370_11191915 Ga0157370_111919152 135
748 3300013104 Ga0157370_11197106 Ga0157370_111971062 135
749 3300013105 Ga0157369_10475474 Ga0157369_104754743 135
750 3300013105 Ga0157369_10589793 Ga0157369_105897933 135
751 3300013105 Ga0157369_11183365 Ga0157369_111833652 135
752 3300013105 Ga0157369_11879110 Ga0157369_118791101 135
753 3300013296 Ga0157374_10442804 Ga0157374_104428043 135
754 3300013296 Ga0157374_10761911 Ga0157374_107619111 135
755 3300013296 Ga0157374_11820053 Ga0157374_118200531 135
756 3300013296 Ga0157374_12858385 Ga0157374_128583851 135
757 3300013297 Ga0157378_12191975 Ga0157378_121919752 135
758 3300013306 Ga0163162_10408973 Ga0163162_104089733 135
759 3300013306 Ga0163162_10442697 Ga0163162_104426973 135
760 3300013306 Ga0163162_10617802 Ga0163162_106178023 135
761 3300013306 Ga0163162_10894844 Ga0163162_108948443 135
762 3300013307 Ga0157372_10274420 Ga0157372_102744201 135
763 3300013307 Ga0157372_10553882 Ga0157372_105538823 135
764 3300013307 Ga0157372_10927850 Ga0157372_109278502 135
765 3300013307 Ga0157372_11708082 Ga0157372_117080821 135
766 3300013307 Ga0157372_12598440 Ga0157372_125984401 135
767 3300013307 Ga0157372_12974731 Ga0157372_129747311 135
768 3300013308 Ga0157375_10260991 Ga0157375_102609911 135
769 3300013308 Ga0157375_10902761 Ga0157375_109027612 135
770 3300013308 Ga0157375_12103571 Ga0157375_121035711 135
771 3300014325 Ga0163163_10338021 Ga0163163_103380214 135
772 3300014325 Ga0163163_10689529 Ga0163163_106895293 135
773 3300014326 Ga0157380_10796907 Ga0157380_107969072 135
774 3300014326 Ga0157380_11023414 Ga0157380_110234141 135
775 3300014326 Ga0157380_11027663 Ga0157380_110276633 135
776 3300014326 Ga0157380_11731749 Ga0157380_117317491 135
777 3300014326 Ga0157380_12945135 Ga0157380_129451351 135
778 3300014745 Ga0157377_10347050 Ga0157377_103470503 135
779 3300014745 Ga0157377_10887749 Ga0157377_108877492 135
780 3300014968 Ga0157379_10689748 Ga0157379_106897482 135
781 3300014968 Ga0157379_11509206 Ga0157379_115092062 135
782 3300014969 Ga0157376_10332356 Ga0157376_103323563 135
783 3300014969 Ga0157376_10745563 Ga0157376_107455632 135
784 3300014969 Ga0157376_12029854 Ga0157376_120298542 135
785 3300014969 Ga0157376_12232786 Ga0157376_122327862 135
786 3300017792 Ga0163161_10166675 Ga0163161_101666752 135
787 3300017792 Ga0163161_10260041 Ga0163161_102600413 135
788 3300017792 Ga0163161_10690939 Ga0163161_106909391 135
789 3300020069 Ga0197907_10260649 Ga0197907_102606492 135
790 3300020069 Ga0197907_11160759 Ga0197907_111607592 135
791 3300020070 Ga0206356_10156694 Ga0206356_101566941 135
792 3300020070 Ga0206356_10527733 Ga0206356_105277332 135
793 3300020070 Ga0206356_11545250 Ga0206356_115452502 135
794 3300020076 Ga0206355_1550264 Ga0206355_15502641 135
795 3300020077 Ga0206351_10035649 Ga0206351_100356492 135
796 3300020078 Ga0206352_10895791 Ga0206352_108957911 135
797 3300020080 Ga0206350_10403330 Ga0206350_104033302 135
798 3300020080 Ga0206350_11621122 Ga0206350_116211222 135
799 3300020081 Ga0206354_10395992 Ga0206354_103959921 135
800 3300020081 Ga0206354_10577140 Ga0206354_105771402 135
801 3300020081 Ga0206354_10729251 Ga0206354_107292511 135
802 3300020081 Ga0206354_10754954 Ga0206354_107549542 135
803 3300020082 Ga0206353_10349727 Ga0206353_103497272 135
804 3300020082 Ga0206353_10938401 Ga0206353_109384011 135
805 3300020082 Ga0206353_11230023 Ga0206353_112300232 135
806 3300022467 Ga0224712_10175186 Ga0224712_101751862 135
807 3300022467 Ga0224712_10179169 Ga0224712_101791692 135
808 3300022467 Ga0224712_10209681 Ga0224712_102096813 135
809 3300022467 Ga0224712_10329666 Ga0224712_103296662 135
810 3300025302 Ga0207426_1105583 Ga0207426_11055832 135
811 3300025321 Ga0207656_10491943 Ga0207656_104919432 135
812 3300025893 Ga0207682_10218795 Ga0207682_102187952 135
813 3300025893 Ga0207682_10272464 Ga0207682_102724641 135
814 3300025898 Ga0207692_10100092 Ga0207692_101000921 135
815 3300025899 Ga0207642_10328675 Ga0207642_103286752 135
816 3300025899 Ga0207642_10386233 Ga0207642_103862332 135
817 3300025899 Ga0207642_10803733 Ga0207642_108037331 135
818 3300025900 Ga0207710_10346056 Ga0207710_103460563 135
819 3300025901 Ga0207688_10014487 Ga0207688_100144874 135
820 3300025901 Ga0207688_10077880 Ga0207688_100778803 135
821 3300025901 Ga0207688_10098651 Ga0207688_100986514 135
822 3300025901 Ga0207688_10427456 Ga0207688_104274562 135
823 3300025901 Ga0207688_10578383 Ga0207688_105783832 135
824 3300025903 Ga0207680_10217566 Ga0207680_102175662 135
825 3300025904 Ga0207647_10037449 Ga0207647_100374496 135
826 3300025904 Ga0207647_10785528 Ga0207647_107855281 135
827 3300025906 Ga0207699_10412654 Ga0207699_104126542 135
828 3300025906 Ga0207699_10640395 Ga0207699_106403952 135
829 3300025906 Ga0207699_10839350 Ga0207699_108393502 135
830 3300025907 Ga0207645_10194319 Ga0207645_101943193 135
831 3300025908 Ga0207643_10056455 Ga0207643_100564554 135
832 3300025908 Ga0207643_10060045 Ga0207643_100600452 135
833 3300025908 Ga0207643_10067248 Ga0207643_100672482 135
834 3300025908 Ga0207643_10130984 Ga0207643_101309842 135
835 3300025908 Ga0207643_10620487 Ga0207643_106204872 135
836 3300025908 Ga0207643_10910315 Ga0207643_109103152 135
837 3300025909 Ga0207705_10278631 Ga0207705_102786311 135
838 3300025909 Ga0207705_10861482 Ga0207705_108614822 135
839 3300025911 Ga0207654_10112077 Ga0207654_101120773 135
840 3300025911 Ga0207654_10345644 Ga0207654_103456442 135
841 3300025911 Ga0207654_10940969 Ga0207654_109409691 135
842 3300025912 Ga0207707_10120608 Ga0207707_101206083 135
843 3300025912 Ga0207707_11014908 Ga0207707_110149081 135
844 3300025912 Ga0207707_11111053 Ga0207707_111110531 135
845 3300025913 Ga0207695_10024364 Ga0207695_100243644 135
846 3300025914 Ga0207671_10007459 Ga0207671_1000745913 135
847 3300025914 Ga0207671_10756199 Ga0207671_107561992 135
848 3300025915 Ga0207693_10042371 Ga0207693_100423714 135
849 3300025915 Ga0207693_10128045 Ga0207693_101280451 135
850 3300025915 Ga0207693_10401087 Ga0207693_104010872 135
851 3300025916 Ga0207663_10043259 Ga0207663_100432594 135
852 3300025916 Ga0207663_10148493 Ga0207663_101484933 135
853 3300025916 Ga0207663_10163174 Ga0207663_101631743 135
854 3300025916 Ga0207663_10237231 Ga0207663_102372312 135
855 3300025916 Ga0207663_10467160 Ga0207663_104671602 135
856 3300025917 Ga0207660_10314975 Ga0207660_103149752 135
857 3300025917 Ga0207660_10871599 Ga0207660_108715992 135
858 3300025917 Ga0207660_11358589 Ga0207660_113585892 135
859 3300025918 Ga0207662_10012124 Ga0207662_100121243 135
860 3300025918 Ga0207662_10012576 Ga0207662_1001257610 135
861 3300025918 Ga0207662_10178187 Ga0207662_101781873 135
862 3300025918 Ga0207662_10314016 Ga0207662_103140162 135
863 3300025919 Ga0207657_10010857 Ga0207657_1001085712 135
864 3300025919 Ga0207657_10086697 Ga0207657_100866975 135
865 3300025919 Ga0207657_10119705 Ga0207657_101197052 135
866 3300025919 Ga0207657_10240566 Ga0207657_102405661 135
867 3300025919 Ga0207657_10480692 Ga0207657_104806922 135
868 3300025920 Ga0207649_10303873 Ga0207649_103038732 135
869 3300025920 Ga0207649_10732492 Ga0207649_107324921 135
870 3300025920 Ga0207649_11188910 Ga0207649_111889102 135
871 3300025921 Ga0207652_10457008 Ga0207652_104570082 135
872 3300025924 Ga0207694_10419362 Ga0207694_104193623 135
873 3300025924 Ga0207694_10434353 Ga0207694_104343532 135
874 3300025924 Ga0207694_10959882 Ga0207694_109598822 135
875 3300025925 Ga0207650_10221288 Ga0207650_102212883 135
876 3300025925 Ga0207650_11484926 Ga0207650_114849262 135
877 3300025927 Ga0207687_10097367 Ga0207687_100973673 135
878 3300025927 Ga0207687_10149376 Ga0207687_101493763 135
879 3300025927 Ga0207687_10167257 Ga0207687_101672572 135
880 3300025927 Ga0207687_10263470 Ga0207687_102634703 135
881 3300025927 Ga0207687_10760920 Ga0207687_107609203 135
882 3300025929 Ga0207664_10176362 Ga0207664_101763623 135
883 3300025929 Ga0207664_10305464 Ga0207664_103054643 135
884 3300025931 Ga0207644_10672219 Ga0207644_106722192 135
885 3300025931 Ga0207644_11098874 Ga0207644_110988742 135
886 3300025932 Ga0207690_10055403 Ga0207690_100554033 135
887 3300025932 Ga0207690_10142127 Ga0207690_101421272 135
888 3300025932 Ga0207690_10327141 Ga0207690_103271413 135
889 3300025932 Ga0207690_10355275 Ga0207690_103552751 135
890 3300025932 Ga0207690_11411966 Ga0207690_114119661 135
891 3300025933 Ga0207706_10056627 Ga0207706_100566277 135
892 3300025933 Ga0207706_10272226 Ga0207706_102722264 135
893 3300025933 Ga0207706_10274417 Ga0207706_102744172 135
894 3300025933 Ga0207706_10625895 Ga0207706_106258952 135
895 3300025933 Ga0207706_11494648 Ga0207706_114946482 135
896 3300025934 Ga0207686_10967217 Ga0207686_109672171 135
897 3300025935 Ga0207709_10052519 Ga0207709_100525193 135
898 3300025935 Ga0207709_10097825 Ga0207709_100978255 135
899 3300025935 Ga0207709_10300316 Ga0207709_103003161 135
900 3300025935 Ga0207709_10328423 Ga0207709_103284232 135
901 3300025936 Ga0207670_10197632 Ga0207670_101976323 135
902 3300025937 Ga0207669_10041848 Ga0207669_100418485 135
903 3300025937 Ga0207669_10564845 Ga0207669_105648453 135
904 3300025937 Ga0207669_10605580 Ga0207669_106055801 135
905 3300025938 Ga0207704_10504860 Ga0207704_105048602 135
906 3300025938 Ga0207704_10743348 Ga0207704_107433482 135
907 3300025939 Ga0207665_10178516 Ga0207665_101785163 135
908 3300025939 Ga0207665_10191422 Ga0207665_101914223 135
909 3300025939 Ga0207665_10762533 Ga0207665_107625331 135
910 3300025939 Ga0207665_11255041 Ga0207665_112550411 135
911 3300025940 Ga0207691_10170989 Ga0207691_101709892 135
912 3300025940 Ga0207691_10325442 Ga0207691_103254423 135
913 3300025941 Ga0207711_11287322 Ga0207711_112873221 135
914 3300025942 Ga0207689_10013833 Ga0207689_100138339 135
915 3300025942 Ga0207689_10264484 Ga0207689_102644843 135
916 3300025942 Ga0207689_10278642 Ga0207689_102786422 135
917 3300025944 Ga0207661_10126242 Ga0207661_101262422 135
918 3300025944 Ga0207661_10150775 Ga0207661_101507753 135
919 3300025944 Ga0207661_10429873 Ga0207661_104298732 135
920 3300025944 Ga0207661_11683660 Ga0207661_116836601 135
921 3300025945 Ga0207679_10073821 Ga0207679_100738214 135
922 3300025945 Ga0207679_10345969 Ga0207679_103459693 135
923 3300025945 Ga0207679_10485459 Ga0207679_104854591 135
924 3300025945 Ga0207679_10696535 Ga0207679_106965352 135
925 3300025949 Ga0207667_11131185 Ga0207667_111311852 135
926 3300025960 Ga0207651_11255239 Ga0207651_112552391 135
927 3300025961 Ga0207712_11007244 Ga0207712_110072442 135
928 3300025961 Ga0207712_11086161 Ga0207712_110861611 135
929 3300025961 Ga0207712_11196174 Ga0207712_111961742 135
930 3300025961 Ga0207712_11361899 Ga0207712_113618992 135
931 3300025972 Ga0207668_10049888 Ga0207668_100498884 135
932 3300025972 Ga0207668_10114278 Ga0207668_101142783 135
933 3300025972 Ga0207668_10385218 Ga0207668_103852183 135
934 3300025972 Ga0207668_10542070 Ga0207668_105420702 135
935 3300025972 Ga0207668_10631785 Ga0207668_106317852 135
936 3300025972 Ga0207668_10718649 Ga0207668_107186491 135
937 3300025972 Ga0207668_10967723 Ga0207668_109677231 135
938 3300025981 Ga0207640_10123688 Ga0207640_101236883 135
939 3300025981 Ga0207640_10135995 Ga0207640_101359955 135
940 3300025981 Ga0207640_10555145 Ga0207640_105551453 135
941 3300025981 Ga0207640_10907629 Ga0207640_109076291 135
942 3300025981 Ga0207640_11074355 Ga0207640_110743551 135
943 3300025986 Ga0207658_10148842 Ga0207658_101488422 135
944 3300025986 Ga0207658_11374086 Ga0207658_113740861 135
945 3300026023 Ga0207677_10067197 Ga0207677_100671973 135
946 3300026023 Ga0207677_10118219 Ga0207677_101182194 135
947 3300026023 Ga0207677_10181177 Ga0207677_101811774 135
948 3300026035 Ga0207703_10229042 Ga0207703_102290423 135
949 3300026035 Ga0207703_10268366 Ga0207703_102683662 135
950 3300026035 Ga0207703_10303136 Ga0207703_103031362 135
951 3300026041 Ga0207639_10037689 Ga0207639_100376892 135
952 3300026041 Ga0207639_10392748 Ga0207639_103927482 135
953 3300026041 Ga0207639_10648702 Ga0207639_106487021 135
954 3300026067 Ga0207678_10022375 Ga0207678_1002237510 135
955 3300026067 Ga0207678_10639574 Ga0207678_106395742 135
956 3300026067 Ga0207678_10971943 Ga0207678_109719432 135
957 3300026067 Ga0207678_11806138 Ga0207678_118061381 135
958 3300026075 Ga0207708_10008513 Ga0207708_100085134 135
959 3300026075 Ga0207708_10025712 Ga0207708_100257128 135
960 3300026075 Ga0207708_10156614 Ga0207708_101566141 135
961 3300026075 Ga0207708_10200996 Ga0207708_102009964 135
962 3300026075 Ga0207708_10211554 Ga0207708_102115543 135
963 3300026075 Ga0207708_10577552 Ga0207708_105775522 135
964 3300026075 Ga0207708_10665828 Ga0207708_106658282 135
965 3300026078 Ga0207702_10069350 Ga0207702_100693508 135
966 3300026078 Ga0207702_10497876 Ga0207702_104978763 135
967 3300026078 Ga0207702_10835944 Ga0207702_108359441 135
968 3300026088 Ga0207641_10899230 Ga0207641_108992301 135
969 3300026089 Ga0207648_10132395 Ga0207648_101323955 135
970 3300026089 Ga0207648_10188365 Ga0207648_101883653 135
971 3300026089 Ga0207648_10266533 Ga0207648_102665333 135
972 3300026089 Ga0207648_11484598 Ga0207648_114845982 135
973 3300026095 Ga0207676_10428470 Ga0207676_104284703 135
974 3300026095 Ga0207676_11056908 Ga0207676_110569082 135
975 3300026095 Ga0207676_11177026 Ga0207676_111770261 135
976 3300026095 Ga0207676_12096599 Ga0207676_120965991 135
977 3300026116 Ga0207674_10207862 Ga0207674_102078622 135
978 3300026116 Ga0207674_11752306 Ga0207674_117523061 135
979 3300026116 Ga0207674_11793271 Ga0207674_117932712 135
980 3300026118 Ga0207675_100024485 Ga0207675_1000244856 135
981 3300026118 Ga0207675_100071876 Ga0207675_1000718764 135
982 3300026118 Ga0207675_100318748 Ga0207675_1003187483 135
983 3300026118 Ga0207675_100485795 Ga0207675_1004857952 135
984 3300026118 Ga0207675_100498973 Ga0207675_1004989733 135
985 3300026121 Ga0207683_10025472 Ga0207683_100254729 135
986 3300026121 Ga0207683_10408180 Ga0207683_104081803 135
987 3300026121 Ga0207683_10443152 Ga0207683_104431522 135
988 3300026121 Ga0207683_11128168 Ga0207683_111281682 135
989 3300026121 Ga0207683_11605734 Ga0207683_116057342 135
990 3300026142 Ga0207698_10151614 Ga0207698_101516143 135
991 3300026142 Ga0207698_10464413 Ga0207698_104644132 135
992 3300026142 Ga0207698_10657921 Ga0207698_106579212 135
993 3300027717 Ga0209998_10020598 Ga0209998_100205983 135
994 3300027907 Ga0207428_10120383 Ga0207428_101203834 135
995 3300027907 Ga0207428_10234728 Ga0207428_102347283 135
996 3300028379 Ga0268266_10104816 Ga0268266_101048163 135
997 3300028379 Ga0268266_10889140 Ga0268266_108891402 135
998 3300028380 Ga0268265_10208156 Ga0268265_102081562 135
999 3300028380 Ga0268265_10681929 Ga0268265_106819292 135
1000 3300028380 Ga0268265_11192463 Ga0268265_111924632 135
1001 3300028381 Ga0268264_10705856 Ga0268264_107058563 135
1002 3300028381 Ga0268264_11894812 Ga0268264_118948121 135
1003 3300028800 Ga0265338_10059335 Ga0265338_100593353 135
1004 3300031251 Ga0265327_10031033 Ga0265327_100310335 135
1005 3300031344 Ga0265316_10143256 Ga0265316_101432562 135
1006 3300031344 Ga0265316_10610282 Ga0265316_106102821 135
1007 3300031548 Ga0307408_100814173 Ga0307408_1008141732 135
1008 3300031548 Ga0307408_101114411 Ga0307408_1011144112 135
1009 3300031548 Ga0307408_102517028 Ga0307408_1025170281 135
1010 3300031731 Ga0307405_10033428 Ga0307405_100334288 135
1011 3300031731 Ga0307405_10280288 Ga0307405_102802882 135
1012 3300031731 Ga0307405_10716697 Ga0307405_107166972 135
1013 3300031824 Ga0307413_10044661 Ga0307413_100446612 135
1014 3300031824 Ga0307413_10151556 Ga0307413_101515564 135
1015 3300031824 Ga0307413_10328433 Ga0307413_103284333 135
1016 3300031824 Ga0307413_10821925 Ga0307413_108219252 135
1017 3300031824 Ga0307413_11114826 Ga0307413_111148262 135
1018 3300031824 Ga0307413_11334761 Ga0307413_113347611 135
1019 3300031852 Ga0307410_10044469 Ga0307410_100444694 135
1020 3300031852 Ga0307410_10258101 Ga0307410_102581013 135
1021 3300031852 Ga0307410_10545719 Ga0307410_105457193 135
1022 3300031852 Ga0307410_10567990 Ga0307410_105679901 135
1023 3300031852 Ga0307410_11081542 Ga0307410_110815422 135
1024 3300031852 Ga0307410_11236762 Ga0307410_112367621 135
1025 3300031852 Ga0307410_11300851 Ga0307410_113008511 135
1026 3300031889 Ga0326468_10002313 Ga0326468_100023133 135
1027 3300031889 Ga0326468_10018305 Ga0326468_100183051 135
1028 3300031901 Ga0307406_10159532 Ga0307406_101595322 135
1029 3300031901 Ga0307406_10265638 Ga0307406_102656382 135
1030 3300031901 Ga0307406_10372485 Ga0307406_103724852 135
1031 3300031901 Ga0307406_10708689 Ga0307406_107086893 135
1032 3300031901 Ga0307406_10783199 Ga0307406_107831992 135
1033 3300031901 Ga0307406_11177499 Ga0307406_111774991 135
1034 3300031901 Ga0307406_11847597 Ga0307406_118475971 135
1035 3300031901 Ga0307406_11867453 Ga0307406_118674531 135
1036 3300031903 Ga0307407_10175869 Ga0307407_101758692 135
1037 3300031903 Ga0307407_10232560 Ga0307407_102325603 135
1038 3300031903 Ga0307407_10293767 Ga0307407_102937672 135
1039 3300031903 Ga0307407_10419521 Ga0307407_104195212 135
1040 3300031903 Ga0307407_10709844 Ga0307407_107098441 135
1041 3300031903 Ga0307407_10767567 Ga0307407_107675671 135
1042 3300031911 Ga0307412_10253099 Ga0307412_102530993 135
1043 3300031911 Ga0307412_10407525 Ga0307412_104075252 135
1044 3300031911 Ga0307412_11941369 Ga0307412_119413691 135
1045 3300031995 Ga0307409_100156161 Ga0307409_1001561613 135
1046 3300031995 Ga0307409_100179831 Ga0307409_1001798315 135
1047 3300031995 Ga0307409_100274970 Ga0307409_1002749702 135
1048 3300031995 Ga0307409_100278582 Ga0307409_1002785824 135
1049 3300031995 Ga0307409_100486157 Ga0307409_1004861573 135
1050 3300031995 Ga0307409_100695631 Ga0307409_1006956312 135
1051 3300031995 Ga0307409_100887963 Ga0307409_1008879632 135
1052 3300031995 Ga0307409_100982899 Ga0307409_1009828991 135
1053 3300031995 Ga0307409_101020673 Ga0307409_1010206731 135
1054 3300031995 Ga0307409_101129999 Ga0307409_1011299993 135
1055 3300031995 Ga0307409_101367888 Ga0307409_1013678881 135
1056 3300031995 Ga0307409_102002568 Ga0307409_1020025681 135
1057 3300032002 Ga0307416_100028261 Ga0307416_1000282616 135
1058 3300032002 Ga0307416_100365960 Ga0307416_1003659602 135
1059 3300032002 Ga0307416_100480353 Ga0307416_1004803533 135
1060 3300032002 Ga0307416_100928300 Ga0307416_1009283002 135
1061 3300032002 Ga0307416_101249613 Ga0307416_1012496133 135
1062 3300032002 Ga0307416_102138600 Ga0307416_1021386002 135
1063 3300032002 Ga0307416_102293180 Ga0307416_1022931801 135
1064 3300032004 Ga0307414_10157137 Ga0307414_101571375 135
1065 3300032004 Ga0307414_10346983 Ga0307414_103469832 135
1066 3300032004 Ga0307414_10560133 Ga0307414_105601331 135
1067 3300032004 Ga0307414_10688168 Ga0307414_106881683 135
1068 3300032004 Ga0307414_10715807 Ga0307414_107158073 135
1069 3300032004 Ga0307414_10881573 Ga0307414_108815732 135
1070 3300032004 Ga0307414_10985361 Ga0307414_109853612 135
1071 3300032005 Ga0307411_10228428 Ga0307411_102284283 135
1072 3300032005 Ga0307411_10969451 Ga0307411_109694512 135
1073 3300032005 Ga0307411_11245521 Ga0307411_112455211 135
1074 3300032005 Ga0307411_11254122 Ga0307411_112541221 135
1075 3300032005 Ga0307411_12338354 Ga0307411_123383541 135
1076 3300032126 Ga0307415_100013486 Ga0307415_1000134865 135
1077 3300032126 Ga0307415_100069318 Ga0307415_1000693184 135
1078 3300032126 Ga0307415_100315083 Ga0307415_1003150832 135
1079 3300032126 Ga0307415_100733400 Ga0307415_1007334002 135
1080 3300032126 Ga0307415_101190469 Ga0307415_1011904692 135
1081 3300032126 Ga0307415_101318536 Ga0307415_1013185361 135
1082 3300032126 Ga0307415_101883455 Ga0307415_1018834552 135
1083 3300034820 Ga0373959_0010441 Ga0373959_0010441_1164_1574 135
1084 3300035084 Ga0373928_0083552 Ga0373928_0083552_227_637 135
1085 3300035088 Ga0373940_0172431 Ga0373940_0172431_111_521 135
1086 3300035092 Ga0373952_0141808 Ga0373952_0141808_137_547 135
1087 3300035115 Ga0373941_0026675 Ga0373941_0026675_433_843 135
1088 3300035691 Ga0373931_0350671 Ga0373931_0350671_412_819 135
1089 3300035691 Ga0373931_0690626 Ga0373931_0690626_208_618 135
1090 3300035724 Ga0373933_0600388 Ga0373933_0600388_34_441 135
1091 3300035724 Ga0373933_0946005 Ga0373933_0946005_94_501 135
1092 3300035725 Ga0373947_0773182 Ga0373947_0773182_74_481 135
1093 3300037068 Ga0373925_0143662 Ga0373925_0143662_192_599 135
1094 3300037312 Ga0395899_0234080 Ga0395899_0234080_592_999 135
1095 3300037418 Ga0395900_0129946 Ga0395900_0129946_1685_2092 135
1096 3300037418 Ga0395900_1173528 Ga0395900_1173528_248_655 135
1097 3300037466 Ga0395898_0255428 Ga0395898_0255428_887_1294 135
1098 3300037466 Ga0395898_0296456 Ga0395898_0296456_1124_1531 135
1099 3300037466 Ga0395898_0426716 Ga0395898_0426716_318_725 135
1100 3300037466 Ga0395898_0607110 Ga0395898_0607110_385_792 135
1101 3300037466 Ga0395898_0730487 Ga0395898_0730487_78_485 135
1102 3300037471 Ga0395905_0225550 Ga0395905_0225550_374_781 135
1103 3300037471 Ga0395905_0309184 Ga0395905_0309184_746_1153 135
1104 3300037853 Ga0436364_1395085 Ga0436364_1395085_14_421 135
1105 3300038443 Ga0395901_0124285 Ga0395901_0124285_1624_2031 135
1106 3300038443 Ga0395901_1130784 Ga0395901_1130784_205_612 135
1107 3300038443 Ga0395901_1646832 Ga0395901_1646832_13_420 135
1108 3300039437 Ga0436365_0954496 Ga0436365_0954496_378_785 135
1109 3300039437 Ga0436365_1838581 Ga0436365_1838581_186_593 135
1110 3300039450 Ga0436363_0584301 Ga0436363_0584301_112_519 135
1111 3300039450 Ga0436363_0986073 Ga0436363_0986073_484_891 135
1112 3300041406 Ga0439439_0222361 Ga0439439_0222361_73_480 135
1113 3300041413 Ga0439465_0086957 Ga0439465_0086957_528_935 135
1114 3300041443 Ga0451789_0091105 Ga0451789_0091105_781_1188 135
1115 3300041451 Ga0451791_1353119 Ga0451791_1353119_1809_2216 135
1116 3300041452 Ga0451793_0152428 Ga0451793_0152428_71_478 135
1117 3300041453 Ga0451797_0011443 Ga0451797_0011443_1006_1413 135
1118 3300041459 Ga0451800_0362132 Ga0451800_0362132_361_768 135
1119 3300041460 Ga0451802_0857638 Ga0451802_0857638_36_443 135
1120 3300041486 Ga0451807_1972304 Ga0451807_1972304_155_562 135
1121 3300041491 Ga0451833_0506572 Ga0451833_0506572_301_708 135
1122 3300041494 Ga0451837_0354457 Ga0451837_0354457_1954_2361 135
1123 3300041498 Ga0451841_1193332 Ga0451841_1193332_661_1068 135
1124 3300041509 Ga0451843_0771766 Ga0451843_0771766_410_817 135
1125 3300041512 Ga0451853_0777436 Ga0451853_0777436_378_785 135
1126 3300041512 Ga0451853_2037896 Ga0451853_2037896_1569_1976 135
1127 3300042008 Ga0439450_058704 Ga0439450_058704_402_809 135
1128 3300042009 Ga0439451_061574 Ga0439451_061574_74_481 135
1129 3300042012 Ga0439455_0127718 Ga0439455_0127718_105_512 135
1130 3300042016 Ga0439463_017891 Ga0439463_017891_942_1349 135
1131 3300042118 Ga0450914_002915 Ga0450914_002915_11_418 135
1132 3300042142 Ga0450905_054786 Ga0450905_054786_131_538 135
1133 3300042437 Ga0439444_0001353 Ga0439444_0001353_1898_2305 135
1134 3300042438 Ga0439459_0111886 Ga0439459_0111886_30_437 135
1135 3300042438 Ga0439459_0175930 Ga0439459_0175930_138_545 135
1136 3300042438 Ga0439459_0224239 Ga0439459_0224239_68_475 135
1137 3300042439 Ga0439464_0012839 Ga0439464_0012839_149_556 135
1138 3300042532 Ga0450893_0048351 Ga0450893_0048351_64_471 135
1139 3300042993 Ga0439440_0004989 Ga0439440_0004989_1264_1671 135
1140 3300044658 Ga0466972_0287972 Ga0466972_0287972_73_480 135
1141 3300044683 Ga0466965_0154339 Ga0466965_0154339_497_904 135
1142 3300044683 Ga0466965_0212249 Ga0466965_0212249_386_793 135
1143 3300044684 Ga0466966_0093740 Ga0466966_0093740_442_849 135
1144 3300044684 Ga0466966_0124012 Ga0466966_0124012_1060_1467 135
1145 3300044693 Ga0466961_0037057 Ga0466961_0037057_1155_1562 135
1146 3300044693 Ga0466961_0043779 Ga0466961_0043779_2276_2683 135
1147 3300044693 Ga0466961_0085337 Ga0466961_0085337_1467_1874 135
1148 3300044694 Ga0466963_0089212 Ga0466963_0089212_35_442 135
1149 3300044694 Ga0466963_0096517 Ga0466963_0096517_389_796 135
1150 3300044694 Ga0466963_0231007 Ga0466963_0231007_476_883 135
1151 3300044694 Ga0466963_0352209 Ga0466963_0352209_511_918 135
1152 3300044694 Ga0466963_0399690 Ga0466963_0399690_493_900 135
1153 3300044694 Ga0466963_0435733 Ga0466963_0435733_45_452 135
1154 3300044694 Ga0466963_0651368 Ga0466963_0651368_45_452 135
1155 3300044694 Ga0466963_1158883 Ga0466963_1158883_58_465 135
1156 3300044706 Ga0466964_0129233 Ga0466964_0129233_546_953 135
1157 3300044706 Ga0466964_0142785 Ga0466964_0142785_456_866 135
1158 3300044706 Ga0466964_0194842 Ga0466964_0194842_312_719 135
1159 3300044706 Ga0466964_0245374 Ga0466964_0245374_44_454 135
1160 3300044719 Ga0466971_0002843 Ga0466971_0002843_6044_6451 135
1161 3300044719 Ga0466971_0029438 Ga0466971_0029438_1963_2370 135
1162 3300044765 Ga0466970_0191972 Ga0466970_0191972_696_1103 135
1163 3300044842 Ga0466957_0061797 Ga0466957_0061797_734_1141 135
1164 3300044842 Ga0466957_0165341 Ga0466957_0165341_338_745 135
1165 3300044842 Ga0466957_0195507 Ga0466957_0195507_904_1311 135
1166 3300044842 Ga0466957_0648431 Ga0466957_0648431_67_474 135
1167 3300044842 Ga0466957_0940620 Ga0466957_0940620_95_502 135
1168 3300044901 Ga0466960_0047777 Ga0466960_0047777_179_586 135
1169 3300044901 Ga0466960_0059111 Ga0466960_0059111_41_448 135
1170 3300044901 Ga0466960_0063633 Ga0466960_0063633_1170_1580 135
1171 3300044901 Ga0466960_0128550 Ga0466960_0128550_593_1000 135
1172 3300044901 Ga0466960_0272230 Ga0466960_0272230_150_557 135
1173 3300044901 Ga0466960_0324561 Ga0466960_0324561_78_485 135
1174 3300045049 Ga0466959_0002215 Ga0466959_0002215_8840_9247 135
1175 3300045049 Ga0466959_0473289 Ga0466959_0473289_379_786 135
1176 3300045836 Ga0466958_0009429 Ga0466958_0009429_4283_4690 135
1177 3300045836 Ga0466958_0149264 Ga0466958_0149264_695_1102 135
1178 3300045836 Ga0466958_0324134 Ga0466958_0324134_26_433 135
1179 3300045836 Ga0466958_0397663 Ga0466958_0397663_109_516 135
1180 3300045976 Ga0466967_0051187 Ga0466967_0051187_2484_2891 135
1181 3300045976 Ga0466967_0063703 Ga0466967_0063703_916_1323 135
1182 3300045976 Ga0466967_0195274 Ga0466967_0195274_457_867 135
1183 3300045976 Ga0466967_0195449 Ga0466967_0195449_1108_1515 135
1184 3300045976 Ga0466967_0237690 Ga0466967_0237690_946_1353 135
1185 3300045976 Ga0466967_0299080 Ga0466967_0299080_285_692 135
1186 3300045976 Ga0466967_0473383 Ga0466967_0473383_764_1171 135
1187 3300045976 Ga0466967_0509116 Ga0466967_0509116_429_839 135
1188 3300045976 Ga0466967_0629057 Ga0466967_0629057_514_921 135
1189 3300045976 Ga0466967_0873946 Ga0466967_0873946_253_660 135
1190 3300045976 Ga0466967_1736603 Ga0466967_1736603_11_421 135
1191 3300046454 Ga0495592_0156082 Ga0495592_0156082_495_902 135
1192 3300046455 Ga0495603_0121963 Ga0495603_0121963_1025_1432 135
1193 3300046461 Ga0495641_0550194 Ga0495641_0550194_30_437 135
1194 3300046462 Ga0495651_0273325 Ga0495651_0273325_546_953 135
1195 3300046463 Ga0495653_0038646 Ga0495653_0038646_1941_2348 135
1196 3300046475 Ga0495639_0277131 Ga0495639_0277131_167_574 135
1197 3300046491 Ga0495584_0415339 Ga0495584_0415339_40_447 135
1198 3300046499 Ga0495594_0371583 Ga0495594_0371583_188_595 135
1199 3300046511 Ga0495608_0630679 Ga0495608_0630679_118_525 135
1200 3300046513 Ga0495616_0459792 Ga0495616_0459792_93_500 135
1201 3300046514 Ga0495618_0000035 Ga0495618_0000035_74100_74507 135
1202 3300046515 Ga0495620_0072092 Ga0495620_0072092_439_846 135
1203 3300046517 Ga0495630_0000610 Ga0495630_0000610_15856_16263 135
1204 3300046517 Ga0495630_0286116 Ga0495630_0286116_764_1171 135
1205 3300046518 Ga0495631_0264249 Ga0495631_0264249_37_444 135
1206 3300046518 Ga0495631_0433624 Ga0495631_0433624_51_458 135
1207 3300046519 Ga0495632_0333435 Ga0495632_0333435_72_479 135
1208 3300046538 Ga0495609_0237259 Ga0495609_0237259_133_540 135
1209 3300046543 Ga0495645_0000033 Ga0495645_0000033_28801_29208 135
1210 3300046615 Ga0495656_0101624 Ga0495656_0101624_621_1028 135
1211 3300046615 Ga0495656_0599253 Ga0495656_0599253_57_464 135
1212 3300046663 Ga0495635_0557190 Ga0495635_0557190_187_594 135
1213 3300046674 Ga0495588_0166115 Ga0495588_0166115_229_636 135
1214 3300046674 Ga0495588_0499820 Ga0495588_0499820_179_586 135
1215 3300046675 Ga0495657_0000027 Ga0495657_0000027_100978_101385 135
1216 3300046681 Ga0495647_0193224 Ga0495647_0193224_365_772 135
1217 3300046683 Ga0495658_0330886 Ga0495658_0330886_546_953 135
1218 3300046690 Ga0495624_0053715 Ga0495624_0053715_810_1217 135
1219 3300046690 Ga0495624_0442408 Ga0495624_0442408_330_737 135
1220 3300046694 Ga0495649_0425579 Ga0495649_0425579_85_492 135
1221 3300046794 Ga0495589_0219446 Ga0495589_0219446_291_698 135
1222 3300046794 Ga0495589_0273092 Ga0495589_0273092_119_526 135
1223 3300047315 Ga0495581_0182687 Ga0495581_0182687_696_1103 135
1224 3300047317 Ga0495604_0555324 Ga0495604_0555324_36_443 135
1225 3300047319 Ga0495674_0100939 Ga0495674_0100939_421_828 135
1226 3300047319 Ga0495674_0141365 Ga0495674_0141365_58_465 135
1227 3300047321 Ga0495676_0099183 Ga0495676_0099183_1406_1813 135
1228 3300047321 Ga0495676_1018818 Ga0495676_1018818_22_429 135
1229 3300047322 Ga0495680_0165161 Ga0495680_0165161_284_691 135
1230 3300047322 Ga0495680_0294664 Ga0495680_0294664_669_1076 135
1231 3300047445 Ga0495677_0334785 Ga0495677_0334785_104_514 135
1232 3300047471 Ga0495684_0066049 Ga0495684_0066049_1104_1511 135
1233 3300047471 Ga0495684_0900927 Ga0495684_0900927_73_480 135
1234 3300048090 Ga0495615_0165358 Ga0495615_0165358_133_540 135
1235 3300048903 Ga0496100_0024347 Ga0496100_0024347_1944_2354 135
1236 3300048903 Ga0496100_0436162 Ga0496100_0436162_519_926 135
1237 3300048903 Ga0496100_0486014 Ga0496100_0486014_209_619 135
1238 3300048903 Ga0496100_0505230 Ga0496100_0505230_203_613 135
1239 3300048904 Ga0496101_0100575 Ga0496101_0100575_355_762 135
1240 3300048904 Ga0496101_0354842 Ga0496101_0354842_480_887 135
1241 3300048905 Ga0496102_0240481 Ga0496102_0240481_426_833 135
1242 3300048905 Ga0496102_0545251 Ga0496102_0545251_320_730 135
1243 3300048905 Ga0496102_0652788 Ga0496102_0652788_384_791 135
1244 3300048905 Ga0496102_0787944 Ga0496102_0787944_32_439 135
1245 3300048905 Ga0496102_0851097 Ga0496102_0851097_333_740 135
1246 3300048906 Ga0496103_0033430 Ga0496103_0033430_910_1317 135
1247 3300048906 Ga0496103_0818316 Ga0496103_0818316_28_435 135
1248 3300048907 Ga0496104_0000001 Ga0496104_0000001_326925_327332 135
1249 3300048907 Ga0496104_0036497 Ga0496104_0036497_2640_3050 135
1250 3300048907 Ga0496104_0040221 Ga0496104_0040221_366_773 135
1251 3300048907 Ga0496104_0065631 Ga0496104_0065631_2509_2916 135
1252 3300048907 Ga0496104_0143826 Ga0496104_0143826_310_717 135
1253 3300048907 Ga0496104_0769375 Ga0496104_0769375_104_511 135
1254 3300048907 Ga0496104_0871828 Ga0496104_0871828_381_791 135
1255 3300048908 Ga0496105_0083463 Ga0496105_0083463_803_1213 135
1256 3300048908 Ga0496105_0086869 Ga0496105_0086869_1733_2140 135
1257 3300048908 Ga0496105_0501721 Ga0496105_0501721_234_641 135
1258 3300048909 Ga0496106_0147663 Ga0496106_0147663_1330_1740 135
1259 3300048909 Ga0496106_0162838 Ga0496106_0162838_479_886 135
1260 3300048909 Ga0496106_0511564 Ga0496106_0511564_49_456 135
1261 3300048909 Ga0496106_1058730 Ga0496106_1058730_21_428 135
1262 3300048910 Ga0496107_0133809 Ga0496107_0133809_1096_1503 135
1263 3300048910 Ga0496107_0251996 Ga0496107_0251996_550_960 135
1264 3300048910 Ga0496107_0370494 Ga0496107_0370494_293_703 135
1265 3300048910 Ga0496107_0951566 Ga0496107_0951566_21_428 135
1266 3300048910 Ga0496107_1381042 Ga0496107_1381042_58_465 135
1267 3300048911 Ga0496108_0169624 Ga0496108_0169624_304_711 135
1268 3300048911 Ga0496108_0211148 Ga0496108_0211148_198_605 135
1269 3300048911 Ga0496108_0259653 Ga0496108_0259653_21_428 135
1270 3300048911 Ga0496108_0263273 Ga0496108_0263273_906_1313 135
1271 3300048911 Ga0496108_0464789 Ga0496108_0464789_370_777 135
1272 3300048912 Ga0496109_0169840 Ga0496109_0169840_1572_1982 135
1273 3300048912 Ga0496109_0272183 Ga0496109_0272183_494_901 135
1274 3300048912 Ga0496109_0509979 Ga0496109_0509979_523_930 135
1275 3300048912 Ga0496109_0882821 Ga0496109_0882821_324_731 135
1276 3300048912 Ga0496109_0886616 Ga0496109_0886616_317_724 135
1277 3300048912 Ga0496109_1760197 Ga0496109_1760197_55_462 135
1278 3300048913 Ga0496110_0000152 Ga0496110_0000152_26764_27171 135
1279 3300048913 Ga0496110_0052009 Ga0496110_0052009_1420_1827 135
1280 3300048913 Ga0496110_0060868 Ga0496110_0060868_2820_3227 135
1281 3300048913 Ga0496110_0122036 Ga0496110_0122036_1611_2018 135
1282 3300048913 Ga0496110_0279924 Ga0496110_0279924_572_979 135
1283 3300048913 Ga0496110_1393244 Ga0496110_1393244_123_533 135
1284 3300048913 Ga0496110_1608591 Ga0496110_1608591_35_442 135
1285 3300048914 Ga0496111_0000123 Ga0496111_0000123_11504_11911 135
1286 3300048914 Ga0496111_0103230 Ga0496111_0103230_256_663 135
1287 3300048914 Ga0496111_0140920 Ga0496111_0140920_1343_1750 135
1288 3300048914 Ga0496111_0470284 Ga0496111_0470284_392_799 135
1289 3300048914 Ga0496111_1053826 Ga0496111_1053826_92_499 135
1290 3300048915 Ga0496112_0005170 Ga0496112_0005170_6842_7249 135
1291 3300048915 Ga0496112_0024276 Ga0496112_0024276_2892_3299 135
1292 3300048915 Ga0496112_0037175 Ga0496112_0037175_244_651 135
1293 3300048915 Ga0496112_0193955 Ga0496112_0193955_1227_1637 135
1294 3300048915 Ga0496112_0562304 Ga0496112_0562304_87_494 135
1295 3300048915 Ga0496112_0964105 Ga0496112_0964105_71_478 135
1296 3300048915 Ga0496112_1170335 Ga0496112_1170335_173_580 135
1297 3300048916 Ga0496113_0042204 Ga0496113_0042204_2827_3234 135
1298 3300048916 Ga0496113_0079994 Ga0496113_0079994_1805_2215 135
1299 3300048916 Ga0496113_0218770 Ga0496113_0218770_498_905 135
1300 3300048916 Ga0496113_0306181 Ga0496113_0306181_348_755 135
1301 3300048916 Ga0496113_0590688 Ga0496113_0590688_383_790 135
1302 3300048916 Ga0496113_0663916 Ga0496113_0663916_275_682 135
1303 3300048917 Ga0496114_0018473 Ga0496114_0018473_4276_4686 135
1304 3300048917 Ga0496114_0191299 Ga0496114_0191299_56_463 135
1305 3300048917 Ga0496114_0714998 Ga0496114_0714998_437_844 135
1306 3300048917 Ga0496114_0916565 Ga0496114_0916565_230_637 135
1307 3300048917 Ga0496114_1392193 Ga0496114_1392193_137_544 135
1308 3300048918 Ga0496115_0338767 Ga0496115_0338767_446_853 135
1309 3300048918 Ga0496115_0554612 Ga0496115_0554612_174_581 135
1310 3300048929 Ga0496126_1310790 Ga0496126_1310790_41_448 135
1311 3300049127 Ga0501306_001374 Ga0501306_001374_1784_2191 135
1312 3300049127 Ga0501306_099357 Ga0501306_099357_73_480 135
1313 3300049127 Ga0501306_106457 Ga0501306_106457_17_424 135
1314 3300049128 Ga0501308_010483 Ga0501308_010483_609_1016 135
1315 3300049129 Ga0501309_025922 Ga0501309_025922_213_620 135
1316 3300049130 Ga0501310_020346 Ga0501310_020346_369_776 135
1317 3300049130 Ga0501310_022222 Ga0501310_022222_27_434 135
1318 3300049130 Ga0501310_039267 Ga0501310_039267_61_468 135
1319 3300049160 Ga0501304_033043 Ga0501304_033043_100_507 135
1320 3300049161 Ga0501305_026589 Ga0501305_026589_172_579 135
1321 3300049161 Ga0501305_031867 Ga0501305_031867_14_421 135
1322 3300049161 Ga0501305_065671 Ga0501305_065671_60_467 135
1323 3300049162 Ga0501307_010596 Ga0501307_010596_49_456 135
1324 3300049162 Ga0501307_068861 Ga0501307_068861_19_426 135
1325 3300049162 Ga0501307_074433 Ga0501307_074433_48_455 135
1326 3300049527 Ga0501311_031990 Ga0501311_031990_298_705 135
1327 3300049527 Ga0501311_034039 Ga0501311_034039_14_421 135
1328 3300049527 Ga0501311_048303 Ga0501311_048303_30_437 135
1329 3300049527 Ga0501311_080347 Ga0501311_080347_21_428 135
1330 3300049528 Ga0501312_080589 Ga0501312_080589_89_496 135
1331 3300049529 Ga0501313_016784 Ga0501313_016784_428_835 135
1332 3300049529 Ga0501313_018715 Ga0501313_018715_406_813 135
1333 3300049530 Ga0501314_016823 Ga0501314_016823_12_419 135
1334 3300049531 Ga0501315_057939 Ga0501315_057939_90_497 135
1335 3300049532 Ga0501316_070799 Ga0501316_070799_70_477 135
1336 3300049533 Ga0501317_008122 Ga0501317_008122_436_843 135
1337 3300049533 Ga0501317_043034 Ga0501317_043034_256_663 135
1338 3300049533 Ga0501317_051676 Ga0501317_051676_58_468 135
1339 3300049534 Ga0501318_005041 Ga0501318_005041_453_860 135
1340 3300049534 Ga0501318_048258 Ga0501318_048258_45_455 135
1341 3300049534 Ga0501318_049778 Ga0501318_049778_173_580 135
1342 3300049534 Ga0501318_054445 Ga0501318_054445_15_422 135
1343 3300049534 Ga0501318_068568 Ga0501318_068568_68_475 135
1344 3300049534 Ga0501318_077689 Ga0501318_077689_27_434 135
1345 3300049535 Ga0501319_012645 Ga0501319_012645_165_572 135
1346 3300049535 Ga0501319_016493 Ga0501319_016493_70_477 135
1347 3300049536 Ga0501320_004510 Ga0501320_004510_744_1151 135
1348 3300049536 Ga0501320_055114 Ga0501320_055114_113_520 135
1349 3300049537 Ga0501321_035885 Ga0501321_035885_91_501 135
1350 3300049539 Ga0501323_003329 Ga0501323_003329_931_1338 135
1351 3300049539 Ga0501323_020376 Ga0501323_020376_441_848 135
1352 3300049539 Ga0501323_021398 Ga0501323_021398_26_433 135
1353 3300049539 Ga0501323_041310 Ga0501323_041310_129_536 135
1354 3300049539 Ga0501323_050893 Ga0501323_050893_42_449 135
1355 3300049539 Ga0501323_056816 Ga0501323_056816_113_520 135
1356 3300049540 Ga0501324_005127 Ga0501324_005127_612_1019 135
1357 3300049540 Ga0501324_021188 Ga0501324_021188_24_431 135
1358 3300049541 Ga0501325_015874 Ga0501325_015874_125_532 135
1359 3300049541 Ga0501325_025100 Ga0501325_025100_179_586 135
1360 3300049541 Ga0501325_026039 Ga0501325_026039_151_558 135
1361 3300049542 Ga0501326_04670 Ga0501326_04670_293_700 135
1362 3300049548 Ga0501332_06041 Ga0501332_06041_308_715 135
1363 3300049552 Ga0501336_011089 Ga0501336_011089_29_436 135
1364 3300049556 Ga0501340_013035 Ga0501340_013035_38_445 135
1365 3300049568 Ga0501031_0045032 Ga0501031_0045032_1044_1451 135
1366 3300049568 Ga0501031_0241734 Ga0501031_0241734_755_1162 135
1367 3300049568 Ga0501031_0668653 Ga0501031_0668653_39_446 135
1368 3300049570 Ga0501033_0369756 Ga0501033_0369756_44_451 135
1369 3300049570 Ga0501033_0538860 Ga0501033_0538860_101_508 135
1370 3300049570 Ga0501033_0963606 Ga0501033_0963606_85_492 135
1371 3300049571 Ga0501034_0312070 Ga0501034_0312070_284_691 135
1372 3300049572 Ga0501036_0224890 Ga0501036_0224890_383_790 135
1373 3300049572 Ga0501036_0460193 Ga0501036_0460193_238_645 135
1374 3300049572 Ga0501036_1454859 Ga0501036_1454859_102_509 135
1375 3300049573 Ga0501037_1130128 Ga0501037_1130128_52_459 135
1376 3300049574 Ga0501038_0064358 Ga0501038_0064358_1029_1436 135
1377 3300049574 Ga0501038_0236800 Ga0501038_0236800_510_917 135
1378 3300049575 Ga0501039_0834539 Ga0501039_0834539_33_440 135
1379 3300049575 Ga0501039_1051204 Ga0501039_1051204_212_619 135
1380 3300049576 Ga0501040_0476507 Ga0501040_0476507_236_643 135
1381 3300049576 Ga0501040_1005508 Ga0501040_1005508_21_428 135
1382 3300049576 Ga0501040_1269103 Ga0501040_1269103_41_448 135
1383 3300049577 Ga0501041_0101653 Ga0501041_0101653_1326_1733 135
1384 3300049577 Ga0501041_0355174 Ga0501041_0355174_479_886 135
1385 3300049577 Ga0501041_0630780 Ga0501041_0630780_153_560 135
1386 3300049577 Ga0501041_0969940 Ga0501041_0969940_126_533 135
1387 3300049578 Ga0501042_0123976 Ga0501042_0123976_25_432 135
1388 3300049580 Ga0501046_0370010 Ga0501046_0370010_439_846 135
1389 3300049580 Ga0501046_1273382 Ga0501046_1273382_25_432 135
1390 3300049581 Ga0501047_0064838 Ga0501047_0064838_619_1026 135
1391 3300049582 Ga0501048_0114451 Ga0501048_0114451_273_680 135
1392 3300049582 Ga0501048_0129715 Ga0501048_0129715_1136_1543 135
1393 3300049583 Ga0501067_0103473 Ga0501067_0103473_851_1261 135
1394 3300049583 Ga0501067_0205228 Ga0501067_0205228_257_667 135
1395 3300049583 Ga0501067_0303084 Ga0501067_0303084_408_815 135
1396 3300049583 Ga0501067_0353157 Ga0501067_0353157_131_538 135
1397 3300049583 Ga0501067_0844086 Ga0501067_0844086_27_434 135
1398 3300049584 Ga0501068_0436743 Ga0501068_0436743_102_509 135
1399 3300049585 Ga0501069_0008335 Ga0501069_0008335_1436_1843 135
1400 3300049585 Ga0501069_0335301 Ga0501069_0335301_284_691 135
1401 3300049586 Ga0501070_0257541 Ga0501070_0257541_488_898 135
1402 3300049586 Ga0501070_1002555 Ga0501070_1002555_41_448 135
1403 3300049587 Ga0501071_0446459 Ga0501071_0446459_134_541 135
1404 3300049587 Ga0501071_0732412 Ga0501071_0732412_116_523 135
1405 3300049587 Ga0501071_0901864 Ga0501071_0901864_167_574 135
1406 3300049588 Ga0501072_0022407 Ga0501072_0022407_82_489 135
1407 3300049588 Ga0501072_0164404 Ga0501072_0164404_681_1088 135
1408 3300049589 Ga0501073_1073292 Ga0501073_1073292_37_444 135
1409 3300049590 Ga0501074_0235240 Ga0501074_0235240_527_934 135
1410 3300049590 Ga0501074_0345981 Ga0501074_0345981_72_479 135
1411 3300049590 Ga0501074_0589332 Ga0501074_0589332_176_583 135
1412 3300049591 Ga0501075_0259986 Ga0501075_0259986_480_887 135
1413 3300049592 Ga0501076_0185295 Ga0501076_0185295_1048_1455 135
1414 3300049592 Ga0501076_0376060 Ga0501076_0376060_648_1055 135
1415 3300049592 Ga0501076_0629695 Ga0501076_0629695_302_709 135
1416 3300049592 Ga0501076_0755445 Ga0501076_0755445_79_486 135
1417 3300049593 Ga0501077_0082333 Ga0501077_0082333_198_605 135
1418 3300049656 Ga0501209_177865 Ga0501209_177865_226_636 135
1419 3300049741 Ga0501079_0111889 Ga0501079_0111889_1054_1461 135
1420 3300049742 Ga0501080_0051340 Ga0501080_0051340_715_1122 135
1421 3300049742 Ga0501080_0192882 Ga0501080_0192882_576_983 135
1422 3300049742 Ga0501080_1080077 Ga0501080_1080077_56_463 135
1423 3300049743 Ga0501081_0339785 Ga0501081_0339785_614_1021 135
1424 3300049743 Ga0501081_0953734 Ga0501081_0953734_90_497 135
1425 3300049744 Ga0501083_0306065 Ga0501083_0306065_381_788 135
1426 3300049744 Ga0501083_0768191 Ga0501083_0768191_13_420 135
1427 3300049762 Ga0501265_053120 Ga0501265_053120_22_429 135
1428 3300049822 Ga0501035_0774111 Ga0501035_0774111_112_519 135
1429 3300049823 Ga0501044_0340937 Ga0501044_0340937_936_1343 135
1430 3300049823 Ga0501044_0497092 Ga0501044_0497092_400_807 135
1431 3300049824 Ga0501045_0236958 Ga0501045_0236958_91_498 135
1432 3300050491 nmdc:mga00v17_295790_c1 nmdc:mga00v17_295790_c1_180_587 135
1433 3300050492 nmdc:mga0yw44_473461_c1 nmdc:mga0yw44_473461_c1_256_663 135
1434 3300050494 nmdc:mga06z11_232003_c1 nmdc:mga06z11_232003_c1_260_667 135
1435 3300050507 nmdc:mga05p37_536441_c1 nmdc:mga05p37_536441_c1_261_668 135
1436 3300050508 nmdc:mga09592_279953_c1 nmdc:mga09592_279953_c1_605_1012 135
1437 3300050509 nmdc:mga0qj67_12200_c1 nmdc:mga0qj67_12200_c1_295_702 135
1438 3300050509 nmdc:mga0qj67_675251_c1 nmdc:mga0qj67_675251_c1_230_637 135
1439 3300050509 nmdc:mga0qj67_754676_c1 nmdc:mga0qj67_754676_c1_38_445 135
1440 3300050510 nmdc:mga06r32_551663_c1 nmdc:mga06r32_551663_c1_395_802 135
1441 3300050511 nmdc:mga08y16_166926_c1 nmdc:mga08y16_166926_c1_1040_1447 135
1442 3300050511 nmdc:mga08y16_1798830_c1 nmdc:mga08y16_1798830_c1_57_467 135
1443 3300050511 nmdc:mga08y16_690375_c1 nmdc:mga08y16_690375_c1_517_924 135
1444 3300050511 nmdc:mga08y16_883194_c1 nmdc:mga08y16_883194_c1_464_871 135
1445 3300050512 nmdc:mga0n895_108333_c1 nmdc:mga0n895_108333_c1_1768_2178 135
1446 3300050515 nmdc:mga0a205_422107_c1 nmdc:mga0a205_422107_c1_500_907 135
1447 3300050515 nmdc:mga0a205_79219_c1 nmdc:mga0a205_79219_c1_1155_1565 135
1448 3300053078 Ga0495612_0000369 Ga0495612_0000369_4114_4521 135
1449 3300053083 Ga0495655_0013664 Ga0495655_0013664_922_1329 135
1450 3300053083 Ga0495655_0070854 Ga0495655_0070854_473_880 135
1451 3300053083 Ga0495655_0076526 Ga0495655_0076526_257_664 135
1452 3300053083 Ga0495655_0081252 Ga0495655_0081252_300_707 135
1453 3300053085 Ga0495619_0520861 Ga0495619_0520861_332_739 135
1454 3300053139 Ga0500568_0019599 Ga0500568_0019599_1009_1416 135
1455 3300053146 Ga0500588_0024168 Ga0500588_0024168_249_656 135
1456 3300059423 Ga0590074_024028 Ga0590074_024028_41_448 135
1457 3300059424 Ga0590075_042752 Ga0590075_042752_47_454 135
1458 3300059426 Ga0590077_155958 Ga0590077_155958_110_517 135
1459 3300059477 Ga0587084_044913 Ga0587084_044913_177_587 135
1460 3300059477 Ga0587084_046473 Ga0587084_046473_264_671 135
1461 3300059477 Ga0587084_092526 Ga0587084_092526_23_430 135
1462 3300059477 Ga0587084_093019 Ga0587084_093019_34_441 135
1463 3300059478 Ga0587093_037022 Ga0587093_037022_85_492 135
1464 3300059490 Ga0587066_016158 Ga0587066_016158_728_1135 135
1465 3300059490 Ga0587066_211811 Ga0587066_211811_69_476 135
1466 3300059491 Ga0587070_065532 Ga0587070_065532_284_691 135
1467 3300059491 Ga0587070_095022 Ga0587070_095022_27_434 135
1468 3300059491 Ga0587070_125430 Ga0587070_125430_51_458 135
1469 3300059491 Ga0587070_128994 Ga0587070_128994_172_579 135
1470 3300059491 Ga0587070_140264 Ga0587070_140264_29_436 135
1471 3300059492 Ga0587073_0069057 Ga0587073_0069057_58_465 135
1472 3300059492 Ga0587073_0094173 Ga0587073_0094173_147_554 135
1473 3300059492 Ga0587073_0159272 Ga0587073_0159272_168_575 135
1474 3300059492 Ga0587073_0173419 Ga0587073_0173419_191_598 135
1475 3300059492 Ga0587073_0261005 Ga0587073_0261005_38_445 135
1476 3300059493 Ga0587077_030979 Ga0587077_030979_530_937 135
1477 3300059493 Ga0587077_145331 Ga0587077_145331_48_455 135
1478 3300059493 Ga0587077_233956 Ga0587077_233956_87_494 135
1479 3300059493 Ga0587077_240351 Ga0587077_240351_93_500 135
1480 3300059503 Ga0587080_071212 Ga0587080_071212_124_531 135
1481 3300059504 Ga0587082_058848 Ga0587082_058848_38_445 135
1482 3300059504 Ga0587082_098908 Ga0587082_098908_168_575 135
1483 3300059504 Ga0587082_106949 Ga0587082_106949_41_448 135
1484 3300059504 Ga0587082_131332 Ga0587082_131332_132_539 135
1485 3300059504 Ga0587082_142610 Ga0587082_142610_63_473 135
1486 3300059505 Ga0587083_0018038 Ga0587083_0018038_291_698 135
1487 3300059505 Ga0587083_0033850 Ga0587083_0033850_598_1005 135
1488 3300059505 Ga0587083_0096572 Ga0587083_0096572_90_497 135
1489 3300059505 Ga0587083_0110869 Ga0587083_0110869_38_445 135
1490 3300059505 Ga0587083_0149597 Ga0587083_0149597_19_426 135
1491 3300059505 Ga0587083_0222296 Ga0587083_0222296_107_514 135
1492 3300059506 Ga0587085_015683 Ga0587085_015683_255_662 135
1493 3300059506 Ga0587085_091739 Ga0587085_091739_22_429 135
1494 3300059506 Ga0587085_135702 Ga0587085_135702_58_465 135
1495 3300059506 Ga0587085_145523 Ga0587085_145523_18_425 135
1496 3300059508 Ga0587088_026663 Ga0587088_026663_552_959 135
1497 3300059508 Ga0587088_028995 Ga0587088_028995_229_636 135
1498 3300059508 Ga0587088_045695 Ga0587088_045695_272_679 135
1499 3300059508 Ga0587088_181181 Ga0587088_181181_38_445 135
1500 3300059509 Ga0587089_068176 Ga0587089_068176_28_435 135
1501 3300059510 Ga0587090_054846 Ga0587090_054846_89_496 135
1502 3300059510 Ga0587090_081700 Ga0587090_081700_182_589 135
1503 3300059510 Ga0587090_169179 Ga0587090_169179_45_455 135
1504 3300059511 Ga0587091_103448 Ga0587091_103448_226_633 135
1505 3300059511 Ga0587091_126610 Ga0587091_126610_185_592 135
1506 3300059511 Ga0587091_169527 Ga0587091_169527_88_495 135
1507 3300059512 Ga0587092_065416 Ga0587092_065416_247_654 135
1508 3300059512 Ga0587092_165766 Ga0587092_165766_81_488 135
1509 3300059513 Ga0587094_089861 Ga0587094_089861_35_442 135
1510 3300059514 Ga0587095_018844 Ga0587095_018844_57_464 135
1511 3300059603 Ga0587097_05180 Ga0587097_05180_153_560 135
1512 3300059604 Ga0587098_018025 Ga0587098_018025_380_787 135
1513 3300059604 Ga0587098_020782 Ga0587098_020782_386_796 135
1514 3300059605 Ga0587106_023859 Ga0587106_023859_378_785 135
1515 3300059605 Ga0587106_081286 Ga0587106_081286_23_430 135
1516 3300059605 Ga0587106_089576 Ga0587106_089576_185_592 135
1517 3300059605 Ga0587106_112462 Ga0587106_112462_47_454 135
1518 3300059605 Ga0587106_121566 Ga0587106_121566_126_533 135
1519 3300059605 Ga0587106_129945 Ga0587106_129945_66_473 135
1520 3300059608 Ga0587129_017342 Ga0587129_017342_184_591 135
1521 3300059622 Ga0587099_007630 Ga0587099_007630_596_1003 135
1522 3300059623 Ga0587101_050694 Ga0587101_050694_175_585 135
1523 3300059626 Ga0587115_116519 Ga0587115_116519_33_440 135
1524 3300059627 Ga0587117_052156 Ga0587117_052156_38_445 135
1525 3300059628 Ga0587122_004333 Ga0587122_004333_282_689 135
1526 3300059628 Ga0587122_020432 Ga0587122_020432_279_686 135
1527 3300059630 Ga0587128_026561 Ga0587128_026561_384_791 135
1528 3300059630 Ga0587128_029373 Ga0587128_029373_120_527 135
1529 3300059630 Ga0587128_044943 Ga0587128_044943_202_612 135
1530 3300059630 Ga0587128_079359 Ga0587128_079359_45_452 135
1531 3300059630 Ga0587128_105903 Ga0587128_105903_157_564 135
1532 3300059631 Ga0587130_054665 Ga0587130_054665_65_472 135
1533 3300059639 Ga0587062_057141 Ga0587062_057141_24_431 135
1534 3300059639 Ga0587062_059546 Ga0587062_059546_79_486 135
1535 3300059640 Ga0587067_010025 Ga0587067_010025_58_465 135
1536 3300059640 Ga0587067_051321 Ga0587067_051321_214_621 135
1537 3300059640 Ga0587067_055304 Ga0587067_055304_362_769 135
1538 3300059640 Ga0587067_097813 Ga0587067_097813_184_591 135
1539 3300059640 Ga0587067_122607 Ga0587067_122607_14_421 135
1540 3300059640 Ga0587067_122738 Ga0587067_122738_158_568 135
1541 3300059640 Ga0587067_135607 Ga0587067_135607_41_448 135
1542 3300059640 Ga0587067_148294 Ga0587067_148294_45_455 135
1543 3300059640 Ga0587067_221353 Ga0587067_221353_59_466 135
1544 3300059641 Ga0587068_067249 Ga0587068_067249_208_618 135
1545 3300059641 Ga0587068_077366 Ga0587068_077366_18_425 135
1546 3300059641 Ga0587068_163235 Ga0587068_163235_58_468 135
1547 3300059641 Ga0587068_166675 Ga0587068_166675_66_473 135
1548 3300059642 Ga0587069_015201 Ga0587069_015201_89_496 135
1549 3300059642 Ga0587069_063646 Ga0587069_063646_35_442 135
1550 3300059642 Ga0587069_073056 Ga0587069_073056_180_587 135
1551 3300059643 Ga0587072_060947 Ga0587072_060947_327_734 135
1552 3300059643 Ga0587072_062989 Ga0587072_062989_309_716 135
1553 3300059643 Ga0587072_112016 Ga0587072_112016_89_496 135
1554 3300059644 Ga0587075_068501 Ga0587075_068501_225_632 135
1555 3300059645 Ga0587076_091573 Ga0587076_091573_211_618 135
1556 3300059645 Ga0587076_164397 Ga0587076_164397_51_458 135
1557 3300059645 Ga0587076_201425 Ga0587076_201425_59_466 135
1558 3300059647 Ga0587079_047232 Ga0587079_047232_439_846 135
1559 3300059647 Ga0587079_053478 Ga0587079_053478_51_458 135
1560 3300059647 Ga0587079_067618 Ga0587079_067618_68_475 135
1561 3300059647 Ga0587079_080061 Ga0587079_080061_273_683 135
1562 3300059647 Ga0587079_187115 Ga0587079_187115_13_420 135
1563 3300059647 Ga0587079_225766 Ga0587079_225766_26_433 135
1564 3300059649 Ga0587102_026339 Ga0587102_026339_68_478 135
1565 3300059649 Ga0587102_029372 Ga0587102_029372_38_445 135
1566 3300059651 Ga0587105_012645 Ga0587105_012645_234_641 135
1567 3300059652 Ga0587107_027459 Ga0587107_027459_210_617 135
1568 3300059652 Ga0587107_039534 Ga0587107_039534_296_703 135
1569 3300059655 Ga0587114_045530 Ga0587114_045530_247_654 135
1570 3300059655 Ga0587114_114909 Ga0587114_114909_89_496 135
1571 3300060346 Ga0587111_0057452 Ga0587111_0057452_207_617 135
1572 3300060346 Ga0587111_0108606 Ga0587111_0108606_29_436 135
1573 3300060346 Ga0587111_0122459 Ga0587111_0122459_167_574 135
1574 3300060346 Ga0587111_0262553 Ga0587111_0262553_38_445 135
1575 3300060353 Ga0501082_0293905 Ga0501082_0293905_67_474 135
1576 3300060353 Ga0501082_1757257 Ga0501082_1757257_18_425 135
1577 3300061719 Ga0466962_0009693 Ga0466962_0009693_2791_3198 135
1578 3300061734 Ga0530510_0018622 Ga0530510_0018622_3301_3708 135
1579 3300061734 Ga0530510_0539437 Ga0530510_0539437_449_856 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00410

Ribosomal_S8

Ribosomal protein S8

5

136

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zeb-assembly1.cif.gz_h m. smegmatis p/p state 70s ribosome structure 0.9738 3 135
4pdb-assembly1.cif.gz_A crystal structure of bacillus anthracis ribosomal protein s8 in complex with an rna aptamer 0.9725 4 135
5xyu-assembly1.cif.gz_H small subunit of mycobacterium smegmatis ribosome 0.9712 2 135
8cwo-assembly1.cif.gz_H cutibacterium acnes 30s ribosomal subunit with sarecycline bound, body domain only in the local refined map 0.9695 2 135
7nhn-assembly1.cif.gz_i vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9667 3 135
ID Description Score Start End Superfamily
3ofpH02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.978 78 135 3.30.1490.10
3uz6K02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.9753 79 135 3.30.1490.10
3ofpH02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.9619 78 135 3.30.1490.10
4pdbA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.9475 4 77 3.30.1370.30
3uz6K02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.9431 79 135 3.30.1490.10
ID Description Score Start End GO Terms
AF-A0A7K0F3I4-F1-model_v4 deleted 1.003 76 135
AF-A0A218L615-F1-model_v4 Small ribosomal subunit protein uS8c (30S ribosomal protein S8, chloroplastic) 1.003 79 135 GO:0003735
GO:0005840
GO:0006412
GO:0009507
GO:0019843
GO:1990904
AF-A0A2V7XB09-F1-model_v4 Small ribosomal subunit protein uS8 (30S ribosomal protein S8) 1 75 135 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7W1CCK0-F1-model_v4 Small ribosomal subunit protein uS8 (30S ribosomal protein S8) 0.9988 67 135 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-W1U493-F1-model_v4 deleted 0.9938 76 135

Feature Viewer

pLDDT pTM Quality
94.93 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map