F494883

General Info

Members Datasets Scaffolds Average Seq Length
1579 484 3158 238

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10180291|Ga0207648_101802912
Length 272
Sequence MPTECLFRDDSYLKSCDARVVAVTEQGGIVLDRTVFYATSGGQPGDTGSLTTADGTRIPVETALYTDAAKSEIAHVLPAGANAPKVGDSLTAEIDWGKRYARMRMHTALHLLSAALPYAVTGGSVGDSESRLDFDIPEAGLDKDAITAKVAEMIASNAAVSSRWISDAELEANPGLVKTMSVKPPMGTGRVRLIEIAGLDLQPCGGTHVRATGEIGAVRVTQIEKKGKQNRCAGSVGRRAARDRSPMARDRSRSREGEQDDGVERGLDRARA

Samples

Sample ID Description Type Environment
1 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
8 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
14 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
15 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
16 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
19 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
20 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
21 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
22 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
23 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
24 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
25 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
31 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
46 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
59 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
60 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
61 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
62 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
63 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
64 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
65 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
66 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
67 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
68 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
73 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
74 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
75 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
76 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
77 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
78 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
79 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
80 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
81 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
82 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
83 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
84 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
85 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
86 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
87 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
92 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
93 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
94 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
95 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
96 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
97 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
98 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
99 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
100 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
101 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
102 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
103 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
104 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
107 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
108 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
109 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
110 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
111 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
112 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
113 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
114 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
115 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
116 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
117 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
118 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
119 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
120 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
121 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
122 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
123 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
124 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
125 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
126 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
127 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
128 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
129 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
130 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
131 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
132 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
133 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
134 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
135 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
136 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
137 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
138 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
139 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
140 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
141 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
142 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
143 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
144 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
145 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
146 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
147 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
148 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
149 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
150 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
151 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
152 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
153 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
154 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
155 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
156 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
157 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
158 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
159 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
160 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
161 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
162 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
163 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
164 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
165 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
166 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
167 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
168 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
169 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
170 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
171 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
172 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
173 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
174 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
175 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
176 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
178 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
179 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
250 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
252 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
256 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
257 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
258 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
259 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
260 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
261 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
262 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
263 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
264 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
265 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
266 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
267 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
268 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
269 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
270 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
271 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
272 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
273 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
274 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
275 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
276 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
277 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
278 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
279 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
280 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
281 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
282 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
283 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
284 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
285 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
286 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
287 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
288 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
289 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
290 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
291 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
292 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
293 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
294 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
295 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
296 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
297 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
298 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
299 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
300 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
301 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
302 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
303 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
304 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
305 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
306 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
307 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
308 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
309 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
310 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
311 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
312 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
313 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
314 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
315 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
316 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
317 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
318 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
319 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
320 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
321 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
322 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
323 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
324 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
325 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
326 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
327 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
328 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
329 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
330 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
331 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
332 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
333 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
334 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
335 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
336 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
337 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
338 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
339 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
340 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
341 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
342 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
343 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
344 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
345 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
346 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
347 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
348 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
349 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
350 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
351 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
352 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
353 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
354 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
355 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
356 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
357 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
358 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
359 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
360 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
361 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
362 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
363 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
364 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
365 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
366 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
367 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
368 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
369 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
370 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
371 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
372 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
373 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
374 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
375 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
376 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
377 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
378 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
379 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
380 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
381 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
382 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
383 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
384 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
385 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
386 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
387 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
388 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
389 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
390 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
391 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
392 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
393 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
394 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
395 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
396 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
397 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
398 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
399 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
400 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
401 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
402 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
403 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
404 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
405 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
406 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
407 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
408 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
409 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
410 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
411 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
412 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
413 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
414 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
415 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
416 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
417 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
418 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
419 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
420 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
421 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
429 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
435 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
436 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
437 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
438 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
439 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
440 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
441 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
442 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
443 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
444 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
445 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
446 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
447 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
448 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
449 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
450 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
451 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
452 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
453 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
454 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
455 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
456 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
457 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
458 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
459 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
460 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
461 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
462 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
463 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
464 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
465 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
466 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
467 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
468 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
469 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
470 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
471 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
472 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
473 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
474 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
475 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
476 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
477 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
478 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
479 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
480 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
481 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
482 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
483 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
484 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.06
Isolates 0.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.12
Nodule 0
Rhizoplane 9.75
Rhizosphere 85.24
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207648_10180291 3300026089 Bacteria 1869
2 ARcpr5oldR_c000028 3300000041 Bacteria 29588
3 ARSoilYngRDRAFT_c00217 3300000042 Bacteria 9300
4 ARcpr5yngRDRAFT_c000173 3300000043 Bacteria 10132
5 ARSoilOldRDRAFT_c000023 3300000044 Bacteria 34965
6 ARCol0yngRDRAFT_1000191 3300000652 Bacteria 10310
7 JGI24741J21665_1025379 3300001915 Bacteria 906
8 JGI24752J21851_1010192 3300001976 Bacteria 1226
9 JGI24746J21847_1005138 3300001977 Bacteria 2049
10 JGI24740J21852_10018609 3300001979 Bacteria 2458
11 JGI24739J22299_10000148 3300001989 Bacteria 22525
12 JGI24737J22298_10001402 3300001990 Bacteria 8548
13 JGI24737J22298_10017355 3300001990 Bacteria 2320
14 JGI24743J22301_10001462 3300001991 Bacteria 3269
15 JGI24750J21931_1000011 3300002070 Bacteria 22441
16 JGI24750J21931_1003616 3300002070 Bacteria 1856
17 JGI24745J21846_1005158 3300002073 Bacteria 1420
18 JGI24748J21848_1000485 3300002074 Bacteria 4362
19 JGI24738J21930_10000236 3300002075 Bacteria 15024
20 JGI24749J21850_1001952 3300002076 Bacteria 2915
21 JGI24749J21850_1004668 3300002076 Bacteria 1921
22 JGI24744J21845_10000887 3300002077 Bacteria 5646
23 JGI24035J26624_1000114 3300002126 Bacteria 6994
24 JGI24033J26618_1003148 3300002155 Bacteria 1727
25 JGI24033J26618_1003288 3300002155 Bacteria 1697
26 JGI24034J26672_10005870 3300002239 Bacteria 1766
27 JGI24742J22300_10000252 3300002244 Bacteria 7969
28 JGI24751J29686_10005836 3300002459 Bacteria 2512
29 JGI24751J29686_10026980 3300002459 Bacteria 1192
30 JGI25406J46586_10032185 3300003203 Bacteria 1951
31 JGI25153J46596_10004476 3300003215 Bacteria 7532
32 JGI25405J52794_10006291 3300003911 Bacteria 2167
33 Ga0065716_1001752 3300005277 Bacteria 3584
34 Ga0065704_10105216 3300005289 Bacteria 2115
35 Ga0065712_10002440 3300005290 Bacteria 5368
36 Ga0065712_10096365 3300005290 Bacteria 2186
37 Ga0065712_10118955 3300005290 Bacteria 1699
38 Ga0065715_10001564 3300005293 Bacteria 10196
39 Ga0065715_10033620 3300005293 Bacteria 1824
40 Ga0065715_10088960 3300005293 Bacteria 20217
41 Ga0070658_10014302 3300005327 Bacteria 6368
42 Ga0070676_10000536 3300005328 Bacteria 18324
43 Ga0070676_10041342 3300005328 Bacteria 2673
44 Ga0070676_10142973 3300005328 Bacteria 1525
45 Ga0070683_100000144 3300005329 Bacteria 45900
46 Ga0070683_100055001 3300005329 Bacteria 3691
47 Ga0070683_100425296 3300005329 Bacteria 1267
48 Ga0070690_100001428 3300005330 Bacteria 12481
49 Ga0070690_100002001 3300005330 Bacteria 10850
50 Ga0070690_100112831 3300005330 Bacteria 1816
51 Ga0070670_100000437 3300005331 Bacteria 34047
52 Ga0070670_100010574 3300005331 Bacteria 7880
53 Ga0070670_100093113 3300005331 Bacteria 2592
54 Ga0070670_100231452 3300005331 Bacteria 1608
55 Ga0070677_10000166 3300005333 Bacteria 22747
56 Ga0070677_10099117 3300005333 Bacteria 1282
57 Ga0068869_100000035 3300005334 Bacteria 55467
58 Ga0068869_100144496 3300005334 Bacteria 1840
59 Ga0070666_10060622 3300005335 Bacteria 2561
60 Ga0070680_100003662 3300005336 Bacteria 11484
61 Ga0070680_100056551 3300005336 Bacteria 3207
62 Ga0070680_100145684 3300005336 Bacteria 1987
63 Ga0070680_100276749 3300005336 Bacteria 1421
64 Ga0070682_100002219 3300005337 Bacteria 10771
65 Ga0070682_100107123 3300005337 Bacteria 1856
66 Ga0068868_100001888 3300005338 Bacteria 14384
67 Ga0070660_100000944 3300005339 Bacteria 19405
68 Ga0070660_100080326 3300005339 Bacteria 2559
69 Ga0070660_100139586 3300005339 Bacteria 1943
70 Ga0070689_100000207 3300005340 Bacteria 35559
71 Ga0070689_100008854 3300005340 Bacteria 7111
72 Ga0070689_100019990 3300005340 Bacteria 4962
73 Ga0070689_100021249 3300005340 Bacteria 4828
74 Ga0070691_10001234 3300005341 Bacteria 10769
75 Ga0070691_10048613 3300005341 Bacteria 2019
76 Ga0070691_10071638 3300005341 Bacteria 1683
77 Ga0070687_100000261 3300005343 Bacteria 17944
78 Ga0070687_100086044 3300005343 Bacteria 1727
79 Ga0070661_100000017 3300005344 Bacteria 153232
80 Ga0070661_100149659 3300005344 Bacteria 1764
81 Ga0070661_100333634 3300005344 Bacteria 1186
82 Ga0070692_10001418 3300005345 Bacteria 8682
83 Ga0070692_10005458 3300005345 Bacteria 5429
84 Ga0070692_10040522 3300005345 Bacteria 2383
85 Ga0070692_10168066 3300005345 Bacteria 1262
86 Ga0070668_100140244 3300005347 Bacteria 1948
87 Ga0070668_100308586 3300005347 Bacteria 1329
88 Ga0070668_100324609 3300005347 Bacteria 1297
89 Ga0070668_100328096 3300005347 Bacteria 1290
90 Ga0070668_100541598 3300005347 Bacteria 1012
91 Ga0070669_100000250 3300005353 Bacteria 44115
92 Ga0070669_100215645 3300005353 Bacteria 1516
93 Ga0070675_100000246 3300005354 Bacteria 35225
94 Ga0070675_100078753 3300005354 Bacteria 2745
95 Ga0070671_100007422 3300005355 Bacteria 8762
96 Ga0070671_100028654 3300005355 Bacteria 4587
97 Ga0070671_100073891 3300005355 Bacteria 2848
98 Ga0070674_100000355 3300005356 Bacteria 22844
99 Ga0070674_100018670 3300005356 Bacteria 4391
100 Ga0070674_100142815 3300005356 Bacteria 1798
101 Ga0070674_100408846 3300005356 Bacteria 1111
102 Ga0070673_100000032 3300005364 Bacteria 61665
103 Ga0070673_100042414 3300005364 Bacteria 3508
104 Ga0070673_100193540 3300005364 Bacteria 1748
105 Ga0070688_100000594 3300005365 Bacteria 18125
106 Ga0070688_100013506 3300005365 Bacteria 4607
107 Ga0070688_100025273 3300005365 Bacteria 3515
108 Ga0070688_100186076 3300005365 Bacteria 1444
109 Ga0070659_100000214 3300005366 Bacteria 44422
110 Ga0070659_100035022 3300005366 Bacteria 3907
111 Ga0070667_100000816 3300005367 Bacteria 29087
112 Ga0070667_100034043 3300005367 Bacteria 4262
113 Ga0070667_100051439 3300005367 Bacteria 3473
114 Ga0070667_100605221 3300005367 Bacteria 1010
115 Ga0070667_100625868 3300005367 Bacteria 993
116 Ga0070703_10001365 3300005406 Bacteria 7412
117 Ga0070703_10001548 3300005406 Bacteria 6859
118 Ga0070709_10004360 3300005434 Bacteria 7625
119 Ga0070709_10016295 3300005434 Bacteria 4240
120 Ga0070714_100012941 3300005435 Bacteria 6671
121 Ga0070714_100481217 3300005435 Bacteria 1182
122 Ga0070713_100005123 3300005436 Bacteria 8918
123 Ga0070713_100013950 3300005436 Bacteria 5949
124 Ga0070710_10315891 3300005437 Bacteria 1024
125 Ga0070701_10000230 3300005438 Bacteria 17727
126 Ga0070701_10002700 3300005438 Bacteria 6876
127 Ga0070701_10020139 3300005438 Bacteria 3163
128 Ga0070711_100008381 3300005439 Bacteria 6330
129 Ga0070711_100017527 3300005439 Bacteria 4562
130 Ga0070711_100251801 3300005439 Bacteria 1386
131 Ga0070711_100458681 3300005439 Bacteria 1044
132 Ga0070705_100000171 3300005440 Bacteria 37880
133 Ga0070705_100003882 3300005440 Bacteria 7310
134 Ga0070705_100123695 3300005440 Bacteria 1675
135 Ga0070700_100000234 3300005441 Bacteria 30487
136 Ga0070700_100000482 3300005441 Bacteria 19974
137 Ga0070694_100000247 3300005444 Bacteria 28607
138 Ga0070694_100003250 3300005444 Bacteria 9704
139 Ga0070694_100104770 3300005444 Bacteria 2006
140 Ga0070708_100050386 3300005445 Bacteria 3686
141 Ga0070663_100026358 3300005455 Bacteria 3937
142 Ga0070663_100036809 3300005455 Bacteria 3402
143 Ga0070663_100378405 3300005455 Bacteria 1152
144 Ga0070678_100070825 3300005456 Bacteria 2608
145 Ga0070678_100147105 3300005456 Bacteria 1893
146 Ga0070662_100003327 3300005457 Bacteria 10025
147 Ga0070662_100046522 3300005457 Bacteria 3117
148 Ga0070662_100054983 3300005457 Bacteria 2886
149 Ga0070681_10000401 3300005458 Bacteria 35170
150 Ga0070681_10094966 3300005458 Bacteria 2930
151 Ga0070681_10097689 3300005458 Bacteria 2884
152 Ga0070681_10101800 3300005458 Bacteria 2818
153 Ga0070681_10126076 3300005458 Bacteria 2493
154 Ga0070681_10166646 3300005458 Bacteria 2126
155 Ga0070681_10202951 3300005458 Bacteria 1900
156 Ga0070681_10203174 3300005458 Bacteria 1899
157 Ga0070681_10296633 3300005458 Bacteria 1526
158 Ga0070681_10552211 3300005458 Bacteria 1066
159 Ga0068867_100000190 3300005459 Bacteria 40626
160 Ga0068867_100069262 3300005459 Bacteria 2635
161 Ga0068867_100216309 3300005459 Bacteria 1542
162 Ga0070685_10002568 3300005466 Bacteria 9293
163 Ga0070685_10006005 3300005466 Bacteria 6188
164 Ga0070685_10069160 3300005466 Bacteria 2088
165 Ga0070706_100114608 3300005467 Bacteria 2510
166 Ga0070706_100211233 3300005467 Bacteria 1812
167 Ga0070706_100254037 3300005467 Bacteria 1641
168 Ga0070707_100531971 3300005468 Bacteria 1137
169 Ga0070698_100174486 3300005471 Bacteria 2090
170 Ga0070699_100000167 3300005518 Bacteria 63239
171 Ga0070679_100000847 3300005530 Bacteria 26675
172 Ga0070679_100123282 3300005530 Bacteria 2575
173 Ga0070679_100144745 3300005530 Bacteria 2355
174 Ga0070679_100179661 3300005530 Bacteria 2089
175 Ga0070679_100192310 3300005530 Bacteria 2009
176 Ga0070679_100324673 3300005530 Bacteria 1488
177 Ga0070684_100000904 3300005535 Bacteria 21016
178 Ga0070684_100025874 3300005535 Bacteria 4937
179 Ga0070684_100217716 3300005535 Bacteria 1742
180 Ga0070684_100273447 3300005535 Bacteria 1547
181 Ga0070684_100282134 3300005535 Bacteria 1522
182 Ga0070684_100366281 3300005535 Bacteria 1327
183 Ga0070697_100049238 3300005536 Bacteria 3420
184 Ga0068853_100006394 3300005539 Bacteria 9358
185 Ga0068853_100050590 3300005539 Bacteria 3575
186 Ga0068853_100544688 3300005539 Bacteria 1099
187 Ga0070672_100000529 3300005543 Bacteria 22392
188 Ga0070672_100074762 3300005543 Bacteria 2703
189 Ga0070672_100207043 3300005543 Bacteria 1642
190 Ga0070672_100213601 3300005543 Bacteria 1616
191 Ga0070672_100301252 3300005543 Bacteria 1359
192 Ga0070686_100000269 3300005544 Bacteria 35470
193 Ga0070686_100003617 3300005544 Bacteria 8478
194 Ga0070686_100009747 3300005544 Bacteria 5397
195 Ga0070686_100013607 3300005544 Bacteria 4665
196 Ga0070695_100000406 3300005545 Bacteria 22313
197 Ga0070695_100003493 3300005545 Bacteria 9175
198 Ga0070696_100000304 3300005546 Bacteria 29759
199 Ga0070696_100002999 3300005546 Bacteria 11209
200 Ga0070696_100100859 3300005546 Bacteria 2069
201 Ga0070693_100002112 3300005547 Bacteria 9095
202 Ga0070693_100009505 3300005547 Bacteria 4836
203 Ga0070693_100042910 3300005547 Bacteria 2551
204 Ga0070665_100063574 3300005548 Bacteria 3701
205 Ga0070665_100073842 3300005548 Bacteria 3416
206 Ga0070665_100972688 3300005548 Bacteria 861
207 Ga0070704_100000385 3300005549 Bacteria 20151
208 Ga0070704_100000566 3300005549 Bacteria 17827
209 Ga0070704_100060045 3300005549 Bacteria 2715
210 Ga0070704_100312875 3300005549 Bacteria 1313
211 Ga0068855_100006856 3300005563 Bacteria 13819
212 Ga0068855_100081134 3300005563 Bacteria 3760
213 Ga0068855_100116563 3300005563 Bacteria 3061
214 Ga0068855_100144287 3300005563 Bacteria 2711
215 Ga0068855_100465648 3300005563 Bacteria 1378
216 Ga0070664_100000912 3300005564 Bacteria 23051
217 Ga0070664_100333920 3300005564 Bacteria 1376
218 Ga0068857_100000494 3300005577 Bacteria 28282
219 Ga0068857_100011609 3300005577 Bacteria 7665
220 Ga0068857_100244976 3300005577 Bacteria 1642
221 Ga0068857_100363680 3300005577 Bacteria 1341
222 Ga0068854_100000139 3300005578 Bacteria 50270
223 Ga0068854_100159715 3300005578 Bacteria 1744
224 Ga0068854_100292604 3300005578 Bacteria 1315
225 Ga0068856_100005193 3300005614 Bacteria 12858
226 Ga0068856_100167879 3300005614 Bacteria 2206
227 Ga0068856_100179850 3300005614 Bacteria 2128
228 Ga0068856_100194234 3300005614 Bacteria 2044
229 Ga0068856_100874197 3300005614 Bacteria 918
230 Ga0070702_100054674 3300005615 Bacteria 2298
231 Ga0070702_100245102 3300005615 Bacteria 1211
232 Ga0068852_100000193 3300005616 Bacteria 41505
233 Ga0068852_100098275 3300005616 Bacteria 2635
234 Ga0068852_100353508 3300005616 Bacteria 1435
235 Ga0068852_100438174 3300005616 Bacteria 1291
236 Ga0068859_100002972 3300005617 Bacteria 17185
237 Ga0068859_100021099 3300005617 Bacteria 6536
238 Ga0068859_100478637 3300005617 Bacteria 1340
239 Ga0068859_100494335 3300005617 Bacteria 1319
240 Ga0068864_100000226 3300005618 Bacteria 50929
241 Ga0068864_100005554 3300005618 Bacteria 10340
242 Ga0068864_100091561 3300005618 Bacteria 2683
243 Ga0068864_100209466 3300005618 Bacteria 1794
244 Ga0068866_10000199 3300005718 Bacteria 28222
245 Ga0068866_10056158 3300005718 Bacteria 2025
246 Ga0068866_10242311 3300005718 Bacteria 1099
247 Ga0068861_100000847 3300005719 Bacteria 18540
248 Ga0068851_10110326 3300005834 Bacteria 1468
249 Ga0068870_10004231 3300005840 Bacteria 6169
250 Ga0068863_100001877 3300005841 Bacteria 20878
251 Ga0068863_100044870 3300005841 Bacteria 4195
252 Ga0068858_100000512 3300005842 Bacteria 40596
253 Ga0068858_100044217 3300005842 Bacteria 4129
254 Ga0068858_100182497 3300005842 Bacteria 1982
255 Ga0068858_100502778 3300005842 Unclassified 1171
256 Ga0068860_100001525 3300005843 Bacteria 24947
257 Ga0068860_100001592 3300005843 Bacteria 24376
258 Ga0068860_100057915 3300005843 Bacteria 3683
259 Ga0068860_100061019 3300005843 Bacteria 3582
260 Ga0068862_100000557 3300005844 Bacteria 38898
261 Ga0068862_100031172 3300005844 Bacteria 4498
262 Ga0068862_100034921 3300005844 Bacteria 4256
263 Ga0068862_100335652 3300005844 Bacteria 1399
264 Ga0081455_10000035 3300005937 Bacteria 136366
265 Ga0081455_10001717 3300005937 Bacteria 26511
266 Ga0081455_10003750 3300005937 Bacteria 17364
267 Ga0081455_10039883 3300005937 Bacteria 4145
268 Ga0081455_10223349 3300005937 Bacteria 1394
269 Ga0081538_10001738 3300005981 Bacteria 22124
270 Ga0081538_10060587 3300005981 Bacteria 2175
271 Ga0081538_10068489 3300005981 Bacteria 1973
272 Ga0081540_1007073 3300005983 Bacteria 8064
273 Ga0081540_1064606 3300005983 Bacteria 1726
274 Ga0081539_10002061 3300005985 Bacteria 30119
275 Ga0070717_10028561 3300006028 Bacteria 4466
276 Ga0070717_10086152 3300006028 Bacteria 2644
277 Ga0070717_10123132 3300006028 Bacteria 2223
278 Ga0070717_10246288 3300006028 Bacteria 1578
279 Ga0070717_10858928 3300006028 Bacteria 826
280 Ga0075365_10004829 3300006038 Bacteria 7192
281 Ga0075365_10006356 3300006038 Bacteria 6493
282 Ga0075365_10041906 3300006038 Bacteria 2991
283 Ga0075365_10108460 3300006038 Bacteria 1906
284 Ga0075368_10002630 3300006042 Bacteria 5897
285 Ga0075368_10011483 3300006042 Bacteria 3222
286 Ga0075368_10040731 3300006042 Bacteria 1824
287 Ga0075368_10164585 3300006042 Bacteria 930
288 Ga0075363_100103326 3300006048 Bacteria 1578
289 Ga0075364_10004638 3300006051 Bacteria 7924
290 Ga0075364_10008067 3300006051 Bacteria 6278
291 Ga0075364_10246607 3300006051 Bacteria 1214
292 Ga0075432_10019290 3300006058 Bacteria 2329
293 Ga0070715_10098939 3300006163 Bacteria 1357
294 Ga0070715_10141852 3300006163 Bacteria 1168
295 Ga0070715_10171288 3300006163 Unclassified 1081
296 Ga0070716_100018071 3300006173 Bacteria 3667
297 Ga0070712_100012496 3300006175 Bacteria 5398
298 Ga0070712_100130680 3300006175 Bacteria 1902
299 Ga0070712_100635127 3300006175 Bacteria 906
300 Ga0075362_10002664 3300006177 Bacteria 6062
301 Ga0075362_10080901 3300006177 Bacteria 1497
302 Ga0075362_10095146 3300006177 Bacteria 1387
303 Ga0075362_10110073 3300006177 Bacteria 1296
304 Ga0075367_10008394 3300006178 Bacteria 5349
305 Ga0075367_10013463 3300006178 Bacteria 4397
306 Ga0075367_10041545 3300006178 Bacteria 2689
307 Ga0075367_10079735 3300006178 Bacteria 1979
308 Ga0075367_10156175 3300006178 Bacteria 1418
309 Ga0075369_10154964 3300006186 Bacteria 1048
310 Ga0075427_10003198 3300006194 Bacteria 2246
311 Ga0075366_10030395 3300006195 Bacteria 3175
312 Ga0097621_100000049 3300006237 Bacteria 61062
313 Ga0097621_100076779 3300006237 Bacteria 2772
314 Ga0075370_10009592 3300006353 Bacteria 5033
315 Ga0075370_10076344 3300006353 Bacteria 1921
316 Ga0075370_10383678 3300006353 Bacteria 842
317 Ga0068871_100000097 3300006358 Bacteria 52015
318 Ga0068871_100015992 3300006358 Bacteria 5636
319 Ga0068871_100032808 3300006358 Bacteria 4105
320 Ga0068871_100161020 3300006358 Bacteria 1919
321 Ga0068871_100227143 3300006358 Bacteria 1619
322 Ga0075428_100011811 3300006844 Bacteria 9720
323 Ga0075428_100026110 3300006844 Bacteria 6467
324 Ga0075428_100045882 3300006844 Bacteria 4801
325 Ga0075428_100075012 3300006844 Bacteria 3694
326 Ga0075428_100076282 3300006844 Bacteria 3660
327 Ga0075428_100084938 3300006844 Bacteria 3453
328 Ga0075428_100293444 3300006844 Bacteria 1749
329 Ga0075428_100369767 3300006844 Bacteria 1538
330 Ga0075430_100004110 3300006846 Bacteria 12278
331 Ga0075430_100263355 3300006846 Bacteria 1428
332 Ga0075431_100003772 3300006847 Bacteria 14731
333 Ga0075431_100015906 3300006847 Bacteria 7631
334 Ga0075431_100037458 3300006847 Bacteria 4996
335 Ga0075431_100076180 3300006847 Bacteria 3462
336 Ga0075431_100087511 3300006847 Bacteria 3214
337 Ga0075431_100153596 3300006847 Bacteria 2369
338 Ga0075431_100172811 3300006847 Bacteria 2220
339 Ga0075431_100282725 3300006847 Bacteria 1680
340 Ga0075431_100457082 3300006847 Bacteria 1272
341 Ga0075431_100718708 3300006847 Bacteria 976
342 Ga0075433_10002397 3300006852 Bacteria 14260
343 Ga0075433_10008081 3300006852 Bacteria 8377
344 Ga0075434_100000383 3300006871 Bacteria 32396
345 Ga0075434_100001135 3300006871 Bacteria 21932
346 Ga0075434_100009398 3300006871 Bacteria 9114
347 Ga0075434_100060410 3300006871 Bacteria 3770
348 Ga0075434_100278916 3300006871 Bacteria 1691
349 Ga0075434_100334846 3300006871 Bacteria 1534
350 Ga0075434_100456457 3300006871 Bacteria 1299
351 Ga0075434_100457489 3300006871 Bacteria 1297
352 Ga0075434_100523044 3300006871 Bacteria 1207
353 Ga0075434_100595436 3300006871 Bacteria 1125
354 Ga0075429_100001354 3300006880 Bacteria 20025
355 Ga0075429_100016192 3300006880 Bacteria 6460
356 Ga0075429_100143178 3300006880 Bacteria 2093
357 Ga0075429_100234603 3300006880 Bacteria 1607
358 Ga0075429_100269619 3300006880 Bacteria 1491
359 Ga0068865_100000119 3300006881 Bacteria 39895
360 Ga0068865_100033862 3300006881 Bacteria 3422
361 Ga0068865_100059392 3300006881 Bacteria 2674
362 Ga0068865_100068549 3300006881 Bacteria 2508
363 Ga0075436_100032452 3300006914 Bacteria 3599
364 Ga0075436_100065255 3300006914 Bacteria 2517
365 Ga0097620_100002972 3300006931 Bacteria 17185
366 Ga0097620_100021099 3300006931 Bacteria 6536
367 Ga0097620_100478646 3300006931 Bacteria 1340
368 Ga0097620_100494280 3300006931 Bacteria 1319
369 Ga0075435_100004250 3300007076 Bacteria 9836
370 Ga0075435_100022627 3300007076 Bacteria 4849
371 Ga0075435_100030953 3300007076 Bacteria 4212
372 Ga0075435_100114600 3300007076 Bacteria 2244
373 Ga0075435_100262671 3300007076 Bacteria 1471
374 Ga0099794_10072350 3300007265 Bacteria 1690
375 Ga0105251_10047287 3300009011 Bacteria 2068
376 Ga0105244_10110443 3300009036 Bacteria 1338
377 Ga0105240_10009789 3300009093 Bacteria 13533
378 Ga0105240_10056188 3300009093 Bacteria 4926
379 Ga0105240_10241483 3300009093 Bacteria 2094
380 Ga0111539_10000237 3300009094 Bacteria 65638
381 Ga0111539_10001512 3300009094 Bacteria 31036
382 Ga0111539_10007189 3300009094 Bacteria 14270
383 Ga0111539_10010350 3300009094 Bacteria 11742
384 Ga0111539_10022663 3300009094 Bacteria 7714
385 Ga0111539_10059007 3300009094 Bacteria 4551
386 Ga0111539_10097324 3300009094 Bacteria 3457
387 Ga0111539_10236892 3300009094 Bacteria 2124
388 Ga0105245_10000202 3300009098 Bacteria 57012
389 Ga0105245_10109349 3300009098 Bacteria 2569
390 Ga0105245_10178381 3300009098 Bacteria 2028
391 Ga0105245_10243774 3300009098 Bacteria 1743
392 Ga0105247_10003839 3300009101 Bacteria 9725
393 Ga0105247_10010478 3300009101 Bacteria 5605
394 Ga0105247_10018903 3300009101 Bacteria 4138
395 Ga0105247_10026789 3300009101 Bacteria 3484
396 Ga0114129_10007020 3300009147 Bacteria 16034
397 Ga0114129_10008425 3300009147 Bacteria 14689
398 Ga0114129_10011185 3300009147 Bacteria 12793
399 Ga0114129_10033296 3300009147 Bacteria 7283
400 Ga0114129_10105568 3300009147 Bacteria 3893
401 Ga0114129_10797829 3300009147 Bacteria 1205
402 Ga0114129_10858957 3300009147 Bacteria 1153
403 Ga0105243_10011526 3300009148 Bacteria 6690
404 Ga0105243_10042474 3300009148 Bacteria 3559
405 Ga0105243_10296026 3300009148 Bacteria 1464
406 Ga0105243_10849673 3300009148 Bacteria 904
407 Ga0105241_10000430 3300009174 Bacteria 31789
408 Ga0105241_10175455 3300009174 Bacteria 1773
409 Ga0105241_10500497 3300009174 Bacteria 1083
410 Ga0105241_10886951 3300009174 Bacteria 827
411 Ga0105242_10002131 3300009176 Bacteria 15612
412 Ga0105242_10051392 3300009176 Bacteria 3358
413 Ga0105242_10071991 3300009176 Bacteria 2870
414 Ga0105242_10086045 3300009176 Bacteria 2637
415 Ga0105242_10187186 3300009176 Bacteria 1830
416 Ga0105248_10001335 3300009177 Bacteria 27466
417 Ga0105248_10036278 3300009177 Bacteria 5514
418 Ga0105248_10230078 3300009177 Bacteria 2087
419 Ga0105237_10008523 3300009545 Bacteria 11087
420 Ga0105237_10083778 3300009545 Bacteria 3179
421 Ga0105237_10258915 3300009545 Bacteria 1742
422 Ga0105238_10008420 3300009551 Bacteria 10324
423 Ga0105238_10171448 3300009551 Bacteria 2146
424 Ga0105238_10359719 3300009551 Bacteria 1445
425 Ga0105249_10000215 3300009553 Bacteria 66439
426 Ga0105249_10004272 3300009553 Bacteria 12349
427 Ga0105249_10009891 3300009553 Bacteria 8360
428 Ga0105249_10239953 3300009553 Bacteria 1791
429 Ga0105249_10495012 3300009553 Bacteria 1267
430 Ga0105249_10538886 3300009553 Bacteria 1216
431 Ga0105249_10650255 3300009553 Bacteria 1112
432 Ga0105249_10911171 3300009553 Bacteria 946
433 Ga0099796_10023513 3300010159 Bacteria 1925
434 Ga0105239_10012264 3300010375 Bacteria 9548
435 Ga0105239_10085291 3300010375 Bacteria 3480
436 Ga0105239_10175361 3300010375 Bacteria 2398
437 Ga0105246_10000019 3300011119 Bacteria 62666
438 Ga0105246_10017617 3300011119 Bacteria 4543
439 Ga0105246_10055648 3300011119 Bacteria 2731
440 Ga0105246_10072338 3300011119 Bacteria 2431
441 Ga0105246_10119563 3300011119 Bacteria 1950
442 Ga0105246_10512762 3300011119 Bacteria 1020
443 Ga0105246_10612699 3300011119 Bacteria 942
444 Ga0157345_1002449 3300012498 Bacteria 1313
445 Ga0157373_10449838 3300013100 Bacteria 927
446 Ga0157371_10018237 3300013102 Bacteria 5192
447 Ga0157371_10053792 3300013102 Bacteria 2859
448 Ga0157370_10016547 3300013104 Bacteria 7461
449 Ga0157370_10205810 3300013104 Bacteria 1825
450 Ga0157370_10572688 3300013104 Bacteria 1035
451 Ga0157369_10557568 3300013105 Bacteria 1184
452 Ga0157374_10013571 3300013296 Bacteria 7115
453 Ga0157374_10092708 3300013296 Bacteria 2883
454 Ga0157374_10246546 3300013296 Bacteria 1757
455 Ga0157374_10855088 3300013296 Bacteria 927
456 Ga0157378_10168915 3300013297 Bacteria 2050
457 Ga0157378_10673985 3300013297 Bacteria 1052
458 Ga0163162_10001187 3300013306 Bacteria 24299
459 Ga0163162_10091452 3300013306 Bacteria 3126
460 Ga0163162_10118403 3300013306 Bacteria 2750
461 Ga0163162_10194139 3300013306 Bacteria 2158
462 Ga0163162_10566275 3300013306 Bacteria 1264
463 Ga0157372_10104810 3300013307 Bacteria 3234
464 Ga0157372_10130301 3300013307 Bacteria 2893
465 Ga0157372_10972062 3300013307 Bacteria 984
466 Ga0157375_10000135 3300013308 Bacteria 73281
467 Ga0157375_10112760 3300013308 Bacteria 2820
468 Ga0157375_10149043 3300013308 Bacteria 2473
469 Ga0157375_10235765 3300013308 Bacteria 1989
470 Ga0157375_10272416 3300013308 Bacteria 1855
471 Ga0163163_10001813 3300014325 Bacteria 18018
472 Ga0163163_10037509 3300014325 Bacteria 4715
473 Ga0163163_10081539 3300014325 Bacteria 3237
474 Ga0163163_10133163 3300014325 Bacteria 2526
475 Ga0163163_10259552 3300014325 Bacteria 1788
476 Ga0157380_10000284 3300014326 Bacteria 30507
477 Ga0157380_10009510 3300014326 Bacteria 6970
478 Ga0157380_10045169 3300014326 Bacteria 3456
479 Ga0157380_10339269 3300014326 Bacteria 1401
480 Ga0182008_10023306 3300014497 Bacteria 3164
481 Ga0157377_10000076 3300014745 Bacteria 75835
482 Ga0157377_10009804 3300014745 Bacteria 4718
483 Ga0157379_10000065 3300014968 Bacteria 67475
484 Ga0157379_10028167 3300014968 Bacteria 5000
485 Ga0157379_10053984 3300014968 Bacteria 3590
486 Ga0157379_10143288 3300014968 Bacteria 2155
487 Ga0157379_10268760 3300014968 Bacteria 1550
488 Ga0157379_10491284 3300014968 Bacteria 1137
489 Ga0157376_10000180 3300014969 Bacteria 43524
490 Ga0157376_10169568 3300014969 Bacteria 1986
491 Ga0163161_10000421 3300017792 Bacteria 35625
492 Ga0163161_10057300 3300017792 Bacteria 2831
493 Ga0163161_10122388 3300017792 Bacteria 1956
494 Ga0163161_10245987 3300017792 Bacteria 1393
495 Ga0206353_10191222 3300020082 Bacteria 2702
496 Ga0213876_10027568 3300021384 Bacteria 2997
497 Ga0213876_10077420 3300021384 Bacteria 1757
498 Ga0213875_10000007 3300021388 Bacteria 562717
499 Ga0207666_1000354 3300025271 Bacteria 6296
500 Ga0207666_1000418 3300025271 Bacteria 5541
501 Ga0207673_1000514 3300025290 Bacteria 4096
502 Ga0209758_1006420 3300025297 Bacteria 8462
503 Ga0207697_10000370 3300025315 Bacteria 25198
504 Ga0207697_10006177 3300025315 Bacteria 5460
505 Ga0207653_10000520 3300025885 Bacteria 14672
506 Ga0207682_10000304 3300025893 Bacteria 22182
507 Ga0207682_10001407 3300025893 Bacteria 11113
508 Ga0207692_10011547 3300025898 Bacteria 3764
509 Ga0207692_10028953 3300025898 Bacteria 2626
510 Ga0207692_10061264 3300025898 Bacteria 1949
511 Ga0207642_10000516 3300025899 Bacteria 11828
512 Ga0207642_10046913 3300025899 Bacteria 1928
513 Ga0207642_10118703 3300025899 Bacteria 1360
514 Ga0207710_10037210 3300025900 Bacteria 2149
515 Ga0207688_10000014 3300025901 Bacteria 59269
516 Ga0207688_10039446 3300025901 Bacteria 2623
517 Ga0207688_10174572 3300025901 Bacteria 1279
518 Ga0207680_10070512 3300025903 Bacteria 2164
519 Ga0207647_10020223 3300025904 Bacteria 4465
520 Ga0207647_10129062 3300025904 Bacteria 1487
521 Ga0207685_10005940 3300025905 Bacteria 3275
522 Ga0207699_10016141 3300025906 Bacteria 3898
523 Ga0207699_10019327 3300025906 Bacteria 3631
524 Ga0207699_10058845 3300025906 Bacteria 2300
525 Ga0207699_10090308 3300025906 Bacteria 1922
526 Ga0207699_10119296 3300025906 Bacteria 1703
527 Ga0207645_10000160 3300025907 Bacteria 53155
528 Ga0207645_10015986 3300025907 Bacteria 4971
529 Ga0207645_10033351 3300025907 Bacteria 3310
530 Ga0207645_10039871 3300025907 Bacteria 3009
531 Ga0207645_10056603 3300025907 Bacteria 2503
532 Ga0207643_10000009 3300025908 Bacteria 160496
533 Ga0207643_10013114 3300025908 Bacteria 4484
534 Ga0207643_10043613 3300025908 Bacteria 2532
535 Ga0207705_10071868 3300025909 Bacteria 2509
536 Ga0207705_10141416 3300025909 Bacteria 1797
537 Ga0207684_10182839 3300025910 Bacteria 1808
538 Ga0207654_10000441 3300025911 Bacteria 23641
539 Ga0207654_10089393 3300025911 Bacteria 1874
540 Ga0207707_10000554 3300025912 Bacteria 37851
541 Ga0207707_10062090 3300025912 Bacteria 3251
542 Ga0207707_10079079 3300025912 Bacteria 2871
543 Ga0207707_10092039 3300025912 Bacteria 2650
544 Ga0207707_10206367 3300025912 Bacteria 1712
545 Ga0207695_10074067 3300025913 Bacteria 3467
546 Ga0207671_10019030 3300025914 Bacteria 5260
547 Ga0207671_10229462 3300025914 Bacteria 1456
548 Ga0207671_10242468 3300025914 Bacteria 1416
549 Ga0207693_10005726 3300025915 Bacteria 10319
550 Ga0207693_10067856 3300025915 Bacteria 2792
551 Ga0207693_10073182 3300025915 Bacteria 2683
552 Ga0207693_10077596 3300025915 Bacteria 2601
553 Ga0207693_10124294 3300025915 Bacteria 2027
554 Ga0207693_10279397 3300025915 Bacteria 1308
555 Ga0207663_10006452 3300025916 Bacteria 6001
556 Ga0207663_10013217 3300025916 Bacteria 4484
557 Ga0207663_10171491 3300025916 Bacteria 1541
558 Ga0207663_10244686 3300025916 Bacteria 1317
559 Ga0207663_10284356 3300025916 Bacteria 1230
560 Ga0207660_10000161 3300025917 Bacteria 41972
561 Ga0207660_10006228 3300025917 Bacteria 7749
562 Ga0207660_10054812 3300025917 Bacteria 2846
563 Ga0207660_10094455 3300025917 Bacteria 2223
564 Ga0207660_10138442 3300025917 Bacteria 1859
565 Ga0207662_10001074 3300025918 Bacteria 12850
566 Ga0207662_10011994 3300025918 Bacteria 4820
567 Ga0207662_10013455 3300025918 Bacteria 4577
568 Ga0207662_10049759 3300025918 Bacteria 2487
569 Ga0207662_10082683 3300025918 Bacteria 1962
570 Ga0207657_10000294 3300025919 Bacteria 53220
571 Ga0207657_10017327 3300025919 Bacteria 6911
572 Ga0207657_10019363 3300025919 Bacteria 6466
573 Ga0207657_10044754 3300025919 Bacteria 3889
574 Ga0207657_10065546 3300025919 Bacteria 3096
575 Ga0207657_10071664 3300025919 Bacteria 2934
576 Ga0207649_10000429 3300025920 Bacteria 30596
577 Ga0207649_10050379 3300025920 Bacteria 2575
578 Ga0207652_10044984 3300025921 Bacteria 3763
579 Ga0207652_10045984 3300025921 Bacteria 3723
580 Ga0207652_10129523 3300025921 Bacteria 2250
581 Ga0207652_10207576 3300025921 Bacteria 1763
582 Ga0207652_10422727 3300025921 Bacteria 1202
583 Ga0207652_10502035 3300025921 Bacteria 1092
584 Ga0207646_10655492 3300025922 Bacteria 940
585 Ga0207681_10000035 3300025923 Bacteria 161792
586 Ga0207681_10043294 3300025923 Bacteria 3013
587 Ga0207681_10094415 3300025923 Bacteria 2143
588 Ga0207681_10147070 3300025923 Bacteria 1762
589 Ga0207681_10184442 3300025923 Bacteria 1592
590 Ga0207694_10006222 3300025924 Bacteria 9117
591 Ga0207694_10292956 3300025924 Bacteria 1339
592 Ga0207694_10409336 3300025924 Bacteria 1128
593 Ga0207650_10009941 3300025925 Bacteria 6510
594 Ga0207650_10063852 3300025925 Bacteria 2755
595 Ga0207650_10088741 3300025925 Bacteria 2359
596 Ga0207659_10000027 3300025926 Bacteria 135454
597 Ga0207659_10012080 3300025926 Bacteria 5476
598 Ga0207659_10075169 3300025926 Bacteria 2478
599 Ga0207659_10153856 3300025926 Bacteria 1798
600 Ga0207659_10407600 3300025926 Bacteria 1138
601 Ga0207687_10000551 3300025927 Bacteria 25176
602 Ga0207687_10008252 3300025927 Bacteria 6813
603 Ga0207687_10375268 3300025927 Bacteria 1164
604 Ga0207687_10438217 3300025927 Bacteria 1082
605 Ga0207687_10589573 3300025927 Bacteria 936
606 Ga0207700_10016032 3300025928 Bacteria 4967
607 Ga0207700_10020626 3300025928 Bacteria 4480
608 Ga0207664_10024052 3300025929 Bacteria 4574
609 Ga0207664_10068193 3300025929 Bacteria 2857
610 Ga0207664_10210958 3300025929 Bacteria 1680
611 Ga0207664_10218888 3300025929 Bacteria 1650
612 Ga0207664_10770232 3300025929 Bacteria 866
613 Ga0207644_10003065 3300025931 Bacteria 10760
614 Ga0207644_10024126 3300025931 Bacteria 4172
615 Ga0207644_10024425 3300025931 Bacteria 4149
616 Ga0207644_10053710 3300025931 Bacteria 2900
617 Ga0207690_10000056 3300025932 Bacteria 101387
618 Ga0207690_10065219 3300025932 Bacteria 2489
619 Ga0207690_10067561 3300025932 Bacteria 2452
620 Ga0207690_10728654 3300025932 Bacteria 816
621 Ga0207706_10000307 3300025933 Bacteria 52944
622 Ga0207706_10019938 3300025933 Bacteria 6027
623 Ga0207706_10020976 3300025933 Bacteria 5868
624 Ga0207706_10058718 3300025933 Bacteria 3388
625 Ga0207706_10158375 3300025933 Bacteria 1991
626 Ga0207706_10299417 3300025933 Bacteria 1401
627 Ga0207686_10001582 3300025934 Bacteria 12793
628 Ga0207686_10020326 3300025934 Bacteria 3791
629 Ga0207686_10057612 3300025934 Bacteria 2446
630 Ga0207686_10171744 3300025934 Bacteria 1529
631 Ga0207686_10212601 3300025934 Bacteria 1391
632 Ga0207686_10355561 3300025934 Bacteria 1104
633 Ga0207709_10000087 3300025935 Bacteria 155019
634 Ga0207709_10009741 3300025935 Bacteria 5295
635 Ga0207709_10100890 3300025935 Bacteria 1908
636 Ga0207709_10199865 3300025935 Bacteria 1427
637 Ga0207709_10485754 3300025935 Bacteria 961
638 Ga0207670_10000263 3300025936 Bacteria 32926
639 Ga0207670_10006655 3300025936 Bacteria 6427
640 Ga0207670_10008975 3300025936 Bacteria 5673
641 Ga0207670_10083194 3300025936 Bacteria 2244
642 Ga0207670_10280398 3300025936 Bacteria 1298
643 Ga0207670_10381171 3300025936 Bacteria 1123
644 Ga0207669_10000052 3300025937 Bacteria 58284
645 Ga0207669_10036794 3300025937 Bacteria 2801
646 Ga0207669_10076172 3300025937 Bacteria 2128
647 Ga0207669_10167638 3300025937 Bacteria 1559
648 Ga0207669_10571722 3300025937 Bacteria 915
649 Ga0207704_10000063 3300025938 Bacteria 74699
650 Ga0207704_10008777 3300025938 Bacteria 4851
651 Ga0207704_10044292 3300025938 Bacteria 2635
652 Ga0207704_10071364 3300025938 Bacteria 2204
653 Ga0207704_10221861 3300025938 Bacteria 1399
654 Ga0207665_10017994 3300025939 Bacteria 4643
655 Ga0207691_10000167 3300025940 Bacteria 60999
656 Ga0207691_10121820 3300025940 Bacteria 2311
657 Ga0207691_10144301 3300025940 Bacteria 2096
658 Ga0207711_10017811 3300025941 Bacteria 5902
659 Ga0207711_10025629 3300025941 Bacteria 4946
660 Ga0207711_10538050 3300025941 Bacteria 1089
661 Ga0207689_10000155 3300025942 Bacteria 59178
662 Ga0207689_10330343 3300025942 Bacteria 1266
663 Ga0207661_10000072 3300025944 Bacteria 69126
664 Ga0207661_10089894 3300025944 Bacteria 2556
665 Ga0207661_10299170 3300025944 Bacteria 1442
666 Ga0207661_10444650 3300025944 Bacteria 1180
667 Ga0207679_10000057 3300025945 Bacteria 104912
668 Ga0207679_10017981 3300025945 Bacteria 4725
669 Ga0207679_10119066 3300025945 Bacteria 2099
670 Ga0207679_10228952 3300025945 Bacteria 1568
671 Ga0207679_10259106 3300025945 Bacteria 1482
672 Ga0207667_10010749 3300025949 Bacteria 10676
673 Ga0207667_10027211 3300025949 Bacteria 6230
674 Ga0207667_10199854 3300025949 Bacteria 2051
675 Ga0207667_10235146 3300025949 Bacteria 1876
676 Ga0207667_10289964 3300025949 Bacteria 1672
677 Ga0207667_10652522 3300025949 Bacteria 1058
678 Ga0207651_10000087 3300025960 Bacteria 41160
679 Ga0207651_10118903 3300025960 Bacteria 2000
680 Ga0207651_10420012 3300025960 Bacteria 1141
681 Ga0207651_10476253 3300025960 Bacteria 1075
682 Ga0207712_10000122 3300025961 Bacteria 83730
683 Ga0207712_10009565 3300025961 Bacteria 6137
684 Ga0207712_10010640 3300025961 Bacteria 5841
685 Ga0207712_10227563 3300025961 Bacteria 1495
686 Ga0207668_10000084 3300025972 Bacteria 70850
687 Ga0207668_10013912 3300025972 Bacteria 4969
688 Ga0207668_10026818 3300025972 Bacteria 3747
689 Ga0207668_10187872 3300025972 Bacteria 1635
690 Ga0207668_10223093 3300025972 Bacteria 1515
691 Ga0207640_10001027 3300025981 Bacteria 15422
692 Ga0207640_10076067 3300025981 Bacteria 2277
693 Ga0207640_10117964 3300025981 Bacteria 1895
694 Ga0207658_10003107 3300025986 Bacteria 11882
695 Ga0207658_10140058 3300025986 Bacteria 1956
696 Ga0207658_10188724 3300025986 Bacteria 1711
697 Ga0207677_10012206 3300026023 Bacteria 4929
698 Ga0207703_10001870 3300026035 Bacteria 18725
699 Ga0207703_10003716 3300026035 Bacteria 12702
700 Ga0207703_10022833 3300026035 Bacteria 4914
701 Ga0207703_10324813 3300026035 Bacteria 1410
702 Ga0207639_10001925 3300026041 Bacteria 13946
703 Ga0207639_10690883 3300026041 Bacteria 946
704 Ga0207678_10000187 3300026067 Bacteria 53154
705 Ga0207678_10027928 3300026067 Bacteria 4926
706 Ga0207678_10037590 3300026067 Bacteria 4210
707 Ga0207678_10055576 3300026067 Bacteria 3410
708 Ga0207678_10066744 3300026067 Bacteria 3088
709 Ga0207708_10000158 3300026075 Bacteria 53154
710 Ga0207708_10000296 3300026075 Bacteria 39206
711 Ga0207708_10002015 3300026075 Bacteria 14967
712 Ga0207708_10002641 3300026075 Bacteria 13186
713 Ga0207708_10058689 3300026075 Bacteria 2936
714 Ga0207708_10629646 3300026075 Bacteria 911
715 Ga0207702_10001960 3300026078 Bacteria 20035
716 Ga0207702_10063916 3300026078 Bacteria 3149
717 Ga0207702_10172352 3300026078 Bacteria 1985
718 Ga0207702_10248625 3300026078 Bacteria 1669
719 Ga0207702_10340705 3300026078 Bacteria 1432
720 Ga0207702_10342006 3300026078 Bacteria 1429
721 Ga0207702_10415663 3300026078 Bacteria 1300
722 Ga0207641_10000896 3300026088 Bacteria 31014
723 Ga0207641_10031874 3300026088 Bacteria 4373
724 Ga0207648_10001167 3300026089 Bacteria 29390
725 Ga0207648_10003124 3300026089 Bacteria 17485
726 Ga0207648_10094370 3300026089 Bacteria 2616
727 Ga0207648_10156264 3300026089 Bacteria 2013
728 Ga0207676_10000089 3300026095 Bacteria 82462
729 Ga0207676_10018700 3300026095 Bacteria 5043
730 Ga0207676_10127658 3300026095 Bacteria 2156
731 Ga0207674_10001478 3300026116 Bacteria 30348
732 Ga0207674_10012981 3300026116 Bacteria 9286
733 Ga0207674_10048193 3300026116 Bacteria 4361
734 Ga0207674_10055121 3300026116 Bacteria 4044
735 Ga0207674_10146357 3300026116 Bacteria 2321
736 Ga0207674_10289726 3300026116 Bacteria 1586
737 Ga0207675_100000229 3300026118 Bacteria 52966
738 Ga0207675_100111466 3300026118 Bacteria 2582
739 Ga0207675_100134223 3300026118 Bacteria 2347
740 Ga0207683_10000525 3300026121 Bacteria 35508
741 Ga0207683_10006495 3300026121 Bacteria 10006
742 Ga0207683_10010816 3300026121 Bacteria 7781
743 Ga0207683_10022729 3300026121 Bacteria 5386
744 Ga0207683_10319679 3300026121 Bacteria 1422
745 Ga0207698_10000474 3300026142 Bacteria 23337
746 Ga0207698_10089517 3300026142 Bacteria 2514
747 Ga0207698_10365216 3300026142 Bacteria 1368
748 Ga0207698_10503186 3300026142 Bacteria 1179
749 Ga0209982_1006987 3300027552 Bacteria 1649
750 Ga0210002_1006040 3300027617 Bacteria 1821
751 Ga0209971_1004003 3300027682 Bacteria 3483
752 Ga0209971_1014968 3300027682 Bacteria 1838
753 Ga0209998_10001800 3300027717 Bacteria 5072
754 Ga0209998_10002157 3300027717 Bacteria 4579
755 Ga0209813_10007333 3300027866 Bacteria 2746
756 Ga0209813_10007971 3300027866 Bacteria 2659
757 Ga0209813_10122766 3300027866 Bacteria 906
758 Ga0209974_10019819 3300027876 Bacteria 2229
759 Ga0209974_10027444 3300027876 Bacteria 1884
760 Ga0207428_10000037 3300027907 Bacteria 218857
761 Ga0207428_10000308 3300027907 Bacteria 64810
762 Ga0207428_10000474 3300027907 Bacteria 48360
763 Ga0207428_10063820 3300027907 Bacteria 2909
764 Ga0207428_10105304 3300027907 Bacteria 2175
765 Ga0207428_10113451 3300027907 Bacteria 2083
766 Ga0268266_10024123 3300028379 Bacteria 5175
767 Ga0268266_10033960 3300028379 Bacteria 4335
768 Ga0268266_10578734 3300028379 Bacteria 1077
769 Ga0268265_10000195 3300028380 Bacteria 70871
770 Ga0268265_10000508 3300028380 Bacteria 40027
771 Ga0268265_10014611 3300028380 Bacteria 5353
772 Ga0268265_10293639 3300028380 Bacteria 1460
773 Ga0268264_10000526 3300028381 Bacteria 48503
774 Ga0268264_10005989 3300028381 Bacteria 10296
775 Ga0268264_10052107 3300028381 Bacteria 3412
776 Ga0268264_10220840 3300028381 Bacteria 1744
777 Ga0265337_1002502 3300028556 Bacteria 8378
778 Ga0265318_10004336 3300028577 Bacteria 6891
779 Ga0265338_10022782 3300028800 Bacteria 6466
780 Ga0265330_10029811 3300031235 Bacteria 2451
781 Ga0265330_10086147 3300031235 Bacteria 1351
782 Ga0265332_10006780 3300031238 Bacteria 5190
783 Ga0265332_10102177 3300031238 Bacteria 1209
784 Ga0265320_10031514 3300031240 Bacteria 2722
785 Ga0265325_10000126 3300031241 Bacteria 52410
786 Ga0265325_10000352 3300031241 Bacteria 32405
787 Ga0265325_10010060 3300031241 Bacteria 5494
788 Ga0265325_10016900 3300031241 Bacteria 4068
789 Ga0265329_10029030 3300031242 Archaea 1811
790 Ga0265329_10034663 3300031242 Bacteria 1630
791 Ga0265340_10000192 3300031247 Bacteria 30626
792 Ga0265340_10018794 3300031247 Bacteria 3562
793 Ga0265340_10026222 3300031247 Bacteria 2947
794 Ga0265340_10033433 3300031247 Bacteria 2560
795 Ga0265340_10056591 3300031247 Bacteria 1886
796 Ga0265340_10146659 3300031247 Bacteria 1077
797 Ga0265339_10007994 3300031249 Bacteria 6782
798 Ga0265339_10010090 3300031249 Bacteria 5885
799 Ga0265339_10124935 3300031249 Bacteria 1320
800 Ga0265339_10150565 3300031249 Bacteria 1177
801 Ga0265316_10278928 3300031344 Bacteria 1221
802 Ga0265313_10000106 3300031595 Bacteria 83923
803 Ga0265313_10006310 3300031595 Bacteria 8441
804 Ga0265313_10014074 3300031595 Bacteria 4758
805 Ga0265313_10020932 3300031595 Bacteria 3591
806 Ga0265313_10097307 3300031595 Bacteria 1311
807 Ga0307508_10016695 3300031616 Bacteria 6680
808 Ga0316575_10111479 3300031665 Bacteria 1116
809 Ga0316579_10109015 3300031691 Bacteria 1328
810 Ga0265314_10005573 3300031711 Bacteria 11319
811 Ga0265314_10107268 3300031711 Bacteria 1782
812 Ga0265342_10000100 3300031712 Bacteria 94554
813 Ga0265342_10000882 3300031712 Bacteria 29894
814 Ga0265342_10039481 3300031712 Bacteria 2868
815 Ga0307413_10774705 3300031824 Bacteria 804
816 Ga0307416_100724120 3300032002 Bacteria 1086
817 Ga0307416_100811174 3300032002 Bacteria 1032
818 Ga0307411_10153015 3300032005 Bacteria 1717
819 Ga0307415_100381532 3300032126 Bacteria 1197
820 Ga0316583_10000161 3300032133 Bacteria 16491
821 Ga0316583_10093777 3300032133 Bacteria 1047
822 Ga0307510_10260030 3300033180 Bacteria 1217
823 Ga0373930_0000020 3300034816 Bacteria 15356
824 Ga0373930_0001897 3300034816 Bacteria 3188
825 Ga0373948_0000775 3300034817 Bacteria 4185
826 Ga0373948_0003627 3300034817 Bacteria 2388
827 Ga0373950_0002092 3300034818 Bacteria 2710
828 Ga0373950_0002937 3300034818 Bacteria 2400
829 Ga0373958_0000679 3300034819 Bacteria 4307
830 Ga0373958_0000892 3300034819 Bacteria 3849
831 Ga0373959_0002322 3300034820 Bacteria 3024
832 Ga0373959_0004634 3300034820 Bacteria 2224
833 Ga0373938_0000321 3300034957 Bacteria 7652
834 Ga0373938_0001943 3300034957 Bacteria 3313
835 Ga0373926_0005663 3300035083 Bacteria 4122
836 Ga0373926_0031996 3300035083 Bacteria 1856
837 Ga0373926_0047484 3300035083 Bacteria 1542
838 Ga0373926_0102616 3300035083 Bacteria 1070
839 Ga0373928_0003285 3300035084 Bacteria 3097
840 Ga0373928_0007867 3300035084 Bacteria 2063
841 Ga0373929_0000042 3300035085 Bacteria 29236
842 Ga0373934_0031395 3300035086 Bacteria 2080
843 Ga0373934_0048369 3300035086 Bacteria 1683
844 Ga0373940_0002473 3300035088 Bacteria 3600
845 Ga0373940_0008037 3300035088 Bacteria 2406
846 Ga0373940_0026599 3300035088 Bacteria 1515
847 Ga0373944_0008477 3300035089 Bacteria 2776
848 Ga0373944_0021423 3300035089 Bacteria 1871
849 Ga0373944_0027193 3300035089 Bacteria 1695
850 Ga0373944_0071706 3300035089 Bacteria 1129
851 Ga0373949_0005028 3300035090 Bacteria 2977
852 Ga0373949_0008824 3300035090 Bacteria 2205
853 Ga0373949_0019983 3300035090 Bacteria 1530
854 Ga0373951_0003336 3300035091 Bacteria 3928
855 Ga0373951_0010103 3300035091 Bacteria 2118
856 Ga0373952_0000102 3300035092 Bacteria 11425
857 Ga0373952_0002076 3300035092 Bacteria 3609
858 Ga0373952_0003332 3300035092 Bacteria 2896
859 Ga0373923_0002700 3300035111 Bacteria 5526
860 Ga0373923_0004197 3300035111 Bacteria 4756
861 Ga0373923_0075405 3300035111 Bacteria 1455
862 Ga0373932_0002320 3300035112 Bacteria 4838
863 Ga0373932_0002582 3300035112 Bacteria 4528
864 Ga0373936_0003041 3300035113 Bacteria 6271
865 Ga0373936_0164967 3300035113 Bacteria 966
866 Ga0373939_0000261 3300035114 Bacteria 14162
867 Ga0373939_0000299 3300035114 Bacteria 12900
868 Ga0373939_0002349 3300035114 Bacteria 4475
869 Ga0373939_0040056 3300035114 Bacteria 1405
870 Ga0373939_0041631 3300035114 Bacteria 1385
871 Ga0373941_0004117 3300035115 Bacteria 3336
872 Ga0373941_0010894 3300035115 Bacteria 2337
873 Ga0373941_0032409 3300035115 Bacteria 1564
874 Ga0373945_0002982 3300035116 Bacteria 5316
875 Ga0373953_0001408 3300035117 Bacteria 6943
876 Ga0373953_0017950 3300035117 Bacteria 2609
877 Ga0373953_0040072 3300035117 Bacteria 1859
878 Ga0373954_0003125 3300035118 Bacteria 6995
879 Ga0373954_0011821 3300035118 Bacteria 3876
880 Ga0373954_0046561 3300035118 Bacteria 2028
881 Ga0373954_0124163 3300035118 Bacteria 1254
882 Ga0373956_0004874 3300035119 Bacteria 5373
883 Ga0373956_0014969 3300035119 Bacteria 3244
884 Ga0373956_0033597 3300035119 Bacteria 2256
885 Ga0373956_0178018 3300035119 Bacteria 1005
886 Ga0373957_0011372 3300035120 Bacteria 2970
887 Ga0373957_0019808 3300035120 Bacteria 2371
888 Ga0373957_0028596 3300035120 Bacteria 2032
889 Ga0373957_0090234 3300035120 Bacteria 1217
890 Ga0373960_0001113 3300035121 Bacteria 5796
891 Ga0373960_0005022 3300035121 Bacteria 3050
892 Ga0373960_0029703 3300035121 Bacteria 1517
893 Ga0373960_0043313 3300035121 Bacteria 1310
894 Ga0373960_0083640 3300035121 Bacteria 1009
895 Ga0373943_0001959 3300035170 Bacteria 9321
896 Ga0373943_0043498 3300035170 Bacteria 2181
897 Ga0373943_0045730 3300035170 Bacteria 2134
898 Ga0373943_0149170 3300035170 Bacteria 1266
899 Ga0373946_0000552 3300035171 Bacteria 12398
900 Ga0373946_0008023 3300035171 Bacteria 3877
901 Ga0373946_0024168 3300035171 Bacteria 2378
902 Ga0373955_0000513 3300035172 Bacteria 16479
903 Ga0373955_0000862 3300035172 Bacteria 12983
904 Ga0373955_0034680 3300035172 Bacteria 2668
905 Ga0373942_0001283 3300035207 Bacteria 6569
906 Ga0373942_0008995 3300035207 Bacteria 2334
907 Ga0373942_0039604 3300035207 Bacteria 1282
908 Ga0373961_0002305 3300035241 Bacteria 4987
909 Ga0373961_0002581 3300035241 Bacteria 4662
910 Ga0373961_0052384 3300035241 Bacteria 1215
911 Ga0373962_0036853 3300035242 Bacteria 1364
912 Ga0316574_0076088 3300035398 Bacteria 2126
913 Ga0373924_0000240 3300035410 Bacteria 16742
914 Ga0373924_0007693 3300035410 Bacteria 3894
915 Ga0373924_0016808 3300035410 Bacteria 2799
916 Ga0373931_0003801 3300035691 Bacteria 6830
917 Ga0373931_0004468 3300035691 Bacteria 6393
918 Ga0373931_0005387 3300035691 Bacteria 5910
919 Ga0373931_0008666 3300035691 Bacteria 4835
920 Ga0373935_0000088 3300035692 Bacteria 40092
921 Ga0373935_0003255 3300035692 Bacteria 9390
922 Ga0373935_0040467 3300035692 Bacteria 2925
923 Ga0373935_0058215 3300035692 Bacteria 2468
924 Ga0373927_0027363 3300035695 Bacteria 3723
925 Ga0373927_0027573 3300035695 Bacteria 3707
926 Ga0373927_0038709 3300035695 Bacteria 3095
927 Ga0373927_0263465 3300035695 Bacteria 1133
928 Ga0373933_0003120 3300035724 Bacteria 9238
929 Ga0373933_0011012 3300035724 Bacteria 4969
930 Ga0373933_0013709 3300035724 Bacteria 4497
931 Ga0373933_0013911 3300035724 Bacteria 4465
932 Ga0373933_0018113 3300035724 Bacteria 3957
933 Ga0373933_0229796 3300035724 Bacteria 1191
934 Ga0373933_0269808 3300035724 Bacteria 1098
935 Ga0373933_0436289 3300035724 Bacteria 856
936 Ga0373947_0001466 3300035725 Bacteria 14516
937 Ga0373947_0001608 3300035725 Bacteria 13851
938 Ga0373947_0007595 3300035725 Bacteria 6274
939 Ga0373947_0077321 3300035725 Bacteria 2052
940 Ga0373947_0160029 3300035725 Bacteria 1456
941 Ga0373947_0333368 3300035725 Bacteria 1016
942 Ga0373937_0000124 3300036401 Bacteria 73933
943 Ga0373937_0007923 3300036401 Bacteria 9207
944 Ga0373937_0010800 3300036401 Bacteria 7993
945 Ga0373937_0049008 3300036401 Bacteria 3868
946 Ga0373937_0067527 3300036401 Bacteria 3294
947 Ga0373937_0096758 3300036401 Bacteria 2738
948 Ga0373937_0309262 3300036401 Bacteria 1494
949 Ga0373937_0730241 3300036401 Bacteria 937
950 Ga0373925_0000929 3300037068 Bacteria 26669
951 Ga0373925_0025220 3300037068 Bacteria 4341
952 Ga0373925_0030267 3300037068 Bacteria 3974
953 Ga0373925_0131102 3300037068 Bacteria 1954
954 Ga0373925_0200772 3300037068 Bacteria 1585
955 Ga0373925_0618602 3300037068 Bacteria 892
956 Ga0395899_0007959 3300037312 Bacteria 8164
957 Ga0395899_0065556 3300037312 Bacteria 2669
958 Ga0395900_0005074 3300037418 Bacteria 13816
959 Ga0395900_0008149 3300037418 Bacteria 10783
960 Ga0395898_0012968 3300037466 Bacteria 8594
961 Ga0395898_0019972 3300037466 Bacteria 6813
962 Ga0395898_0044004 3300037466 Bacteria 4398
963 Ga0436364_0320537 3300037853 Bacteria 1050
964 Ga0436364_0461857 3300037853 Bacteria 19352
965 Ga0436364_0934985 3300037853 Bacteria 2733
966 Ga0395901_0048458 3300038443 Bacteria 4412
967 Ga0395901_0104341 3300038443 Bacteria 2975
968 Ga0436365_0067390 3300039437 Bacteria 6814
969 Ga0436365_0459020 3300039437 Bacteria 2358
970 Ga0436365_1235938 3300039437 Bacteria 3518
971 Ga0436361_0431504 3300039447 Bacteria 2076
972 Ga0436363_0565062 3300039450 Bacteria 1275
973 Ga0436363_0588048 3300039450 Bacteria 1011
974 Ga0436362_1201994 3300039453 Bacteria 1112
975 Ga0439453_0000484 3300041408 Bacteria 4367
976 Ga0439453_0012281 3300041408 Bacteria 1440
977 Ga0439441_024967 3300042001 Bacteria 1126
978 Ga0439450_092512 3300042008 Bacteria 761
979 Ga0439455_0011472 3300042012 Bacteria 1970
980 Ga0439463_043431 3300042016 Bacteria 1144
981 Ga0439446_0096249 3300042156 Bacteria 932
982 Ga0451577_0130165 3300042876 Bacteria 2257
983 Ga0439440_0004213 3300042993 Bacteria 2820
984 Ga0466966_0119120 3300044684 Bacteria 1623
985 Ga0466963_0319141 3300044694 Bacteria 1093
986 Ga0466971_0123601 3300044719 Bacteria 1199
987 Ga0451576_0052301 3300045051 Bacteria 4280
988 Ga0466967_0051512 3300045976 Bacteria 3608
989 Ga0466967_0294143 3300045976 Bacteria 1561
990 Ga0495617_039107 3300046452 Bacteria 1586
991 Ga0495617_060812 3300046452 Bacteria 1250
992 Ga0495592_0000020 3300046454 Bacteria 140576
993 Ga0495592_0009547 3300046454 Bacteria 7299
994 Ga0495592_0012703 3300046454 Bacteria 6401
995 Ga0495592_0221622 3300046454 Bacteria 1264
996 Ga0495592_0503038 3300046454 Bacteria 751
997 Ga0495603_0025279 3300046455 Bacteria 3591
998 Ga0495603_0034874 3300046455 Bacteria 3024
999 Ga0495603_0106974 3300046455 Bacteria 1632
1000 Ga0495603_0132770 3300046455 Bacteria 1449
1001 Ga0495590_0050857 3300046457 Bacteria 1447
1002 Ga0495590_0103288 3300046457 Bacteria 1014
1003 Ga0495629_0000222 3300046459 Bacteria 50600
1004 Ga0495629_0005609 3300046459 Bacteria 9372
1005 Ga0495629_0073719 3300046459 Bacteria 2383
1006 Ga0495629_0108030 3300046459 Bacteria 1941
1007 Ga0495638_0012075 3300046460 Bacteria 5933
1008 Ga0495641_0016360 3300046461 Bacteria 3911
1009 Ga0495641_0031517 3300046461 Bacteria 2532
1010 Ga0495641_0041306 3300046461 Bacteria 2143
1011 Ga0495641_0052185 3300046461 Bacteria 1865
1012 Ga0495651_0001798 3300046462 Bacteria 16533
1013 Ga0495651_0019865 3300046462 Bacteria 5210
1014 Ga0495651_0035254 3300046462 Bacteria 3897
1015 Ga0495651_0051434 3300046462 Bacteria 3176
1016 Ga0495653_0000046 3300046463 Bacteria 113893
1017 Ga0495653_0007380 3300046463 Bacteria 9006
1018 Ga0495653_0007877 3300046463 Bacteria 8720
1019 Ga0495653_0052601 3300046463 Bacteria 3120
1020 Ga0495580_0014500 3300046472 Bacteria 5976
1021 Ga0495580_0122946 3300046472 Bacteria 1801
1022 Ga0495582_0006030 3300046473 Bacteria 6758
1023 Ga0495582_0006417 3300046473 Bacteria 6533
1024 Ga0495582_0010354 3300046473 Bacteria 5131
1025 Ga0495582_0068540 3300046473 Bacteria 1960
1026 Ga0495605_0037445 3300046474 Bacteria 2440
1027 Ga0495639_0003996 3300046475 Bacteria 6329
1028 Ga0495639_0217033 3300046475 Bacteria 939
1029 Ga0495662_0001624 3300046476 Bacteria 11174
1030 Ga0495662_0052690 3300046476 Bacteria 1964
1031 Ga0495664_0000017 3300046477 Bacteria 172210
1032 Ga0495664_0011559 3300046477 Bacteria 4978
1033 Ga0495664_0096799 3300046477 Bacteria 1776
1034 Ga0495664_0210115 3300046477 Bacteria 1179
1035 Ga0495584_0027260 3300046491 Bacteria 2895
1036 Ga0495584_0104369 3300046491 Bacteria 1433
1037 Ga0495584_0123394 3300046491 Bacteria 1312
1038 Ga0495585_0001425 3300046492 Bacteria 18789
1039 Ga0495585_0190219 3300046492 Bacteria 1050
1040 Ga0495594_0017590 3300046499 Bacteria 3779
1041 Ga0495594_0066849 3300046499 Bacteria 1994
1042 Ga0495594_0210889 3300046499 Bacteria 1107
1043 Ga0495607_0260264 3300046501 Bacteria 831
1044 Ga0495608_0000560 3300046511 Bacteria 25606
1045 Ga0495608_0041445 3300046511 Bacteria 3081
1046 Ga0495608_0054768 3300046511 Bacteria 2636
1047 Ga0495608_0088003 3300046511 Bacteria 2011
1048 Ga0495608_0122712 3300046511 Bacteria 1665
1049 Ga0495608_0354044 3300046511 Bacteria 903
1050 Ga0495618_0000059 3300046514 Bacteria 79623
1051 Ga0495618_0037132 3300046514 Bacteria 3058
1052 Ga0495618_0107847 3300046514 Bacteria 1783
1053 Ga0495628_0000530 3300046516 Bacteria 34897
1054 Ga0495628_0014379 3300046516 Bacteria 6635
1055 Ga0495628_0017502 3300046516 Bacteria 5966
1056 Ga0495628_0033051 3300046516 Bacteria 4172
1057 Ga0495628_0121222 3300046516 Bacteria 2005
1058 Ga0495628_0148709 3300046516 Bacteria 1785
1059 Ga0495628_0337056 3300046516 Bacteria 1111
1060 Ga0495630_0003755 3300046517 Bacteria 10601
1061 Ga0495630_0086059 3300046517 Bacteria 2373
1062 Ga0495630_0249689 3300046517 Bacteria 1355
1063 Ga0495630_0712051 3300046517 Bacteria 768
1064 Ga0495644_0000656 3300046523 Bacteria 14496
1065 Ga0495644_0012285 3300046523 Bacteria 3292
1066 Ga0495648_0227049 3300046524 Bacteria 917
1067 Ga0495652_0001393 3300046529 Bacteria 26853
1068 Ga0495652_0023653 3300046529 Bacteria 5445
1069 Ga0495652_0081945 3300046529 Bacteria 2660
1070 Ga0495652_0268227 3300046529 Bacteria 1256
1071 Ga0495640_0000029 3300046533 Bacteria 79567
1072 Ga0495640_0088868 3300046533 Bacteria 2041
1073 Ga0495586_0049786 3300046535 Bacteria 2266
1074 Ga0495586_0076203 3300046535 Bacteria 1837
1075 Ga0495587_0000019 3300046536 Bacteria 161972
1076 Ga0495587_0082282 3300046536 Bacteria 1866
1077 Ga0495587_0103407 3300046536 Bacteria 1640
1078 Ga0495587_0109249 3300046536 Bacteria 1589
1079 Ga0495587_0139470 3300046536 Bacteria 1384
1080 Ga0495598_0174008 3300046537 Bacteria 764
1081 Ga0495621_0032491 3300046539 Bacteria 1795
1082 Ga0495621_0064463 3300046539 Bacteria 1337
1083 Ga0495645_0000006 3300046543 Bacteria 382503
1084 Ga0495645_0007306 3300046543 Bacteria 7684
1085 Ga0495645_0092181 3300046543 Bacteria 2164
1086 Ga0495645_0214999 3300046543 Bacteria 1296
1087 Ga0495622_0006881 3300046557 Bacteria 5279
1088 Ga0495622_0029858 3300046557 Bacteria 2547
1089 Ga0495622_0175983 3300046557 Bacteria 961
1090 Ga0495633_0005034 3300046558 Bacteria 8237
1091 Ga0495633_0093209 3300046558 Bacteria 1400
1092 Ga0495633_0125223 3300046558 Bacteria 1189
1093 Ga0495667_0000061 3300046559 Bacteria 94650
1094 Ga0495667_0003512 3300046559 Bacteria 10519
1095 Ga0495667_0012058 3300046559 Bacteria 5853
1096 Ga0495667_0016658 3300046559 Bacteria 4962
1097 Ga0495667_0045437 3300046559 Bacteria 2908
1098 Ga0495656_0000262 3300046615 Bacteria 18537
1099 Ga0495656_0009406 3300046615 Bacteria 3513
1100 Ga0495656_0016353 3300046615 Bacteria 2814
1101 Ga0495634_0003572 3300046642 Bacteria 12439
1102 Ga0495634_0153734 3300046642 Bacteria 1453
1103 Ga0495611_0042526 3300046648 Bacteria 2029
1104 Ga0495635_0005209 3300046663 Bacteria 9047
1105 Ga0495635_0020959 3300046663 Bacteria 4555
1106 Ga0495635_0064668 3300046663 Bacteria 2511
1107 Ga0495635_0076067 3300046663 Bacteria 2300
1108 Ga0495659_0001142 3300046664 Bacteria 9228
1109 Ga0495659_0152606 3300046664 Bacteria 928
1110 Ga0495659_0170287 3300046664 Bacteria 883
1111 Ga0495588_0003364 3300046674 Bacteria 6950
1112 Ga0495588_0016789 3300046674 Bacteria 3542
1113 Ga0495657_0000306 3300046675 Bacteria 44762
1114 Ga0495657_0058110 3300046675 Bacteria 2569
1115 Ga0495657_0065747 3300046675 Bacteria 2384
1116 Ga0495599_0000066 3300046678 Bacteria 72412
1117 Ga0495599_0004314 3300046678 Bacteria 8414
1118 Ga0495599_0024348 3300046678 Bacteria 3786
1119 Ga0495623_0000428 3300046679 Bacteria 27653
1120 Ga0495623_0001394 3300046679 Bacteria 16421
1121 Ga0495623_0055303 3300046679 Bacteria 2502
1122 Ga0495646_0000108 3300046680 Bacteria 40754
1123 Ga0495646_0016683 3300046680 Bacteria 4663
1124 Ga0495646_0021361 3300046680 Bacteria 4089
1125 Ga0495646_0038478 3300046680 Bacteria 2953
1126 Ga0495647_0008348 3300046681 Bacteria 3481
1127 Ga0495647_0010525 3300046681 Bacteria 3151
1128 Ga0495647_0035128 3300046681 Bacteria 1880
1129 Ga0495658_0000656 3300046683 Bacteria 18755
1130 Ga0495658_0081876 3300046683 Bacteria 1896
1131 Ga0495658_0131742 3300046683 Bacteria 1522
1132 Ga0495613_0238001 3300046689 Bacteria 1274
1133 Ga0495624_0025941 3300046690 Bacteria 3844
1134 Ga0495624_0044494 3300046690 Bacteria 2829
1135 Ga0495624_0045160 3300046690 Bacteria 2806
1136 Ga0495624_0212293 3300046690 Bacteria 1174
1137 Ga0495670_0003236 3300046691 Bacteria 8018
1138 Ga0495670_0126797 3300046691 Bacteria 1329
1139 Ga0495600_0000030 3300046809 Bacteria 89424
1140 Ga0495600_0000708 3300046809 Bacteria 17501
1141 Ga0495600_0003719 3300046809 Bacteria 9018
1142 Ga0495600_0040446 3300046809 Bacteria 3036
1143 Ga0495600_0083709 3300046809 Bacteria 2082
1144 Ga0495581_0005847 3300047315 Bacteria 7133
1145 Ga0495581_0010274 3300047315 Bacteria 5414
1146 Ga0495604_0000501 3300047317 Bacteria 34507
1147 Ga0495604_0013476 3300047317 Bacteria 6513
1148 Ga0495604_0014927 3300047317 Bacteria 6196
1149 Ga0495604_0048949 3300047317 Bacteria 3286
1150 Ga0495604_0105282 3300047317 Bacteria 2065
1151 Ga0495604_0147904 3300047317 Bacteria 1672
1152 Ga0495604_0187197 3300047317 Bacteria 1445
1153 Ga0495674_0001027 3300047319 Bacteria 26811
1154 Ga0495674_0087251 3300047319 Bacteria 2670
1155 Ga0495674_0145588 3300047319 Bacteria 1989
1156 Ga0495674_0152441 3300047319 Bacteria 1937
1157 Ga0495674_0438209 3300047319 Bacteria 1051
1158 Ga0495674_0623251 3300047319 Bacteria 853
1159 Ga0495676_0038571 3300047321 Bacteria 3966
1160 Ga0495676_0039314 3300047321 Bacteria 3919
1161 Ga0495676_0091203 3300047321 Bacteria 2278
1162 Ga0495676_0187718 3300047321 Bacteria 1444
1163 Ga0495680_0002301 3300047322 Bacteria 19625
1164 Ga0495680_0002894 3300047322 Bacteria 17254
1165 Ga0495680_0007421 3300047322 Bacteria 10056
1166 Ga0495680_0018474 3300047322 Bacteria 5917
1167 Ga0495680_0024681 3300047322 Bacteria 4984
1168 Ga0495680_0027756 3300047322 Bacteria 4645
1169 Ga0495675_0000719 3300047444 Bacteria 20684
1170 Ga0495675_0011635 3300047444 Bacteria 5524
1171 Ga0495675_0021716 3300047444 Bacteria 4089
1172 Ga0495675_0169067 3300047444 Bacteria 1343
1173 Ga0495675_0203873 3300047444 Bacteria 1203
1174 Ga0495679_020243 3300047446 Bacteria 2320
1175 Ga0495685_010564 3300047447 Bacteria 3100
1176 Ga0495685_044762 3300047447 Bacteria 1509
1177 Ga0495673_0084059 3300047469 Bacteria 1313
1178 Ga0495684_0000056 3300047471 Bacteria 79718
1179 Ga0495684_0045090 3300047471 Bacteria 3375
1180 Ga0495684_0280439 3300047471 Bacteria 1202
1181 Ga0495593_0001400 3300047673 Bacteria 14114
1182 Ga0495593_0009436 3300047673 Bacteria 5662
1183 Ga0495602_0000006 3300048088 Bacteria 322593
1184 Ga0495602_0004878 3300048088 Bacteria 14046
1185 Ga0495602_0028646 3300048088 Bacteria 5325
1186 Ga0495602_0318501 3300048088 Bacteria 1132
1187 Ga0495614_0230748 3300048089 Bacteria 843
1188 Ga0496100_0000189 3300048903 Bacteria 34151
1189 Ga0496100_0001161 3300048903 Bacteria 12807
1190 Ga0496100_0004954 3300048903 Bacteria 7118
1191 Ga0496100_0049689 3300048903 Bacteria 2713
1192 Ga0496100_0068743 3300048903 Bacteria 2357
1193 Ga0496100_0086288 3300048903 Bacteria 2132
1194 Ga0496100_0315268 3300048903 Bacteria 1173
1195 Ga0496101_0000367 3300048904 Bacteria 29989
1196 Ga0496101_0002673 3300048904 Bacteria 10941
1197 Ga0496101_0224841 3300048904 Bacteria 1457
1198 Ga0496101_0248825 3300048904 Bacteria 1384
1199 Ga0496101_0290753 3300048904 Bacteria 1278
1200 Ga0496101_0299396 3300048904 Bacteria 1259
1201 Ga0496102_0000967 3300048905 Bacteria 27034
1202 Ga0496102_0002863 3300048905 Bacteria 14654
1203 Ga0496102_0002928 3300048905 Bacteria 14484
1204 Ga0496102_0009278 3300048905 Bacteria 8442
1205 Ga0496102_0013770 3300048905 Bacteria 7015
1206 Ga0496102_0017017 3300048905 Bacteria 6363
1207 Ga0496102_0091527 3300048905 Bacteria 2815
1208 Ga0496102_0244805 3300048905 Bacteria 1691
1209 Ga0496102_0302506 3300048905 Bacteria 1507
1210 Ga0496102_0307262 3300048905 Bacteria 1494
1211 Ga0496103_0001608 3300048906 Bacteria 14839
1212 Ga0496103_0001665 3300048906 Bacteria 14545
1213 Ga0496103_0005379 3300048906 Bacteria 7671
1214 Ga0496103_0013937 3300048906 Bacteria 4773
1215 Ga0496103_0030811 3300048906 Bacteria 3265
1216 Ga0496103_0032609 3300048906 Bacteria 3179
1217 Ga0496103_0052684 3300048906 Bacteria 2520
1218 Ga0496103_0054457 3300048906 Bacteria 2480
1219 Ga0496103_0242930 3300048906 Bacteria 1158
1220 Ga0496104_0000116 3300048907 Bacteria 74423
1221 Ga0496104_0001806 3300048907 Bacteria 18557
1222 Ga0496104_0003787 3300048907 Bacteria 13088
1223 Ga0496104_0003981 3300048907 Bacteria 12794
1224 Ga0496104_0004377 3300048907 Bacteria 12298
1225 Ga0496104_0005021 3300048907 Bacteria 11544
1226 Ga0496104_0006644 3300048907 Bacteria 10181
1227 Ga0496104_0087226 3300048907 Bacteria 2980
1228 Ga0496104_0141339 3300048907 Bacteria 2312
1229 Ga0496104_0163210 3300048907 Bacteria 2136
1230 Ga0496104_0190266 3300048907 Bacteria 1963
1231 Ga0496104_0208931 3300048907 Bacteria 1864
1232 Ga0496104_0304314 3300048907 Bacteria 1506
1233 Ga0496104_0348595 3300048907 Bacteria 1393
1234 Ga0496105_0000550 3300048908 Bacteria 24744
1235 Ga0496105_0008839 3300048908 Bacteria 7846
1236 Ga0496105_0009845 3300048908 Bacteria 7492
1237 Ga0496105_0014629 3300048908 Bacteria 6248
1238 Ga0496105_0025397 3300048908 Bacteria 4822
1239 Ga0496105_0049329 3300048908 Bacteria 3475
1240 Ga0496105_0056463 3300048908 Bacteria 3240
1241 Ga0496105_0062353 3300048908 Bacteria 3076
1242 Ga0496105_0106070 3300048908 Bacteria 2319
1243 Ga0496105_0132699 3300048908 Bacteria 2052
1244 Ga0496106_0000736 3300048909 Bacteria 23593
1245 Ga0496106_0004342 3300048909 Bacteria 10529
1246 Ga0496106_0007993 3300048909 Bacteria 7815
1247 Ga0496106_0008120 3300048909 Bacteria 7753
1248 Ga0496106_0011796 3300048909 Bacteria 6450
1249 Ga0496106_0069576 3300048909 Bacteria 2687
1250 Ga0496106_0288303 3300048909 Bacteria 1316
1251 Ga0496106_0358592 3300048909 Bacteria 1171
1252 Ga0496106_0780538 3300048909 Bacteria 758
1253 Ga0496107_0000061 3300048910 Bacteria 53089
1254 Ga0496107_0000646 3300048910 Bacteria 19609
1255 Ga0496107_0006231 3300048910 Bacteria 8201
1256 Ga0496107_0024408 3300048910 Bacteria 4276
1257 Ga0496107_0085808 3300048910 Bacteria 2297
1258 Ga0496107_0110341 3300048910 Bacteria 2021
1259 Ga0496107_0114464 3300048910 Bacteria 1984
1260 Ga0496107_0220588 3300048910 Bacteria 1411
1261 Ga0496107_0254201 3300048910 Bacteria 1307
1262 Ga0496108_0001716 3300048911 Bacteria 17374
1263 Ga0496108_0006940 3300048911 Bacteria 9168
1264 Ga0496108_0010675 3300048911 Bacteria 7452
1265 Ga0496108_0017108 3300048911 Bacteria 5930
1266 Ga0496108_0076752 3300048911 Bacteria 2824
1267 Ga0496108_0102200 3300048911 Bacteria 2446
1268 Ga0496108_0142582 3300048911 Bacteria 2064
1269 Ga0496108_0256175 3300048911 Bacteria 1522
1270 Ga0496108_0658237 3300048911 Bacteria 910
1271 Ga0496109_0004602 3300048912 Bacteria 11514
1272 Ga0496109_0019595 3300048912 Bacteria 5967
1273 Ga0496109_0023516 3300048912 Bacteria 5471
1274 Ga0496109_0024181 3300048912 Bacteria 5398
1275 Ga0496109_0029321 3300048912 Bacteria 4929
1276 Ga0496109_0307433 3300048912 Bacteria 1495
1277 Ga0496109_0324443 3300048912 Bacteria 1453
1278 Ga0496109_0371279 3300048912 Bacteria 1351
1279 Ga0496109_0406192 3300048912 Bacteria 1287
1280 Ga0496109_0511437 3300048912 Bacteria 1133
1281 Ga0496110_0000401 3300048913 Bacteria 29358
1282 Ga0496110_0010675 3300048913 Bacteria 7479
1283 Ga0496110_0011385 3300048913 Bacteria 7278
1284 Ga0496110_0019695 3300048913 Bacteria 5685
1285 Ga0496110_0043780 3300048913 Bacteria 3908
1286 Ga0496110_0067983 3300048913 Bacteria 3153
1287 Ga0496110_0106673 3300048913 Bacteria 2514
1288 Ga0496110_0361501 3300048913 Bacteria 1322
1289 Ga0496110_0783945 3300048913 Bacteria 857
1290 Ga0496110_0784061 3300048913 Bacteria 857
1291 Ga0496111_0001881 3300048914 Bacteria 12410
1292 Ga0496111_0005191 3300048914 Bacteria 8304
1293 Ga0496111_0010028 3300048914 Bacteria 6338
1294 Ga0496111_0016147 3300048914 Bacteria 5143
1295 Ga0496111_0020730 3300048914 Bacteria 4580
1296 Ga0496111_0090586 3300048914 Bacteria 2240
1297 Ga0496111_0143854 3300048914 Bacteria 1767
1298 Ga0496111_0198765 3300048914 Bacteria 1490
1299 Ga0496111_0494186 3300048914 Bacteria 901
1300 Ga0496112_0004013 3300048915 Bacteria 12340
1301 Ga0496112_0010313 3300048915 Bacteria 8473
1302 Ga0496112_0014330 3300048915 Bacteria 7348
1303 Ga0496112_0055743 3300048915 Bacteria 3888
1304 Ga0496112_0168031 3300048915 Bacteria 2159
1305 Ga0496112_0235313 3300048915 Bacteria 1785
1306 Ga0496112_0244231 3300048915 Bacteria 1747
1307 Ga0496112_0299223 3300048915 Bacteria 1554
1308 Ga0496112_0407761 3300048915 Bacteria 1298
1309 Ga0496112_0797196 3300048915 Bacteria 869
1310 Ga0496113_0000682 3300048916 Bacteria 17292
1311 Ga0496113_0001738 3300048916 Bacteria 12337
1312 Ga0496113_0009613 3300048916 Bacteria 6348
1313 Ga0496113_0013969 3300048916 Bacteria 5462
1314 Ga0496113_0025336 3300048916 Bacteria 4226
1315 Ga0496113_0028906 3300048916 Bacteria 3994
1316 Ga0496113_0054399 3300048916 Bacteria 2996
1317 Ga0496113_0074021 3300048916 Bacteria 2596
1318 Ga0496113_0080065 3300048916 Bacteria 2501
1319 Ga0496113_0115486 3300048916 Bacteria 2094
1320 Ga0496113_0254450 3300048916 Bacteria 1402
1321 Ga0496113_0256902 3300048916 Bacteria 1395
1322 Ga0496114_0002405 3300048917 Bacteria 14267
1323 Ga0496114_0022492 3300048917 Bacteria 5139
1324 Ga0496114_0080545 3300048917 Bacteria 2750
1325 Ga0496114_0091730 3300048917 Bacteria 2580
1326 Ga0496114_0195968 3300048917 Bacteria 1768
1327 Ga0496114_0512036 3300048917 Bacteria 1061
1328 Ga0496114_0544833 3300048917 Bacteria 1025
1329 Ga0496114_0864952 3300048917 Unclassified 784
1330 Ga0496115_0001413 3300048918 Bacteria 17185
1331 Ga0496115_0005844 3300048918 Bacteria 8963
1332 Ga0496115_0011047 3300048918 Bacteria 6764
1333 Ga0496115_0037310 3300048918 Bacteria 3851
1334 Ga0496115_0056246 3300048918 Bacteria 3162
1335 Ga0496115_0088276 3300048918 Bacteria 2531
1336 Ga0496115_0119638 3300048918 Bacteria 2166
1337 Ga0496115_0132658 3300048918 Bacteria 2053
1338 Ga0496115_0161503 3300048918 Bacteria 1851
1339 Ga0496115_0199591 3300048918 Unclassified 1652
1340 Ga0496115_0261008 3300048918 Bacteria 1424
1341 Ga0496115_0650563 3300048918 Unclassified 833
1342 Ga0501031_0075121 3300049568 Bacteria 2200
1343 Ga0501032_0028317 3300049569 Bacteria 3850
1344 Ga0501033_0062792 3300049570 Bacteria 2735
1345 Ga0501033_0087148 3300049570 Bacteria 2285
1346 Ga0501033_0142433 3300049570 Bacteria 1733
1347 Ga0501033_0304194 3300049570 Bacteria 1122
1348 Ga0501033_0436067 3300049570 Bacteria 911
1349 Ga0501034_0010159 3300049571 Bacteria 9822
1350 Ga0501034_0079854 3300049571 Bacteria 3275
1351 Ga0501034_0085139 3300049571 Bacteria 3163
1352 Ga0501034_0132421 3300049571 Bacteria 2476
1353 Ga0501034_0143267 3300049571 Bacteria 2368
1354 Ga0501034_0447997 3300049571 Bacteria 1209
1355 Ga0501034_0460039 3300049571 Bacteria 1189
1356 Ga0501036_0226905 3300049572 Bacteria 1568
1357 Ga0501036_0480384 3300049572 Bacteria 1034
1358 Ga0501037_0355219 3300049573 Bacteria 1010
1359 Ga0501038_0081122 3300049574 Bacteria 2733
1360 Ga0501038_0108560 3300049574 Bacteria 2301
1361 Ga0501039_0190702 3300049575 Bacteria 1612
1362 Ga0501039_0307517 3300049575 Bacteria 1246
1363 Ga0501040_0120998 3300049576 Bacteria 1837
1364 Ga0501040_0272705 3300049576 Bacteria 1208
1365 Ga0501042_0099390 3300049578 Bacteria 2092
1366 Ga0501042_0585421 3300049578 Bacteria 811
1367 Ga0501043_0126167 3300049579 Bacteria 2007
1368 Ga0501046_0007129 3300049580 Bacteria 9834
1369 Ga0501046_0164719 3300049580 Bacteria 1666
1370 Ga0501046_0268667 3300049580 Bacteria 1251
1371 Ga0501047_0144982 3300049581 Bacteria 2252
1372 Ga0501047_0190645 3300049581 Bacteria 1914
1373 Ga0501047_0212962 3300049581 Bacteria 1790
1374 Ga0501047_0228869 3300049581 Bacteria 1713
1375 Ga0501047_0672002 3300049581 Bacteria 854
1376 Ga0501067_0011699 3300049583 Bacteria 4861
1377 Ga0501068_0436238 3300049584 Bacteria 847
1378 Ga0501069_0014533 3300049585 Bacteria 4210
1379 Ga0501069_0166874 3300049585 Bacteria 1269
1380 Ga0501069_0381786 3300049585 Bacteria 832
1381 Ga0501070_0004928 3300049586 Bacteria 11393
1382 Ga0501070_0014873 3300049586 Bacteria 6547
1383 Ga0501070_0056756 3300049586 Bacteria 3246
1384 Ga0501070_0234137 3300049586 Bacteria 1504
1385 Ga0501070_0367048 3300049586 Bacteria 1167
1386 Ga0501071_0118866 3300049587 Bacteria 1958
1387 Ga0501071_0315633 3300049587 Bacteria 1186
1388 Ga0501071_0334638 3300049587 Bacteria 1151
1389 Ga0501072_0002038 3300049588 Bacteria 15051
1390 Ga0501072_0019373 3300049588 Bacteria 5259
1391 Ga0501072_0037372 3300049588 Bacteria 3808
1392 Ga0501072_0303621 3300049588 Bacteria 1269
1393 Ga0501072_0583136 3300049588 Bacteria 882
1394 Ga0501073_0036871 3300049589 Bacteria 3472
1395 Ga0501073_0099501 3300049589 Bacteria 2019
1396 Ga0501073_0169412 3300049589 Bacteria 1512
1397 Ga0501073_0187189 3300049589 Bacteria 1433
1398 Ga0501073_0228696 3300049589 Bacteria 1285
1399 Ga0501073_0246889 3300049589 Bacteria 1232
1400 Ga0501073_0358376 3300049589 Bacteria 1007
1401 Ga0501073_0500869 3300049589 Bacteria 840
1402 Ga0501074_0019000 3300049590 Bacteria 4992
1403 Ga0501074_0159471 3300049590 Bacteria 1611
1404 Ga0501075_0142426 3300049591 Bacteria 1827
1405 Ga0501075_0376191 3300049591 Bacteria 1083
1406 Ga0501076_0018369 3300049592 Bacteria 5330
1407 Ga0501076_0215484 3300049592 Bacteria 1570
1408 Ga0501076_0527835 3300049592 Bacteria 973
1409 Ga0501077_0051623 3300049593 Bacteria 2613
1410 Ga0501077_0235239 3300049593 Bacteria 1164
1411 Ga0501079_0136730 3300049741 Bacteria 1908
1412 Ga0501079_0185104 3300049741 Bacteria 1626
1413 Ga0501079_0224161 3300049741 Bacteria 1469
1414 Ga0501079_0615253 3300049741 Bacteria 855
1415 Ga0501080_0024499 3300049742 Bacteria 5593
1416 Ga0501080_0058737 3300049742 Bacteria 3580
1417 Ga0501080_0244216 3300049742 Bacteria 1638
1418 Ga0501080_0836015 3300049742 Bacteria 806
1419 Ga0501081_0019804 3300049743 Bacteria 4483
1420 Ga0501081_0218557 3300049743 Bacteria 1385
1421 Ga0501083_0186510 3300049744 Bacteria 1354
1422 Ga0501083_0251072 3300049744 Bacteria 1151
1423 Ga0501083_0449813 3300049744 Bacteria 838
1424 Ga0501035_0030762 3300049822 Bacteria 4893
1425 Ga0501035_0072293 3300049822 Bacteria 3053
1426 Ga0501035_0109445 3300049822 Bacteria 2422
1427 Ga0501035_0114638 3300049822 Bacteria 2360
1428 Ga0501035_0299793 3300049822 Bacteria 1354
1429 Ga0501035_0324078 3300049822 Bacteria 1294
1430 Ga0501044_0028950 3300049823 Bacteria 5843
1431 Ga0501044_0072558 3300049823 Bacteria 3499
1432 Ga0501044_0203977 3300049823 Bacteria 1935
1433 Ga0501044_0226346 3300049823 Bacteria 1819
1434 Ga0501045_0128592 3300049824 Bacteria 1883
1435 Ga0501045_0183171 3300049824 Bacteria 1561
1436 nmdc:mga03683_103889_c1 3300050489 Bacteria 1251
1437 nmdc:mga03683_115443_c1 3300050489 Bacteria 1190
1438 nmdc:mga03683_218358_c1 3300050489 Bacteria 879
1439 nmdc:mga03n38_21992_c1 3300050490 Bacteria 2574
1440 nmdc:mga00v17_37939_c1 3300050491 Bacteria 2879
1441 nmdc:mga00v17_50495_c1 3300050491 Bacteria 2528
1442 nmdc:mga00v17_87957_c1 3300050491 Bacteria 1947
1443 nmdc:mga0yw44_13887_c1 3300050492 Bacteria 4257
1444 nmdc:mga0yw44_21791_c1 3300050492 Bacteria 3582
1445 nmdc:mga0yw44_26127_c1 3300050492 Bacteria 3331
1446 nmdc:mga0yw44_26235_c1 3300050492 Bacteria 3326
1447 nmdc:mga0k408_332832_c1 3300050493 Bacteria 906
1448 nmdc:mga0k408_33623_c1 3300050493 Bacteria 2933
1449 nmdc:mga0k408_65306_c1 3300050493 Bacteria 2118
1450 nmdc:mga06z11_162684_c1 3300050494 Bacteria 1277
1451 nmdc:mga06z11_197446_c1 3300050494 Bacteria 1167
1452 nmdc:mga06z11_273540_c1 3300050494 Bacteria 999
1453 nmdc:mga06z11_28241_c1 3300050494 Bacteria 2690
1454 nmdc:mga06z11_3236_c1 3300050494 Bacteria 6293
1455 nmdc:mga06z11_9556_c1 3300050494 Bacteria 4092
1456 nmdc:mga04h51_3168_c1 3300050495 Bacteria 3970
1457 nmdc:mga04h51_59634_c1 3300050495 Bacteria 1304
1458 nmdc:mga04h51_83023_c1 3300050495 Bacteria 1141
1459 nmdc:mga04h51_8529_c1 3300050495 Bacteria 2745
1460 nmdc:mga07m45_35650_c1 3300050496 Bacteria 2768
1461 nmdc:mga07m45_59262_c1 3300050496 Bacteria 1229
1462 nmdc:mga05p37_297809_c1 3300050507 Bacteria 1918
1463 nmdc:mga05p37_344158_c1 3300050507 Bacteria 1757
1464 nmdc:mga05p37_5632_c1 3300050507 Bacteria 14723
1465 nmdc:mga05p37_5665_c1 3300050507 Bacteria 14689
1466 nmdc:mga05p37_61997_c1 3300050507 Bacteria 4602
1467 nmdc:mga05p37_685734_c1 3300050507 Bacteria 1141
1468 nmdc:mga05p37_7070_c1 3300050507 Bacteria 13230
1469 nmdc:mga05p37_96432_c1 3300050507 Bacteria 3644
1470 nmdc:mga09592_1148_c1 3300050508 Bacteria 21118
1471 nmdc:mga09592_19266_c1 3300050508 Bacteria 5603
1472 nmdc:mga09592_199977_c1 3300050508 Bacteria 1730
1473 nmdc:mga09592_5879_c1 3300050508 Bacteria 10013
1474 nmdc:mga0qj67_124296_c1 3300050509 Bacteria 2088
1475 nmdc:mga0qj67_161801_c1 3300050509 Bacteria 1817
1476 nmdc:mga0qj67_36752_c1 3300050509 Bacteria 3834
1477 nmdc:mga0qj67_48972_c1 3300050509 Bacteria 3340
1478 nmdc:mga06r32_10189_c1 3300050510 Bacteria 8485
1479 nmdc:mga06r32_10472_c1 3300050510 Bacteria 8363
1480 nmdc:mga06r32_105411_c1 3300050510 Bacteria 2769
1481 nmdc:mga06r32_167234_c1 3300050510 Bacteria 2182
1482 nmdc:mga06r32_275684_c1 3300050510 Bacteria 1669
1483 nmdc:mga06r32_4222_c1 3300050510 Bacteria 12874
1484 nmdc:mga06r32_452809_c1 3300050510 Bacteria 1263
1485 nmdc:mga06r32_88292_c1 3300050510 Bacteria 3026
1486 nmdc:mga08y16_116995_c1 3300050511 Bacteria 2775
1487 nmdc:mga08y16_185355_c1 3300050511 Bacteria 2160
1488 nmdc:mga08y16_2503_c1 3300050511 Bacteria 18895
1489 nmdc:mga08y16_42495_c1 3300050511 Bacteria 4760
1490 nmdc:mga08y16_4316_c1 3300050511 Bacteria 14850
1491 nmdc:mga08y16_433528_c1 3300050511 Bacteria 1342
1492 nmdc:mga08y16_51194_c1 3300050511 Bacteria 4320
1493 nmdc:mga08y16_548540_c1 3300050511 Bacteria 1170
1494 nmdc:mga08y16_56282_c1 3300050511 Bacteria 4111
1495 nmdc:mga08y16_5824_c1 3300050511 Bacteria 12915
1496 nmdc:mga08y16_738_c1 3300050511 Bacteria 31085
1497 nmdc:mga0n895_141479_c1 3300050512 Bacteria 2435
1498 nmdc:mga0n895_30978_c1 3300050512 Bacteria 5117
1499 nmdc:mga0n895_312707_c1 3300050512 Bacteria 1592
1500 nmdc:mga0n895_32029_c1 3300050512 Bacteria 5041
1501 nmdc:mga0n895_403530_c1 3300050512 Bacteria 1382
1502 nmdc:mga0n895_450314_c1 3300050512 Bacteria 1300
1503 nmdc:mga0n895_562_c1 3300050512 Bacteria 25458
1504 nmdc:mga0n895_563811_c1 3300050512 Bacteria 1144
1505 nmdc:mga0n895_7736_c1 3300050512 Bacteria 9251
1506 nmdc:mga0n895_776751_c1 3300050512 Bacteria 950
1507 nmdc:mga0n895_842_c1 3300050512 Bacteria 22003
1508 nmdc:mga0n895_86453_c1 3300050512 Bacteria 3132
1509 nmdc:mga0rr50_19224_c1 3300050513 Bacteria 4605
1510 nmdc:mga0rr50_231452_c1 3300050513 Bacteria 1529
1511 nmdc:mga0rr50_300730_c1 3300050513 Bacteria 1342
1512 nmdc:mga0rr50_40314_c1 3300050513 Bacteria 3394
1513 nmdc:mga0rr50_482837_c1 3300050513 Bacteria 1052
1514 nmdc:mga0rr50_62434_c1 3300050513 Bacteria 2811
1515 nmdc:mga08x19_127569_c1 3300050514 Bacteria 1709
1516 nmdc:mga08x19_1998_c1 3300050514 Bacteria 12485
1517 nmdc:mga08x19_44407_c1 3300050514 Bacteria 2837
1518 nmdc:mga08x19_444205_c1 3300050514 Bacteria 912
1519 nmdc:mga0a205_1040_c1 3300050515 Bacteria 23115
1520 nmdc:mga0a205_120013_c1 3300050515 Bacteria 2528
1521 nmdc:mga0a205_253120_c1 3300050515 Bacteria 1640
1522 nmdc:mga0a205_4522_c1 3300050515 Bacteria 12484
1523 nmdc:mga0a205_6591_c1 3300050515 Bacteria 10502
1524 nmdc:mga0sz30_15012_c2 3300050516 Bacteria 2161
1525 Ga0495601_0000007 3300053077 Bacteria 365972
1526 Ga0495601_0005686 3300053077 Bacteria 7266
1527 Ga0495601_0010735 3300053077 Bacteria 5465
1528 Ga0495601_0022399 3300053077 Bacteria 3877
1529 Ga0495601_0048962 3300053077 Bacteria 2663
1530 Ga0495601_0075987 3300053077 Bacteria 2151
1531 Ga0495601_0193211 3300053077 Bacteria 1330
1532 Ga0495612_0000108 3300053078 Bacteria 34924
1533 Ga0495612_0002028 3300053078 Bacteria 8347
1534 Ga0495612_0003773 3300053078 Bacteria 6303
1535 Ga0495612_0056154 3300053078 Bacteria 1624
1536 Ga0495612_0145782 3300053078 Bacteria 1028
1537 Ga0495612_0246103 3300053078 Bacteria 795
1538 Ga0495655_0068436 3300053083 Bacteria 987
1539 Ga0495595_0000767 3300053084 Bacteria 12201
1540 Ga0495595_0002857 3300053084 Bacteria 6806
1541 Ga0495595_0005668 3300053084 Bacteria 5053
1542 Ga0495595_0010908 3300053084 Bacteria 3790
1543 Ga0495595_0035705 3300053084 Bacteria 2252
1544 Ga0495595_0038499 3300053084 Bacteria 2178
1545 Ga0495595_0094208 3300053084 Bacteria 1439
1546 Ga0495595_0134525 3300053084 Bacteria 1210
1547 Ga0495595_0153234 3300053084 Bacteria 1135
1548 Ga0495619_0000023 3300053085 Bacteria 182266
1549 Ga0495619_0000271 3300053085 Bacteria 37662
1550 Ga0495619_0001755 3300053085 Bacteria 14416
1551 Ga0495619_0002683 3300053085 Bacteria 11647
1552 Ga0495619_0014923 3300053085 Bacteria 4906
1553 Ga0495619_0042753 3300053085 Bacteria 2968
1554 Ga0495619_0062377 3300053085 Bacteria 2481
1555 Ga0495619_0091763 3300053085 Bacteria 2056
1556 Ga0495619_0281220 3300053085 Bacteria 1153
1557 Ga0495619_0296913 3300053085 Bacteria 1119
1558 Ga0500595_011034 3300053119 Bacteria 3559
1559 Ga0500652_129479 3300053131 Bacteria 1053
1560 Ga0500655_024812 3300053133 Bacteria 1136
1561 Ga0500658_0057936 3300053134 Bacteria 1603
1562 Ga0500658_0070827 3300053134 Bacteria 1471
1563 Ga0500568_0078430 3300053139 Bacteria 1256
1564 Ga0500603_075444 3300053150 Bacteria 968
1565 Ga0501084_0015408 3300054114 Bacteria 6338
1566 Ga0501084_0344307 3300054114 Bacteria 1259
1567 Ga0501084_0718430 3300054114 Bacteria 842
1568 Ga0501082_0000046 3300060353 Bacteria 86307
1569 Ga0501082_0056939 3300060353 Bacteria 3368
1570 Ga0501082_0083985 3300060353 Bacteria 2747
1571 Ga0501082_0102503 3300060353 Bacteria 2476
1572 Ga0501082_0107237 3300060353 Bacteria 2417
1573 Ga0501082_0199025 3300060353 Bacteria 1743
1574 Ga0501082_0239246 3300060353 Bacteria 1580
1575 Ga0501082_0314088 3300060353 Bacteria 1365
1576 Ga0501082_0809073 3300060353 Bacteria 820
1577 Ga0530510_0030059 3300061734 Bacteria 3901
1578 Ga0530510_0101477 3300061734 Bacteria 2104
1579 2643756546 2643221547 Bacteria 4740017
1580 Ga0207648_10180291
1581 ARcpr5oldR_c000028
1582 ARSoilYngRDRAFT_c00217
1583 ARcpr5yngRDRAFT_c000173
1584 ARSoilOldRDRAFT_c000023
1585 ARCol0yngRDRAFT_1000191
1586 JGI24741J21665_1025379
1587 JGI24752J21851_1010192
1588 JGI24746J21847_1005138
1589 JGI24740J21852_10018609
1590 JGI24739J22299_10000148
1591 JGI24737J22298_10001402
1592 JGI24737J22298_10017355
1593 JGI24743J22301_10001462
1594 JGI24750J21931_1000011
1595 JGI24750J21931_1003616
1596 JGI24745J21846_1005158
1597 JGI24748J21848_1000485
1598 JGI24738J21930_10000236
1599 JGI24749J21850_1001952
1600 JGI24749J21850_1004668
1601 JGI24744J21845_10000887
1602 JGI24035J26624_1000114
1603 JGI24033J26618_1003148
1604 JGI24033J26618_1003288
1605 JGI24034J26672_10005870
1606 JGI24742J22300_10000252
1607 JGI24751J29686_10005836
1608 JGI24751J29686_10026980
1609 JGI25406J46586_10032185
1610 JGI25153J46596_10004476
1611 JGI25405J52794_10006291
1612 Ga0065716_1001752
1613 Ga0065704_10105216
1614 Ga0065712_10002440
1615 Ga0065712_10096365
1616 Ga0065712_10118955
1617 Ga0065715_10001564
1618 Ga0065715_10033620
1619 Ga0065715_10088960
1620 Ga0070658_10014302
1621 Ga0070676_10000536
1622 Ga0070676_10041342
1623 Ga0070676_10142973
1624 Ga0070683_100000144
1625 Ga0070683_100055001
1626 Ga0070683_100425296
1627 Ga0070690_100001428
1628 Ga0070690_100002001
1629 Ga0070690_100112831
1630 Ga0070670_100000437
1631 Ga0070670_100010574
1632 Ga0070670_100093113
1633 Ga0070670_100231452
1634 Ga0070677_10000166
1635 Ga0070677_10099117
1636 Ga0068869_100000035
1637 Ga0068869_100144496
1638 Ga0070666_10060622
1639 Ga0070680_100003662
1640 Ga0070680_100056551
1641 Ga0070680_100145684
1642 Ga0070680_100276749
1643 Ga0070682_100002219
1644 Ga0070682_100107123
1645 Ga0068868_100001888
1646 Ga0070660_100000944
1647 Ga0070660_100080326
1648 Ga0070660_100139586
1649 Ga0070689_100000207
1650 Ga0070689_100008854
1651 Ga0070689_100019990
1652 Ga0070689_100021249
1653 Ga0070691_10001234
1654 Ga0070691_10048613
1655 Ga0070691_10071638
1656 Ga0070687_100000261
1657 Ga0070687_100086044
1658 Ga0070661_100000017
1659 Ga0070661_100149659
1660 Ga0070661_100333634
1661 Ga0070692_10001418
1662 Ga0070692_10005458
1663 Ga0070692_10040522
1664 Ga0070692_10168066
1665 Ga0070668_100140244
1666 Ga0070668_100308586
1667 Ga0070668_100324609
1668 Ga0070668_100328096
1669 Ga0070668_100541598
1670 Ga0070669_100000250
1671 Ga0070669_100215645
1672 Ga0070675_100000246
1673 Ga0070675_100078753
1674 Ga0070671_100007422
1675 Ga0070671_100028654
1676 Ga0070671_100073891
1677 Ga0070674_100000355
1678 Ga0070674_100018670
1679 Ga0070674_100142815
1680 Ga0070674_100408846
1681 Ga0070673_100000032
1682 Ga0070673_100042414
1683 Ga0070673_100193540
1684 Ga0070688_100000594
1685 Ga0070688_100013506
1686 Ga0070688_100025273
1687 Ga0070688_100186076
1688 Ga0070659_100000214
1689 Ga0070659_100035022
1690 Ga0070667_100000816
1691 Ga0070667_100034043
1692 Ga0070667_100051439
1693 Ga0070667_100605221
1694 Ga0070667_100625868
1695 Ga0070703_10001365
1696 Ga0070703_10001548
1697 Ga0070709_10004360
1698 Ga0070709_10016295
1699 Ga0070714_100012941
1700 Ga0070714_100481217
1701 Ga0070713_100005123
1702 Ga0070713_100013950
1703 Ga0070710_10315891
1704 Ga0070701_10000230
1705 Ga0070701_10002700
1706 Ga0070701_10020139
1707 Ga0070711_100008381
1708 Ga0070711_100017527
1709 Ga0070711_100251801
1710 Ga0070711_100458681
1711 Ga0070705_100000171
1712 Ga0070705_100003882
1713 Ga0070705_100123695
1714 Ga0070700_100000234
1715 Ga0070700_100000482
1716 Ga0070694_100000247
1717 Ga0070694_100003250
1718 Ga0070694_100104770
1719 Ga0070708_100050386
1720 Ga0070663_100026358
1721 Ga0070663_100036809
1722 Ga0070663_100378405
1723 Ga0070678_100070825
1724 Ga0070678_100147105
1725 Ga0070662_100003327
1726 Ga0070662_100046522
1727 Ga0070662_100054983
1728 Ga0070681_10000401
1729 Ga0070681_10094966
1730 Ga0070681_10097689
1731 Ga0070681_10101800
1732 Ga0070681_10126076
1733 Ga0070681_10166646
1734 Ga0070681_10202951
1735 Ga0070681_10203174
1736 Ga0070681_10296633
1737 Ga0070681_10552211
1738 Ga0068867_100000190
1739 Ga0068867_100069262
1740 Ga0068867_100216309
1741 Ga0070685_10002568
1742 Ga0070685_10006005
1743 Ga0070685_10069160
1744 Ga0070706_100114608
1745 Ga0070706_100211233
1746 Ga0070706_100254037
1747 Ga0070707_100531971
1748 Ga0070698_100174486
1749 Ga0070699_100000167
1750 Ga0070679_100000847
1751 Ga0070679_100123282
1752 Ga0070679_100144745
1753 Ga0070679_100179661
1754 Ga0070679_100192310
1755 Ga0070679_100324673
1756 Ga0070684_100000904
1757 Ga0070684_100025874
1758 Ga0070684_100217716
1759 Ga0070684_100273447
1760 Ga0070684_100282134
1761 Ga0070684_100366281
1762 Ga0070697_100049238
1763 Ga0068853_100006394
1764 Ga0068853_100050590
1765 Ga0068853_100544688
1766 Ga0070672_100000529
1767 Ga0070672_100074762
1768 Ga0070672_100207043
1769 Ga0070672_100213601
1770 Ga0070672_100301252
1771 Ga0070686_100000269
1772 Ga0070686_100003617
1773 Ga0070686_100009747
1774 Ga0070686_100013607
1775 Ga0070695_100000406
1776 Ga0070695_100003493
1777 Ga0070696_100000304
1778 Ga0070696_100002999
1779 Ga0070696_100100859
1780 Ga0070693_100002112
1781 Ga0070693_100009505
1782 Ga0070693_100042910
1783 Ga0070665_100063574
1784 Ga0070665_100073842
1785 Ga0070665_100972688
1786 Ga0070704_100000385
1787 Ga0070704_100000566
1788 Ga0070704_100060045
1789 Ga0070704_100312875
1790 Ga0068855_100006856
1791 Ga0068855_100081134
1792 Ga0068855_100116563
1793 Ga0068855_100144287
1794 Ga0068855_100465648
1795 Ga0070664_100000912
1796 Ga0070664_100333920
1797 Ga0068857_100000494
1798 Ga0068857_100011609
1799 Ga0068857_100244976
1800 Ga0068857_100363680
1801 Ga0068854_100000139
1802 Ga0068854_100159715
1803 Ga0068854_100292604
1804 Ga0068856_100005193
1805 Ga0068856_100167879
1806 Ga0068856_100179850
1807 Ga0068856_100194234
1808 Ga0068856_100874197
1809 Ga0070702_100054674
1810 Ga0070702_100245102
1811 Ga0068852_100000193
1812 Ga0068852_100098275
1813 Ga0068852_100353508
1814 Ga0068852_100438174
1815 Ga0068859_100002972
1816 Ga0068859_100021099
1817 Ga0068859_100478637
1818 Ga0068859_100494335
1819 Ga0068864_100000226
1820 Ga0068864_100005554
1821 Ga0068864_100091561
1822 Ga0068864_100209466
1823 Ga0068866_10000199
1824 Ga0068866_10056158
1825 Ga0068866_10242311
1826 Ga0068861_100000847
1827 Ga0068851_10110326
1828 Ga0068870_10004231
1829 Ga0068863_100001877
1830 Ga0068863_100044870
1831 Ga0068858_100000512
1832 Ga0068858_100044217
1833 Ga0068858_100182497
1834 Ga0068858_100502778
1835 Ga0068860_100001525
1836 Ga0068860_100001592
1837 Ga0068860_100057915
1838 Ga0068860_100061019
1839 Ga0068862_100000557
1840 Ga0068862_100031172
1841 Ga0068862_100034921
1842 Ga0068862_100335652
1843 Ga0081455_10000035
1844 Ga0081455_10001717
1845 Ga0081455_10003750
1846 Ga0081455_10039883
1847 Ga0081455_10223349
1848 Ga0081538_10001738
1849 Ga0081538_10060587
1850 Ga0081538_10068489
1851 Ga0081540_1007073
1852 Ga0081540_1064606
1853 Ga0081539_10002061
1854 Ga0070717_10028561
1855 Ga0070717_10086152
1856 Ga0070717_10123132
1857 Ga0070717_10246288
1858 Ga0070717_10858928
1859 Ga0075365_10004829
1860 Ga0075365_10006356
1861 Ga0075365_10041906
1862 Ga0075365_10108460
1863 Ga0075368_10002630
1864 Ga0075368_10011483
1865 Ga0075368_10040731
1866 Ga0075368_10164585
1867 Ga0075363_100103326
1868 Ga0075364_10004638
1869 Ga0075364_10008067
1870 Ga0075364_10246607
1871 Ga0075432_10019290
1872 Ga0070715_10098939
1873 Ga0070715_10141852
1874 Ga0070715_10171288
1875 Ga0070716_100018071
1876 Ga0070712_100012496
1877 Ga0070712_100130680
1878 Ga0070712_100635127
1879 Ga0075362_10002664
1880 Ga0075362_10080901
1881 Ga0075362_10095146
1882 Ga0075362_10110073
1883 Ga0075367_10008394
1884 Ga0075367_10013463
1885 Ga0075367_10041545
1886 Ga0075367_10079735
1887 Ga0075367_10156175
1888 Ga0075369_10154964
1889 Ga0075427_10003198
1890 Ga0075366_10030395
1891 Ga0097621_100000049
1892 Ga0097621_100076779
1893 Ga0075370_10009592
1894 Ga0075370_10076344
1895 Ga0075370_10383678
1896 Ga0068871_100000097
1897 Ga0068871_100015992
1898 Ga0068871_100032808
1899 Ga0068871_100161020
1900 Ga0068871_100227143
1901 Ga0075428_100011811
1902 Ga0075428_100026110
1903 Ga0075428_100045882
1904 Ga0075428_100075012
1905 Ga0075428_100076282
1906 Ga0075428_100084938
1907 Ga0075428_100293444
1908 Ga0075428_100369767
1909 Ga0075430_100004110
1910 Ga0075430_100263355
1911 Ga0075431_100003772
1912 Ga0075431_100015906
1913 Ga0075431_100037458
1914 Ga0075431_100076180
1915 Ga0075431_100087511
1916 Ga0075431_100153596
1917 Ga0075431_100172811
1918 Ga0075431_100282725
1919 Ga0075431_100457082
1920 Ga0075431_100718708
1921 Ga0075433_10002397
1922 Ga0075433_10008081
1923 Ga0075434_100000383
1924 Ga0075434_100001135
1925 Ga0075434_100009398
1926 Ga0075434_100060410
1927 Ga0075434_100278916
1928 Ga0075434_100334846
1929 Ga0075434_100456457
1930 Ga0075434_100457489
1931 Ga0075434_100523044
1932 Ga0075434_100595436
1933 Ga0075429_100001354
1934 Ga0075429_100016192
1935 Ga0075429_100143178
1936 Ga0075429_100234603
1937 Ga0075429_100269619
1938 Ga0068865_100000119
1939 Ga0068865_100033862
1940 Ga0068865_100059392
1941 Ga0068865_100068549
1942 Ga0075436_100032452
1943 Ga0075436_100065255
1944 Ga0097620_100002972
1945 Ga0097620_100021099
1946 Ga0097620_100478646
1947 Ga0097620_100494280
1948 Ga0075435_100004250
1949 Ga0075435_100022627
1950 Ga0075435_100030953
1951 Ga0075435_100114600
1952 Ga0075435_100262671
1953 Ga0099794_10072350
1954 Ga0105251_10047287
1955 Ga0105244_10110443
1956 Ga0105240_10009789
1957 Ga0105240_10056188
1958 Ga0105240_10241483
1959 Ga0111539_10000237
1960 Ga0111539_10001512
1961 Ga0111539_10007189
1962 Ga0111539_10010350
1963 Ga0111539_10022663
1964 Ga0111539_10059007
1965 Ga0111539_10097324
1966 Ga0111539_10236892
1967 Ga0105245_10000202
1968 Ga0105245_10109349
1969 Ga0105245_10178381
1970 Ga0105245_10243774
1971 Ga0105247_10003839
1972 Ga0105247_10010478
1973 Ga0105247_10018903
1974 Ga0105247_10026789
1975 Ga0114129_10007020
1976 Ga0114129_10008425
1977 Ga0114129_10011185
1978 Ga0114129_10033296
1979 Ga0114129_10105568
1980 Ga0114129_10797829
1981 Ga0114129_10858957
1982 Ga0105243_10011526
1983 Ga0105243_10042474
1984 Ga0105243_10296026
1985 Ga0105243_10849673
1986 Ga0105241_10000430
1987 Ga0105241_10175455
1988 Ga0105241_10500497
1989 Ga0105241_10886951
1990 Ga0105242_10002131
1991 Ga0105242_10051392
1992 Ga0105242_10071991
1993 Ga0105242_10086045
1994 Ga0105242_10187186
1995 Ga0105248_10001335
1996 Ga0105248_10036278
1997 Ga0105248_10230078
1998 Ga0105237_10008523
1999 Ga0105237_10083778
2000 Ga0105237_10258915
2001 Ga0105238_10008420
2002 Ga0105238_10171448
2003 Ga0105238_10359719
2004 Ga0105249_10000215
2005 Ga0105249_10004272
2006 Ga0105249_10009891
2007 Ga0105249_10239953
2008 Ga0105249_10495012
2009 Ga0105249_10538886
2010 Ga0105249_10650255
2011 Ga0105249_10911171
2012 Ga0099796_10023513
2013 Ga0105239_10012264
2014 Ga0105239_10085291
2015 Ga0105239_10175361
2016 Ga0105246_10000019
2017 Ga0105246_10017617
2018 Ga0105246_10055648
2019 Ga0105246_10072338
2020 Ga0105246_10119563
2021 Ga0105246_10512762
2022 Ga0105246_10612699
2023 Ga0157345_1002449
2024 Ga0157373_10449838
2025 Ga0157371_10018237
2026 Ga0157371_10053792
2027 Ga0157370_10016547
2028 Ga0157370_10205810
2029 Ga0157370_10572688
2030 Ga0157369_10557568
2031 Ga0157374_10013571
2032 Ga0157374_10092708
2033 Ga0157374_10246546
2034 Ga0157374_10855088
2035 Ga0157378_10168915
2036 Ga0157378_10673985
2037 Ga0163162_10001187
2038 Ga0163162_10091452
2039 Ga0163162_10118403
2040 Ga0163162_10194139
2041 Ga0163162_10566275
2042 Ga0157372_10104810
2043 Ga0157372_10130301
2044 Ga0157372_10972062
2045 Ga0157375_10000135
2046 Ga0157375_10112760
2047 Ga0157375_10149043
2048 Ga0157375_10235765
2049 Ga0157375_10272416
2050 Ga0163163_10001813
2051 Ga0163163_10037509
2052 Ga0163163_10081539
2053 Ga0163163_10133163
2054 Ga0163163_10259552
2055 Ga0157380_10000284
2056 Ga0157380_10009510
2057 Ga0157380_10045169
2058 Ga0157380_10339269
2059 Ga0182008_10023306
2060 Ga0157377_10000076
2061 Ga0157377_10009804
2062 Ga0157379_10000065
2063 Ga0157379_10028167
2064 Ga0157379_10053984
2065 Ga0157379_10143288
2066 Ga0157379_10268760
2067 Ga0157379_10491284
2068 Ga0157376_10000180
2069 Ga0157376_10169568
2070 Ga0163161_10000421
2071 Ga0163161_10057300
2072 Ga0163161_10122388
2073 Ga0163161_10245987
2074 Ga0206353_10191222
2075 Ga0213876_10027568
2076 Ga0213876_10077420
2077 Ga0213875_10000007
2078 Ga0207666_1000354
2079 Ga0207666_1000418
2080 Ga0207673_1000514
2081 Ga0209758_1006420
2082 Ga0207697_10000370
2083 Ga0207697_10006177
2084 Ga0207653_10000520
2085 Ga0207682_10000304
2086 Ga0207682_10001407
2087 Ga0207692_10011547
2088 Ga0207692_10028953
2089 Ga0207692_10061264
2090 Ga0207642_10000516
2091 Ga0207642_10046913
2092 Ga0207642_10118703
2093 Ga0207710_10037210
2094 Ga0207688_10000014
2095 Ga0207688_10039446
2096 Ga0207688_10174572
2097 Ga0207680_10070512
2098 Ga0207647_10020223
2099 Ga0207647_10129062
2100 Ga0207685_10005940
2101 Ga0207699_10016141
2102 Ga0207699_10019327
2103 Ga0207699_10058845
2104 Ga0207699_10090308
2105 Ga0207699_10119296
2106 Ga0207645_10000160
2107 Ga0207645_10015986
2108 Ga0207645_10033351
2109 Ga0207645_10039871
2110 Ga0207645_10056603
2111 Ga0207643_10000009
2112 Ga0207643_10013114
2113 Ga0207643_10043613
2114 Ga0207705_10071868
2115 Ga0207705_10141416
2116 Ga0207684_10182839
2117 Ga0207654_10000441
2118 Ga0207654_10089393
2119 Ga0207707_10000554
2120 Ga0207707_10062090
2121 Ga0207707_10079079
2122 Ga0207707_10092039
2123 Ga0207707_10206367
2124 Ga0207695_10074067
2125 Ga0207671_10019030
2126 Ga0207671_10229462
2127 Ga0207671_10242468
2128 Ga0207693_10005726
2129 Ga0207693_10067856
2130 Ga0207693_10073182
2131 Ga0207693_10077596
2132 Ga0207693_10124294
2133 Ga0207693_10279397
2134 Ga0207663_10006452
2135 Ga0207663_10013217
2136 Ga0207663_10171491
2137 Ga0207663_10244686
2138 Ga0207663_10284356
2139 Ga0207660_10000161
2140 Ga0207660_10006228
2141 Ga0207660_10054812
2142 Ga0207660_10094455
2143 Ga0207660_10138442
2144 Ga0207662_10001074
2145 Ga0207662_10011994
2146 Ga0207662_10013455
2147 Ga0207662_10049759
2148 Ga0207662_10082683
2149 Ga0207657_10000294
2150 Ga0207657_10017327
2151 Ga0207657_10019363
2152 Ga0207657_10044754
2153 Ga0207657_10065546
2154 Ga0207657_10071664
2155 Ga0207649_10000429
2156 Ga0207649_10050379
2157 Ga0207652_10044984
2158 Ga0207652_10045984
2159 Ga0207652_10129523
2160 Ga0207652_10207576
2161 Ga0207652_10422727
2162 Ga0207652_10502035
2163 Ga0207646_10655492
2164 Ga0207681_10000035
2165 Ga0207681_10043294
2166 Ga0207681_10094415
2167 Ga0207681_10147070
2168 Ga0207681_10184442
2169 Ga0207694_10006222
2170 Ga0207694_10292956
2171 Ga0207694_10409336
2172 Ga0207650_10009941
2173 Ga0207650_10063852
2174 Ga0207650_10088741
2175 Ga0207659_10000027
2176 Ga0207659_10012080
2177 Ga0207659_10075169
2178 Ga0207659_10153856
2179 Ga0207659_10407600
2180 Ga0207687_10000551
2181 Ga0207687_10008252
2182 Ga0207687_10375268
2183 Ga0207687_10438217
2184 Ga0207687_10589573
2185 Ga0207700_10016032
2186 Ga0207700_10020626
2187 Ga0207664_10024052
2188 Ga0207664_10068193
2189 Ga0207664_10210958
2190 Ga0207664_10218888
2191 Ga0207664_10770232
2192 Ga0207644_10003065
2193 Ga0207644_10024126
2194 Ga0207644_10024425
2195 Ga0207644_10053710
2196 Ga0207690_10000056
2197 Ga0207690_10065219
2198 Ga0207690_10067561
2199 Ga0207690_10728654
2200 Ga0207706_10000307
2201 Ga0207706_10019938
2202 Ga0207706_10020976
2203 Ga0207706_10058718
2204 Ga0207706_10158375
2205 Ga0207706_10299417
2206 Ga0207686_10001582
2207 Ga0207686_10020326
2208 Ga0207686_10057612
2209 Ga0207686_10171744
2210 Ga0207686_10212601
2211 Ga0207686_10355561
2212 Ga0207709_10000087
2213 Ga0207709_10009741
2214 Ga0207709_10100890
2215 Ga0207709_10199865
2216 Ga0207709_10485754
2217 Ga0207670_10000263
2218 Ga0207670_10006655
2219 Ga0207670_10008975
2220 Ga0207670_10083194
2221 Ga0207670_10280398
2222 Ga0207670_10381171
2223 Ga0207669_10000052
2224 Ga0207669_10036794
2225 Ga0207669_10076172
2226 Ga0207669_10167638
2227 Ga0207669_10571722
2228 Ga0207704_10000063
2229 Ga0207704_10008777
2230 Ga0207704_10044292
2231 Ga0207704_10071364
2232 Ga0207704_10221861
2233 Ga0207665_10017994
2234 Ga0207691_10000167
2235 Ga0207691_10121820
2236 Ga0207691_10144301
2237 Ga0207711_10017811
2238 Ga0207711_10025629
2239 Ga0207711_10538050
2240 Ga0207689_10000155
2241 Ga0207689_10330343
2242 Ga0207661_10000072
2243 Ga0207661_10089894
2244 Ga0207661_10299170
2245 Ga0207661_10444650
2246 Ga0207679_10000057
2247 Ga0207679_10017981
2248 Ga0207679_10119066
2249 Ga0207679_10228952
2250 Ga0207679_10259106
2251 Ga0207667_10010749
2252 Ga0207667_10027211
2253 Ga0207667_10199854
2254 Ga0207667_10235146
2255 Ga0207667_10289964
2256 Ga0207667_10652522
2257 Ga0207651_10000087
2258 Ga0207651_10118903
2259 Ga0207651_10420012
2260 Ga0207651_10476253
2261 Ga0207712_10000122
2262 Ga0207712_10009565
2263 Ga0207712_10010640
2264 Ga0207712_10227563
2265 Ga0207668_10000084
2266 Ga0207668_10013912
2267 Ga0207668_10026818
2268 Ga0207668_10187872
2269 Ga0207668_10223093
2270 Ga0207640_10001027
2271 Ga0207640_10076067
2272 Ga0207640_10117964
2273 Ga0207658_10003107
2274 Ga0207658_10140058
2275 Ga0207658_10188724
2276 Ga0207677_10012206
2277 Ga0207703_10001870
2278 Ga0207703_10003716
2279 Ga0207703_10022833
2280 Ga0207703_10324813
2281 Ga0207639_10001925
2282 Ga0207639_10690883
2283 Ga0207678_10000187
2284 Ga0207678_10027928
2285 Ga0207678_10037590
2286 Ga0207678_10055576
2287 Ga0207678_10066744
2288 Ga0207708_10000158
2289 Ga0207708_10000296
2290 Ga0207708_10002015
2291 Ga0207708_10002641
2292 Ga0207708_10058689
2293 Ga0207708_10629646
2294 Ga0207702_10001960
2295 Ga0207702_10063916
2296 Ga0207702_10172352
2297 Ga0207702_10248625
2298 Ga0207702_10340705
2299 Ga0207702_10342006
2300 Ga0207702_10415663
2301 Ga0207641_10000896
2302 Ga0207641_10031874
2303 Ga0207648_10001167
2304 Ga0207648_10003124
2305 Ga0207648_10094370
2306 Ga0207648_10156264
2307 Ga0207676_10000089
2308 Ga0207676_10018700
2309 Ga0207676_10127658
2310 Ga0207674_10001478
2311 Ga0207674_10012981
2312 Ga0207674_10048193
2313 Ga0207674_10055121
2314 Ga0207674_10146357
2315 Ga0207674_10289726
2316 Ga0207675_100000229
2317 Ga0207675_100111466
2318 Ga0207675_100134223
2319 Ga0207683_10000525
2320 Ga0207683_10006495
2321 Ga0207683_10010816
2322 Ga0207683_10022729
2323 Ga0207683_10319679
2324 Ga0207698_10000474
2325 Ga0207698_10089517
2326 Ga0207698_10365216
2327 Ga0207698_10503186
2328 Ga0209982_1006987
2329 Ga0210002_1006040
2330 Ga0209971_1004003
2331 Ga0209971_1014968
2332 Ga0209998_10001800
2333 Ga0209998_10002157
2334 Ga0209813_10007333
2335 Ga0209813_10007971
2336 Ga0209813_10122766
2337 Ga0209974_10019819
2338 Ga0209974_10027444
2339 Ga0207428_10000037
2340 Ga0207428_10000308
2341 Ga0207428_10000474
2342 Ga0207428_10063820
2343 Ga0207428_10105304
2344 Ga0207428_10113451
2345 Ga0268266_10024123
2346 Ga0268266_10033960
2347 Ga0268266_10578734
2348 Ga0268265_10000195
2349 Ga0268265_10000508
2350 Ga0268265_10014611
2351 Ga0268265_10293639
2352 Ga0268264_10000526
2353 Ga0268264_10005989
2354 Ga0268264_10052107
2355 Ga0268264_10220840
2356 Ga0265337_1002502
2357 Ga0265318_10004336
2358 Ga0265338_10022782
2359 Ga0265330_10029811
2360 Ga0265330_10086147
2361 Ga0265332_10006780
2362 Ga0265332_10102177
2363 Ga0265320_10031514
2364 Ga0265325_10000126
2365 Ga0265325_10000352
2366 Ga0265325_10010060
2367 Ga0265325_10016900
2368 Ga0265329_10029030
2369 Ga0265329_10034663
2370 Ga0265340_10000192
2371 Ga0265340_10018794
2372 Ga0265340_10026222
2373 Ga0265340_10033433
2374 Ga0265340_10056591
2375 Ga0265340_10146659
2376 Ga0265339_10007994
2377 Ga0265339_10010090
2378 Ga0265339_10124935
2379 Ga0265339_10150565
2380 Ga0265316_10278928
2381 Ga0265313_10000106
2382 Ga0265313_10006310
2383 Ga0265313_10014074
2384 Ga0265313_10020932
2385 Ga0265313_10097307
2386 Ga0307508_10016695
2387 Ga0316575_10111479
2388 Ga0316579_10109015
2389 Ga0265314_10005573
2390 Ga0265314_10107268
2391 Ga0265342_10000100
2392 Ga0265342_10000882
2393 Ga0265342_10039481
2394 Ga0307413_10774705
2395 Ga0307416_100724120
2396 Ga0307416_100811174
2397 Ga0307411_10153015
2398 Ga0307415_100381532
2399 Ga0316583_10000161
2400 Ga0316583_10093777
2401 Ga0307510_10260030
2402 Ga0373930_0000020
2403 Ga0373930_0001897
2404 Ga0373948_0000775
2405 Ga0373948_0003627
2406 Ga0373950_0002092
2407 Ga0373950_0002937
2408 Ga0373958_0000679
2409 Ga0373958_0000892
2410 Ga0373959_0002322
2411 Ga0373959_0004634
2412 Ga0373938_0000321
2413 Ga0373938_0001943
2414 Ga0373926_0005663
2415 Ga0373926_0031996
2416 Ga0373926_0047484
2417 Ga0373926_0102616
2418 Ga0373928_0003285
2419 Ga0373928_0007867
2420 Ga0373929_0000042
2421 Ga0373934_0031395
2422 Ga0373934_0048369
2423 Ga0373940_0002473
2424 Ga0373940_0008037
2425 Ga0373940_0026599
2426 Ga0373944_0008477
2427 Ga0373944_0021423
2428 Ga0373944_0027193
2429 Ga0373944_0071706
2430 Ga0373949_0005028
2431 Ga0373949_0008824
2432 Ga0373949_0019983
2433 Ga0373951_0003336
2434 Ga0373951_0010103
2435 Ga0373952_0000102
2436 Ga0373952_0002076
2437 Ga0373952_0003332
2438 Ga0373923_0002700
2439 Ga0373923_0004197
2440 Ga0373923_0075405
2441 Ga0373932_0002320
2442 Ga0373932_0002582
2443 Ga0373936_0003041
2444 Ga0373936_0164967
2445 Ga0373939_0000261
2446 Ga0373939_0000299
2447 Ga0373939_0002349
2448 Ga0373939_0040056
2449 Ga0373939_0041631
2450 Ga0373941_0004117
2451 Ga0373941_0010894
2452 Ga0373941_0032409
2453 Ga0373945_0002982
2454 Ga0373953_0001408
2455 Ga0373953_0017950
2456 Ga0373953_0040072
2457 Ga0373954_0003125
2458 Ga0373954_0011821
2459 Ga0373954_0046561
2460 Ga0373954_0124163
2461 Ga0373956_0004874
2462 Ga0373956_0014969
2463 Ga0373956_0033597
2464 Ga0373956_0178018
2465 Ga0373957_0011372
2466 Ga0373957_0019808
2467 Ga0373957_0028596
2468 Ga0373957_0090234
2469 Ga0373960_0001113
2470 Ga0373960_0005022
2471 Ga0373960_0029703
2472 Ga0373960_0043313
2473 Ga0373960_0083640
2474 Ga0373943_0001959
2475 Ga0373943_0043498
2476 Ga0373943_0045730
2477 Ga0373943_0149170
2478 Ga0373946_0000552
2479 Ga0373946_0008023
2480 Ga0373946_0024168
2481 Ga0373955_0000513
2482 Ga0373955_0000862
2483 Ga0373955_0034680
2484 Ga0373942_0001283
2485 Ga0373942_0008995
2486 Ga0373942_0039604
2487 Ga0373961_0002305
2488 Ga0373961_0002581
2489 Ga0373961_0052384
2490 Ga0373962_0036853
2491 Ga0316574_0076088
2492 Ga0373924_0000240
2493 Ga0373924_0007693
2494 Ga0373924_0016808
2495 Ga0373931_0003801
2496 Ga0373931_0004468
2497 Ga0373931_0005387
2498 Ga0373931_0008666
2499 Ga0373935_0000088
2500 Ga0373935_0003255
2501 Ga0373935_0040467
2502 Ga0373935_0058215
2503 Ga0373927_0027363
2504 Ga0373927_0027573
2505 Ga0373927_0038709
2506 Ga0373927_0263465
2507 Ga0373933_0003120
2508 Ga0373933_0011012
2509 Ga0373933_0013709
2510 Ga0373933_0013911
2511 Ga0373933_0018113
2512 Ga0373933_0229796
2513 Ga0373933_0269808
2514 Ga0373933_0436289
2515 Ga0373947_0001466
2516 Ga0373947_0001608
2517 Ga0373947_0007595
2518 Ga0373947_0077321
2519 Ga0373947_0160029
2520 Ga0373947_0333368
2521 Ga0373937_0000124
2522 Ga0373937_0007923
2523 Ga0373937_0010800
2524 Ga0373937_0049008
2525 Ga0373937_0067527
2526 Ga0373937_0096758
2527 Ga0373937_0309262
2528 Ga0373937_0730241
2529 Ga0373925_0000929
2530 Ga0373925_0025220
2531 Ga0373925_0030267
2532 Ga0373925_0131102
2533 Ga0373925_0200772
2534 Ga0373925_0618602
2535 Ga0395899_0007959
2536 Ga0395899_0065556
2537 Ga0395900_0005074
2538 Ga0395900_0008149
2539 Ga0395898_0012968
2540 Ga0395898_0019972
2541 Ga0395898_0044004
2542 Ga0436364_0320537
2543 Ga0436364_0461857
2544 Ga0436364_0934985
2545 Ga0395901_0048458
2546 Ga0395901_0104341
2547 Ga0436365_0067390
2548 Ga0436365_0459020
2549 Ga0436365_1235938
2550 Ga0436361_0431504
2551 Ga0436363_0565062
2552 Ga0436363_0588048
2553 Ga0436362_1201994
2554 Ga0439453_0000484
2555 Ga0439453_0012281
2556 Ga0439441_024967
2557 Ga0439450_092512
2558 Ga0439455_0011472
2559 Ga0439463_043431
2560 Ga0439446_0096249
2561 Ga0451577_0130165
2562 Ga0439440_0004213
2563 Ga0466966_0119120
2564 Ga0466963_0319141
2565 Ga0466971_0123601
2566 Ga0451576_0052301
2567 Ga0466967_0051512
2568 Ga0466967_0294143
2569 Ga0495617_039107
2570 Ga0495617_060812
2571 Ga0495592_0000020
2572 Ga0495592_0009547
2573 Ga0495592_0012703
2574 Ga0495592_0221622
2575 Ga0495592_0503038
2576 Ga0495603_0025279
2577 Ga0495603_0034874
2578 Ga0495603_0106974
2579 Ga0495603_0132770
2580 Ga0495590_0050857
2581 Ga0495590_0103288
2582 Ga0495629_0000222
2583 Ga0495629_0005609
2584 Ga0495629_0073719
2585 Ga0495629_0108030
2586 Ga0495638_0012075
2587 Ga0495641_0016360
2588 Ga0495641_0031517
2589 Ga0495641_0041306
2590 Ga0495641_0052185
2591 Ga0495651_0001798
2592 Ga0495651_0019865
2593 Ga0495651_0035254
2594 Ga0495651_0051434
2595 Ga0495653_0000046
2596 Ga0495653_0007380
2597 Ga0495653_0007877
2598 Ga0495653_0052601
2599 Ga0495580_0014500
2600 Ga0495580_0122946
2601 Ga0495582_0006030
2602 Ga0495582_0006417
2603 Ga0495582_0010354
2604 Ga0495582_0068540
2605 Ga0495605_0037445
2606 Ga0495639_0003996
2607 Ga0495639_0217033
2608 Ga0495662_0001624
2609 Ga0495662_0052690
2610 Ga0495664_0000017
2611 Ga0495664_0011559
2612 Ga0495664_0096799
2613 Ga0495664_0210115
2614 Ga0495584_0027260
2615 Ga0495584_0104369
2616 Ga0495584_0123394
2617 Ga0495585_0001425
2618 Ga0495585_0190219
2619 Ga0495594_0017590
2620 Ga0495594_0066849
2621 Ga0495594_0210889
2622 Ga0495607_0260264
2623 Ga0495608_0000560
2624 Ga0495608_0041445
2625 Ga0495608_0054768
2626 Ga0495608_0088003
2627 Ga0495608_0122712
2628 Ga0495608_0354044
2629 Ga0495618_0000059
2630 Ga0495618_0037132
2631 Ga0495618_0107847
2632 Ga0495628_0000530
2633 Ga0495628_0014379
2634 Ga0495628_0017502
2635 Ga0495628_0033051
2636 Ga0495628_0121222
2637 Ga0495628_0148709
2638 Ga0495628_0337056
2639 Ga0495630_0003755
2640 Ga0495630_0086059
2641 Ga0495630_0249689
2642 Ga0495630_0712051
2643 Ga0495644_0000656
2644 Ga0495644_0012285
2645 Ga0495648_0227049
2646 Ga0495652_0001393
2647 Ga0495652_0023653
2648 Ga0495652_0081945
2649 Ga0495652_0268227
2650 Ga0495640_0000029
2651 Ga0495640_0088868
2652 Ga0495586_0049786
2653 Ga0495586_0076203
2654 Ga0495587_0000019
2655 Ga0495587_0082282
2656 Ga0495587_0103407
2657 Ga0495587_0109249
2658 Ga0495587_0139470
2659 Ga0495598_0174008
2660 Ga0495621_0032491
2661 Ga0495621_0064463
2662 Ga0495645_0000006
2663 Ga0495645_0007306
2664 Ga0495645_0092181
2665 Ga0495645_0214999
2666 Ga0495622_0006881
2667 Ga0495622_0029858
2668 Ga0495622_0175983
2669 Ga0495633_0005034
2670 Ga0495633_0093209
2671 Ga0495633_0125223
2672 Ga0495667_0000061
2673 Ga0495667_0003512
2674 Ga0495667_0012058
2675 Ga0495667_0016658
2676 Ga0495667_0045437
2677 Ga0495656_0000262
2678 Ga0495656_0009406
2679 Ga0495656_0016353
2680 Ga0495634_0003572
2681 Ga0495634_0153734
2682 Ga0495611_0042526
2683 Ga0495635_0005209
2684 Ga0495635_0020959
2685 Ga0495635_0064668
2686 Ga0495635_0076067
2687 Ga0495659_0001142
2688 Ga0495659_0152606
2689 Ga0495659_0170287
2690 Ga0495588_0003364
2691 Ga0495588_0016789
2692 Ga0495657_0000306
2693 Ga0495657_0058110
2694 Ga0495657_0065747
2695 Ga0495599_0000066
2696 Ga0495599_0004314
2697 Ga0495599_0024348
2698 Ga0495623_0000428
2699 Ga0495623_0001394
2700 Ga0495623_0055303
2701 Ga0495646_0000108
2702 Ga0495646_0016683
2703 Ga0495646_0021361
2704 Ga0495646_0038478
2705 Ga0495647_0008348
2706 Ga0495647_0010525
2707 Ga0495647_0035128
2708 Ga0495658_0000656
2709 Ga0495658_0081876
2710 Ga0495658_0131742
2711 Ga0495613_0238001
2712 Ga0495624_0025941
2713 Ga0495624_0044494
2714 Ga0495624_0045160
2715 Ga0495624_0212293
2716 Ga0495670_0003236
2717 Ga0495670_0126797
2718 Ga0495600_0000030
2719 Ga0495600_0000708
2720 Ga0495600_0003719
2721 Ga0495600_0040446
2722 Ga0495600_0083709
2723 Ga0495581_0005847
2724 Ga0495581_0010274
2725 Ga0495604_0000501
2726 Ga0495604_0013476
2727 Ga0495604_0014927
2728 Ga0495604_0048949
2729 Ga0495604_0105282
2730 Ga0495604_0147904
2731 Ga0495604_0187197
2732 Ga0495674_0001027
2733 Ga0495674_0087251
2734 Ga0495674_0145588
2735 Ga0495674_0152441
2736 Ga0495674_0438209
2737 Ga0495674_0623251
2738 Ga0495676_0038571
2739 Ga0495676_0039314
2740 Ga0495676_0091203
2741 Ga0495676_0187718
2742 Ga0495680_0002301
2743 Ga0495680_0002894
2744 Ga0495680_0007421
2745 Ga0495680_0018474
2746 Ga0495680_0024681
2747 Ga0495680_0027756
2748 Ga0495675_0000719
2749 Ga0495675_0011635
2750 Ga0495675_0021716
2751 Ga0495675_0169067
2752 Ga0495675_0203873
2753 Ga0495679_020243
2754 Ga0495685_010564
2755 Ga0495685_044762
2756 Ga0495673_0084059
2757 Ga0495684_0000056
2758 Ga0495684_0045090
2759 Ga0495684_0280439
2760 Ga0495593_0001400
2761 Ga0495593_0009436
2762 Ga0495602_0000006
2763 Ga0495602_0004878
2764 Ga0495602_0028646
2765 Ga0495602_0318501
2766 Ga0495614_0230748
2767 Ga0496100_0000189
2768 Ga0496100_0001161
2769 Ga0496100_0004954
2770 Ga0496100_0049689
2771 Ga0496100_0068743
2772 Ga0496100_0086288
2773 Ga0496100_0315268
2774 Ga0496101_0000367
2775 Ga0496101_0002673
2776 Ga0496101_0224841
2777 Ga0496101_0248825
2778 Ga0496101_0290753
2779 Ga0496101_0299396
2780 Ga0496102_0000967
2781 Ga0496102_0002863
2782 Ga0496102_0002928
2783 Ga0496102_0009278
2784 Ga0496102_0013770
2785 Ga0496102_0017017
2786 Ga0496102_0091527
2787 Ga0496102_0244805
2788 Ga0496102_0302506
2789 Ga0496102_0307262
2790 Ga0496103_0001608
2791 Ga0496103_0001665
2792 Ga0496103_0005379
2793 Ga0496103_0013937
2794 Ga0496103_0030811
2795 Ga0496103_0032609
2796 Ga0496103_0052684
2797 Ga0496103_0054457
2798 Ga0496103_0242930
2799 Ga0496104_0000116
2800 Ga0496104_0001806
2801 Ga0496104_0003787
2802 Ga0496104_0003981
2803 Ga0496104_0004377
2804 Ga0496104_0005021
2805 Ga0496104_0006644
2806 Ga0496104_0087226
2807 Ga0496104_0141339
2808 Ga0496104_0163210
2809 Ga0496104_0190266
2810 Ga0496104_0208931
2811 Ga0496104_0304314
2812 Ga0496104_0348595
2813 Ga0496105_0000550
2814 Ga0496105_0008839
2815 Ga0496105_0009845
2816 Ga0496105_0014629
2817 Ga0496105_0025397
2818 Ga0496105_0049329
2819 Ga0496105_0056463
2820 Ga0496105_0062353
2821 Ga0496105_0106070
2822 Ga0496105_0132699
2823 Ga0496106_0000736
2824 Ga0496106_0004342
2825 Ga0496106_0007993
2826 Ga0496106_0008120
2827 Ga0496106_0011796
2828 Ga0496106_0069576
2829 Ga0496106_0288303
2830 Ga0496106_0358592
2831 Ga0496106_0780538
2832 Ga0496107_0000061
2833 Ga0496107_0000646
2834 Ga0496107_0006231
2835 Ga0496107_0024408
2836 Ga0496107_0085808
2837 Ga0496107_0110341
2838 Ga0496107_0114464
2839 Ga0496107_0220588
2840 Ga0496107_0254201
2841 Ga0496108_0001716
2842 Ga0496108_0006940
2843 Ga0496108_0010675
2844 Ga0496108_0017108
2845 Ga0496108_0076752
2846 Ga0496108_0102200
2847 Ga0496108_0142582
2848 Ga0496108_0256175
2849 Ga0496108_0658237
2850 Ga0496109_0004602
2851 Ga0496109_0019595
2852 Ga0496109_0023516
2853 Ga0496109_0024181
2854 Ga0496109_0029321
2855 Ga0496109_0307433
2856 Ga0496109_0324443
2857 Ga0496109_0371279
2858 Ga0496109_0406192
2859 Ga0496109_0511437
2860 Ga0496110_0000401
2861 Ga0496110_0010675
2862 Ga0496110_0011385
2863 Ga0496110_0019695
2864 Ga0496110_0043780
2865 Ga0496110_0067983
2866 Ga0496110_0106673
2867 Ga0496110_0361501
2868 Ga0496110_0783945
2869 Ga0496110_0784061
2870 Ga0496111_0001881
2871 Ga0496111_0005191
2872 Ga0496111_0010028
2873 Ga0496111_0016147
2874 Ga0496111_0020730
2875 Ga0496111_0090586
2876 Ga0496111_0143854
2877 Ga0496111_0198765
2878 Ga0496111_0494186
2879 Ga0496112_0004013
2880 Ga0496112_0010313
2881 Ga0496112_0014330
2882 Ga0496112_0055743
2883 Ga0496112_0168031
2884 Ga0496112_0235313
2885 Ga0496112_0244231
2886 Ga0496112_0299223
2887 Ga0496112_0407761
2888 Ga0496112_0797196
2889 Ga0496113_0000682
2890 Ga0496113_0001738
2891 Ga0496113_0009613
2892 Ga0496113_0013969
2893 Ga0496113_0025336
2894 Ga0496113_0028906
2895 Ga0496113_0054399
2896 Ga0496113_0074021
2897 Ga0496113_0080065
2898 Ga0496113_0115486
2899 Ga0496113_0254450
2900 Ga0496113_0256902
2901 Ga0496114_0002405
2902 Ga0496114_0022492
2903 Ga0496114_0080545
2904 Ga0496114_0091730
2905 Ga0496114_0195968
2906 Ga0496114_0512036
2907 Ga0496114_0544833
2908 Ga0496114_0864952
2909 Ga0496115_0001413
2910 Ga0496115_0005844
2911 Ga0496115_0011047
2912 Ga0496115_0037310
2913 Ga0496115_0056246
2914 Ga0496115_0088276
2915 Ga0496115_0119638
2916 Ga0496115_0132658
2917 Ga0496115_0161503
2918 Ga0496115_0199591
2919 Ga0496115_0261008
2920 Ga0496115_0650563
2921 Ga0501031_0075121
2922 Ga0501032_0028317
2923 Ga0501033_0062792
2924 Ga0501033_0087148
2925 Ga0501033_0142433
2926 Ga0501033_0304194
2927 Ga0501033_0436067
2928 Ga0501034_0010159
2929 Ga0501034_0079854
2930 Ga0501034_0085139
2931 Ga0501034_0132421
2932 Ga0501034_0143267
2933 Ga0501034_0447997
2934 Ga0501034_0460039
2935 Ga0501036_0226905
2936 Ga0501036_0480384
2937 Ga0501037_0355219
2938 Ga0501038_0081122
2939 Ga0501038_0108560
2940 Ga0501039_0190702
2941 Ga0501039_0307517
2942 Ga0501040_0120998
2943 Ga0501040_0272705
2944 Ga0501042_0099390
2945 Ga0501042_0585421
2946 Ga0501043_0126167
2947 Ga0501046_0007129
2948 Ga0501046_0164719
2949 Ga0501046_0268667
2950 Ga0501047_0144982
2951 Ga0501047_0190645
2952 Ga0501047_0212962
2953 Ga0501047_0228869
2954 Ga0501047_0672002
2955 Ga0501067_0011699
2956 Ga0501068_0436238
2957 Ga0501069_0014533
2958 Ga0501069_0166874
2959 Ga0501069_0381786
2960 Ga0501070_0004928
2961 Ga0501070_0014873
2962 Ga0501070_0056756
2963 Ga0501070_0234137
2964 Ga0501070_0367048
2965 Ga0501071_0118866
2966 Ga0501071_0315633
2967 Ga0501071_0334638
2968 Ga0501072_0002038
2969 Ga0501072_0019373
2970 Ga0501072_0037372
2971 Ga0501072_0303621
2972 Ga0501072_0583136
2973 Ga0501073_0036871
2974 Ga0501073_0099501
2975 Ga0501073_0169412
2976 Ga0501073_0187189
2977 Ga0501073_0228696
2978 Ga0501073_0246889
2979 Ga0501073_0358376
2980 Ga0501073_0500869
2981 Ga0501074_0019000
2982 Ga0501074_0159471
2983 Ga0501075_0142426
2984 Ga0501075_0376191
2985 Ga0501076_0018369
2986 Ga0501076_0215484
2987 Ga0501076_0527835
2988 Ga0501077_0051623
2989 Ga0501077_0235239
2990 Ga0501079_0136730
2991 Ga0501079_0185104
2992 Ga0501079_0224161
2993 Ga0501079_0615253
2994 Ga0501080_0024499
2995 Ga0501080_0058737
2996 Ga0501080_0244216
2997 Ga0501080_0836015
2998 Ga0501081_0019804
2999 Ga0501081_0218557
3000 Ga0501083_0186510
3001 Ga0501083_0251072
3002 Ga0501083_0449813
3003 Ga0501035_0030762
3004 Ga0501035_0072293
3005 Ga0501035_0109445
3006 Ga0501035_0114638
3007 Ga0501035_0299793
3008 Ga0501035_0324078
3009 Ga0501044_0028950
3010 Ga0501044_0072558
3011 Ga0501044_0203977
3012 Ga0501044_0226346
3013 Ga0501045_0128592
3014 Ga0501045_0183171
3015 nmdc:mga03683_103889_c1
3016 nmdc:mga03683_115443_c1
3017 nmdc:mga03683_218358_c1
3018 nmdc:mga03n38_21992_c1
3019 nmdc:mga00v17_37939_c1
3020 nmdc:mga00v17_50495_c1
3021 nmdc:mga00v17_87957_c1
3022 nmdc:mga0yw44_13887_c1
3023 nmdc:mga0yw44_21791_c1
3024 nmdc:mga0yw44_26127_c1
3025 nmdc:mga0yw44_26235_c1
3026 nmdc:mga0k408_332832_c1
3027 nmdc:mga0k408_33623_c1
3028 nmdc:mga0k408_65306_c1
3029 nmdc:mga06z11_162684_c1
3030 nmdc:mga06z11_197446_c1
3031 nmdc:mga06z11_273540_c1
3032 nmdc:mga06z11_28241_c1
3033 nmdc:mga06z11_3236_c1
3034 nmdc:mga06z11_9556_c1
3035 nmdc:mga04h51_3168_c1
3036 nmdc:mga04h51_59634_c1
3037 nmdc:mga04h51_83023_c1
3038 nmdc:mga04h51_8529_c1
3039 nmdc:mga07m45_35650_c1
3040 nmdc:mga07m45_59262_c1
3041 nmdc:mga05p37_297809_c1
3042 nmdc:mga05p37_344158_c1
3043 nmdc:mga05p37_5632_c1
3044 nmdc:mga05p37_5665_c1
3045 nmdc:mga05p37_61997_c1
3046 nmdc:mga05p37_685734_c1
3047 nmdc:mga05p37_7070_c1
3048 nmdc:mga05p37_96432_c1
3049 nmdc:mga09592_1148_c1
3050 nmdc:mga09592_19266_c1
3051 nmdc:mga09592_199977_c1
3052 nmdc:mga09592_5879_c1
3053 nmdc:mga0qj67_124296_c1
3054 nmdc:mga0qj67_161801_c1
3055 nmdc:mga0qj67_36752_c1
3056 nmdc:mga0qj67_48972_c1
3057 nmdc:mga06r32_10189_c1
3058 nmdc:mga06r32_10472_c1
3059 nmdc:mga06r32_105411_c1
3060 nmdc:mga06r32_167234_c1
3061 nmdc:mga06r32_275684_c1
3062 nmdc:mga06r32_4222_c1
3063 nmdc:mga06r32_452809_c1
3064 nmdc:mga06r32_88292_c1
3065 nmdc:mga08y16_116995_c1
3066 nmdc:mga08y16_185355_c1
3067 nmdc:mga08y16_2503_c1
3068 nmdc:mga08y16_42495_c1
3069 nmdc:mga08y16_4316_c1
3070 nmdc:mga08y16_433528_c1
3071 nmdc:mga08y16_51194_c1
3072 nmdc:mga08y16_548540_c1
3073 nmdc:mga08y16_56282_c1
3074 nmdc:mga08y16_5824_c1
3075 nmdc:mga08y16_738_c1
3076 nmdc:mga0n895_141479_c1
3077 nmdc:mga0n895_30978_c1
3078 nmdc:mga0n895_312707_c1
3079 nmdc:mga0n895_32029_c1
3080 nmdc:mga0n895_403530_c1
3081 nmdc:mga0n895_450314_c1
3082 nmdc:mga0n895_562_c1
3083 nmdc:mga0n895_563811_c1
3084 nmdc:mga0n895_7736_c1
3085 nmdc:mga0n895_776751_c1
3086 nmdc:mga0n895_842_c1
3087 nmdc:mga0n895_86453_c1
3088 nmdc:mga0rr50_19224_c1
3089 nmdc:mga0rr50_231452_c1
3090 nmdc:mga0rr50_300730_c1
3091 nmdc:mga0rr50_40314_c1
3092 nmdc:mga0rr50_482837_c1
3093 nmdc:mga0rr50_62434_c1
3094 nmdc:mga08x19_127569_c1
3095 nmdc:mga08x19_1998_c1
3096 nmdc:mga08x19_44407_c1
3097 nmdc:mga08x19_444205_c1
3098 nmdc:mga0a205_1040_c1
3099 nmdc:mga0a205_120013_c1
3100 nmdc:mga0a205_253120_c1
3101 nmdc:mga0a205_4522_c1
3102 nmdc:mga0a205_6591_c1
3103 nmdc:mga0sz30_15012_c2
3104 Ga0495601_0000007
3105 Ga0495601_0005686
3106 Ga0495601_0010735
3107 Ga0495601_0022399
3108 Ga0495601_0048962
3109 Ga0495601_0075987
3110 Ga0495601_0193211
3111 Ga0495612_0000108
3112 Ga0495612_0002028
3113 Ga0495612_0003773
3114 Ga0495612_0056154
3115 Ga0495612_0145782
3116 Ga0495612_0246103
3117 Ga0495655_0068436
3118 Ga0495595_0000767
3119 Ga0495595_0002857
3120 Ga0495595_0005668
3121 Ga0495595_0010908
3122 Ga0495595_0035705
3123 Ga0495595_0038499
3124 Ga0495595_0094208
3125 Ga0495595_0134525
3126 Ga0495595_0153234
3127 Ga0495619_0000023
3128 Ga0495619_0000271
3129 Ga0495619_0001755
3130 Ga0495619_0002683
3131 Ga0495619_0014923
3132 Ga0495619_0042753
3133 Ga0495619_0062377
3134 Ga0495619_0091763
3135 Ga0495619_0281220
3136 Ga0495619_0296913
3137 Ga0500595_011034
3138 Ga0500652_129479
3139 Ga0500655_024812
3140 Ga0500658_0057936
3141 Ga0500658_0070827
3142 Ga0500568_0078430
3143 Ga0500603_075444
3144 Ga0501084_0015408
3145 Ga0501084_0344307
3146 Ga0501084_0718430
3147 Ga0501082_0000046
3148 Ga0501082_0056939
3149 Ga0501082_0083985
3150 Ga0501082_0102503
3151 Ga0501082_0107237
3152 Ga0501082_0199025
3153 Ga0501082_0239246
3154 Ga0501082_0314088
3155 Ga0501082_0809073
3156 Ga0530510_0030059
3157 Ga0530510_0101477
3158 2643756546

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07973

tRNA_SAD

Threonyl and Alanyl tRNA synthetase second additional domain

191

231

0.96

PF01411

tRNA-synt_2c

tRNA synthetases class II (A)

11

98

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zzg-assembly2.cif.gz_B crystal structure of alanyl-trna synthetase in complex with 5''-o-(n-(l-alanyl)-sulfamyoxyl) adenine without oligomerization domain 0.9096 1 237
2zzg-assembly1.cif.gz_A crystal structure of alanyl-trna synthetase in complex with 5''-o-(n-(l-alanyl)-sulfamyoxyl) adenine without oligomerization domain 0.9084 1 237
2zzg-assembly2.cif.gz_B crystal structure of alanyl-trna synthetase in complex with 5''-o-(n-(l-alanyl)-sulfamyoxyl) adenine without oligomerization domain 0.9059 1 237
2zzg-assembly1.cif.gz_A crystal structure of alanyl-trna synthetase in complex with 5''-o-(n-(l-alanyl)-sulfamyoxyl) adenine without oligomerization domain 0.9047 1 237
2zzf-assembly1.cif.gz_A crystal structure of alanyl-trna synthetase without oligomerization domain 0.903 1 237
ID Description Score Start End Superfamily
af_Q57984_485_578_2.40.30.130 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9375 1 93 2.40.30.130
2ztgA03 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9191 1 93 2.40.30.130
2zzeB03 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.8881 1 91 2.40.30.130
af_Q559E5_5_168_3.30.980.10 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.8864 102 237 3.30.980.10
af_Q57984_485_578_2.40.30.130 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.8805 1 93 2.40.30.130

Map