F494883
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1579 | 484 | 3158 | 238 |
Family's Representative Sequence
| Representative Sequence | 3300026089|Ga0207648_10180291|Ga0207648_101802912 |
| Length | 272 |
| Sequence | MPTECLFRDDSYLKSCDARVVAVTEQGGIVLDRTVFYATSGGQPGDTGSLTTADGTRIPVETALYTDAAKSEIAHVLPAGANAPKVGDSLTAEIDWGKRYARMRMHTALHLLSAALPYAVTGGSVGDSESRLDFDIPEAGLDKDAITAKVAEMIASNAAVSSRWISDAELEANPGLVKTMSVKPPMGTGRVRLIEIAGLDLQPCGGTHVRATGEIGAVRVTQIEKKGKQNRCAGSVGRRAARDRSPMARDRSRSREGEQDDGVERGLDRARA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 7 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 8 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 14 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 15 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 16 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 17 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 18 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 19 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 20 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 21 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 22 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 23 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 24 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 25 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 26 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 27 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 28 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 31 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 39 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 74 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 80 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 83 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 91 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 93 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 94 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 95 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 97 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 98 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 99 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 100 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 101 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 102 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 103 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 104 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 105 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 106 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 107 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 108 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 109 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 110 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 111 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 113 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 114 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 115 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 116 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 117 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 120 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 121 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 122 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 123 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 124 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 125 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 127 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 128 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 129 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 130 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 131 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 132 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 133 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 134 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 135 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 136 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 138 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 139 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 154 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 157 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 169 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 174 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 175 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 176 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 250 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 252 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 256 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 257 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 258 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 259 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 260 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 261 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 262 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 263 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 264 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 265 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 266 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 267 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 268 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 269 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 270 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 271 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 272 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 273 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 274 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 275 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 276 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 277 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 278 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 279 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 280 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 281 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 282 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 283 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 284 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 285 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 286 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 287 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 288 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 289 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 290 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 291 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 292 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 293 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 294 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 295 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 296 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 297 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 298 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 299 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 300 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 301 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 302 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 303 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 304 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 305 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 306 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 307 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 308 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 309 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 310 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 311 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 312 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 313 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 314 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 315 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 316 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 317 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 318 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 319 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 320 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 321 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 322 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 323 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 324 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 325 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 326 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 327 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 328 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 329 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 330 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 331 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 332 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 333 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 334 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 335 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 336 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 337 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 338 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 339 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 340 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 341 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 406 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 407 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 408 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 409 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 410 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 411 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 412 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 413 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 415 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 416 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 417 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 418 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 419 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 420 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 421 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 453 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 454 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 455 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 456 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 457 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 458 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 459 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 460 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 470 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 476 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 477 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 478 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 479 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 480 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 481 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 484 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.87 |
| Metatranscriptomes | 0.06 |
| Isolates | 0.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.12 |
| Nodule | 0 |
| Rhizoplane | 9.75 |
| Rhizosphere | 85.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207648_10180291 | 3300026089 | Bacteria | 1869 |
| 2 | ARcpr5oldR_c000028 | 3300000041 | Bacteria | 29588 |
| 3 | ARSoilYngRDRAFT_c00217 | 3300000042 | Bacteria | 9300 |
| 4 | ARcpr5yngRDRAFT_c000173 | 3300000043 | Bacteria | 10132 |
| 5 | ARSoilOldRDRAFT_c000023 | 3300000044 | Bacteria | 34965 |
| 6 | ARCol0yngRDRAFT_1000191 | 3300000652 | Bacteria | 10310 |
| 7 | JGI24741J21665_1025379 | 3300001915 | Bacteria | 906 |
| 8 | JGI24752J21851_1010192 | 3300001976 | Bacteria | 1226 |
| 9 | JGI24746J21847_1005138 | 3300001977 | Bacteria | 2049 |
| 10 | JGI24740J21852_10018609 | 3300001979 | Bacteria | 2458 |
| 11 | JGI24739J22299_10000148 | 3300001989 | Bacteria | 22525 |
| 12 | JGI24737J22298_10001402 | 3300001990 | Bacteria | 8548 |
| 13 | JGI24737J22298_10017355 | 3300001990 | Bacteria | 2320 |
| 14 | JGI24743J22301_10001462 | 3300001991 | Bacteria | 3269 |
| 15 | JGI24750J21931_1000011 | 3300002070 | Bacteria | 22441 |
| 16 | JGI24750J21931_1003616 | 3300002070 | Bacteria | 1856 |
| 17 | JGI24745J21846_1005158 | 3300002073 | Bacteria | 1420 |
| 18 | JGI24748J21848_1000485 | 3300002074 | Bacteria | 4362 |
| 19 | JGI24738J21930_10000236 | 3300002075 | Bacteria | 15024 |
| 20 | JGI24749J21850_1001952 | 3300002076 | Bacteria | 2915 |
| 21 | JGI24749J21850_1004668 | 3300002076 | Bacteria | 1921 |
| 22 | JGI24744J21845_10000887 | 3300002077 | Bacteria | 5646 |
| 23 | JGI24035J26624_1000114 | 3300002126 | Bacteria | 6994 |
| 24 | JGI24033J26618_1003148 | 3300002155 | Bacteria | 1727 |
| 25 | JGI24033J26618_1003288 | 3300002155 | Bacteria | 1697 |
| 26 | JGI24034J26672_10005870 | 3300002239 | Bacteria | 1766 |
| 27 | JGI24742J22300_10000252 | 3300002244 | Bacteria | 7969 |
| 28 | JGI24751J29686_10005836 | 3300002459 | Bacteria | 2512 |
| 29 | JGI24751J29686_10026980 | 3300002459 | Bacteria | 1192 |
| 30 | JGI25406J46586_10032185 | 3300003203 | Bacteria | 1951 |
| 31 | JGI25153J46596_10004476 | 3300003215 | Bacteria | 7532 |
| 32 | JGI25405J52794_10006291 | 3300003911 | Bacteria | 2167 |
| 33 | Ga0065716_1001752 | 3300005277 | Bacteria | 3584 |
| 34 | Ga0065704_10105216 | 3300005289 | Bacteria | 2115 |
| 35 | Ga0065712_10002440 | 3300005290 | Bacteria | 5368 |
| 36 | Ga0065712_10096365 | 3300005290 | Bacteria | 2186 |
| 37 | Ga0065712_10118955 | 3300005290 | Bacteria | 1699 |
| 38 | Ga0065715_10001564 | 3300005293 | Bacteria | 10196 |
| 39 | Ga0065715_10033620 | 3300005293 | Bacteria | 1824 |
| 40 | Ga0065715_10088960 | 3300005293 | Bacteria | 20217 |
| 41 | Ga0070658_10014302 | 3300005327 | Bacteria | 6368 |
| 42 | Ga0070676_10000536 | 3300005328 | Bacteria | 18324 |
| 43 | Ga0070676_10041342 | 3300005328 | Bacteria | 2673 |
| 44 | Ga0070676_10142973 | 3300005328 | Bacteria | 1525 |
| 45 | Ga0070683_100000144 | 3300005329 | Bacteria | 45900 |
| 46 | Ga0070683_100055001 | 3300005329 | Bacteria | 3691 |
| 47 | Ga0070683_100425296 | 3300005329 | Bacteria | 1267 |
| 48 | Ga0070690_100001428 | 3300005330 | Bacteria | 12481 |
| 49 | Ga0070690_100002001 | 3300005330 | Bacteria | 10850 |
| 50 | Ga0070690_100112831 | 3300005330 | Bacteria | 1816 |
| 51 | Ga0070670_100000437 | 3300005331 | Bacteria | 34047 |
| 52 | Ga0070670_100010574 | 3300005331 | Bacteria | 7880 |
| 53 | Ga0070670_100093113 | 3300005331 | Bacteria | 2592 |
| 54 | Ga0070670_100231452 | 3300005331 | Bacteria | 1608 |
| 55 | Ga0070677_10000166 | 3300005333 | Bacteria | 22747 |
| 56 | Ga0070677_10099117 | 3300005333 | Bacteria | 1282 |
| 57 | Ga0068869_100000035 | 3300005334 | Bacteria | 55467 |
| 58 | Ga0068869_100144496 | 3300005334 | Bacteria | 1840 |
| 59 | Ga0070666_10060622 | 3300005335 | Bacteria | 2561 |
| 60 | Ga0070680_100003662 | 3300005336 | Bacteria | 11484 |
| 61 | Ga0070680_100056551 | 3300005336 | Bacteria | 3207 |
| 62 | Ga0070680_100145684 | 3300005336 | Bacteria | 1987 |
| 63 | Ga0070680_100276749 | 3300005336 | Bacteria | 1421 |
| 64 | Ga0070682_100002219 | 3300005337 | Bacteria | 10771 |
| 65 | Ga0070682_100107123 | 3300005337 | Bacteria | 1856 |
| 66 | Ga0068868_100001888 | 3300005338 | Bacteria | 14384 |
| 67 | Ga0070660_100000944 | 3300005339 | Bacteria | 19405 |
| 68 | Ga0070660_100080326 | 3300005339 | Bacteria | 2559 |
| 69 | Ga0070660_100139586 | 3300005339 | Bacteria | 1943 |
| 70 | Ga0070689_100000207 | 3300005340 | Bacteria | 35559 |
| 71 | Ga0070689_100008854 | 3300005340 | Bacteria | 7111 |
| 72 | Ga0070689_100019990 | 3300005340 | Bacteria | 4962 |
| 73 | Ga0070689_100021249 | 3300005340 | Bacteria | 4828 |
| 74 | Ga0070691_10001234 | 3300005341 | Bacteria | 10769 |
| 75 | Ga0070691_10048613 | 3300005341 | Bacteria | 2019 |
| 76 | Ga0070691_10071638 | 3300005341 | Bacteria | 1683 |
| 77 | Ga0070687_100000261 | 3300005343 | Bacteria | 17944 |
| 78 | Ga0070687_100086044 | 3300005343 | Bacteria | 1727 |
| 79 | Ga0070661_100000017 | 3300005344 | Bacteria | 153232 |
| 80 | Ga0070661_100149659 | 3300005344 | Bacteria | 1764 |
| 81 | Ga0070661_100333634 | 3300005344 | Bacteria | 1186 |
| 82 | Ga0070692_10001418 | 3300005345 | Bacteria | 8682 |
| 83 | Ga0070692_10005458 | 3300005345 | Bacteria | 5429 |
| 84 | Ga0070692_10040522 | 3300005345 | Bacteria | 2383 |
| 85 | Ga0070692_10168066 | 3300005345 | Bacteria | 1262 |
| 86 | Ga0070668_100140244 | 3300005347 | Bacteria | 1948 |
| 87 | Ga0070668_100308586 | 3300005347 | Bacteria | 1329 |
| 88 | Ga0070668_100324609 | 3300005347 | Bacteria | 1297 |
| 89 | Ga0070668_100328096 | 3300005347 | Bacteria | 1290 |
| 90 | Ga0070668_100541598 | 3300005347 | Bacteria | 1012 |
| 91 | Ga0070669_100000250 | 3300005353 | Bacteria | 44115 |
| 92 | Ga0070669_100215645 | 3300005353 | Bacteria | 1516 |
| 93 | Ga0070675_100000246 | 3300005354 | Bacteria | 35225 |
| 94 | Ga0070675_100078753 | 3300005354 | Bacteria | 2745 |
| 95 | Ga0070671_100007422 | 3300005355 | Bacteria | 8762 |
| 96 | Ga0070671_100028654 | 3300005355 | Bacteria | 4587 |
| 97 | Ga0070671_100073891 | 3300005355 | Bacteria | 2848 |
| 98 | Ga0070674_100000355 | 3300005356 | Bacteria | 22844 |
| 99 | Ga0070674_100018670 | 3300005356 | Bacteria | 4391 |
| 100 | Ga0070674_100142815 | 3300005356 | Bacteria | 1798 |
| 101 | Ga0070674_100408846 | 3300005356 | Bacteria | 1111 |
| 102 | Ga0070673_100000032 | 3300005364 | Bacteria | 61665 |
| 103 | Ga0070673_100042414 | 3300005364 | Bacteria | 3508 |
| 104 | Ga0070673_100193540 | 3300005364 | Bacteria | 1748 |
| 105 | Ga0070688_100000594 | 3300005365 | Bacteria | 18125 |
| 106 | Ga0070688_100013506 | 3300005365 | Bacteria | 4607 |
| 107 | Ga0070688_100025273 | 3300005365 | Bacteria | 3515 |
| 108 | Ga0070688_100186076 | 3300005365 | Bacteria | 1444 |
| 109 | Ga0070659_100000214 | 3300005366 | Bacteria | 44422 |
| 110 | Ga0070659_100035022 | 3300005366 | Bacteria | 3907 |
| 111 | Ga0070667_100000816 | 3300005367 | Bacteria | 29087 |
| 112 | Ga0070667_100034043 | 3300005367 | Bacteria | 4262 |
| 113 | Ga0070667_100051439 | 3300005367 | Bacteria | 3473 |
| 114 | Ga0070667_100605221 | 3300005367 | Bacteria | 1010 |
| 115 | Ga0070667_100625868 | 3300005367 | Bacteria | 993 |
| 116 | Ga0070703_10001365 | 3300005406 | Bacteria | 7412 |
| 117 | Ga0070703_10001548 | 3300005406 | Bacteria | 6859 |
| 118 | Ga0070709_10004360 | 3300005434 | Bacteria | 7625 |
| 119 | Ga0070709_10016295 | 3300005434 | Bacteria | 4240 |
| 120 | Ga0070714_100012941 | 3300005435 | Bacteria | 6671 |
| 121 | Ga0070714_100481217 | 3300005435 | Bacteria | 1182 |
| 122 | Ga0070713_100005123 | 3300005436 | Bacteria | 8918 |
| 123 | Ga0070713_100013950 | 3300005436 | Bacteria | 5949 |
| 124 | Ga0070710_10315891 | 3300005437 | Bacteria | 1024 |
| 125 | Ga0070701_10000230 | 3300005438 | Bacteria | 17727 |
| 126 | Ga0070701_10002700 | 3300005438 | Bacteria | 6876 |
| 127 | Ga0070701_10020139 | 3300005438 | Bacteria | 3163 |
| 128 | Ga0070711_100008381 | 3300005439 | Bacteria | 6330 |
| 129 | Ga0070711_100017527 | 3300005439 | Bacteria | 4562 |
| 130 | Ga0070711_100251801 | 3300005439 | Bacteria | 1386 |
| 131 | Ga0070711_100458681 | 3300005439 | Bacteria | 1044 |
| 132 | Ga0070705_100000171 | 3300005440 | Bacteria | 37880 |
| 133 | Ga0070705_100003882 | 3300005440 | Bacteria | 7310 |
| 134 | Ga0070705_100123695 | 3300005440 | Bacteria | 1675 |
| 135 | Ga0070700_100000234 | 3300005441 | Bacteria | 30487 |
| 136 | Ga0070700_100000482 | 3300005441 | Bacteria | 19974 |
| 137 | Ga0070694_100000247 | 3300005444 | Bacteria | 28607 |
| 138 | Ga0070694_100003250 | 3300005444 | Bacteria | 9704 |
| 139 | Ga0070694_100104770 | 3300005444 | Bacteria | 2006 |
| 140 | Ga0070708_100050386 | 3300005445 | Bacteria | 3686 |
| 141 | Ga0070663_100026358 | 3300005455 | Bacteria | 3937 |
| 142 | Ga0070663_100036809 | 3300005455 | Bacteria | 3402 |
| 143 | Ga0070663_100378405 | 3300005455 | Bacteria | 1152 |
| 144 | Ga0070678_100070825 | 3300005456 | Bacteria | 2608 |
| 145 | Ga0070678_100147105 | 3300005456 | Bacteria | 1893 |
| 146 | Ga0070662_100003327 | 3300005457 | Bacteria | 10025 |
| 147 | Ga0070662_100046522 | 3300005457 | Bacteria | 3117 |
| 148 | Ga0070662_100054983 | 3300005457 | Bacteria | 2886 |
| 149 | Ga0070681_10000401 | 3300005458 | Bacteria | 35170 |
| 150 | Ga0070681_10094966 | 3300005458 | Bacteria | 2930 |
| 151 | Ga0070681_10097689 | 3300005458 | Bacteria | 2884 |
| 152 | Ga0070681_10101800 | 3300005458 | Bacteria | 2818 |
| 153 | Ga0070681_10126076 | 3300005458 | Bacteria | 2493 |
| 154 | Ga0070681_10166646 | 3300005458 | Bacteria | 2126 |
| 155 | Ga0070681_10202951 | 3300005458 | Bacteria | 1900 |
| 156 | Ga0070681_10203174 | 3300005458 | Bacteria | 1899 |
| 157 | Ga0070681_10296633 | 3300005458 | Bacteria | 1526 |
| 158 | Ga0070681_10552211 | 3300005458 | Bacteria | 1066 |
| 159 | Ga0068867_100000190 | 3300005459 | Bacteria | 40626 |
| 160 | Ga0068867_100069262 | 3300005459 | Bacteria | 2635 |
| 161 | Ga0068867_100216309 | 3300005459 | Bacteria | 1542 |
| 162 | Ga0070685_10002568 | 3300005466 | Bacteria | 9293 |
| 163 | Ga0070685_10006005 | 3300005466 | Bacteria | 6188 |
| 164 | Ga0070685_10069160 | 3300005466 | Bacteria | 2088 |
| 165 | Ga0070706_100114608 | 3300005467 | Bacteria | 2510 |
| 166 | Ga0070706_100211233 | 3300005467 | Bacteria | 1812 |
| 167 | Ga0070706_100254037 | 3300005467 | Bacteria | 1641 |
| 168 | Ga0070707_100531971 | 3300005468 | Bacteria | 1137 |
| 169 | Ga0070698_100174486 | 3300005471 | Bacteria | 2090 |
| 170 | Ga0070699_100000167 | 3300005518 | Bacteria | 63239 |
| 171 | Ga0070679_100000847 | 3300005530 | Bacteria | 26675 |
| 172 | Ga0070679_100123282 | 3300005530 | Bacteria | 2575 |
| 173 | Ga0070679_100144745 | 3300005530 | Bacteria | 2355 |
| 174 | Ga0070679_100179661 | 3300005530 | Bacteria | 2089 |
| 175 | Ga0070679_100192310 | 3300005530 | Bacteria | 2009 |
| 176 | Ga0070679_100324673 | 3300005530 | Bacteria | 1488 |
| 177 | Ga0070684_100000904 | 3300005535 | Bacteria | 21016 |
| 178 | Ga0070684_100025874 | 3300005535 | Bacteria | 4937 |
| 179 | Ga0070684_100217716 | 3300005535 | Bacteria | 1742 |
| 180 | Ga0070684_100273447 | 3300005535 | Bacteria | 1547 |
| 181 | Ga0070684_100282134 | 3300005535 | Bacteria | 1522 |
| 182 | Ga0070684_100366281 | 3300005535 | Bacteria | 1327 |
| 183 | Ga0070697_100049238 | 3300005536 | Bacteria | 3420 |
| 184 | Ga0068853_100006394 | 3300005539 | Bacteria | 9358 |
| 185 | Ga0068853_100050590 | 3300005539 | Bacteria | 3575 |
| 186 | Ga0068853_100544688 | 3300005539 | Bacteria | 1099 |
| 187 | Ga0070672_100000529 | 3300005543 | Bacteria | 22392 |
| 188 | Ga0070672_100074762 | 3300005543 | Bacteria | 2703 |
| 189 | Ga0070672_100207043 | 3300005543 | Bacteria | 1642 |
| 190 | Ga0070672_100213601 | 3300005543 | Bacteria | 1616 |
| 191 | Ga0070672_100301252 | 3300005543 | Bacteria | 1359 |
| 192 | Ga0070686_100000269 | 3300005544 | Bacteria | 35470 |
| 193 | Ga0070686_100003617 | 3300005544 | Bacteria | 8478 |
| 194 | Ga0070686_100009747 | 3300005544 | Bacteria | 5397 |
| 195 | Ga0070686_100013607 | 3300005544 | Bacteria | 4665 |
| 196 | Ga0070695_100000406 | 3300005545 | Bacteria | 22313 |
| 197 | Ga0070695_100003493 | 3300005545 | Bacteria | 9175 |
| 198 | Ga0070696_100000304 | 3300005546 | Bacteria | 29759 |
| 199 | Ga0070696_100002999 | 3300005546 | Bacteria | 11209 |
| 200 | Ga0070696_100100859 | 3300005546 | Bacteria | 2069 |
| 201 | Ga0070693_100002112 | 3300005547 | Bacteria | 9095 |
| 202 | Ga0070693_100009505 | 3300005547 | Bacteria | 4836 |
| 203 | Ga0070693_100042910 | 3300005547 | Bacteria | 2551 |
| 204 | Ga0070665_100063574 | 3300005548 | Bacteria | 3701 |
| 205 | Ga0070665_100073842 | 3300005548 | Bacteria | 3416 |
| 206 | Ga0070665_100972688 | 3300005548 | Bacteria | 861 |
| 207 | Ga0070704_100000385 | 3300005549 | Bacteria | 20151 |
| 208 | Ga0070704_100000566 | 3300005549 | Bacteria | 17827 |
| 209 | Ga0070704_100060045 | 3300005549 | Bacteria | 2715 |
| 210 | Ga0070704_100312875 | 3300005549 | Bacteria | 1313 |
| 211 | Ga0068855_100006856 | 3300005563 | Bacteria | 13819 |
| 212 | Ga0068855_100081134 | 3300005563 | Bacteria | 3760 |
| 213 | Ga0068855_100116563 | 3300005563 | Bacteria | 3061 |
| 214 | Ga0068855_100144287 | 3300005563 | Bacteria | 2711 |
| 215 | Ga0068855_100465648 | 3300005563 | Bacteria | 1378 |
| 216 | Ga0070664_100000912 | 3300005564 | Bacteria | 23051 |
| 217 | Ga0070664_100333920 | 3300005564 | Bacteria | 1376 |
| 218 | Ga0068857_100000494 | 3300005577 | Bacteria | 28282 |
| 219 | Ga0068857_100011609 | 3300005577 | Bacteria | 7665 |
| 220 | Ga0068857_100244976 | 3300005577 | Bacteria | 1642 |
| 221 | Ga0068857_100363680 | 3300005577 | Bacteria | 1341 |
| 222 | Ga0068854_100000139 | 3300005578 | Bacteria | 50270 |
| 223 | Ga0068854_100159715 | 3300005578 | Bacteria | 1744 |
| 224 | Ga0068854_100292604 | 3300005578 | Bacteria | 1315 |
| 225 | Ga0068856_100005193 | 3300005614 | Bacteria | 12858 |
| 226 | Ga0068856_100167879 | 3300005614 | Bacteria | 2206 |
| 227 | Ga0068856_100179850 | 3300005614 | Bacteria | 2128 |
| 228 | Ga0068856_100194234 | 3300005614 | Bacteria | 2044 |
| 229 | Ga0068856_100874197 | 3300005614 | Bacteria | 918 |
| 230 | Ga0070702_100054674 | 3300005615 | Bacteria | 2298 |
| 231 | Ga0070702_100245102 | 3300005615 | Bacteria | 1211 |
| 232 | Ga0068852_100000193 | 3300005616 | Bacteria | 41505 |
| 233 | Ga0068852_100098275 | 3300005616 | Bacteria | 2635 |
| 234 | Ga0068852_100353508 | 3300005616 | Bacteria | 1435 |
| 235 | Ga0068852_100438174 | 3300005616 | Bacteria | 1291 |
| 236 | Ga0068859_100002972 | 3300005617 | Bacteria | 17185 |
| 237 | Ga0068859_100021099 | 3300005617 | Bacteria | 6536 |
| 238 | Ga0068859_100478637 | 3300005617 | Bacteria | 1340 |
| 239 | Ga0068859_100494335 | 3300005617 | Bacteria | 1319 |
| 240 | Ga0068864_100000226 | 3300005618 | Bacteria | 50929 |
| 241 | Ga0068864_100005554 | 3300005618 | Bacteria | 10340 |
| 242 | Ga0068864_100091561 | 3300005618 | Bacteria | 2683 |
| 243 | Ga0068864_100209466 | 3300005618 | Bacteria | 1794 |
| 244 | Ga0068866_10000199 | 3300005718 | Bacteria | 28222 |
| 245 | Ga0068866_10056158 | 3300005718 | Bacteria | 2025 |
| 246 | Ga0068866_10242311 | 3300005718 | Bacteria | 1099 |
| 247 | Ga0068861_100000847 | 3300005719 | Bacteria | 18540 |
| 248 | Ga0068851_10110326 | 3300005834 | Bacteria | 1468 |
| 249 | Ga0068870_10004231 | 3300005840 | Bacteria | 6169 |
| 250 | Ga0068863_100001877 | 3300005841 | Bacteria | 20878 |
| 251 | Ga0068863_100044870 | 3300005841 | Bacteria | 4195 |
| 252 | Ga0068858_100000512 | 3300005842 | Bacteria | 40596 |
| 253 | Ga0068858_100044217 | 3300005842 | Bacteria | 4129 |
| 254 | Ga0068858_100182497 | 3300005842 | Bacteria | 1982 |
| 255 | Ga0068858_100502778 | 3300005842 | Unclassified | 1171 |
| 256 | Ga0068860_100001525 | 3300005843 | Bacteria | 24947 |
| 257 | Ga0068860_100001592 | 3300005843 | Bacteria | 24376 |
| 258 | Ga0068860_100057915 | 3300005843 | Bacteria | 3683 |
| 259 | Ga0068860_100061019 | 3300005843 | Bacteria | 3582 |
| 260 | Ga0068862_100000557 | 3300005844 | Bacteria | 38898 |
| 261 | Ga0068862_100031172 | 3300005844 | Bacteria | 4498 |
| 262 | Ga0068862_100034921 | 3300005844 | Bacteria | 4256 |
| 263 | Ga0068862_100335652 | 3300005844 | Bacteria | 1399 |
| 264 | Ga0081455_10000035 | 3300005937 | Bacteria | 136366 |
| 265 | Ga0081455_10001717 | 3300005937 | Bacteria | 26511 |
| 266 | Ga0081455_10003750 | 3300005937 | Bacteria | 17364 |
| 267 | Ga0081455_10039883 | 3300005937 | Bacteria | 4145 |
| 268 | Ga0081455_10223349 | 3300005937 | Bacteria | 1394 |
| 269 | Ga0081538_10001738 | 3300005981 | Bacteria | 22124 |
| 270 | Ga0081538_10060587 | 3300005981 | Bacteria | 2175 |
| 271 | Ga0081538_10068489 | 3300005981 | Bacteria | 1973 |
| 272 | Ga0081540_1007073 | 3300005983 | Bacteria | 8064 |
| 273 | Ga0081540_1064606 | 3300005983 | Bacteria | 1726 |
| 274 | Ga0081539_10002061 | 3300005985 | Bacteria | 30119 |
| 275 | Ga0070717_10028561 | 3300006028 | Bacteria | 4466 |
| 276 | Ga0070717_10086152 | 3300006028 | Bacteria | 2644 |
| 277 | Ga0070717_10123132 | 3300006028 | Bacteria | 2223 |
| 278 | Ga0070717_10246288 | 3300006028 | Bacteria | 1578 |
| 279 | Ga0070717_10858928 | 3300006028 | Bacteria | 826 |
| 280 | Ga0075365_10004829 | 3300006038 | Bacteria | 7192 |
| 281 | Ga0075365_10006356 | 3300006038 | Bacteria | 6493 |
| 282 | Ga0075365_10041906 | 3300006038 | Bacteria | 2991 |
| 283 | Ga0075365_10108460 | 3300006038 | Bacteria | 1906 |
| 284 | Ga0075368_10002630 | 3300006042 | Bacteria | 5897 |
| 285 | Ga0075368_10011483 | 3300006042 | Bacteria | 3222 |
| 286 | Ga0075368_10040731 | 3300006042 | Bacteria | 1824 |
| 287 | Ga0075368_10164585 | 3300006042 | Bacteria | 930 |
| 288 | Ga0075363_100103326 | 3300006048 | Bacteria | 1578 |
| 289 | Ga0075364_10004638 | 3300006051 | Bacteria | 7924 |
| 290 | Ga0075364_10008067 | 3300006051 | Bacteria | 6278 |
| 291 | Ga0075364_10246607 | 3300006051 | Bacteria | 1214 |
| 292 | Ga0075432_10019290 | 3300006058 | Bacteria | 2329 |
| 293 | Ga0070715_10098939 | 3300006163 | Bacteria | 1357 |
| 294 | Ga0070715_10141852 | 3300006163 | Bacteria | 1168 |
| 295 | Ga0070715_10171288 | 3300006163 | Unclassified | 1081 |
| 296 | Ga0070716_100018071 | 3300006173 | Bacteria | 3667 |
| 297 | Ga0070712_100012496 | 3300006175 | Bacteria | 5398 |
| 298 | Ga0070712_100130680 | 3300006175 | Bacteria | 1902 |
| 299 | Ga0070712_100635127 | 3300006175 | Bacteria | 906 |
| 300 | Ga0075362_10002664 | 3300006177 | Bacteria | 6062 |
| 301 | Ga0075362_10080901 | 3300006177 | Bacteria | 1497 |
| 302 | Ga0075362_10095146 | 3300006177 | Bacteria | 1387 |
| 303 | Ga0075362_10110073 | 3300006177 | Bacteria | 1296 |
| 304 | Ga0075367_10008394 | 3300006178 | Bacteria | 5349 |
| 305 | Ga0075367_10013463 | 3300006178 | Bacteria | 4397 |
| 306 | Ga0075367_10041545 | 3300006178 | Bacteria | 2689 |
| 307 | Ga0075367_10079735 | 3300006178 | Bacteria | 1979 |
| 308 | Ga0075367_10156175 | 3300006178 | Bacteria | 1418 |
| 309 | Ga0075369_10154964 | 3300006186 | Bacteria | 1048 |
| 310 | Ga0075427_10003198 | 3300006194 | Bacteria | 2246 |
| 311 | Ga0075366_10030395 | 3300006195 | Bacteria | 3175 |
| 312 | Ga0097621_100000049 | 3300006237 | Bacteria | 61062 |
| 313 | Ga0097621_100076779 | 3300006237 | Bacteria | 2772 |
| 314 | Ga0075370_10009592 | 3300006353 | Bacteria | 5033 |
| 315 | Ga0075370_10076344 | 3300006353 | Bacteria | 1921 |
| 316 | Ga0075370_10383678 | 3300006353 | Bacteria | 842 |
| 317 | Ga0068871_100000097 | 3300006358 | Bacteria | 52015 |
| 318 | Ga0068871_100015992 | 3300006358 | Bacteria | 5636 |
| 319 | Ga0068871_100032808 | 3300006358 | Bacteria | 4105 |
| 320 | Ga0068871_100161020 | 3300006358 | Bacteria | 1919 |
| 321 | Ga0068871_100227143 | 3300006358 | Bacteria | 1619 |
| 322 | Ga0075428_100011811 | 3300006844 | Bacteria | 9720 |
| 323 | Ga0075428_100026110 | 3300006844 | Bacteria | 6467 |
| 324 | Ga0075428_100045882 | 3300006844 | Bacteria | 4801 |
| 325 | Ga0075428_100075012 | 3300006844 | Bacteria | 3694 |
| 326 | Ga0075428_100076282 | 3300006844 | Bacteria | 3660 |
| 327 | Ga0075428_100084938 | 3300006844 | Bacteria | 3453 |
| 328 | Ga0075428_100293444 | 3300006844 | Bacteria | 1749 |
| 329 | Ga0075428_100369767 | 3300006844 | Bacteria | 1538 |
| 330 | Ga0075430_100004110 | 3300006846 | Bacteria | 12278 |
| 331 | Ga0075430_100263355 | 3300006846 | Bacteria | 1428 |
| 332 | Ga0075431_100003772 | 3300006847 | Bacteria | 14731 |
| 333 | Ga0075431_100015906 | 3300006847 | Bacteria | 7631 |
| 334 | Ga0075431_100037458 | 3300006847 | Bacteria | 4996 |
| 335 | Ga0075431_100076180 | 3300006847 | Bacteria | 3462 |
| 336 | Ga0075431_100087511 | 3300006847 | Bacteria | 3214 |
| 337 | Ga0075431_100153596 | 3300006847 | Bacteria | 2369 |
| 338 | Ga0075431_100172811 | 3300006847 | Bacteria | 2220 |
| 339 | Ga0075431_100282725 | 3300006847 | Bacteria | 1680 |
| 340 | Ga0075431_100457082 | 3300006847 | Bacteria | 1272 |
| 341 | Ga0075431_100718708 | 3300006847 | Bacteria | 976 |
| 342 | Ga0075433_10002397 | 3300006852 | Bacteria | 14260 |
| 343 | Ga0075433_10008081 | 3300006852 | Bacteria | 8377 |
| 344 | Ga0075434_100000383 | 3300006871 | Bacteria | 32396 |
| 345 | Ga0075434_100001135 | 3300006871 | Bacteria | 21932 |
| 346 | Ga0075434_100009398 | 3300006871 | Bacteria | 9114 |
| 347 | Ga0075434_100060410 | 3300006871 | Bacteria | 3770 |
| 348 | Ga0075434_100278916 | 3300006871 | Bacteria | 1691 |
| 349 | Ga0075434_100334846 | 3300006871 | Bacteria | 1534 |
| 350 | Ga0075434_100456457 | 3300006871 | Bacteria | 1299 |
| 351 | Ga0075434_100457489 | 3300006871 | Bacteria | 1297 |
| 352 | Ga0075434_100523044 | 3300006871 | Bacteria | 1207 |
| 353 | Ga0075434_100595436 | 3300006871 | Bacteria | 1125 |
| 354 | Ga0075429_100001354 | 3300006880 | Bacteria | 20025 |
| 355 | Ga0075429_100016192 | 3300006880 | Bacteria | 6460 |
| 356 | Ga0075429_100143178 | 3300006880 | Bacteria | 2093 |
| 357 | Ga0075429_100234603 | 3300006880 | Bacteria | 1607 |
| 358 | Ga0075429_100269619 | 3300006880 | Bacteria | 1491 |
| 359 | Ga0068865_100000119 | 3300006881 | Bacteria | 39895 |
| 360 | Ga0068865_100033862 | 3300006881 | Bacteria | 3422 |
| 361 | Ga0068865_100059392 | 3300006881 | Bacteria | 2674 |
| 362 | Ga0068865_100068549 | 3300006881 | Bacteria | 2508 |
| 363 | Ga0075436_100032452 | 3300006914 | Bacteria | 3599 |
| 364 | Ga0075436_100065255 | 3300006914 | Bacteria | 2517 |
| 365 | Ga0097620_100002972 | 3300006931 | Bacteria | 17185 |
| 366 | Ga0097620_100021099 | 3300006931 | Bacteria | 6536 |
| 367 | Ga0097620_100478646 | 3300006931 | Bacteria | 1340 |
| 368 | Ga0097620_100494280 | 3300006931 | Bacteria | 1319 |
| 369 | Ga0075435_100004250 | 3300007076 | Bacteria | 9836 |
| 370 | Ga0075435_100022627 | 3300007076 | Bacteria | 4849 |
| 371 | Ga0075435_100030953 | 3300007076 | Bacteria | 4212 |
| 372 | Ga0075435_100114600 | 3300007076 | Bacteria | 2244 |
| 373 | Ga0075435_100262671 | 3300007076 | Bacteria | 1471 |
| 374 | Ga0099794_10072350 | 3300007265 | Bacteria | 1690 |
| 375 | Ga0105251_10047287 | 3300009011 | Bacteria | 2068 |
| 376 | Ga0105244_10110443 | 3300009036 | Bacteria | 1338 |
| 377 | Ga0105240_10009789 | 3300009093 | Bacteria | 13533 |
| 378 | Ga0105240_10056188 | 3300009093 | Bacteria | 4926 |
| 379 | Ga0105240_10241483 | 3300009093 | Bacteria | 2094 |
| 380 | Ga0111539_10000237 | 3300009094 | Bacteria | 65638 |
| 381 | Ga0111539_10001512 | 3300009094 | Bacteria | 31036 |
| 382 | Ga0111539_10007189 | 3300009094 | Bacteria | 14270 |
| 383 | Ga0111539_10010350 | 3300009094 | Bacteria | 11742 |
| 384 | Ga0111539_10022663 | 3300009094 | Bacteria | 7714 |
| 385 | Ga0111539_10059007 | 3300009094 | Bacteria | 4551 |
| 386 | Ga0111539_10097324 | 3300009094 | Bacteria | 3457 |
| 387 | Ga0111539_10236892 | 3300009094 | Bacteria | 2124 |
| 388 | Ga0105245_10000202 | 3300009098 | Bacteria | 57012 |
| 389 | Ga0105245_10109349 | 3300009098 | Bacteria | 2569 |
| 390 | Ga0105245_10178381 | 3300009098 | Bacteria | 2028 |
| 391 | Ga0105245_10243774 | 3300009098 | Bacteria | 1743 |
| 392 | Ga0105247_10003839 | 3300009101 | Bacteria | 9725 |
| 393 | Ga0105247_10010478 | 3300009101 | Bacteria | 5605 |
| 394 | Ga0105247_10018903 | 3300009101 | Bacteria | 4138 |
| 395 | Ga0105247_10026789 | 3300009101 | Bacteria | 3484 |
| 396 | Ga0114129_10007020 | 3300009147 | Bacteria | 16034 |
| 397 | Ga0114129_10008425 | 3300009147 | Bacteria | 14689 |
| 398 | Ga0114129_10011185 | 3300009147 | Bacteria | 12793 |
| 399 | Ga0114129_10033296 | 3300009147 | Bacteria | 7283 |
| 400 | Ga0114129_10105568 | 3300009147 | Bacteria | 3893 |
| 401 | Ga0114129_10797829 | 3300009147 | Bacteria | 1205 |
| 402 | Ga0114129_10858957 | 3300009147 | Bacteria | 1153 |
| 403 | Ga0105243_10011526 | 3300009148 | Bacteria | 6690 |
| 404 | Ga0105243_10042474 | 3300009148 | Bacteria | 3559 |
| 405 | Ga0105243_10296026 | 3300009148 | Bacteria | 1464 |
| 406 | Ga0105243_10849673 | 3300009148 | Bacteria | 904 |
| 407 | Ga0105241_10000430 | 3300009174 | Bacteria | 31789 |
| 408 | Ga0105241_10175455 | 3300009174 | Bacteria | 1773 |
| 409 | Ga0105241_10500497 | 3300009174 | Bacteria | 1083 |
| 410 | Ga0105241_10886951 | 3300009174 | Bacteria | 827 |
| 411 | Ga0105242_10002131 | 3300009176 | Bacteria | 15612 |
| 412 | Ga0105242_10051392 | 3300009176 | Bacteria | 3358 |
| 413 | Ga0105242_10071991 | 3300009176 | Bacteria | 2870 |
| 414 | Ga0105242_10086045 | 3300009176 | Bacteria | 2637 |
| 415 | Ga0105242_10187186 | 3300009176 | Bacteria | 1830 |
| 416 | Ga0105248_10001335 | 3300009177 | Bacteria | 27466 |
| 417 | Ga0105248_10036278 | 3300009177 | Bacteria | 5514 |
| 418 | Ga0105248_10230078 | 3300009177 | Bacteria | 2087 |
| 419 | Ga0105237_10008523 | 3300009545 | Bacteria | 11087 |
| 420 | Ga0105237_10083778 | 3300009545 | Bacteria | 3179 |
| 421 | Ga0105237_10258915 | 3300009545 | Bacteria | 1742 |
| 422 | Ga0105238_10008420 | 3300009551 | Bacteria | 10324 |
| 423 | Ga0105238_10171448 | 3300009551 | Bacteria | 2146 |
| 424 | Ga0105238_10359719 | 3300009551 | Bacteria | 1445 |
| 425 | Ga0105249_10000215 | 3300009553 | Bacteria | 66439 |
| 426 | Ga0105249_10004272 | 3300009553 | Bacteria | 12349 |
| 427 | Ga0105249_10009891 | 3300009553 | Bacteria | 8360 |
| 428 | Ga0105249_10239953 | 3300009553 | Bacteria | 1791 |
| 429 | Ga0105249_10495012 | 3300009553 | Bacteria | 1267 |
| 430 | Ga0105249_10538886 | 3300009553 | Bacteria | 1216 |
| 431 | Ga0105249_10650255 | 3300009553 | Bacteria | 1112 |
| 432 | Ga0105249_10911171 | 3300009553 | Bacteria | 946 |
| 433 | Ga0099796_10023513 | 3300010159 | Bacteria | 1925 |
| 434 | Ga0105239_10012264 | 3300010375 | Bacteria | 9548 |
| 435 | Ga0105239_10085291 | 3300010375 | Bacteria | 3480 |
| 436 | Ga0105239_10175361 | 3300010375 | Bacteria | 2398 |
| 437 | Ga0105246_10000019 | 3300011119 | Bacteria | 62666 |
| 438 | Ga0105246_10017617 | 3300011119 | Bacteria | 4543 |
| 439 | Ga0105246_10055648 | 3300011119 | Bacteria | 2731 |
| 440 | Ga0105246_10072338 | 3300011119 | Bacteria | 2431 |
| 441 | Ga0105246_10119563 | 3300011119 | Bacteria | 1950 |
| 442 | Ga0105246_10512762 | 3300011119 | Bacteria | 1020 |
| 443 | Ga0105246_10612699 | 3300011119 | Bacteria | 942 |
| 444 | Ga0157345_1002449 | 3300012498 | Bacteria | 1313 |
| 445 | Ga0157373_10449838 | 3300013100 | Bacteria | 927 |
| 446 | Ga0157371_10018237 | 3300013102 | Bacteria | 5192 |
| 447 | Ga0157371_10053792 | 3300013102 | Bacteria | 2859 |
| 448 | Ga0157370_10016547 | 3300013104 | Bacteria | 7461 |
| 449 | Ga0157370_10205810 | 3300013104 | Bacteria | 1825 |
| 450 | Ga0157370_10572688 | 3300013104 | Bacteria | 1035 |
| 451 | Ga0157369_10557568 | 3300013105 | Bacteria | 1184 |
| 452 | Ga0157374_10013571 | 3300013296 | Bacteria | 7115 |
| 453 | Ga0157374_10092708 | 3300013296 | Bacteria | 2883 |
| 454 | Ga0157374_10246546 | 3300013296 | Bacteria | 1757 |
| 455 | Ga0157374_10855088 | 3300013296 | Bacteria | 927 |
| 456 | Ga0157378_10168915 | 3300013297 | Bacteria | 2050 |
| 457 | Ga0157378_10673985 | 3300013297 | Bacteria | 1052 |
| 458 | Ga0163162_10001187 | 3300013306 | Bacteria | 24299 |
| 459 | Ga0163162_10091452 | 3300013306 | Bacteria | 3126 |
| 460 | Ga0163162_10118403 | 3300013306 | Bacteria | 2750 |
| 461 | Ga0163162_10194139 | 3300013306 | Bacteria | 2158 |
| 462 | Ga0163162_10566275 | 3300013306 | Bacteria | 1264 |
| 463 | Ga0157372_10104810 | 3300013307 | Bacteria | 3234 |
| 464 | Ga0157372_10130301 | 3300013307 | Bacteria | 2893 |
| 465 | Ga0157372_10972062 | 3300013307 | Bacteria | 984 |
| 466 | Ga0157375_10000135 | 3300013308 | Bacteria | 73281 |
| 467 | Ga0157375_10112760 | 3300013308 | Bacteria | 2820 |
| 468 | Ga0157375_10149043 | 3300013308 | Bacteria | 2473 |
| 469 | Ga0157375_10235765 | 3300013308 | Bacteria | 1989 |
| 470 | Ga0157375_10272416 | 3300013308 | Bacteria | 1855 |
| 471 | Ga0163163_10001813 | 3300014325 | Bacteria | 18018 |
| 472 | Ga0163163_10037509 | 3300014325 | Bacteria | 4715 |
| 473 | Ga0163163_10081539 | 3300014325 | Bacteria | 3237 |
| 474 | Ga0163163_10133163 | 3300014325 | Bacteria | 2526 |
| 475 | Ga0163163_10259552 | 3300014325 | Bacteria | 1788 |
| 476 | Ga0157380_10000284 | 3300014326 | Bacteria | 30507 |
| 477 | Ga0157380_10009510 | 3300014326 | Bacteria | 6970 |
| 478 | Ga0157380_10045169 | 3300014326 | Bacteria | 3456 |
| 479 | Ga0157380_10339269 | 3300014326 | Bacteria | 1401 |
| 480 | Ga0182008_10023306 | 3300014497 | Bacteria | 3164 |
| 481 | Ga0157377_10000076 | 3300014745 | Bacteria | 75835 |
| 482 | Ga0157377_10009804 | 3300014745 | Bacteria | 4718 |
| 483 | Ga0157379_10000065 | 3300014968 | Bacteria | 67475 |
| 484 | Ga0157379_10028167 | 3300014968 | Bacteria | 5000 |
| 485 | Ga0157379_10053984 | 3300014968 | Bacteria | 3590 |
| 486 | Ga0157379_10143288 | 3300014968 | Bacteria | 2155 |
| 487 | Ga0157379_10268760 | 3300014968 | Bacteria | 1550 |
| 488 | Ga0157379_10491284 | 3300014968 | Bacteria | 1137 |
| 489 | Ga0157376_10000180 | 3300014969 | Bacteria | 43524 |
| 490 | Ga0157376_10169568 | 3300014969 | Bacteria | 1986 |
| 491 | Ga0163161_10000421 | 3300017792 | Bacteria | 35625 |
| 492 | Ga0163161_10057300 | 3300017792 | Bacteria | 2831 |
| 493 | Ga0163161_10122388 | 3300017792 | Bacteria | 1956 |
| 494 | Ga0163161_10245987 | 3300017792 | Bacteria | 1393 |
| 495 | Ga0206353_10191222 | 3300020082 | Bacteria | 2702 |
| 496 | Ga0213876_10027568 | 3300021384 | Bacteria | 2997 |
| 497 | Ga0213876_10077420 | 3300021384 | Bacteria | 1757 |
| 498 | Ga0213875_10000007 | 3300021388 | Bacteria | 562717 |
| 499 | Ga0207666_1000354 | 3300025271 | Bacteria | 6296 |
| 500 | Ga0207666_1000418 | 3300025271 | Bacteria | 5541 |
| 501 | Ga0207673_1000514 | 3300025290 | Bacteria | 4096 |
| 502 | Ga0209758_1006420 | 3300025297 | Bacteria | 8462 |
| 503 | Ga0207697_10000370 | 3300025315 | Bacteria | 25198 |
| 504 | Ga0207697_10006177 | 3300025315 | Bacteria | 5460 |
| 505 | Ga0207653_10000520 | 3300025885 | Bacteria | 14672 |
| 506 | Ga0207682_10000304 | 3300025893 | Bacteria | 22182 |
| 507 | Ga0207682_10001407 | 3300025893 | Bacteria | 11113 |
| 508 | Ga0207692_10011547 | 3300025898 | Bacteria | 3764 |
| 509 | Ga0207692_10028953 | 3300025898 | Bacteria | 2626 |
| 510 | Ga0207692_10061264 | 3300025898 | Bacteria | 1949 |
| 511 | Ga0207642_10000516 | 3300025899 | Bacteria | 11828 |
| 512 | Ga0207642_10046913 | 3300025899 | Bacteria | 1928 |
| 513 | Ga0207642_10118703 | 3300025899 | Bacteria | 1360 |
| 514 | Ga0207710_10037210 | 3300025900 | Bacteria | 2149 |
| 515 | Ga0207688_10000014 | 3300025901 | Bacteria | 59269 |
| 516 | Ga0207688_10039446 | 3300025901 | Bacteria | 2623 |
| 517 | Ga0207688_10174572 | 3300025901 | Bacteria | 1279 |
| 518 | Ga0207680_10070512 | 3300025903 | Bacteria | 2164 |
| 519 | Ga0207647_10020223 | 3300025904 | Bacteria | 4465 |
| 520 | Ga0207647_10129062 | 3300025904 | Bacteria | 1487 |
| 521 | Ga0207685_10005940 | 3300025905 | Bacteria | 3275 |
| 522 | Ga0207699_10016141 | 3300025906 | Bacteria | 3898 |
| 523 | Ga0207699_10019327 | 3300025906 | Bacteria | 3631 |
| 524 | Ga0207699_10058845 | 3300025906 | Bacteria | 2300 |
| 525 | Ga0207699_10090308 | 3300025906 | Bacteria | 1922 |
| 526 | Ga0207699_10119296 | 3300025906 | Bacteria | 1703 |
| 527 | Ga0207645_10000160 | 3300025907 | Bacteria | 53155 |
| 528 | Ga0207645_10015986 | 3300025907 | Bacteria | 4971 |
| 529 | Ga0207645_10033351 | 3300025907 | Bacteria | 3310 |
| 530 | Ga0207645_10039871 | 3300025907 | Bacteria | 3009 |
| 531 | Ga0207645_10056603 | 3300025907 | Bacteria | 2503 |
| 532 | Ga0207643_10000009 | 3300025908 | Bacteria | 160496 |
| 533 | Ga0207643_10013114 | 3300025908 | Bacteria | 4484 |
| 534 | Ga0207643_10043613 | 3300025908 | Bacteria | 2532 |
| 535 | Ga0207705_10071868 | 3300025909 | Bacteria | 2509 |
| 536 | Ga0207705_10141416 | 3300025909 | Bacteria | 1797 |
| 537 | Ga0207684_10182839 | 3300025910 | Bacteria | 1808 |
| 538 | Ga0207654_10000441 | 3300025911 | Bacteria | 23641 |
| 539 | Ga0207654_10089393 | 3300025911 | Bacteria | 1874 |
| 540 | Ga0207707_10000554 | 3300025912 | Bacteria | 37851 |
| 541 | Ga0207707_10062090 | 3300025912 | Bacteria | 3251 |
| 542 | Ga0207707_10079079 | 3300025912 | Bacteria | 2871 |
| 543 | Ga0207707_10092039 | 3300025912 | Bacteria | 2650 |
| 544 | Ga0207707_10206367 | 3300025912 | Bacteria | 1712 |
| 545 | Ga0207695_10074067 | 3300025913 | Bacteria | 3467 |
| 546 | Ga0207671_10019030 | 3300025914 | Bacteria | 5260 |
| 547 | Ga0207671_10229462 | 3300025914 | Bacteria | 1456 |
| 548 | Ga0207671_10242468 | 3300025914 | Bacteria | 1416 |
| 549 | Ga0207693_10005726 | 3300025915 | Bacteria | 10319 |
| 550 | Ga0207693_10067856 | 3300025915 | Bacteria | 2792 |
| 551 | Ga0207693_10073182 | 3300025915 | Bacteria | 2683 |
| 552 | Ga0207693_10077596 | 3300025915 | Bacteria | 2601 |
| 553 | Ga0207693_10124294 | 3300025915 | Bacteria | 2027 |
| 554 | Ga0207693_10279397 | 3300025915 | Bacteria | 1308 |
| 555 | Ga0207663_10006452 | 3300025916 | Bacteria | 6001 |
| 556 | Ga0207663_10013217 | 3300025916 | Bacteria | 4484 |
| 557 | Ga0207663_10171491 | 3300025916 | Bacteria | 1541 |
| 558 | Ga0207663_10244686 | 3300025916 | Bacteria | 1317 |
| 559 | Ga0207663_10284356 | 3300025916 | Bacteria | 1230 |
| 560 | Ga0207660_10000161 | 3300025917 | Bacteria | 41972 |
| 561 | Ga0207660_10006228 | 3300025917 | Bacteria | 7749 |
| 562 | Ga0207660_10054812 | 3300025917 | Bacteria | 2846 |
| 563 | Ga0207660_10094455 | 3300025917 | Bacteria | 2223 |
| 564 | Ga0207660_10138442 | 3300025917 | Bacteria | 1859 |
| 565 | Ga0207662_10001074 | 3300025918 | Bacteria | 12850 |
| 566 | Ga0207662_10011994 | 3300025918 | Bacteria | 4820 |
| 567 | Ga0207662_10013455 | 3300025918 | Bacteria | 4577 |
| 568 | Ga0207662_10049759 | 3300025918 | Bacteria | 2487 |
| 569 | Ga0207662_10082683 | 3300025918 | Bacteria | 1962 |
| 570 | Ga0207657_10000294 | 3300025919 | Bacteria | 53220 |
| 571 | Ga0207657_10017327 | 3300025919 | Bacteria | 6911 |
| 572 | Ga0207657_10019363 | 3300025919 | Bacteria | 6466 |
| 573 | Ga0207657_10044754 | 3300025919 | Bacteria | 3889 |
| 574 | Ga0207657_10065546 | 3300025919 | Bacteria | 3096 |
| 575 | Ga0207657_10071664 | 3300025919 | Bacteria | 2934 |
| 576 | Ga0207649_10000429 | 3300025920 | Bacteria | 30596 |
| 577 | Ga0207649_10050379 | 3300025920 | Bacteria | 2575 |
| 578 | Ga0207652_10044984 | 3300025921 | Bacteria | 3763 |
| 579 | Ga0207652_10045984 | 3300025921 | Bacteria | 3723 |
| 580 | Ga0207652_10129523 | 3300025921 | Bacteria | 2250 |
| 581 | Ga0207652_10207576 | 3300025921 | Bacteria | 1763 |
| 582 | Ga0207652_10422727 | 3300025921 | Bacteria | 1202 |
| 583 | Ga0207652_10502035 | 3300025921 | Bacteria | 1092 |
| 584 | Ga0207646_10655492 | 3300025922 | Bacteria | 940 |
| 585 | Ga0207681_10000035 | 3300025923 | Bacteria | 161792 |
| 586 | Ga0207681_10043294 | 3300025923 | Bacteria | 3013 |
| 587 | Ga0207681_10094415 | 3300025923 | Bacteria | 2143 |
| 588 | Ga0207681_10147070 | 3300025923 | Bacteria | 1762 |
| 589 | Ga0207681_10184442 | 3300025923 | Bacteria | 1592 |
| 590 | Ga0207694_10006222 | 3300025924 | Bacteria | 9117 |
| 591 | Ga0207694_10292956 | 3300025924 | Bacteria | 1339 |
| 592 | Ga0207694_10409336 | 3300025924 | Bacteria | 1128 |
| 593 | Ga0207650_10009941 | 3300025925 | Bacteria | 6510 |
| 594 | Ga0207650_10063852 | 3300025925 | Bacteria | 2755 |
| 595 | Ga0207650_10088741 | 3300025925 | Bacteria | 2359 |
| 596 | Ga0207659_10000027 | 3300025926 | Bacteria | 135454 |
| 597 | Ga0207659_10012080 | 3300025926 | Bacteria | 5476 |
| 598 | Ga0207659_10075169 | 3300025926 | Bacteria | 2478 |
| 599 | Ga0207659_10153856 | 3300025926 | Bacteria | 1798 |
| 600 | Ga0207659_10407600 | 3300025926 | Bacteria | 1138 |
| 601 | Ga0207687_10000551 | 3300025927 | Bacteria | 25176 |
| 602 | Ga0207687_10008252 | 3300025927 | Bacteria | 6813 |
| 603 | Ga0207687_10375268 | 3300025927 | Bacteria | 1164 |
| 604 | Ga0207687_10438217 | 3300025927 | Bacteria | 1082 |
| 605 | Ga0207687_10589573 | 3300025927 | Bacteria | 936 |
| 606 | Ga0207700_10016032 | 3300025928 | Bacteria | 4967 |
| 607 | Ga0207700_10020626 | 3300025928 | Bacteria | 4480 |
| 608 | Ga0207664_10024052 | 3300025929 | Bacteria | 4574 |
| 609 | Ga0207664_10068193 | 3300025929 | Bacteria | 2857 |
| 610 | Ga0207664_10210958 | 3300025929 | Bacteria | 1680 |
| 611 | Ga0207664_10218888 | 3300025929 | Bacteria | 1650 |
| 612 | Ga0207664_10770232 | 3300025929 | Bacteria | 866 |
| 613 | Ga0207644_10003065 | 3300025931 | Bacteria | 10760 |
| 614 | Ga0207644_10024126 | 3300025931 | Bacteria | 4172 |
| 615 | Ga0207644_10024425 | 3300025931 | Bacteria | 4149 |
| 616 | Ga0207644_10053710 | 3300025931 | Bacteria | 2900 |
| 617 | Ga0207690_10000056 | 3300025932 | Bacteria | 101387 |
| 618 | Ga0207690_10065219 | 3300025932 | Bacteria | 2489 |
| 619 | Ga0207690_10067561 | 3300025932 | Bacteria | 2452 |
| 620 | Ga0207690_10728654 | 3300025932 | Bacteria | 816 |
| 621 | Ga0207706_10000307 | 3300025933 | Bacteria | 52944 |
| 622 | Ga0207706_10019938 | 3300025933 | Bacteria | 6027 |
| 623 | Ga0207706_10020976 | 3300025933 | Bacteria | 5868 |
| 624 | Ga0207706_10058718 | 3300025933 | Bacteria | 3388 |
| 625 | Ga0207706_10158375 | 3300025933 | Bacteria | 1991 |
| 626 | Ga0207706_10299417 | 3300025933 | Bacteria | 1401 |
| 627 | Ga0207686_10001582 | 3300025934 | Bacteria | 12793 |
| 628 | Ga0207686_10020326 | 3300025934 | Bacteria | 3791 |
| 629 | Ga0207686_10057612 | 3300025934 | Bacteria | 2446 |
| 630 | Ga0207686_10171744 | 3300025934 | Bacteria | 1529 |
| 631 | Ga0207686_10212601 | 3300025934 | Bacteria | 1391 |
| 632 | Ga0207686_10355561 | 3300025934 | Bacteria | 1104 |
| 633 | Ga0207709_10000087 | 3300025935 | Bacteria | 155019 |
| 634 | Ga0207709_10009741 | 3300025935 | Bacteria | 5295 |
| 635 | Ga0207709_10100890 | 3300025935 | Bacteria | 1908 |
| 636 | Ga0207709_10199865 | 3300025935 | Bacteria | 1427 |
| 637 | Ga0207709_10485754 | 3300025935 | Bacteria | 961 |
| 638 | Ga0207670_10000263 | 3300025936 | Bacteria | 32926 |
| 639 | Ga0207670_10006655 | 3300025936 | Bacteria | 6427 |
| 640 | Ga0207670_10008975 | 3300025936 | Bacteria | 5673 |
| 641 | Ga0207670_10083194 | 3300025936 | Bacteria | 2244 |
| 642 | Ga0207670_10280398 | 3300025936 | Bacteria | 1298 |
| 643 | Ga0207670_10381171 | 3300025936 | Bacteria | 1123 |
| 644 | Ga0207669_10000052 | 3300025937 | Bacteria | 58284 |
| 645 | Ga0207669_10036794 | 3300025937 | Bacteria | 2801 |
| 646 | Ga0207669_10076172 | 3300025937 | Bacteria | 2128 |
| 647 | Ga0207669_10167638 | 3300025937 | Bacteria | 1559 |
| 648 | Ga0207669_10571722 | 3300025937 | Bacteria | 915 |
| 649 | Ga0207704_10000063 | 3300025938 | Bacteria | 74699 |
| 650 | Ga0207704_10008777 | 3300025938 | Bacteria | 4851 |
| 651 | Ga0207704_10044292 | 3300025938 | Bacteria | 2635 |
| 652 | Ga0207704_10071364 | 3300025938 | Bacteria | 2204 |
| 653 | Ga0207704_10221861 | 3300025938 | Bacteria | 1399 |
| 654 | Ga0207665_10017994 | 3300025939 | Bacteria | 4643 |
| 655 | Ga0207691_10000167 | 3300025940 | Bacteria | 60999 |
| 656 | Ga0207691_10121820 | 3300025940 | Bacteria | 2311 |
| 657 | Ga0207691_10144301 | 3300025940 | Bacteria | 2096 |
| 658 | Ga0207711_10017811 | 3300025941 | Bacteria | 5902 |
| 659 | Ga0207711_10025629 | 3300025941 | Bacteria | 4946 |
| 660 | Ga0207711_10538050 | 3300025941 | Bacteria | 1089 |
| 661 | Ga0207689_10000155 | 3300025942 | Bacteria | 59178 |
| 662 | Ga0207689_10330343 | 3300025942 | Bacteria | 1266 |
| 663 | Ga0207661_10000072 | 3300025944 | Bacteria | 69126 |
| 664 | Ga0207661_10089894 | 3300025944 | Bacteria | 2556 |
| 665 | Ga0207661_10299170 | 3300025944 | Bacteria | 1442 |
| 666 | Ga0207661_10444650 | 3300025944 | Bacteria | 1180 |
| 667 | Ga0207679_10000057 | 3300025945 | Bacteria | 104912 |
| 668 | Ga0207679_10017981 | 3300025945 | Bacteria | 4725 |
| 669 | Ga0207679_10119066 | 3300025945 | Bacteria | 2099 |
| 670 | Ga0207679_10228952 | 3300025945 | Bacteria | 1568 |
| 671 | Ga0207679_10259106 | 3300025945 | Bacteria | 1482 |
| 672 | Ga0207667_10010749 | 3300025949 | Bacteria | 10676 |
| 673 | Ga0207667_10027211 | 3300025949 | Bacteria | 6230 |
| 674 | Ga0207667_10199854 | 3300025949 | Bacteria | 2051 |
| 675 | Ga0207667_10235146 | 3300025949 | Bacteria | 1876 |
| 676 | Ga0207667_10289964 | 3300025949 | Bacteria | 1672 |
| 677 | Ga0207667_10652522 | 3300025949 | Bacteria | 1058 |
| 678 | Ga0207651_10000087 | 3300025960 | Bacteria | 41160 |
| 679 | Ga0207651_10118903 | 3300025960 | Bacteria | 2000 |
| 680 | Ga0207651_10420012 | 3300025960 | Bacteria | 1141 |
| 681 | Ga0207651_10476253 | 3300025960 | Bacteria | 1075 |
| 682 | Ga0207712_10000122 | 3300025961 | Bacteria | 83730 |
| 683 | Ga0207712_10009565 | 3300025961 | Bacteria | 6137 |
| 684 | Ga0207712_10010640 | 3300025961 | Bacteria | 5841 |
| 685 | Ga0207712_10227563 | 3300025961 | Bacteria | 1495 |
| 686 | Ga0207668_10000084 | 3300025972 | Bacteria | 70850 |
| 687 | Ga0207668_10013912 | 3300025972 | Bacteria | 4969 |
| 688 | Ga0207668_10026818 | 3300025972 | Bacteria | 3747 |
| 689 | Ga0207668_10187872 | 3300025972 | Bacteria | 1635 |
| 690 | Ga0207668_10223093 | 3300025972 | Bacteria | 1515 |
| 691 | Ga0207640_10001027 | 3300025981 | Bacteria | 15422 |
| 692 | Ga0207640_10076067 | 3300025981 | Bacteria | 2277 |
| 693 | Ga0207640_10117964 | 3300025981 | Bacteria | 1895 |
| 694 | Ga0207658_10003107 | 3300025986 | Bacteria | 11882 |
| 695 | Ga0207658_10140058 | 3300025986 | Bacteria | 1956 |
| 696 | Ga0207658_10188724 | 3300025986 | Bacteria | 1711 |
| 697 | Ga0207677_10012206 | 3300026023 | Bacteria | 4929 |
| 698 | Ga0207703_10001870 | 3300026035 | Bacteria | 18725 |
| 699 | Ga0207703_10003716 | 3300026035 | Bacteria | 12702 |
| 700 | Ga0207703_10022833 | 3300026035 | Bacteria | 4914 |
| 701 | Ga0207703_10324813 | 3300026035 | Bacteria | 1410 |
| 702 | Ga0207639_10001925 | 3300026041 | Bacteria | 13946 |
| 703 | Ga0207639_10690883 | 3300026041 | Bacteria | 946 |
| 704 | Ga0207678_10000187 | 3300026067 | Bacteria | 53154 |
| 705 | Ga0207678_10027928 | 3300026067 | Bacteria | 4926 |
| 706 | Ga0207678_10037590 | 3300026067 | Bacteria | 4210 |
| 707 | Ga0207678_10055576 | 3300026067 | Bacteria | 3410 |
| 708 | Ga0207678_10066744 | 3300026067 | Bacteria | 3088 |
| 709 | Ga0207708_10000158 | 3300026075 | Bacteria | 53154 |
| 710 | Ga0207708_10000296 | 3300026075 | Bacteria | 39206 |
| 711 | Ga0207708_10002015 | 3300026075 | Bacteria | 14967 |
| 712 | Ga0207708_10002641 | 3300026075 | Bacteria | 13186 |
| 713 | Ga0207708_10058689 | 3300026075 | Bacteria | 2936 |
| 714 | Ga0207708_10629646 | 3300026075 | Bacteria | 911 |
| 715 | Ga0207702_10001960 | 3300026078 | Bacteria | 20035 |
| 716 | Ga0207702_10063916 | 3300026078 | Bacteria | 3149 |
| 717 | Ga0207702_10172352 | 3300026078 | Bacteria | 1985 |
| 718 | Ga0207702_10248625 | 3300026078 | Bacteria | 1669 |
| 719 | Ga0207702_10340705 | 3300026078 | Bacteria | 1432 |
| 720 | Ga0207702_10342006 | 3300026078 | Bacteria | 1429 |
| 721 | Ga0207702_10415663 | 3300026078 | Bacteria | 1300 |
| 722 | Ga0207641_10000896 | 3300026088 | Bacteria | 31014 |
| 723 | Ga0207641_10031874 | 3300026088 | Bacteria | 4373 |
| 724 | Ga0207648_10001167 | 3300026089 | Bacteria | 29390 |
| 725 | Ga0207648_10003124 | 3300026089 | Bacteria | 17485 |
| 726 | Ga0207648_10094370 | 3300026089 | Bacteria | 2616 |
| 727 | Ga0207648_10156264 | 3300026089 | Bacteria | 2013 |
| 728 | Ga0207676_10000089 | 3300026095 | Bacteria | 82462 |
| 729 | Ga0207676_10018700 | 3300026095 | Bacteria | 5043 |
| 730 | Ga0207676_10127658 | 3300026095 | Bacteria | 2156 |
| 731 | Ga0207674_10001478 | 3300026116 | Bacteria | 30348 |
| 732 | Ga0207674_10012981 | 3300026116 | Bacteria | 9286 |
| 733 | Ga0207674_10048193 | 3300026116 | Bacteria | 4361 |
| 734 | Ga0207674_10055121 | 3300026116 | Bacteria | 4044 |
| 735 | Ga0207674_10146357 | 3300026116 | Bacteria | 2321 |
| 736 | Ga0207674_10289726 | 3300026116 | Bacteria | 1586 |
| 737 | Ga0207675_100000229 | 3300026118 | Bacteria | 52966 |
| 738 | Ga0207675_100111466 | 3300026118 | Bacteria | 2582 |
| 739 | Ga0207675_100134223 | 3300026118 | Bacteria | 2347 |
| 740 | Ga0207683_10000525 | 3300026121 | Bacteria | 35508 |
| 741 | Ga0207683_10006495 | 3300026121 | Bacteria | 10006 |
| 742 | Ga0207683_10010816 | 3300026121 | Bacteria | 7781 |
| 743 | Ga0207683_10022729 | 3300026121 | Bacteria | 5386 |
| 744 | Ga0207683_10319679 | 3300026121 | Bacteria | 1422 |
| 745 | Ga0207698_10000474 | 3300026142 | Bacteria | 23337 |
| 746 | Ga0207698_10089517 | 3300026142 | Bacteria | 2514 |
| 747 | Ga0207698_10365216 | 3300026142 | Bacteria | 1368 |
| 748 | Ga0207698_10503186 | 3300026142 | Bacteria | 1179 |
| 749 | Ga0209982_1006987 | 3300027552 | Bacteria | 1649 |
| 750 | Ga0210002_1006040 | 3300027617 | Bacteria | 1821 |
| 751 | Ga0209971_1004003 | 3300027682 | Bacteria | 3483 |
| 752 | Ga0209971_1014968 | 3300027682 | Bacteria | 1838 |
| 753 | Ga0209998_10001800 | 3300027717 | Bacteria | 5072 |
| 754 | Ga0209998_10002157 | 3300027717 | Bacteria | 4579 |
| 755 | Ga0209813_10007333 | 3300027866 | Bacteria | 2746 |
| 756 | Ga0209813_10007971 | 3300027866 | Bacteria | 2659 |
| 757 | Ga0209813_10122766 | 3300027866 | Bacteria | 906 |
| 758 | Ga0209974_10019819 | 3300027876 | Bacteria | 2229 |
| 759 | Ga0209974_10027444 | 3300027876 | Bacteria | 1884 |
| 760 | Ga0207428_10000037 | 3300027907 | Bacteria | 218857 |
| 761 | Ga0207428_10000308 | 3300027907 | Bacteria | 64810 |
| 762 | Ga0207428_10000474 | 3300027907 | Bacteria | 48360 |
| 763 | Ga0207428_10063820 | 3300027907 | Bacteria | 2909 |
| 764 | Ga0207428_10105304 | 3300027907 | Bacteria | 2175 |
| 765 | Ga0207428_10113451 | 3300027907 | Bacteria | 2083 |
| 766 | Ga0268266_10024123 | 3300028379 | Bacteria | 5175 |
| 767 | Ga0268266_10033960 | 3300028379 | Bacteria | 4335 |
| 768 | Ga0268266_10578734 | 3300028379 | Bacteria | 1077 |
| 769 | Ga0268265_10000195 | 3300028380 | Bacteria | 70871 |
| 770 | Ga0268265_10000508 | 3300028380 | Bacteria | 40027 |
| 771 | Ga0268265_10014611 | 3300028380 | Bacteria | 5353 |
| 772 | Ga0268265_10293639 | 3300028380 | Bacteria | 1460 |
| 773 | Ga0268264_10000526 | 3300028381 | Bacteria | 48503 |
| 774 | Ga0268264_10005989 | 3300028381 | Bacteria | 10296 |
| 775 | Ga0268264_10052107 | 3300028381 | Bacteria | 3412 |
| 776 | Ga0268264_10220840 | 3300028381 | Bacteria | 1744 |
| 777 | Ga0265337_1002502 | 3300028556 | Bacteria | 8378 |
| 778 | Ga0265318_10004336 | 3300028577 | Bacteria | 6891 |
| 779 | Ga0265338_10022782 | 3300028800 | Bacteria | 6466 |
| 780 | Ga0265330_10029811 | 3300031235 | Bacteria | 2451 |
| 781 | Ga0265330_10086147 | 3300031235 | Bacteria | 1351 |
| 782 | Ga0265332_10006780 | 3300031238 | Bacteria | 5190 |
| 783 | Ga0265332_10102177 | 3300031238 | Bacteria | 1209 |
| 784 | Ga0265320_10031514 | 3300031240 | Bacteria | 2722 |
| 785 | Ga0265325_10000126 | 3300031241 | Bacteria | 52410 |
| 786 | Ga0265325_10000352 | 3300031241 | Bacteria | 32405 |
| 787 | Ga0265325_10010060 | 3300031241 | Bacteria | 5494 |
| 788 | Ga0265325_10016900 | 3300031241 | Bacteria | 4068 |
| 789 | Ga0265329_10029030 | 3300031242 | Archaea | 1811 |
| 790 | Ga0265329_10034663 | 3300031242 | Bacteria | 1630 |
| 791 | Ga0265340_10000192 | 3300031247 | Bacteria | 30626 |
| 792 | Ga0265340_10018794 | 3300031247 | Bacteria | 3562 |
| 793 | Ga0265340_10026222 | 3300031247 | Bacteria | 2947 |
| 794 | Ga0265340_10033433 | 3300031247 | Bacteria | 2560 |
| 795 | Ga0265340_10056591 | 3300031247 | Bacteria | 1886 |
| 796 | Ga0265340_10146659 | 3300031247 | Bacteria | 1077 |
| 797 | Ga0265339_10007994 | 3300031249 | Bacteria | 6782 |
| 798 | Ga0265339_10010090 | 3300031249 | Bacteria | 5885 |
| 799 | Ga0265339_10124935 | 3300031249 | Bacteria | 1320 |
| 800 | Ga0265339_10150565 | 3300031249 | Bacteria | 1177 |
| 801 | Ga0265316_10278928 | 3300031344 | Bacteria | 1221 |
| 802 | Ga0265313_10000106 | 3300031595 | Bacteria | 83923 |
| 803 | Ga0265313_10006310 | 3300031595 | Bacteria | 8441 |
| 804 | Ga0265313_10014074 | 3300031595 | Bacteria | 4758 |
| 805 | Ga0265313_10020932 | 3300031595 | Bacteria | 3591 |
| 806 | Ga0265313_10097307 | 3300031595 | Bacteria | 1311 |
| 807 | Ga0307508_10016695 | 3300031616 | Bacteria | 6680 |
| 808 | Ga0316575_10111479 | 3300031665 | Bacteria | 1116 |
| 809 | Ga0316579_10109015 | 3300031691 | Bacteria | 1328 |
| 810 | Ga0265314_10005573 | 3300031711 | Bacteria | 11319 |
| 811 | Ga0265314_10107268 | 3300031711 | Bacteria | 1782 |
| 812 | Ga0265342_10000100 | 3300031712 | Bacteria | 94554 |
| 813 | Ga0265342_10000882 | 3300031712 | Bacteria | 29894 |
| 814 | Ga0265342_10039481 | 3300031712 | Bacteria | 2868 |
| 815 | Ga0307413_10774705 | 3300031824 | Bacteria | 804 |
| 816 | Ga0307416_100724120 | 3300032002 | Bacteria | 1086 |
| 817 | Ga0307416_100811174 | 3300032002 | Bacteria | 1032 |
| 818 | Ga0307411_10153015 | 3300032005 | Bacteria | 1717 |
| 819 | Ga0307415_100381532 | 3300032126 | Bacteria | 1197 |
| 820 | Ga0316583_10000161 | 3300032133 | Bacteria | 16491 |
| 821 | Ga0316583_10093777 | 3300032133 | Bacteria | 1047 |
| 822 | Ga0307510_10260030 | 3300033180 | Bacteria | 1217 |
| 823 | Ga0373930_0000020 | 3300034816 | Bacteria | 15356 |
| 824 | Ga0373930_0001897 | 3300034816 | Bacteria | 3188 |
| 825 | Ga0373948_0000775 | 3300034817 | Bacteria | 4185 |
| 826 | Ga0373948_0003627 | 3300034817 | Bacteria | 2388 |
| 827 | Ga0373950_0002092 | 3300034818 | Bacteria | 2710 |
| 828 | Ga0373950_0002937 | 3300034818 | Bacteria | 2400 |
| 829 | Ga0373958_0000679 | 3300034819 | Bacteria | 4307 |
| 830 | Ga0373958_0000892 | 3300034819 | Bacteria | 3849 |
| 831 | Ga0373959_0002322 | 3300034820 | Bacteria | 3024 |
| 832 | Ga0373959_0004634 | 3300034820 | Bacteria | 2224 |
| 833 | Ga0373938_0000321 | 3300034957 | Bacteria | 7652 |
| 834 | Ga0373938_0001943 | 3300034957 | Bacteria | 3313 |
| 835 | Ga0373926_0005663 | 3300035083 | Bacteria | 4122 |
| 836 | Ga0373926_0031996 | 3300035083 | Bacteria | 1856 |
| 837 | Ga0373926_0047484 | 3300035083 | Bacteria | 1542 |
| 838 | Ga0373926_0102616 | 3300035083 | Bacteria | 1070 |
| 839 | Ga0373928_0003285 | 3300035084 | Bacteria | 3097 |
| 840 | Ga0373928_0007867 | 3300035084 | Bacteria | 2063 |
| 841 | Ga0373929_0000042 | 3300035085 | Bacteria | 29236 |
| 842 | Ga0373934_0031395 | 3300035086 | Bacteria | 2080 |
| 843 | Ga0373934_0048369 | 3300035086 | Bacteria | 1683 |
| 844 | Ga0373940_0002473 | 3300035088 | Bacteria | 3600 |
| 845 | Ga0373940_0008037 | 3300035088 | Bacteria | 2406 |
| 846 | Ga0373940_0026599 | 3300035088 | Bacteria | 1515 |
| 847 | Ga0373944_0008477 | 3300035089 | Bacteria | 2776 |
| 848 | Ga0373944_0021423 | 3300035089 | Bacteria | 1871 |
| 849 | Ga0373944_0027193 | 3300035089 | Bacteria | 1695 |
| 850 | Ga0373944_0071706 | 3300035089 | Bacteria | 1129 |
| 851 | Ga0373949_0005028 | 3300035090 | Bacteria | 2977 |
| 852 | Ga0373949_0008824 | 3300035090 | Bacteria | 2205 |
| 853 | Ga0373949_0019983 | 3300035090 | Bacteria | 1530 |
| 854 | Ga0373951_0003336 | 3300035091 | Bacteria | 3928 |
| 855 | Ga0373951_0010103 | 3300035091 | Bacteria | 2118 |
| 856 | Ga0373952_0000102 | 3300035092 | Bacteria | 11425 |
| 857 | Ga0373952_0002076 | 3300035092 | Bacteria | 3609 |
| 858 | Ga0373952_0003332 | 3300035092 | Bacteria | 2896 |
| 859 | Ga0373923_0002700 | 3300035111 | Bacteria | 5526 |
| 860 | Ga0373923_0004197 | 3300035111 | Bacteria | 4756 |
| 861 | Ga0373923_0075405 | 3300035111 | Bacteria | 1455 |
| 862 | Ga0373932_0002320 | 3300035112 | Bacteria | 4838 |
| 863 | Ga0373932_0002582 | 3300035112 | Bacteria | 4528 |
| 864 | Ga0373936_0003041 | 3300035113 | Bacteria | 6271 |
| 865 | Ga0373936_0164967 | 3300035113 | Bacteria | 966 |
| 866 | Ga0373939_0000261 | 3300035114 | Bacteria | 14162 |
| 867 | Ga0373939_0000299 | 3300035114 | Bacteria | 12900 |
| 868 | Ga0373939_0002349 | 3300035114 | Bacteria | 4475 |
| 869 | Ga0373939_0040056 | 3300035114 | Bacteria | 1405 |
| 870 | Ga0373939_0041631 | 3300035114 | Bacteria | 1385 |
| 871 | Ga0373941_0004117 | 3300035115 | Bacteria | 3336 |
| 872 | Ga0373941_0010894 | 3300035115 | Bacteria | 2337 |
| 873 | Ga0373941_0032409 | 3300035115 | Bacteria | 1564 |
| 874 | Ga0373945_0002982 | 3300035116 | Bacteria | 5316 |
| 875 | Ga0373953_0001408 | 3300035117 | Bacteria | 6943 |
| 876 | Ga0373953_0017950 | 3300035117 | Bacteria | 2609 |
| 877 | Ga0373953_0040072 | 3300035117 | Bacteria | 1859 |
| 878 | Ga0373954_0003125 | 3300035118 | Bacteria | 6995 |
| 879 | Ga0373954_0011821 | 3300035118 | Bacteria | 3876 |
| 880 | Ga0373954_0046561 | 3300035118 | Bacteria | 2028 |
| 881 | Ga0373954_0124163 | 3300035118 | Bacteria | 1254 |
| 882 | Ga0373956_0004874 | 3300035119 | Bacteria | 5373 |
| 883 | Ga0373956_0014969 | 3300035119 | Bacteria | 3244 |
| 884 | Ga0373956_0033597 | 3300035119 | Bacteria | 2256 |
| 885 | Ga0373956_0178018 | 3300035119 | Bacteria | 1005 |
| 886 | Ga0373957_0011372 | 3300035120 | Bacteria | 2970 |
| 887 | Ga0373957_0019808 | 3300035120 | Bacteria | 2371 |
| 888 | Ga0373957_0028596 | 3300035120 | Bacteria | 2032 |
| 889 | Ga0373957_0090234 | 3300035120 | Bacteria | 1217 |
| 890 | Ga0373960_0001113 | 3300035121 | Bacteria | 5796 |
| 891 | Ga0373960_0005022 | 3300035121 | Bacteria | 3050 |
| 892 | Ga0373960_0029703 | 3300035121 | Bacteria | 1517 |
| 893 | Ga0373960_0043313 | 3300035121 | Bacteria | 1310 |
| 894 | Ga0373960_0083640 | 3300035121 | Bacteria | 1009 |
| 895 | Ga0373943_0001959 | 3300035170 | Bacteria | 9321 |
| 896 | Ga0373943_0043498 | 3300035170 | Bacteria | 2181 |
| 897 | Ga0373943_0045730 | 3300035170 | Bacteria | 2134 |
| 898 | Ga0373943_0149170 | 3300035170 | Bacteria | 1266 |
| 899 | Ga0373946_0000552 | 3300035171 | Bacteria | 12398 |
| 900 | Ga0373946_0008023 | 3300035171 | Bacteria | 3877 |
| 901 | Ga0373946_0024168 | 3300035171 | Bacteria | 2378 |
| 902 | Ga0373955_0000513 | 3300035172 | Bacteria | 16479 |
| 903 | Ga0373955_0000862 | 3300035172 | Bacteria | 12983 |
| 904 | Ga0373955_0034680 | 3300035172 | Bacteria | 2668 |
| 905 | Ga0373942_0001283 | 3300035207 | Bacteria | 6569 |
| 906 | Ga0373942_0008995 | 3300035207 | Bacteria | 2334 |
| 907 | Ga0373942_0039604 | 3300035207 | Bacteria | 1282 |
| 908 | Ga0373961_0002305 | 3300035241 | Bacteria | 4987 |
| 909 | Ga0373961_0002581 | 3300035241 | Bacteria | 4662 |
| 910 | Ga0373961_0052384 | 3300035241 | Bacteria | 1215 |
| 911 | Ga0373962_0036853 | 3300035242 | Bacteria | 1364 |
| 912 | Ga0316574_0076088 | 3300035398 | Bacteria | 2126 |
| 913 | Ga0373924_0000240 | 3300035410 | Bacteria | 16742 |
| 914 | Ga0373924_0007693 | 3300035410 | Bacteria | 3894 |
| 915 | Ga0373924_0016808 | 3300035410 | Bacteria | 2799 |
| 916 | Ga0373931_0003801 | 3300035691 | Bacteria | 6830 |
| 917 | Ga0373931_0004468 | 3300035691 | Bacteria | 6393 |
| 918 | Ga0373931_0005387 | 3300035691 | Bacteria | 5910 |
| 919 | Ga0373931_0008666 | 3300035691 | Bacteria | 4835 |
| 920 | Ga0373935_0000088 | 3300035692 | Bacteria | 40092 |
| 921 | Ga0373935_0003255 | 3300035692 | Bacteria | 9390 |
| 922 | Ga0373935_0040467 | 3300035692 | Bacteria | 2925 |
| 923 | Ga0373935_0058215 | 3300035692 | Bacteria | 2468 |
| 924 | Ga0373927_0027363 | 3300035695 | Bacteria | 3723 |
| 925 | Ga0373927_0027573 | 3300035695 | Bacteria | 3707 |
| 926 | Ga0373927_0038709 | 3300035695 | Bacteria | 3095 |
| 927 | Ga0373927_0263465 | 3300035695 | Bacteria | 1133 |
| 928 | Ga0373933_0003120 | 3300035724 | Bacteria | 9238 |
| 929 | Ga0373933_0011012 | 3300035724 | Bacteria | 4969 |
| 930 | Ga0373933_0013709 | 3300035724 | Bacteria | 4497 |
| 931 | Ga0373933_0013911 | 3300035724 | Bacteria | 4465 |
| 932 | Ga0373933_0018113 | 3300035724 | Bacteria | 3957 |
| 933 | Ga0373933_0229796 | 3300035724 | Bacteria | 1191 |
| 934 | Ga0373933_0269808 | 3300035724 | Bacteria | 1098 |
| 935 | Ga0373933_0436289 | 3300035724 | Bacteria | 856 |
| 936 | Ga0373947_0001466 | 3300035725 | Bacteria | 14516 |
| 937 | Ga0373947_0001608 | 3300035725 | Bacteria | 13851 |
| 938 | Ga0373947_0007595 | 3300035725 | Bacteria | 6274 |
| 939 | Ga0373947_0077321 | 3300035725 | Bacteria | 2052 |
| 940 | Ga0373947_0160029 | 3300035725 | Bacteria | 1456 |
| 941 | Ga0373947_0333368 | 3300035725 | Bacteria | 1016 |
| 942 | Ga0373937_0000124 | 3300036401 | Bacteria | 73933 |
| 943 | Ga0373937_0007923 | 3300036401 | Bacteria | 9207 |
| 944 | Ga0373937_0010800 | 3300036401 | Bacteria | 7993 |
| 945 | Ga0373937_0049008 | 3300036401 | Bacteria | 3868 |
| 946 | Ga0373937_0067527 | 3300036401 | Bacteria | 3294 |
| 947 | Ga0373937_0096758 | 3300036401 | Bacteria | 2738 |
| 948 | Ga0373937_0309262 | 3300036401 | Bacteria | 1494 |
| 949 | Ga0373937_0730241 | 3300036401 | Bacteria | 937 |
| 950 | Ga0373925_0000929 | 3300037068 | Bacteria | 26669 |
| 951 | Ga0373925_0025220 | 3300037068 | Bacteria | 4341 |
| 952 | Ga0373925_0030267 | 3300037068 | Bacteria | 3974 |
| 953 | Ga0373925_0131102 | 3300037068 | Bacteria | 1954 |
| 954 | Ga0373925_0200772 | 3300037068 | Bacteria | 1585 |
| 955 | Ga0373925_0618602 | 3300037068 | Bacteria | 892 |
| 956 | Ga0395899_0007959 | 3300037312 | Bacteria | 8164 |
| 957 | Ga0395899_0065556 | 3300037312 | Bacteria | 2669 |
| 958 | Ga0395900_0005074 | 3300037418 | Bacteria | 13816 |
| 959 | Ga0395900_0008149 | 3300037418 | Bacteria | 10783 |
| 960 | Ga0395898_0012968 | 3300037466 | Bacteria | 8594 |
| 961 | Ga0395898_0019972 | 3300037466 | Bacteria | 6813 |
| 962 | Ga0395898_0044004 | 3300037466 | Bacteria | 4398 |
| 963 | Ga0436364_0320537 | 3300037853 | Bacteria | 1050 |
| 964 | Ga0436364_0461857 | 3300037853 | Bacteria | 19352 |
| 965 | Ga0436364_0934985 | 3300037853 | Bacteria | 2733 |
| 966 | Ga0395901_0048458 | 3300038443 | Bacteria | 4412 |
| 967 | Ga0395901_0104341 | 3300038443 | Bacteria | 2975 |
| 968 | Ga0436365_0067390 | 3300039437 | Bacteria | 6814 |
| 969 | Ga0436365_0459020 | 3300039437 | Bacteria | 2358 |
| 970 | Ga0436365_1235938 | 3300039437 | Bacteria | 3518 |
| 971 | Ga0436361_0431504 | 3300039447 | Bacteria | 2076 |
| 972 | Ga0436363_0565062 | 3300039450 | Bacteria | 1275 |
| 973 | Ga0436363_0588048 | 3300039450 | Bacteria | 1011 |
| 974 | Ga0436362_1201994 | 3300039453 | Bacteria | 1112 |
| 975 | Ga0439453_0000484 | 3300041408 | Bacteria | 4367 |
| 976 | Ga0439453_0012281 | 3300041408 | Bacteria | 1440 |
| 977 | Ga0439441_024967 | 3300042001 | Bacteria | 1126 |
| 978 | Ga0439450_092512 | 3300042008 | Bacteria | 761 |
| 979 | Ga0439455_0011472 | 3300042012 | Bacteria | 1970 |
| 980 | Ga0439463_043431 | 3300042016 | Bacteria | 1144 |
| 981 | Ga0439446_0096249 | 3300042156 | Bacteria | 932 |
| 982 | Ga0451577_0130165 | 3300042876 | Bacteria | 2257 |
| 983 | Ga0439440_0004213 | 3300042993 | Bacteria | 2820 |
| 984 | Ga0466966_0119120 | 3300044684 | Bacteria | 1623 |
| 985 | Ga0466963_0319141 | 3300044694 | Bacteria | 1093 |
| 986 | Ga0466971_0123601 | 3300044719 | Bacteria | 1199 |
| 987 | Ga0451576_0052301 | 3300045051 | Bacteria | 4280 |
| 988 | Ga0466967_0051512 | 3300045976 | Bacteria | 3608 |
| 989 | Ga0466967_0294143 | 3300045976 | Bacteria | 1561 |
| 990 | Ga0495617_039107 | 3300046452 | Bacteria | 1586 |
| 991 | Ga0495617_060812 | 3300046452 | Bacteria | 1250 |
| 992 | Ga0495592_0000020 | 3300046454 | Bacteria | 140576 |
| 993 | Ga0495592_0009547 | 3300046454 | Bacteria | 7299 |
| 994 | Ga0495592_0012703 | 3300046454 | Bacteria | 6401 |
| 995 | Ga0495592_0221622 | 3300046454 | Bacteria | 1264 |
| 996 | Ga0495592_0503038 | 3300046454 | Bacteria | 751 |
| 997 | Ga0495603_0025279 | 3300046455 | Bacteria | 3591 |
| 998 | Ga0495603_0034874 | 3300046455 | Bacteria | 3024 |
| 999 | Ga0495603_0106974 | 3300046455 | Bacteria | 1632 |
| 1000 | Ga0495603_0132770 | 3300046455 | Bacteria | 1449 |
| 1001 | Ga0495590_0050857 | 3300046457 | Bacteria | 1447 |
| 1002 | Ga0495590_0103288 | 3300046457 | Bacteria | 1014 |
| 1003 | Ga0495629_0000222 | 3300046459 | Bacteria | 50600 |
| 1004 | Ga0495629_0005609 | 3300046459 | Bacteria | 9372 |
| 1005 | Ga0495629_0073719 | 3300046459 | Bacteria | 2383 |
| 1006 | Ga0495629_0108030 | 3300046459 | Bacteria | 1941 |
| 1007 | Ga0495638_0012075 | 3300046460 | Bacteria | 5933 |
| 1008 | Ga0495641_0016360 | 3300046461 | Bacteria | 3911 |
| 1009 | Ga0495641_0031517 | 3300046461 | Bacteria | 2532 |
| 1010 | Ga0495641_0041306 | 3300046461 | Bacteria | 2143 |
| 1011 | Ga0495641_0052185 | 3300046461 | Bacteria | 1865 |
| 1012 | Ga0495651_0001798 | 3300046462 | Bacteria | 16533 |
| 1013 | Ga0495651_0019865 | 3300046462 | Bacteria | 5210 |
| 1014 | Ga0495651_0035254 | 3300046462 | Bacteria | 3897 |
| 1015 | Ga0495651_0051434 | 3300046462 | Bacteria | 3176 |
| 1016 | Ga0495653_0000046 | 3300046463 | Bacteria | 113893 |
| 1017 | Ga0495653_0007380 | 3300046463 | Bacteria | 9006 |
| 1018 | Ga0495653_0007877 | 3300046463 | Bacteria | 8720 |
| 1019 | Ga0495653_0052601 | 3300046463 | Bacteria | 3120 |
| 1020 | Ga0495580_0014500 | 3300046472 | Bacteria | 5976 |
| 1021 | Ga0495580_0122946 | 3300046472 | Bacteria | 1801 |
| 1022 | Ga0495582_0006030 | 3300046473 | Bacteria | 6758 |
| 1023 | Ga0495582_0006417 | 3300046473 | Bacteria | 6533 |
| 1024 | Ga0495582_0010354 | 3300046473 | Bacteria | 5131 |
| 1025 | Ga0495582_0068540 | 3300046473 | Bacteria | 1960 |
| 1026 | Ga0495605_0037445 | 3300046474 | Bacteria | 2440 |
| 1027 | Ga0495639_0003996 | 3300046475 | Bacteria | 6329 |
| 1028 | Ga0495639_0217033 | 3300046475 | Bacteria | 939 |
| 1029 | Ga0495662_0001624 | 3300046476 | Bacteria | 11174 |
| 1030 | Ga0495662_0052690 | 3300046476 | Bacteria | 1964 |
| 1031 | Ga0495664_0000017 | 3300046477 | Bacteria | 172210 |
| 1032 | Ga0495664_0011559 | 3300046477 | Bacteria | 4978 |
| 1033 | Ga0495664_0096799 | 3300046477 | Bacteria | 1776 |
| 1034 | Ga0495664_0210115 | 3300046477 | Bacteria | 1179 |
| 1035 | Ga0495584_0027260 | 3300046491 | Bacteria | 2895 |
| 1036 | Ga0495584_0104369 | 3300046491 | Bacteria | 1433 |
| 1037 | Ga0495584_0123394 | 3300046491 | Bacteria | 1312 |
| 1038 | Ga0495585_0001425 | 3300046492 | Bacteria | 18789 |
| 1039 | Ga0495585_0190219 | 3300046492 | Bacteria | 1050 |
| 1040 | Ga0495594_0017590 | 3300046499 | Bacteria | 3779 |
| 1041 | Ga0495594_0066849 | 3300046499 | Bacteria | 1994 |
| 1042 | Ga0495594_0210889 | 3300046499 | Bacteria | 1107 |
| 1043 | Ga0495607_0260264 | 3300046501 | Bacteria | 831 |
| 1044 | Ga0495608_0000560 | 3300046511 | Bacteria | 25606 |
| 1045 | Ga0495608_0041445 | 3300046511 | Bacteria | 3081 |
| 1046 | Ga0495608_0054768 | 3300046511 | Bacteria | 2636 |
| 1047 | Ga0495608_0088003 | 3300046511 | Bacteria | 2011 |
| 1048 | Ga0495608_0122712 | 3300046511 | Bacteria | 1665 |
| 1049 | Ga0495608_0354044 | 3300046511 | Bacteria | 903 |
| 1050 | Ga0495618_0000059 | 3300046514 | Bacteria | 79623 |
| 1051 | Ga0495618_0037132 | 3300046514 | Bacteria | 3058 |
| 1052 | Ga0495618_0107847 | 3300046514 | Bacteria | 1783 |
| 1053 | Ga0495628_0000530 | 3300046516 | Bacteria | 34897 |
| 1054 | Ga0495628_0014379 | 3300046516 | Bacteria | 6635 |
| 1055 | Ga0495628_0017502 | 3300046516 | Bacteria | 5966 |
| 1056 | Ga0495628_0033051 | 3300046516 | Bacteria | 4172 |
| 1057 | Ga0495628_0121222 | 3300046516 | Bacteria | 2005 |
| 1058 | Ga0495628_0148709 | 3300046516 | Bacteria | 1785 |
| 1059 | Ga0495628_0337056 | 3300046516 | Bacteria | 1111 |
| 1060 | Ga0495630_0003755 | 3300046517 | Bacteria | 10601 |
| 1061 | Ga0495630_0086059 | 3300046517 | Bacteria | 2373 |
| 1062 | Ga0495630_0249689 | 3300046517 | Bacteria | 1355 |
| 1063 | Ga0495630_0712051 | 3300046517 | Bacteria | 768 |
| 1064 | Ga0495644_0000656 | 3300046523 | Bacteria | 14496 |
| 1065 | Ga0495644_0012285 | 3300046523 | Bacteria | 3292 |
| 1066 | Ga0495648_0227049 | 3300046524 | Bacteria | 917 |
| 1067 | Ga0495652_0001393 | 3300046529 | Bacteria | 26853 |
| 1068 | Ga0495652_0023653 | 3300046529 | Bacteria | 5445 |
| 1069 | Ga0495652_0081945 | 3300046529 | Bacteria | 2660 |
| 1070 | Ga0495652_0268227 | 3300046529 | Bacteria | 1256 |
| 1071 | Ga0495640_0000029 | 3300046533 | Bacteria | 79567 |
| 1072 | Ga0495640_0088868 | 3300046533 | Bacteria | 2041 |
| 1073 | Ga0495586_0049786 | 3300046535 | Bacteria | 2266 |
| 1074 | Ga0495586_0076203 | 3300046535 | Bacteria | 1837 |
| 1075 | Ga0495587_0000019 | 3300046536 | Bacteria | 161972 |
| 1076 | Ga0495587_0082282 | 3300046536 | Bacteria | 1866 |
| 1077 | Ga0495587_0103407 | 3300046536 | Bacteria | 1640 |
| 1078 | Ga0495587_0109249 | 3300046536 | Bacteria | 1589 |
| 1079 | Ga0495587_0139470 | 3300046536 | Bacteria | 1384 |
| 1080 | Ga0495598_0174008 | 3300046537 | Bacteria | 764 |
| 1081 | Ga0495621_0032491 | 3300046539 | Bacteria | 1795 |
| 1082 | Ga0495621_0064463 | 3300046539 | Bacteria | 1337 |
| 1083 | Ga0495645_0000006 | 3300046543 | Bacteria | 382503 |
| 1084 | Ga0495645_0007306 | 3300046543 | Bacteria | 7684 |
| 1085 | Ga0495645_0092181 | 3300046543 | Bacteria | 2164 |
| 1086 | Ga0495645_0214999 | 3300046543 | Bacteria | 1296 |
| 1087 | Ga0495622_0006881 | 3300046557 | Bacteria | 5279 |
| 1088 | Ga0495622_0029858 | 3300046557 | Bacteria | 2547 |
| 1089 | Ga0495622_0175983 | 3300046557 | Bacteria | 961 |
| 1090 | Ga0495633_0005034 | 3300046558 | Bacteria | 8237 |
| 1091 | Ga0495633_0093209 | 3300046558 | Bacteria | 1400 |
| 1092 | Ga0495633_0125223 | 3300046558 | Bacteria | 1189 |
| 1093 | Ga0495667_0000061 | 3300046559 | Bacteria | 94650 |
| 1094 | Ga0495667_0003512 | 3300046559 | Bacteria | 10519 |
| 1095 | Ga0495667_0012058 | 3300046559 | Bacteria | 5853 |
| 1096 | Ga0495667_0016658 | 3300046559 | Bacteria | 4962 |
| 1097 | Ga0495667_0045437 | 3300046559 | Bacteria | 2908 |
| 1098 | Ga0495656_0000262 | 3300046615 | Bacteria | 18537 |
| 1099 | Ga0495656_0009406 | 3300046615 | Bacteria | 3513 |
| 1100 | Ga0495656_0016353 | 3300046615 | Bacteria | 2814 |
| 1101 | Ga0495634_0003572 | 3300046642 | Bacteria | 12439 |
| 1102 | Ga0495634_0153734 | 3300046642 | Bacteria | 1453 |
| 1103 | Ga0495611_0042526 | 3300046648 | Bacteria | 2029 |
| 1104 | Ga0495635_0005209 | 3300046663 | Bacteria | 9047 |
| 1105 | Ga0495635_0020959 | 3300046663 | Bacteria | 4555 |
| 1106 | Ga0495635_0064668 | 3300046663 | Bacteria | 2511 |
| 1107 | Ga0495635_0076067 | 3300046663 | Bacteria | 2300 |
| 1108 | Ga0495659_0001142 | 3300046664 | Bacteria | 9228 |
| 1109 | Ga0495659_0152606 | 3300046664 | Bacteria | 928 |
| 1110 | Ga0495659_0170287 | 3300046664 | Bacteria | 883 |
| 1111 | Ga0495588_0003364 | 3300046674 | Bacteria | 6950 |
| 1112 | Ga0495588_0016789 | 3300046674 | Bacteria | 3542 |
| 1113 | Ga0495657_0000306 | 3300046675 | Bacteria | 44762 |
| 1114 | Ga0495657_0058110 | 3300046675 | Bacteria | 2569 |
| 1115 | Ga0495657_0065747 | 3300046675 | Bacteria | 2384 |
| 1116 | Ga0495599_0000066 | 3300046678 | Bacteria | 72412 |
| 1117 | Ga0495599_0004314 | 3300046678 | Bacteria | 8414 |
| 1118 | Ga0495599_0024348 | 3300046678 | Bacteria | 3786 |
| 1119 | Ga0495623_0000428 | 3300046679 | Bacteria | 27653 |
| 1120 | Ga0495623_0001394 | 3300046679 | Bacteria | 16421 |
| 1121 | Ga0495623_0055303 | 3300046679 | Bacteria | 2502 |
| 1122 | Ga0495646_0000108 | 3300046680 | Bacteria | 40754 |
| 1123 | Ga0495646_0016683 | 3300046680 | Bacteria | 4663 |
| 1124 | Ga0495646_0021361 | 3300046680 | Bacteria | 4089 |
| 1125 | Ga0495646_0038478 | 3300046680 | Bacteria | 2953 |
| 1126 | Ga0495647_0008348 | 3300046681 | Bacteria | 3481 |
| 1127 | Ga0495647_0010525 | 3300046681 | Bacteria | 3151 |
| 1128 | Ga0495647_0035128 | 3300046681 | Bacteria | 1880 |
| 1129 | Ga0495658_0000656 | 3300046683 | Bacteria | 18755 |
| 1130 | Ga0495658_0081876 | 3300046683 | Bacteria | 1896 |
| 1131 | Ga0495658_0131742 | 3300046683 | Bacteria | 1522 |
| 1132 | Ga0495613_0238001 | 3300046689 | Bacteria | 1274 |
| 1133 | Ga0495624_0025941 | 3300046690 | Bacteria | 3844 |
| 1134 | Ga0495624_0044494 | 3300046690 | Bacteria | 2829 |
| 1135 | Ga0495624_0045160 | 3300046690 | Bacteria | 2806 |
| 1136 | Ga0495624_0212293 | 3300046690 | Bacteria | 1174 |
| 1137 | Ga0495670_0003236 | 3300046691 | Bacteria | 8018 |
| 1138 | Ga0495670_0126797 | 3300046691 | Bacteria | 1329 |
| 1139 | Ga0495600_0000030 | 3300046809 | Bacteria | 89424 |
| 1140 | Ga0495600_0000708 | 3300046809 | Bacteria | 17501 |
| 1141 | Ga0495600_0003719 | 3300046809 | Bacteria | 9018 |
| 1142 | Ga0495600_0040446 | 3300046809 | Bacteria | 3036 |
| 1143 | Ga0495600_0083709 | 3300046809 | Bacteria | 2082 |
| 1144 | Ga0495581_0005847 | 3300047315 | Bacteria | 7133 |
| 1145 | Ga0495581_0010274 | 3300047315 | Bacteria | 5414 |
| 1146 | Ga0495604_0000501 | 3300047317 | Bacteria | 34507 |
| 1147 | Ga0495604_0013476 | 3300047317 | Bacteria | 6513 |
| 1148 | Ga0495604_0014927 | 3300047317 | Bacteria | 6196 |
| 1149 | Ga0495604_0048949 | 3300047317 | Bacteria | 3286 |
| 1150 | Ga0495604_0105282 | 3300047317 | Bacteria | 2065 |
| 1151 | Ga0495604_0147904 | 3300047317 | Bacteria | 1672 |
| 1152 | Ga0495604_0187197 | 3300047317 | Bacteria | 1445 |
| 1153 | Ga0495674_0001027 | 3300047319 | Bacteria | 26811 |
| 1154 | Ga0495674_0087251 | 3300047319 | Bacteria | 2670 |
| 1155 | Ga0495674_0145588 | 3300047319 | Bacteria | 1989 |
| 1156 | Ga0495674_0152441 | 3300047319 | Bacteria | 1937 |
| 1157 | Ga0495674_0438209 | 3300047319 | Bacteria | 1051 |
| 1158 | Ga0495674_0623251 | 3300047319 | Bacteria | 853 |
| 1159 | Ga0495676_0038571 | 3300047321 | Bacteria | 3966 |
| 1160 | Ga0495676_0039314 | 3300047321 | Bacteria | 3919 |
| 1161 | Ga0495676_0091203 | 3300047321 | Bacteria | 2278 |
| 1162 | Ga0495676_0187718 | 3300047321 | Bacteria | 1444 |
| 1163 | Ga0495680_0002301 | 3300047322 | Bacteria | 19625 |
| 1164 | Ga0495680_0002894 | 3300047322 | Bacteria | 17254 |
| 1165 | Ga0495680_0007421 | 3300047322 | Bacteria | 10056 |
| 1166 | Ga0495680_0018474 | 3300047322 | Bacteria | 5917 |
| 1167 | Ga0495680_0024681 | 3300047322 | Bacteria | 4984 |
| 1168 | Ga0495680_0027756 | 3300047322 | Bacteria | 4645 |
| 1169 | Ga0495675_0000719 | 3300047444 | Bacteria | 20684 |
| 1170 | Ga0495675_0011635 | 3300047444 | Bacteria | 5524 |
| 1171 | Ga0495675_0021716 | 3300047444 | Bacteria | 4089 |
| 1172 | Ga0495675_0169067 | 3300047444 | Bacteria | 1343 |
| 1173 | Ga0495675_0203873 | 3300047444 | Bacteria | 1203 |
| 1174 | Ga0495679_020243 | 3300047446 | Bacteria | 2320 |
| 1175 | Ga0495685_010564 | 3300047447 | Bacteria | 3100 |
| 1176 | Ga0495685_044762 | 3300047447 | Bacteria | 1509 |
| 1177 | Ga0495673_0084059 | 3300047469 | Bacteria | 1313 |
| 1178 | Ga0495684_0000056 | 3300047471 | Bacteria | 79718 |
| 1179 | Ga0495684_0045090 | 3300047471 | Bacteria | 3375 |
| 1180 | Ga0495684_0280439 | 3300047471 | Bacteria | 1202 |
| 1181 | Ga0495593_0001400 | 3300047673 | Bacteria | 14114 |
| 1182 | Ga0495593_0009436 | 3300047673 | Bacteria | 5662 |
| 1183 | Ga0495602_0000006 | 3300048088 | Bacteria | 322593 |
| 1184 | Ga0495602_0004878 | 3300048088 | Bacteria | 14046 |
| 1185 | Ga0495602_0028646 | 3300048088 | Bacteria | 5325 |
| 1186 | Ga0495602_0318501 | 3300048088 | Bacteria | 1132 |
| 1187 | Ga0495614_0230748 | 3300048089 | Bacteria | 843 |
| 1188 | Ga0496100_0000189 | 3300048903 | Bacteria | 34151 |
| 1189 | Ga0496100_0001161 | 3300048903 | Bacteria | 12807 |
| 1190 | Ga0496100_0004954 | 3300048903 | Bacteria | 7118 |
| 1191 | Ga0496100_0049689 | 3300048903 | Bacteria | 2713 |
| 1192 | Ga0496100_0068743 | 3300048903 | Bacteria | 2357 |
| 1193 | Ga0496100_0086288 | 3300048903 | Bacteria | 2132 |
| 1194 | Ga0496100_0315268 | 3300048903 | Bacteria | 1173 |
| 1195 | Ga0496101_0000367 | 3300048904 | Bacteria | 29989 |
| 1196 | Ga0496101_0002673 | 3300048904 | Bacteria | 10941 |
| 1197 | Ga0496101_0224841 | 3300048904 | Bacteria | 1457 |
| 1198 | Ga0496101_0248825 | 3300048904 | Bacteria | 1384 |
| 1199 | Ga0496101_0290753 | 3300048904 | Bacteria | 1278 |
| 1200 | Ga0496101_0299396 | 3300048904 | Bacteria | 1259 |
| 1201 | Ga0496102_0000967 | 3300048905 | Bacteria | 27034 |
| 1202 | Ga0496102_0002863 | 3300048905 | Bacteria | 14654 |
| 1203 | Ga0496102_0002928 | 3300048905 | Bacteria | 14484 |
| 1204 | Ga0496102_0009278 | 3300048905 | Bacteria | 8442 |
| 1205 | Ga0496102_0013770 | 3300048905 | Bacteria | 7015 |
| 1206 | Ga0496102_0017017 | 3300048905 | Bacteria | 6363 |
| 1207 | Ga0496102_0091527 | 3300048905 | Bacteria | 2815 |
| 1208 | Ga0496102_0244805 | 3300048905 | Bacteria | 1691 |
| 1209 | Ga0496102_0302506 | 3300048905 | Bacteria | 1507 |
| 1210 | Ga0496102_0307262 | 3300048905 | Bacteria | 1494 |
| 1211 | Ga0496103_0001608 | 3300048906 | Bacteria | 14839 |
| 1212 | Ga0496103_0001665 | 3300048906 | Bacteria | 14545 |
| 1213 | Ga0496103_0005379 | 3300048906 | Bacteria | 7671 |
| 1214 | Ga0496103_0013937 | 3300048906 | Bacteria | 4773 |
| 1215 | Ga0496103_0030811 | 3300048906 | Bacteria | 3265 |
| 1216 | Ga0496103_0032609 | 3300048906 | Bacteria | 3179 |
| 1217 | Ga0496103_0052684 | 3300048906 | Bacteria | 2520 |
| 1218 | Ga0496103_0054457 | 3300048906 | Bacteria | 2480 |
| 1219 | Ga0496103_0242930 | 3300048906 | Bacteria | 1158 |
| 1220 | Ga0496104_0000116 | 3300048907 | Bacteria | 74423 |
| 1221 | Ga0496104_0001806 | 3300048907 | Bacteria | 18557 |
| 1222 | Ga0496104_0003787 | 3300048907 | Bacteria | 13088 |
| 1223 | Ga0496104_0003981 | 3300048907 | Bacteria | 12794 |
| 1224 | Ga0496104_0004377 | 3300048907 | Bacteria | 12298 |
| 1225 | Ga0496104_0005021 | 3300048907 | Bacteria | 11544 |
| 1226 | Ga0496104_0006644 | 3300048907 | Bacteria | 10181 |
| 1227 | Ga0496104_0087226 | 3300048907 | Bacteria | 2980 |
| 1228 | Ga0496104_0141339 | 3300048907 | Bacteria | 2312 |
| 1229 | Ga0496104_0163210 | 3300048907 | Bacteria | 2136 |
| 1230 | Ga0496104_0190266 | 3300048907 | Bacteria | 1963 |
| 1231 | Ga0496104_0208931 | 3300048907 | Bacteria | 1864 |
| 1232 | Ga0496104_0304314 | 3300048907 | Bacteria | 1506 |
| 1233 | Ga0496104_0348595 | 3300048907 | Bacteria | 1393 |
| 1234 | Ga0496105_0000550 | 3300048908 | Bacteria | 24744 |
| 1235 | Ga0496105_0008839 | 3300048908 | Bacteria | 7846 |
| 1236 | Ga0496105_0009845 | 3300048908 | Bacteria | 7492 |
| 1237 | Ga0496105_0014629 | 3300048908 | Bacteria | 6248 |
| 1238 | Ga0496105_0025397 | 3300048908 | Bacteria | 4822 |
| 1239 | Ga0496105_0049329 | 3300048908 | Bacteria | 3475 |
| 1240 | Ga0496105_0056463 | 3300048908 | Bacteria | 3240 |
| 1241 | Ga0496105_0062353 | 3300048908 | Bacteria | 3076 |
| 1242 | Ga0496105_0106070 | 3300048908 | Bacteria | 2319 |
| 1243 | Ga0496105_0132699 | 3300048908 | Bacteria | 2052 |
| 1244 | Ga0496106_0000736 | 3300048909 | Bacteria | 23593 |
| 1245 | Ga0496106_0004342 | 3300048909 | Bacteria | 10529 |
| 1246 | Ga0496106_0007993 | 3300048909 | Bacteria | 7815 |
| 1247 | Ga0496106_0008120 | 3300048909 | Bacteria | 7753 |
| 1248 | Ga0496106_0011796 | 3300048909 | Bacteria | 6450 |
| 1249 | Ga0496106_0069576 | 3300048909 | Bacteria | 2687 |
| 1250 | Ga0496106_0288303 | 3300048909 | Bacteria | 1316 |
| 1251 | Ga0496106_0358592 | 3300048909 | Bacteria | 1171 |
| 1252 | Ga0496106_0780538 | 3300048909 | Bacteria | 758 |
| 1253 | Ga0496107_0000061 | 3300048910 | Bacteria | 53089 |
| 1254 | Ga0496107_0000646 | 3300048910 | Bacteria | 19609 |
| 1255 | Ga0496107_0006231 | 3300048910 | Bacteria | 8201 |
| 1256 | Ga0496107_0024408 | 3300048910 | Bacteria | 4276 |
| 1257 | Ga0496107_0085808 | 3300048910 | Bacteria | 2297 |
| 1258 | Ga0496107_0110341 | 3300048910 | Bacteria | 2021 |
| 1259 | Ga0496107_0114464 | 3300048910 | Bacteria | 1984 |
| 1260 | Ga0496107_0220588 | 3300048910 | Bacteria | 1411 |
| 1261 | Ga0496107_0254201 | 3300048910 | Bacteria | 1307 |
| 1262 | Ga0496108_0001716 | 3300048911 | Bacteria | 17374 |
| 1263 | Ga0496108_0006940 | 3300048911 | Bacteria | 9168 |
| 1264 | Ga0496108_0010675 | 3300048911 | Bacteria | 7452 |
| 1265 | Ga0496108_0017108 | 3300048911 | Bacteria | 5930 |
| 1266 | Ga0496108_0076752 | 3300048911 | Bacteria | 2824 |
| 1267 | Ga0496108_0102200 | 3300048911 | Bacteria | 2446 |
| 1268 | Ga0496108_0142582 | 3300048911 | Bacteria | 2064 |
| 1269 | Ga0496108_0256175 | 3300048911 | Bacteria | 1522 |
| 1270 | Ga0496108_0658237 | 3300048911 | Bacteria | 910 |
| 1271 | Ga0496109_0004602 | 3300048912 | Bacteria | 11514 |
| 1272 | Ga0496109_0019595 | 3300048912 | Bacteria | 5967 |
| 1273 | Ga0496109_0023516 | 3300048912 | Bacteria | 5471 |
| 1274 | Ga0496109_0024181 | 3300048912 | Bacteria | 5398 |
| 1275 | Ga0496109_0029321 | 3300048912 | Bacteria | 4929 |
| 1276 | Ga0496109_0307433 | 3300048912 | Bacteria | 1495 |
| 1277 | Ga0496109_0324443 | 3300048912 | Bacteria | 1453 |
| 1278 | Ga0496109_0371279 | 3300048912 | Bacteria | 1351 |
| 1279 | Ga0496109_0406192 | 3300048912 | Bacteria | 1287 |
| 1280 | Ga0496109_0511437 | 3300048912 | Bacteria | 1133 |
| 1281 | Ga0496110_0000401 | 3300048913 | Bacteria | 29358 |
| 1282 | Ga0496110_0010675 | 3300048913 | Bacteria | 7479 |
| 1283 | Ga0496110_0011385 | 3300048913 | Bacteria | 7278 |
| 1284 | Ga0496110_0019695 | 3300048913 | Bacteria | 5685 |
| 1285 | Ga0496110_0043780 | 3300048913 | Bacteria | 3908 |
| 1286 | Ga0496110_0067983 | 3300048913 | Bacteria | 3153 |
| 1287 | Ga0496110_0106673 | 3300048913 | Bacteria | 2514 |
| 1288 | Ga0496110_0361501 | 3300048913 | Bacteria | 1322 |
| 1289 | Ga0496110_0783945 | 3300048913 | Bacteria | 857 |
| 1290 | Ga0496110_0784061 | 3300048913 | Bacteria | 857 |
| 1291 | Ga0496111_0001881 | 3300048914 | Bacteria | 12410 |
| 1292 | Ga0496111_0005191 | 3300048914 | Bacteria | 8304 |
| 1293 | Ga0496111_0010028 | 3300048914 | Bacteria | 6338 |
| 1294 | Ga0496111_0016147 | 3300048914 | Bacteria | 5143 |
| 1295 | Ga0496111_0020730 | 3300048914 | Bacteria | 4580 |
| 1296 | Ga0496111_0090586 | 3300048914 | Bacteria | 2240 |
| 1297 | Ga0496111_0143854 | 3300048914 | Bacteria | 1767 |
| 1298 | Ga0496111_0198765 | 3300048914 | Bacteria | 1490 |
| 1299 | Ga0496111_0494186 | 3300048914 | Bacteria | 901 |
| 1300 | Ga0496112_0004013 | 3300048915 | Bacteria | 12340 |
| 1301 | Ga0496112_0010313 | 3300048915 | Bacteria | 8473 |
| 1302 | Ga0496112_0014330 | 3300048915 | Bacteria | 7348 |
| 1303 | Ga0496112_0055743 | 3300048915 | Bacteria | 3888 |
| 1304 | Ga0496112_0168031 | 3300048915 | Bacteria | 2159 |
| 1305 | Ga0496112_0235313 | 3300048915 | Bacteria | 1785 |
| 1306 | Ga0496112_0244231 | 3300048915 | Bacteria | 1747 |
| 1307 | Ga0496112_0299223 | 3300048915 | Bacteria | 1554 |
| 1308 | Ga0496112_0407761 | 3300048915 | Bacteria | 1298 |
| 1309 | Ga0496112_0797196 | 3300048915 | Bacteria | 869 |
| 1310 | Ga0496113_0000682 | 3300048916 | Bacteria | 17292 |
| 1311 | Ga0496113_0001738 | 3300048916 | Bacteria | 12337 |
| 1312 | Ga0496113_0009613 | 3300048916 | Bacteria | 6348 |
| 1313 | Ga0496113_0013969 | 3300048916 | Bacteria | 5462 |
| 1314 | Ga0496113_0025336 | 3300048916 | Bacteria | 4226 |
| 1315 | Ga0496113_0028906 | 3300048916 | Bacteria | 3994 |
| 1316 | Ga0496113_0054399 | 3300048916 | Bacteria | 2996 |
| 1317 | Ga0496113_0074021 | 3300048916 | Bacteria | 2596 |
| 1318 | Ga0496113_0080065 | 3300048916 | Bacteria | 2501 |
| 1319 | Ga0496113_0115486 | 3300048916 | Bacteria | 2094 |
| 1320 | Ga0496113_0254450 | 3300048916 | Bacteria | 1402 |
| 1321 | Ga0496113_0256902 | 3300048916 | Bacteria | 1395 |
| 1322 | Ga0496114_0002405 | 3300048917 | Bacteria | 14267 |
| 1323 | Ga0496114_0022492 | 3300048917 | Bacteria | 5139 |
| 1324 | Ga0496114_0080545 | 3300048917 | Bacteria | 2750 |
| 1325 | Ga0496114_0091730 | 3300048917 | Bacteria | 2580 |
| 1326 | Ga0496114_0195968 | 3300048917 | Bacteria | 1768 |
| 1327 | Ga0496114_0512036 | 3300048917 | Bacteria | 1061 |
| 1328 | Ga0496114_0544833 | 3300048917 | Bacteria | 1025 |
| 1329 | Ga0496114_0864952 | 3300048917 | Unclassified | 784 |
| 1330 | Ga0496115_0001413 | 3300048918 | Bacteria | 17185 |
| 1331 | Ga0496115_0005844 | 3300048918 | Bacteria | 8963 |
| 1332 | Ga0496115_0011047 | 3300048918 | Bacteria | 6764 |
| 1333 | Ga0496115_0037310 | 3300048918 | Bacteria | 3851 |
| 1334 | Ga0496115_0056246 | 3300048918 | Bacteria | 3162 |
| 1335 | Ga0496115_0088276 | 3300048918 | Bacteria | 2531 |
| 1336 | Ga0496115_0119638 | 3300048918 | Bacteria | 2166 |
| 1337 | Ga0496115_0132658 | 3300048918 | Bacteria | 2053 |
| 1338 | Ga0496115_0161503 | 3300048918 | Bacteria | 1851 |
| 1339 | Ga0496115_0199591 | 3300048918 | Unclassified | 1652 |
| 1340 | Ga0496115_0261008 | 3300048918 | Bacteria | 1424 |
| 1341 | Ga0496115_0650563 | 3300048918 | Unclassified | 833 |
| 1342 | Ga0501031_0075121 | 3300049568 | Bacteria | 2200 |
| 1343 | Ga0501032_0028317 | 3300049569 | Bacteria | 3850 |
| 1344 | Ga0501033_0062792 | 3300049570 | Bacteria | 2735 |
| 1345 | Ga0501033_0087148 | 3300049570 | Bacteria | 2285 |
| 1346 | Ga0501033_0142433 | 3300049570 | Bacteria | 1733 |
| 1347 | Ga0501033_0304194 | 3300049570 | Bacteria | 1122 |
| 1348 | Ga0501033_0436067 | 3300049570 | Bacteria | 911 |
| 1349 | Ga0501034_0010159 | 3300049571 | Bacteria | 9822 |
| 1350 | Ga0501034_0079854 | 3300049571 | Bacteria | 3275 |
| 1351 | Ga0501034_0085139 | 3300049571 | Bacteria | 3163 |
| 1352 | Ga0501034_0132421 | 3300049571 | Bacteria | 2476 |
| 1353 | Ga0501034_0143267 | 3300049571 | Bacteria | 2368 |
| 1354 | Ga0501034_0447997 | 3300049571 | Bacteria | 1209 |
| 1355 | Ga0501034_0460039 | 3300049571 | Bacteria | 1189 |
| 1356 | Ga0501036_0226905 | 3300049572 | Bacteria | 1568 |
| 1357 | Ga0501036_0480384 | 3300049572 | Bacteria | 1034 |
| 1358 | Ga0501037_0355219 | 3300049573 | Bacteria | 1010 |
| 1359 | Ga0501038_0081122 | 3300049574 | Bacteria | 2733 |
| 1360 | Ga0501038_0108560 | 3300049574 | Bacteria | 2301 |
| 1361 | Ga0501039_0190702 | 3300049575 | Bacteria | 1612 |
| 1362 | Ga0501039_0307517 | 3300049575 | Bacteria | 1246 |
| 1363 | Ga0501040_0120998 | 3300049576 | Bacteria | 1837 |
| 1364 | Ga0501040_0272705 | 3300049576 | Bacteria | 1208 |
| 1365 | Ga0501042_0099390 | 3300049578 | Bacteria | 2092 |
| 1366 | Ga0501042_0585421 | 3300049578 | Bacteria | 811 |
| 1367 | Ga0501043_0126167 | 3300049579 | Bacteria | 2007 |
| 1368 | Ga0501046_0007129 | 3300049580 | Bacteria | 9834 |
| 1369 | Ga0501046_0164719 | 3300049580 | Bacteria | 1666 |
| 1370 | Ga0501046_0268667 | 3300049580 | Bacteria | 1251 |
| 1371 | Ga0501047_0144982 | 3300049581 | Bacteria | 2252 |
| 1372 | Ga0501047_0190645 | 3300049581 | Bacteria | 1914 |
| 1373 | Ga0501047_0212962 | 3300049581 | Bacteria | 1790 |
| 1374 | Ga0501047_0228869 | 3300049581 | Bacteria | 1713 |
| 1375 | Ga0501047_0672002 | 3300049581 | Bacteria | 854 |
| 1376 | Ga0501067_0011699 | 3300049583 | Bacteria | 4861 |
| 1377 | Ga0501068_0436238 | 3300049584 | Bacteria | 847 |
| 1378 | Ga0501069_0014533 | 3300049585 | Bacteria | 4210 |
| 1379 | Ga0501069_0166874 | 3300049585 | Bacteria | 1269 |
| 1380 | Ga0501069_0381786 | 3300049585 | Bacteria | 832 |
| 1381 | Ga0501070_0004928 | 3300049586 | Bacteria | 11393 |
| 1382 | Ga0501070_0014873 | 3300049586 | Bacteria | 6547 |
| 1383 | Ga0501070_0056756 | 3300049586 | Bacteria | 3246 |
| 1384 | Ga0501070_0234137 | 3300049586 | Bacteria | 1504 |
| 1385 | Ga0501070_0367048 | 3300049586 | Bacteria | 1167 |
| 1386 | Ga0501071_0118866 | 3300049587 | Bacteria | 1958 |
| 1387 | Ga0501071_0315633 | 3300049587 | Bacteria | 1186 |
| 1388 | Ga0501071_0334638 | 3300049587 | Bacteria | 1151 |
| 1389 | Ga0501072_0002038 | 3300049588 | Bacteria | 15051 |
| 1390 | Ga0501072_0019373 | 3300049588 | Bacteria | 5259 |
| 1391 | Ga0501072_0037372 | 3300049588 | Bacteria | 3808 |
| 1392 | Ga0501072_0303621 | 3300049588 | Bacteria | 1269 |
| 1393 | Ga0501072_0583136 | 3300049588 | Bacteria | 882 |
| 1394 | Ga0501073_0036871 | 3300049589 | Bacteria | 3472 |
| 1395 | Ga0501073_0099501 | 3300049589 | Bacteria | 2019 |
| 1396 | Ga0501073_0169412 | 3300049589 | Bacteria | 1512 |
| 1397 | Ga0501073_0187189 | 3300049589 | Bacteria | 1433 |
| 1398 | Ga0501073_0228696 | 3300049589 | Bacteria | 1285 |
| 1399 | Ga0501073_0246889 | 3300049589 | Bacteria | 1232 |
| 1400 | Ga0501073_0358376 | 3300049589 | Bacteria | 1007 |
| 1401 | Ga0501073_0500869 | 3300049589 | Bacteria | 840 |
| 1402 | Ga0501074_0019000 | 3300049590 | Bacteria | 4992 |
| 1403 | Ga0501074_0159471 | 3300049590 | Bacteria | 1611 |
| 1404 | Ga0501075_0142426 | 3300049591 | Bacteria | 1827 |
| 1405 | Ga0501075_0376191 | 3300049591 | Bacteria | 1083 |
| 1406 | Ga0501076_0018369 | 3300049592 | Bacteria | 5330 |
| 1407 | Ga0501076_0215484 | 3300049592 | Bacteria | 1570 |
| 1408 | Ga0501076_0527835 | 3300049592 | Bacteria | 973 |
| 1409 | Ga0501077_0051623 | 3300049593 | Bacteria | 2613 |
| 1410 | Ga0501077_0235239 | 3300049593 | Bacteria | 1164 |
| 1411 | Ga0501079_0136730 | 3300049741 | Bacteria | 1908 |
| 1412 | Ga0501079_0185104 | 3300049741 | Bacteria | 1626 |
| 1413 | Ga0501079_0224161 | 3300049741 | Bacteria | 1469 |
| 1414 | Ga0501079_0615253 | 3300049741 | Bacteria | 855 |
| 1415 | Ga0501080_0024499 | 3300049742 | Bacteria | 5593 |
| 1416 | Ga0501080_0058737 | 3300049742 | Bacteria | 3580 |
| 1417 | Ga0501080_0244216 | 3300049742 | Bacteria | 1638 |
| 1418 | Ga0501080_0836015 | 3300049742 | Bacteria | 806 |
| 1419 | Ga0501081_0019804 | 3300049743 | Bacteria | 4483 |
| 1420 | Ga0501081_0218557 | 3300049743 | Bacteria | 1385 |
| 1421 | Ga0501083_0186510 | 3300049744 | Bacteria | 1354 |
| 1422 | Ga0501083_0251072 | 3300049744 | Bacteria | 1151 |
| 1423 | Ga0501083_0449813 | 3300049744 | Bacteria | 838 |
| 1424 | Ga0501035_0030762 | 3300049822 | Bacteria | 4893 |
| 1425 | Ga0501035_0072293 | 3300049822 | Bacteria | 3053 |
| 1426 | Ga0501035_0109445 | 3300049822 | Bacteria | 2422 |
| 1427 | Ga0501035_0114638 | 3300049822 | Bacteria | 2360 |
| 1428 | Ga0501035_0299793 | 3300049822 | Bacteria | 1354 |
| 1429 | Ga0501035_0324078 | 3300049822 | Bacteria | 1294 |
| 1430 | Ga0501044_0028950 | 3300049823 | Bacteria | 5843 |
| 1431 | Ga0501044_0072558 | 3300049823 | Bacteria | 3499 |
| 1432 | Ga0501044_0203977 | 3300049823 | Bacteria | 1935 |
| 1433 | Ga0501044_0226346 | 3300049823 | Bacteria | 1819 |
| 1434 | Ga0501045_0128592 | 3300049824 | Bacteria | 1883 |
| 1435 | Ga0501045_0183171 | 3300049824 | Bacteria | 1561 |
| 1436 | nmdc:mga03683_103889_c1 | 3300050489 | Bacteria | 1251 |
| 1437 | nmdc:mga03683_115443_c1 | 3300050489 | Bacteria | 1190 |
| 1438 | nmdc:mga03683_218358_c1 | 3300050489 | Bacteria | 879 |
| 1439 | nmdc:mga03n38_21992_c1 | 3300050490 | Bacteria | 2574 |
| 1440 | nmdc:mga00v17_37939_c1 | 3300050491 | Bacteria | 2879 |
| 1441 | nmdc:mga00v17_50495_c1 | 3300050491 | Bacteria | 2528 |
| 1442 | nmdc:mga00v17_87957_c1 | 3300050491 | Bacteria | 1947 |
| 1443 | nmdc:mga0yw44_13887_c1 | 3300050492 | Bacteria | 4257 |
| 1444 | nmdc:mga0yw44_21791_c1 | 3300050492 | Bacteria | 3582 |
| 1445 | nmdc:mga0yw44_26127_c1 | 3300050492 | Bacteria | 3331 |
| 1446 | nmdc:mga0yw44_26235_c1 | 3300050492 | Bacteria | 3326 |
| 1447 | nmdc:mga0k408_332832_c1 | 3300050493 | Bacteria | 906 |
| 1448 | nmdc:mga0k408_33623_c1 | 3300050493 | Bacteria | 2933 |
| 1449 | nmdc:mga0k408_65306_c1 | 3300050493 | Bacteria | 2118 |
| 1450 | nmdc:mga06z11_162684_c1 | 3300050494 | Bacteria | 1277 |
| 1451 | nmdc:mga06z11_197446_c1 | 3300050494 | Bacteria | 1167 |
| 1452 | nmdc:mga06z11_273540_c1 | 3300050494 | Bacteria | 999 |
| 1453 | nmdc:mga06z11_28241_c1 | 3300050494 | Bacteria | 2690 |
| 1454 | nmdc:mga06z11_3236_c1 | 3300050494 | Bacteria | 6293 |
| 1455 | nmdc:mga06z11_9556_c1 | 3300050494 | Bacteria | 4092 |
| 1456 | nmdc:mga04h51_3168_c1 | 3300050495 | Bacteria | 3970 |
| 1457 | nmdc:mga04h51_59634_c1 | 3300050495 | Bacteria | 1304 |
| 1458 | nmdc:mga04h51_83023_c1 | 3300050495 | Bacteria | 1141 |
| 1459 | nmdc:mga04h51_8529_c1 | 3300050495 | Bacteria | 2745 |
| 1460 | nmdc:mga07m45_35650_c1 | 3300050496 | Bacteria | 2768 |
| 1461 | nmdc:mga07m45_59262_c1 | 3300050496 | Bacteria | 1229 |
| 1462 | nmdc:mga05p37_297809_c1 | 3300050507 | Bacteria | 1918 |
| 1463 | nmdc:mga05p37_344158_c1 | 3300050507 | Bacteria | 1757 |
| 1464 | nmdc:mga05p37_5632_c1 | 3300050507 | Bacteria | 14723 |
| 1465 | nmdc:mga05p37_5665_c1 | 3300050507 | Bacteria | 14689 |
| 1466 | nmdc:mga05p37_61997_c1 | 3300050507 | Bacteria | 4602 |
| 1467 | nmdc:mga05p37_685734_c1 | 3300050507 | Bacteria | 1141 |
| 1468 | nmdc:mga05p37_7070_c1 | 3300050507 | Bacteria | 13230 |
| 1469 | nmdc:mga05p37_96432_c1 | 3300050507 | Bacteria | 3644 |
| 1470 | nmdc:mga09592_1148_c1 | 3300050508 | Bacteria | 21118 |
| 1471 | nmdc:mga09592_19266_c1 | 3300050508 | Bacteria | 5603 |
| 1472 | nmdc:mga09592_199977_c1 | 3300050508 | Bacteria | 1730 |
| 1473 | nmdc:mga09592_5879_c1 | 3300050508 | Bacteria | 10013 |
| 1474 | nmdc:mga0qj67_124296_c1 | 3300050509 | Bacteria | 2088 |
| 1475 | nmdc:mga0qj67_161801_c1 | 3300050509 | Bacteria | 1817 |
| 1476 | nmdc:mga0qj67_36752_c1 | 3300050509 | Bacteria | 3834 |
| 1477 | nmdc:mga0qj67_48972_c1 | 3300050509 | Bacteria | 3340 |
| 1478 | nmdc:mga06r32_10189_c1 | 3300050510 | Bacteria | 8485 |
| 1479 | nmdc:mga06r32_10472_c1 | 3300050510 | Bacteria | 8363 |
| 1480 | nmdc:mga06r32_105411_c1 | 3300050510 | Bacteria | 2769 |
| 1481 | nmdc:mga06r32_167234_c1 | 3300050510 | Bacteria | 2182 |
| 1482 | nmdc:mga06r32_275684_c1 | 3300050510 | Bacteria | 1669 |
| 1483 | nmdc:mga06r32_4222_c1 | 3300050510 | Bacteria | 12874 |
| 1484 | nmdc:mga06r32_452809_c1 | 3300050510 | Bacteria | 1263 |
| 1485 | nmdc:mga06r32_88292_c1 | 3300050510 | Bacteria | 3026 |
| 1486 | nmdc:mga08y16_116995_c1 | 3300050511 | Bacteria | 2775 |
| 1487 | nmdc:mga08y16_185355_c1 | 3300050511 | Bacteria | 2160 |
| 1488 | nmdc:mga08y16_2503_c1 | 3300050511 | Bacteria | 18895 |
| 1489 | nmdc:mga08y16_42495_c1 | 3300050511 | Bacteria | 4760 |
| 1490 | nmdc:mga08y16_4316_c1 | 3300050511 | Bacteria | 14850 |
| 1491 | nmdc:mga08y16_433528_c1 | 3300050511 | Bacteria | 1342 |
| 1492 | nmdc:mga08y16_51194_c1 | 3300050511 | Bacteria | 4320 |
| 1493 | nmdc:mga08y16_548540_c1 | 3300050511 | Bacteria | 1170 |
| 1494 | nmdc:mga08y16_56282_c1 | 3300050511 | Bacteria | 4111 |
| 1495 | nmdc:mga08y16_5824_c1 | 3300050511 | Bacteria | 12915 |
| 1496 | nmdc:mga08y16_738_c1 | 3300050511 | Bacteria | 31085 |
| 1497 | nmdc:mga0n895_141479_c1 | 3300050512 | Bacteria | 2435 |
| 1498 | nmdc:mga0n895_30978_c1 | 3300050512 | Bacteria | 5117 |
| 1499 | nmdc:mga0n895_312707_c1 | 3300050512 | Bacteria | 1592 |
| 1500 | nmdc:mga0n895_32029_c1 | 3300050512 | Bacteria | 5041 |
| 1501 | nmdc:mga0n895_403530_c1 | 3300050512 | Bacteria | 1382 |
| 1502 | nmdc:mga0n895_450314_c1 | 3300050512 | Bacteria | 1300 |
| 1503 | nmdc:mga0n895_562_c1 | 3300050512 | Bacteria | 25458 |
| 1504 | nmdc:mga0n895_563811_c1 | 3300050512 | Bacteria | 1144 |
| 1505 | nmdc:mga0n895_7736_c1 | 3300050512 | Bacteria | 9251 |
| 1506 | nmdc:mga0n895_776751_c1 | 3300050512 | Bacteria | 950 |
| 1507 | nmdc:mga0n895_842_c1 | 3300050512 | Bacteria | 22003 |
| 1508 | nmdc:mga0n895_86453_c1 | 3300050512 | Bacteria | 3132 |
| 1509 | nmdc:mga0rr50_19224_c1 | 3300050513 | Bacteria | 4605 |
| 1510 | nmdc:mga0rr50_231452_c1 | 3300050513 | Bacteria | 1529 |
| 1511 | nmdc:mga0rr50_300730_c1 | 3300050513 | Bacteria | 1342 |
| 1512 | nmdc:mga0rr50_40314_c1 | 3300050513 | Bacteria | 3394 |
| 1513 | nmdc:mga0rr50_482837_c1 | 3300050513 | Bacteria | 1052 |
| 1514 | nmdc:mga0rr50_62434_c1 | 3300050513 | Bacteria | 2811 |
| 1515 | nmdc:mga08x19_127569_c1 | 3300050514 | Bacteria | 1709 |
| 1516 | nmdc:mga08x19_1998_c1 | 3300050514 | Bacteria | 12485 |
| 1517 | nmdc:mga08x19_44407_c1 | 3300050514 | Bacteria | 2837 |
| 1518 | nmdc:mga08x19_444205_c1 | 3300050514 | Bacteria | 912 |
| 1519 | nmdc:mga0a205_1040_c1 | 3300050515 | Bacteria | 23115 |
| 1520 | nmdc:mga0a205_120013_c1 | 3300050515 | Bacteria | 2528 |
| 1521 | nmdc:mga0a205_253120_c1 | 3300050515 | Bacteria | 1640 |
| 1522 | nmdc:mga0a205_4522_c1 | 3300050515 | Bacteria | 12484 |
| 1523 | nmdc:mga0a205_6591_c1 | 3300050515 | Bacteria | 10502 |
| 1524 | nmdc:mga0sz30_15012_c2 | 3300050516 | Bacteria | 2161 |
| 1525 | Ga0495601_0000007 | 3300053077 | Bacteria | 365972 |
| 1526 | Ga0495601_0005686 | 3300053077 | Bacteria | 7266 |
| 1527 | Ga0495601_0010735 | 3300053077 | Bacteria | 5465 |
| 1528 | Ga0495601_0022399 | 3300053077 | Bacteria | 3877 |
| 1529 | Ga0495601_0048962 | 3300053077 | Bacteria | 2663 |
| 1530 | Ga0495601_0075987 | 3300053077 | Bacteria | 2151 |
| 1531 | Ga0495601_0193211 | 3300053077 | Bacteria | 1330 |
| 1532 | Ga0495612_0000108 | 3300053078 | Bacteria | 34924 |
| 1533 | Ga0495612_0002028 | 3300053078 | Bacteria | 8347 |
| 1534 | Ga0495612_0003773 | 3300053078 | Bacteria | 6303 |
| 1535 | Ga0495612_0056154 | 3300053078 | Bacteria | 1624 |
| 1536 | Ga0495612_0145782 | 3300053078 | Bacteria | 1028 |
| 1537 | Ga0495612_0246103 | 3300053078 | Bacteria | 795 |
| 1538 | Ga0495655_0068436 | 3300053083 | Bacteria | 987 |
| 1539 | Ga0495595_0000767 | 3300053084 | Bacteria | 12201 |
| 1540 | Ga0495595_0002857 | 3300053084 | Bacteria | 6806 |
| 1541 | Ga0495595_0005668 | 3300053084 | Bacteria | 5053 |
| 1542 | Ga0495595_0010908 | 3300053084 | Bacteria | 3790 |
| 1543 | Ga0495595_0035705 | 3300053084 | Bacteria | 2252 |
| 1544 | Ga0495595_0038499 | 3300053084 | Bacteria | 2178 |
| 1545 | Ga0495595_0094208 | 3300053084 | Bacteria | 1439 |
| 1546 | Ga0495595_0134525 | 3300053084 | Bacteria | 1210 |
| 1547 | Ga0495595_0153234 | 3300053084 | Bacteria | 1135 |
| 1548 | Ga0495619_0000023 | 3300053085 | Bacteria | 182266 |
| 1549 | Ga0495619_0000271 | 3300053085 | Bacteria | 37662 |
| 1550 | Ga0495619_0001755 | 3300053085 | Bacteria | 14416 |
| 1551 | Ga0495619_0002683 | 3300053085 | Bacteria | 11647 |
| 1552 | Ga0495619_0014923 | 3300053085 | Bacteria | 4906 |
| 1553 | Ga0495619_0042753 | 3300053085 | Bacteria | 2968 |
| 1554 | Ga0495619_0062377 | 3300053085 | Bacteria | 2481 |
| 1555 | Ga0495619_0091763 | 3300053085 | Bacteria | 2056 |
| 1556 | Ga0495619_0281220 | 3300053085 | Bacteria | 1153 |
| 1557 | Ga0495619_0296913 | 3300053085 | Bacteria | 1119 |
| 1558 | Ga0500595_011034 | 3300053119 | Bacteria | 3559 |
| 1559 | Ga0500652_129479 | 3300053131 | Bacteria | 1053 |
| 1560 | Ga0500655_024812 | 3300053133 | Bacteria | 1136 |
| 1561 | Ga0500658_0057936 | 3300053134 | Bacteria | 1603 |
| 1562 | Ga0500658_0070827 | 3300053134 | Bacteria | 1471 |
| 1563 | Ga0500568_0078430 | 3300053139 | Bacteria | 1256 |
| 1564 | Ga0500603_075444 | 3300053150 | Bacteria | 968 |
| 1565 | Ga0501084_0015408 | 3300054114 | Bacteria | 6338 |
| 1566 | Ga0501084_0344307 | 3300054114 | Bacteria | 1259 |
| 1567 | Ga0501084_0718430 | 3300054114 | Bacteria | 842 |
| 1568 | Ga0501082_0000046 | 3300060353 | Bacteria | 86307 |
| 1569 | Ga0501082_0056939 | 3300060353 | Bacteria | 3368 |
| 1570 | Ga0501082_0083985 | 3300060353 | Bacteria | 2747 |
| 1571 | Ga0501082_0102503 | 3300060353 | Bacteria | 2476 |
| 1572 | Ga0501082_0107237 | 3300060353 | Bacteria | 2417 |
| 1573 | Ga0501082_0199025 | 3300060353 | Bacteria | 1743 |
| 1574 | Ga0501082_0239246 | 3300060353 | Bacteria | 1580 |
| 1575 | Ga0501082_0314088 | 3300060353 | Bacteria | 1365 |
| 1576 | Ga0501082_0809073 | 3300060353 | Bacteria | 820 |
| 1577 | Ga0530510_0030059 | 3300061734 | Bacteria | 3901 |
| 1578 | Ga0530510_0101477 | 3300061734 | Bacteria | 2104 |
| 1579 | 2643756546 | 2643221547 | Bacteria | 4740017 |
| 1580 | Ga0207648_10180291 | |||
| 1581 | ARcpr5oldR_c000028 | |||
| 1582 | ARSoilYngRDRAFT_c00217 | |||
| 1583 | ARcpr5yngRDRAFT_c000173 | |||
| 1584 | ARSoilOldRDRAFT_c000023 | |||
| 1585 | ARCol0yngRDRAFT_1000191 | |||
| 1586 | JGI24741J21665_1025379 | |||
| 1587 | JGI24752J21851_1010192 | |||
| 1588 | JGI24746J21847_1005138 | |||
| 1589 | JGI24740J21852_10018609 | |||
| 1590 | JGI24739J22299_10000148 | |||
| 1591 | JGI24737J22298_10001402 | |||
| 1592 | JGI24737J22298_10017355 | |||
| 1593 | JGI24743J22301_10001462 | |||
| 1594 | JGI24750J21931_1000011 | |||
| 1595 | JGI24750J21931_1003616 | |||
| 1596 | JGI24745J21846_1005158 | |||
| 1597 | JGI24748J21848_1000485 | |||
| 1598 | JGI24738J21930_10000236 | |||
| 1599 | JGI24749J21850_1001952 | |||
| 1600 | JGI24749J21850_1004668 | |||
| 1601 | JGI24744J21845_10000887 | |||
| 1602 | JGI24035J26624_1000114 | |||
| 1603 | JGI24033J26618_1003148 | |||
| 1604 | JGI24033J26618_1003288 | |||
| 1605 | JGI24034J26672_10005870 | |||
| 1606 | JGI24742J22300_10000252 | |||
| 1607 | JGI24751J29686_10005836 | |||
| 1608 | JGI24751J29686_10026980 | |||
| 1609 | JGI25406J46586_10032185 | |||
| 1610 | JGI25153J46596_10004476 | |||
| 1611 | JGI25405J52794_10006291 | |||
| 1612 | Ga0065716_1001752 | |||
| 1613 | Ga0065704_10105216 | |||
| 1614 | Ga0065712_10002440 | |||
| 1615 | Ga0065712_10096365 | |||
| 1616 | Ga0065712_10118955 | |||
| 1617 | Ga0065715_10001564 | |||
| 1618 | Ga0065715_10033620 | |||
| 1619 | Ga0065715_10088960 | |||
| 1620 | Ga0070658_10014302 | |||
| 1621 | Ga0070676_10000536 | |||
| 1622 | Ga0070676_10041342 | |||
| 1623 | Ga0070676_10142973 | |||
| 1624 | Ga0070683_100000144 | |||
| 1625 | Ga0070683_100055001 | |||
| 1626 | Ga0070683_100425296 | |||
| 1627 | Ga0070690_100001428 | |||
| 1628 | Ga0070690_100002001 | |||
| 1629 | Ga0070690_100112831 | |||
| 1630 | Ga0070670_100000437 | |||
| 1631 | Ga0070670_100010574 | |||
| 1632 | Ga0070670_100093113 | |||
| 1633 | Ga0070670_100231452 | |||
| 1634 | Ga0070677_10000166 | |||
| 1635 | Ga0070677_10099117 | |||
| 1636 | Ga0068869_100000035 | |||
| 1637 | Ga0068869_100144496 | |||
| 1638 | Ga0070666_10060622 | |||
| 1639 | Ga0070680_100003662 | |||
| 1640 | Ga0070680_100056551 | |||
| 1641 | Ga0070680_100145684 | |||
| 1642 | Ga0070680_100276749 | |||
| 1643 | Ga0070682_100002219 | |||
| 1644 | Ga0070682_100107123 | |||
| 1645 | Ga0068868_100001888 | |||
| 1646 | Ga0070660_100000944 | |||
| 1647 | Ga0070660_100080326 | |||
| 1648 | Ga0070660_100139586 | |||
| 1649 | Ga0070689_100000207 | |||
| 1650 | Ga0070689_100008854 | |||
| 1651 | Ga0070689_100019990 | |||
| 1652 | Ga0070689_100021249 | |||
| 1653 | Ga0070691_10001234 | |||
| 1654 | Ga0070691_10048613 | |||
| 1655 | Ga0070691_10071638 | |||
| 1656 | Ga0070687_100000261 | |||
| 1657 | Ga0070687_100086044 | |||
| 1658 | Ga0070661_100000017 | |||
| 1659 | Ga0070661_100149659 | |||
| 1660 | Ga0070661_100333634 | |||
| 1661 | Ga0070692_10001418 | |||
| 1662 | Ga0070692_10005458 | |||
| 1663 | Ga0070692_10040522 | |||
| 1664 | Ga0070692_10168066 | |||
| 1665 | Ga0070668_100140244 | |||
| 1666 | Ga0070668_100308586 | |||
| 1667 | Ga0070668_100324609 | |||
| 1668 | Ga0070668_100328096 | |||
| 1669 | Ga0070668_100541598 | |||
| 1670 | Ga0070669_100000250 | |||
| 1671 | Ga0070669_100215645 | |||
| 1672 | Ga0070675_100000246 | |||
| 1673 | Ga0070675_100078753 | |||
| 1674 | Ga0070671_100007422 | |||
| 1675 | Ga0070671_100028654 | |||
| 1676 | Ga0070671_100073891 | |||
| 1677 | Ga0070674_100000355 | |||
| 1678 | Ga0070674_100018670 | |||
| 1679 | Ga0070674_100142815 | |||
| 1680 | Ga0070674_100408846 | |||
| 1681 | Ga0070673_100000032 | |||
| 1682 | Ga0070673_100042414 | |||
| 1683 | Ga0070673_100193540 | |||
| 1684 | Ga0070688_100000594 | |||
| 1685 | Ga0070688_100013506 | |||
| 1686 | Ga0070688_100025273 | |||
| 1687 | Ga0070688_100186076 | |||
| 1688 | Ga0070659_100000214 | |||
| 1689 | Ga0070659_100035022 | |||
| 1690 | Ga0070667_100000816 | |||
| 1691 | Ga0070667_100034043 | |||
| 1692 | Ga0070667_100051439 | |||
| 1693 | Ga0070667_100605221 | |||
| 1694 | Ga0070667_100625868 | |||
| 1695 | Ga0070703_10001365 | |||
| 1696 | Ga0070703_10001548 | |||
| 1697 | Ga0070709_10004360 | |||
| 1698 | Ga0070709_10016295 | |||
| 1699 | Ga0070714_100012941 | |||
| 1700 | Ga0070714_100481217 | |||
| 1701 | Ga0070713_100005123 | |||
| 1702 | Ga0070713_100013950 | |||
| 1703 | Ga0070710_10315891 | |||
| 1704 | Ga0070701_10000230 | |||
| 1705 | Ga0070701_10002700 | |||
| 1706 | Ga0070701_10020139 | |||
| 1707 | Ga0070711_100008381 | |||
| 1708 | Ga0070711_100017527 | |||
| 1709 | Ga0070711_100251801 | |||
| 1710 | Ga0070711_100458681 | |||
| 1711 | Ga0070705_100000171 | |||
| 1712 | Ga0070705_100003882 | |||
| 1713 | Ga0070705_100123695 | |||
| 1714 | Ga0070700_100000234 | |||
| 1715 | Ga0070700_100000482 | |||
| 1716 | Ga0070694_100000247 | |||
| 1717 | Ga0070694_100003250 | |||
| 1718 | Ga0070694_100104770 | |||
| 1719 | Ga0070708_100050386 | |||
| 1720 | Ga0070663_100026358 | |||
| 1721 | Ga0070663_100036809 | |||
| 1722 | Ga0070663_100378405 | |||
| 1723 | Ga0070678_100070825 | |||
| 1724 | Ga0070678_100147105 | |||
| 1725 | Ga0070662_100003327 | |||
| 1726 | Ga0070662_100046522 | |||
| 1727 | Ga0070662_100054983 | |||
| 1728 | Ga0070681_10000401 | |||
| 1729 | Ga0070681_10094966 | |||
| 1730 | Ga0070681_10097689 | |||
| 1731 | Ga0070681_10101800 | |||
| 1732 | Ga0070681_10126076 | |||
| 1733 | Ga0070681_10166646 | |||
| 1734 | Ga0070681_10202951 | |||
| 1735 | Ga0070681_10203174 | |||
| 1736 | Ga0070681_10296633 | |||
| 1737 | Ga0070681_10552211 | |||
| 1738 | Ga0068867_100000190 | |||
| 1739 | Ga0068867_100069262 | |||
| 1740 | Ga0068867_100216309 | |||
| 1741 | Ga0070685_10002568 | |||
| 1742 | Ga0070685_10006005 | |||
| 1743 | Ga0070685_10069160 | |||
| 1744 | Ga0070706_100114608 | |||
| 1745 | Ga0070706_100211233 | |||
| 1746 | Ga0070706_100254037 | |||
| 1747 | Ga0070707_100531971 | |||
| 1748 | Ga0070698_100174486 | |||
| 1749 | Ga0070699_100000167 | |||
| 1750 | Ga0070679_100000847 | |||
| 1751 | Ga0070679_100123282 | |||
| 1752 | Ga0070679_100144745 | |||
| 1753 | Ga0070679_100179661 | |||
| 1754 | Ga0070679_100192310 | |||
| 1755 | Ga0070679_100324673 | |||
| 1756 | Ga0070684_100000904 | |||
| 1757 | Ga0070684_100025874 | |||
| 1758 | Ga0070684_100217716 | |||
| 1759 | Ga0070684_100273447 | |||
| 1760 | Ga0070684_100282134 | |||
| 1761 | Ga0070684_100366281 | |||
| 1762 | Ga0070697_100049238 | |||
| 1763 | Ga0068853_100006394 | |||
| 1764 | Ga0068853_100050590 | |||
| 1765 | Ga0068853_100544688 | |||
| 1766 | Ga0070672_100000529 | |||
| 1767 | Ga0070672_100074762 | |||
| 1768 | Ga0070672_100207043 | |||
| 1769 | Ga0070672_100213601 | |||
| 1770 | Ga0070672_100301252 | |||
| 1771 | Ga0070686_100000269 | |||
| 1772 | Ga0070686_100003617 | |||
| 1773 | Ga0070686_100009747 | |||
| 1774 | Ga0070686_100013607 | |||
| 1775 | Ga0070695_100000406 | |||
| 1776 | Ga0070695_100003493 | |||
| 1777 | Ga0070696_100000304 | |||
| 1778 | Ga0070696_100002999 | |||
| 1779 | Ga0070696_100100859 | |||
| 1780 | Ga0070693_100002112 | |||
| 1781 | Ga0070693_100009505 | |||
| 1782 | Ga0070693_100042910 | |||
| 1783 | Ga0070665_100063574 | |||
| 1784 | Ga0070665_100073842 | |||
| 1785 | Ga0070665_100972688 | |||
| 1786 | Ga0070704_100000385 | |||
| 1787 | Ga0070704_100000566 | |||
| 1788 | Ga0070704_100060045 | |||
| 1789 | Ga0070704_100312875 | |||
| 1790 | Ga0068855_100006856 | |||
| 1791 | Ga0068855_100081134 | |||
| 1792 | Ga0068855_100116563 | |||
| 1793 | Ga0068855_100144287 | |||
| 1794 | Ga0068855_100465648 | |||
| 1795 | Ga0070664_100000912 | |||
| 1796 | Ga0070664_100333920 | |||
| 1797 | Ga0068857_100000494 | |||
| 1798 | Ga0068857_100011609 | |||
| 1799 | Ga0068857_100244976 | |||
| 1800 | Ga0068857_100363680 | |||
| 1801 | Ga0068854_100000139 | |||
| 1802 | Ga0068854_100159715 | |||
| 1803 | Ga0068854_100292604 | |||
| 1804 | Ga0068856_100005193 | |||
| 1805 | Ga0068856_100167879 | |||
| 1806 | Ga0068856_100179850 | |||
| 1807 | Ga0068856_100194234 | |||
| 1808 | Ga0068856_100874197 | |||
| 1809 | Ga0070702_100054674 | |||
| 1810 | Ga0070702_100245102 | |||
| 1811 | Ga0068852_100000193 | |||
| 1812 | Ga0068852_100098275 | |||
| 1813 | Ga0068852_100353508 | |||
| 1814 | Ga0068852_100438174 | |||
| 1815 | Ga0068859_100002972 | |||
| 1816 | Ga0068859_100021099 | |||
| 1817 | Ga0068859_100478637 | |||
| 1818 | Ga0068859_100494335 | |||
| 1819 | Ga0068864_100000226 | |||
| 1820 | Ga0068864_100005554 | |||
| 1821 | Ga0068864_100091561 | |||
| 1822 | Ga0068864_100209466 | |||
| 1823 | Ga0068866_10000199 | |||
| 1824 | Ga0068866_10056158 | |||
| 1825 | Ga0068866_10242311 | |||
| 1826 | Ga0068861_100000847 | |||
| 1827 | Ga0068851_10110326 | |||
| 1828 | Ga0068870_10004231 | |||
| 1829 | Ga0068863_100001877 | |||
| 1830 | Ga0068863_100044870 | |||
| 1831 | Ga0068858_100000512 | |||
| 1832 | Ga0068858_100044217 | |||
| 1833 | Ga0068858_100182497 | |||
| 1834 | Ga0068858_100502778 | |||
| 1835 | Ga0068860_100001525 | |||
| 1836 | Ga0068860_100001592 | |||
| 1837 | Ga0068860_100057915 | |||
| 1838 | Ga0068860_100061019 | |||
| 1839 | Ga0068862_100000557 | |||
| 1840 | Ga0068862_100031172 | |||
| 1841 | Ga0068862_100034921 | |||
| 1842 | Ga0068862_100335652 | |||
| 1843 | Ga0081455_10000035 | |||
| 1844 | Ga0081455_10001717 | |||
| 1845 | Ga0081455_10003750 | |||
| 1846 | Ga0081455_10039883 | |||
| 1847 | Ga0081455_10223349 | |||
| 1848 | Ga0081538_10001738 | |||
| 1849 | Ga0081538_10060587 | |||
| 1850 | Ga0081538_10068489 | |||
| 1851 | Ga0081540_1007073 | |||
| 1852 | Ga0081540_1064606 | |||
| 1853 | Ga0081539_10002061 | |||
| 1854 | Ga0070717_10028561 | |||
| 1855 | Ga0070717_10086152 | |||
| 1856 | Ga0070717_10123132 | |||
| 1857 | Ga0070717_10246288 | |||
| 1858 | Ga0070717_10858928 | |||
| 1859 | Ga0075365_10004829 | |||
| 1860 | Ga0075365_10006356 | |||
| 1861 | Ga0075365_10041906 | |||
| 1862 | Ga0075365_10108460 | |||
| 1863 | Ga0075368_10002630 | |||
| 1864 | Ga0075368_10011483 | |||
| 1865 | Ga0075368_10040731 | |||
| 1866 | Ga0075368_10164585 | |||
| 1867 | Ga0075363_100103326 | |||
| 1868 | Ga0075364_10004638 | |||
| 1869 | Ga0075364_10008067 | |||
| 1870 | Ga0075364_10246607 | |||
| 1871 | Ga0075432_10019290 | |||
| 1872 | Ga0070715_10098939 | |||
| 1873 | Ga0070715_10141852 | |||
| 1874 | Ga0070715_10171288 | |||
| 1875 | Ga0070716_100018071 | |||
| 1876 | Ga0070712_100012496 | |||
| 1877 | Ga0070712_100130680 | |||
| 1878 | Ga0070712_100635127 | |||
| 1879 | Ga0075362_10002664 | |||
| 1880 | Ga0075362_10080901 | |||
| 1881 | Ga0075362_10095146 | |||
| 1882 | Ga0075362_10110073 | |||
| 1883 | Ga0075367_10008394 | |||
| 1884 | Ga0075367_10013463 | |||
| 1885 | Ga0075367_10041545 | |||
| 1886 | Ga0075367_10079735 | |||
| 1887 | Ga0075367_10156175 | |||
| 1888 | Ga0075369_10154964 | |||
| 1889 | Ga0075427_10003198 | |||
| 1890 | Ga0075366_10030395 | |||
| 1891 | Ga0097621_100000049 | |||
| 1892 | Ga0097621_100076779 | |||
| 1893 | Ga0075370_10009592 | |||
| 1894 | Ga0075370_10076344 | |||
| 1895 | Ga0075370_10383678 | |||
| 1896 | Ga0068871_100000097 | |||
| 1897 | Ga0068871_100015992 | |||
| 1898 | Ga0068871_100032808 | |||
| 1899 | Ga0068871_100161020 | |||
| 1900 | Ga0068871_100227143 | |||
| 1901 | Ga0075428_100011811 | |||
| 1902 | Ga0075428_100026110 | |||
| 1903 | Ga0075428_100045882 | |||
| 1904 | Ga0075428_100075012 | |||
| 1905 | Ga0075428_100076282 | |||
| 1906 | Ga0075428_100084938 | |||
| 1907 | Ga0075428_100293444 | |||
| 1908 | Ga0075428_100369767 | |||
| 1909 | Ga0075430_100004110 | |||
| 1910 | Ga0075430_100263355 | |||
| 1911 | Ga0075431_100003772 | |||
| 1912 | Ga0075431_100015906 | |||
| 1913 | Ga0075431_100037458 | |||
| 1914 | Ga0075431_100076180 | |||
| 1915 | Ga0075431_100087511 | |||
| 1916 | Ga0075431_100153596 | |||
| 1917 | Ga0075431_100172811 | |||
| 1918 | Ga0075431_100282725 | |||
| 1919 | Ga0075431_100457082 | |||
| 1920 | Ga0075431_100718708 | |||
| 1921 | Ga0075433_10002397 | |||
| 1922 | Ga0075433_10008081 | |||
| 1923 | Ga0075434_100000383 | |||
| 1924 | Ga0075434_100001135 | |||
| 1925 | Ga0075434_100009398 | |||
| 1926 | Ga0075434_100060410 | |||
| 1927 | Ga0075434_100278916 | |||
| 1928 | Ga0075434_100334846 | |||
| 1929 | Ga0075434_100456457 | |||
| 1930 | Ga0075434_100457489 | |||
| 1931 | Ga0075434_100523044 | |||
| 1932 | Ga0075434_100595436 | |||
| 1933 | Ga0075429_100001354 | |||
| 1934 | Ga0075429_100016192 | |||
| 1935 | Ga0075429_100143178 | |||
| 1936 | Ga0075429_100234603 | |||
| 1937 | Ga0075429_100269619 | |||
| 1938 | Ga0068865_100000119 | |||
| 1939 | Ga0068865_100033862 | |||
| 1940 | Ga0068865_100059392 | |||
| 1941 | Ga0068865_100068549 | |||
| 1942 | Ga0075436_100032452 | |||
| 1943 | Ga0075436_100065255 | |||
| 1944 | Ga0097620_100002972 | |||
| 1945 | Ga0097620_100021099 | |||
| 1946 | Ga0097620_100478646 | |||
| 1947 | Ga0097620_100494280 | |||
| 1948 | Ga0075435_100004250 | |||
| 1949 | Ga0075435_100022627 | |||
| 1950 | Ga0075435_100030953 | |||
| 1951 | Ga0075435_100114600 | |||
| 1952 | Ga0075435_100262671 | |||
| 1953 | Ga0099794_10072350 | |||
| 1954 | Ga0105251_10047287 | |||
| 1955 | Ga0105244_10110443 | |||
| 1956 | Ga0105240_10009789 | |||
| 1957 | Ga0105240_10056188 | |||
| 1958 | Ga0105240_10241483 | |||
| 1959 | Ga0111539_10000237 | |||
| 1960 | Ga0111539_10001512 | |||
| 1961 | Ga0111539_10007189 | |||
| 1962 | Ga0111539_10010350 | |||
| 1963 | Ga0111539_10022663 | |||
| 1964 | Ga0111539_10059007 | |||
| 1965 | Ga0111539_10097324 | |||
| 1966 | Ga0111539_10236892 | |||
| 1967 | Ga0105245_10000202 | |||
| 1968 | Ga0105245_10109349 | |||
| 1969 | Ga0105245_10178381 | |||
| 1970 | Ga0105245_10243774 | |||
| 1971 | Ga0105247_10003839 | |||
| 1972 | Ga0105247_10010478 | |||
| 1973 | Ga0105247_10018903 | |||
| 1974 | Ga0105247_10026789 | |||
| 1975 | Ga0114129_10007020 | |||
| 1976 | Ga0114129_10008425 | |||
| 1977 | Ga0114129_10011185 | |||
| 1978 | Ga0114129_10033296 | |||
| 1979 | Ga0114129_10105568 | |||
| 1980 | Ga0114129_10797829 | |||
| 1981 | Ga0114129_10858957 | |||
| 1982 | Ga0105243_10011526 | |||
| 1983 | Ga0105243_10042474 | |||
| 1984 | Ga0105243_10296026 | |||
| 1985 | Ga0105243_10849673 | |||
| 1986 | Ga0105241_10000430 | |||
| 1987 | Ga0105241_10175455 | |||
| 1988 | Ga0105241_10500497 | |||
| 1989 | Ga0105241_10886951 | |||
| 1990 | Ga0105242_10002131 | |||
| 1991 | Ga0105242_10051392 | |||
| 1992 | Ga0105242_10071991 | |||
| 1993 | Ga0105242_10086045 | |||
| 1994 | Ga0105242_10187186 | |||
| 1995 | Ga0105248_10001335 | |||
| 1996 | Ga0105248_10036278 | |||
| 1997 | Ga0105248_10230078 | |||
| 1998 | Ga0105237_10008523 | |||
| 1999 | Ga0105237_10083778 | |||
| 2000 | Ga0105237_10258915 | |||
| 2001 | Ga0105238_10008420 | |||
| 2002 | Ga0105238_10171448 | |||
| 2003 | Ga0105238_10359719 | |||
| 2004 | Ga0105249_10000215 | |||
| 2005 | Ga0105249_10004272 | |||
| 2006 | Ga0105249_10009891 | |||
| 2007 | Ga0105249_10239953 | |||
| 2008 | Ga0105249_10495012 | |||
| 2009 | Ga0105249_10538886 | |||
| 2010 | Ga0105249_10650255 | |||
| 2011 | Ga0105249_10911171 | |||
| 2012 | Ga0099796_10023513 | |||
| 2013 | Ga0105239_10012264 | |||
| 2014 | Ga0105239_10085291 | |||
| 2015 | Ga0105239_10175361 | |||
| 2016 | Ga0105246_10000019 | |||
| 2017 | Ga0105246_10017617 | |||
| 2018 | Ga0105246_10055648 | |||
| 2019 | Ga0105246_10072338 | |||
| 2020 | Ga0105246_10119563 | |||
| 2021 | Ga0105246_10512762 | |||
| 2022 | Ga0105246_10612699 | |||
| 2023 | Ga0157345_1002449 | |||
| 2024 | Ga0157373_10449838 | |||
| 2025 | Ga0157371_10018237 | |||
| 2026 | Ga0157371_10053792 | |||
| 2027 | Ga0157370_10016547 | |||
| 2028 | Ga0157370_10205810 | |||
| 2029 | Ga0157370_10572688 | |||
| 2030 | Ga0157369_10557568 | |||
| 2031 | Ga0157374_10013571 | |||
| 2032 | Ga0157374_10092708 | |||
| 2033 | Ga0157374_10246546 | |||
| 2034 | Ga0157374_10855088 | |||
| 2035 | Ga0157378_10168915 | |||
| 2036 | Ga0157378_10673985 | |||
| 2037 | Ga0163162_10001187 | |||
| 2038 | Ga0163162_10091452 | |||
| 2039 | Ga0163162_10118403 | |||
| 2040 | Ga0163162_10194139 | |||
| 2041 | Ga0163162_10566275 | |||
| 2042 | Ga0157372_10104810 | |||
| 2043 | Ga0157372_10130301 | |||
| 2044 | Ga0157372_10972062 | |||
| 2045 | Ga0157375_10000135 | |||
| 2046 | Ga0157375_10112760 | |||
| 2047 | Ga0157375_10149043 | |||
| 2048 | Ga0157375_10235765 | |||
| 2049 | Ga0157375_10272416 | |||
| 2050 | Ga0163163_10001813 | |||
| 2051 | Ga0163163_10037509 | |||
| 2052 | Ga0163163_10081539 | |||
| 2053 | Ga0163163_10133163 | |||
| 2054 | Ga0163163_10259552 | |||
| 2055 | Ga0157380_10000284 | |||
| 2056 | Ga0157380_10009510 | |||
| 2057 | Ga0157380_10045169 | |||
| 2058 | Ga0157380_10339269 | |||
| 2059 | Ga0182008_10023306 | |||
| 2060 | Ga0157377_10000076 | |||
| 2061 | Ga0157377_10009804 | |||
| 2062 | Ga0157379_10000065 | |||
| 2063 | Ga0157379_10028167 | |||
| 2064 | Ga0157379_10053984 | |||
| 2065 | Ga0157379_10143288 | |||
| 2066 | Ga0157379_10268760 | |||
| 2067 | Ga0157379_10491284 | |||
| 2068 | Ga0157376_10000180 | |||
| 2069 | Ga0157376_10169568 | |||
| 2070 | Ga0163161_10000421 | |||
| 2071 | Ga0163161_10057300 | |||
| 2072 | Ga0163161_10122388 | |||
| 2073 | Ga0163161_10245987 | |||
| 2074 | Ga0206353_10191222 | |||
| 2075 | Ga0213876_10027568 | |||
| 2076 | Ga0213876_10077420 | |||
| 2077 | Ga0213875_10000007 | |||
| 2078 | Ga0207666_1000354 | |||
| 2079 | Ga0207666_1000418 | |||
| 2080 | Ga0207673_1000514 | |||
| 2081 | Ga0209758_1006420 | |||
| 2082 | Ga0207697_10000370 | |||
| 2083 | Ga0207697_10006177 | |||
| 2084 | Ga0207653_10000520 | |||
| 2085 | Ga0207682_10000304 | |||
| 2086 | Ga0207682_10001407 | |||
| 2087 | Ga0207692_10011547 | |||
| 2088 | Ga0207692_10028953 | |||
| 2089 | Ga0207692_10061264 | |||
| 2090 | Ga0207642_10000516 | |||
| 2091 | Ga0207642_10046913 | |||
| 2092 | Ga0207642_10118703 | |||
| 2093 | Ga0207710_10037210 | |||
| 2094 | Ga0207688_10000014 | |||
| 2095 | Ga0207688_10039446 | |||
| 2096 | Ga0207688_10174572 | |||
| 2097 | Ga0207680_10070512 | |||
| 2098 | Ga0207647_10020223 | |||
| 2099 | Ga0207647_10129062 | |||
| 2100 | Ga0207685_10005940 | |||
| 2101 | Ga0207699_10016141 | |||
| 2102 | Ga0207699_10019327 | |||
| 2103 | Ga0207699_10058845 | |||
| 2104 | Ga0207699_10090308 | |||
| 2105 | Ga0207699_10119296 | |||
| 2106 | Ga0207645_10000160 | |||
| 2107 | Ga0207645_10015986 | |||
| 2108 | Ga0207645_10033351 | |||
| 2109 | Ga0207645_10039871 | |||
| 2110 | Ga0207645_10056603 | |||
| 2111 | Ga0207643_10000009 | |||
| 2112 | Ga0207643_10013114 | |||
| 2113 | Ga0207643_10043613 | |||
| 2114 | Ga0207705_10071868 | |||
| 2115 | Ga0207705_10141416 | |||
| 2116 | Ga0207684_10182839 | |||
| 2117 | Ga0207654_10000441 | |||
| 2118 | Ga0207654_10089393 | |||
| 2119 | Ga0207707_10000554 | |||
| 2120 | Ga0207707_10062090 | |||
| 2121 | Ga0207707_10079079 | |||
| 2122 | Ga0207707_10092039 | |||
| 2123 | Ga0207707_10206367 | |||
| 2124 | Ga0207695_10074067 | |||
| 2125 | Ga0207671_10019030 | |||
| 2126 | Ga0207671_10229462 | |||
| 2127 | Ga0207671_10242468 | |||
| 2128 | Ga0207693_10005726 | |||
| 2129 | Ga0207693_10067856 | |||
| 2130 | Ga0207693_10073182 | |||
| 2131 | Ga0207693_10077596 | |||
| 2132 | Ga0207693_10124294 | |||
| 2133 | Ga0207693_10279397 | |||
| 2134 | Ga0207663_10006452 | |||
| 2135 | Ga0207663_10013217 | |||
| 2136 | Ga0207663_10171491 | |||
| 2137 | Ga0207663_10244686 | |||
| 2138 | Ga0207663_10284356 | |||
| 2139 | Ga0207660_10000161 | |||
| 2140 | Ga0207660_10006228 | |||
| 2141 | Ga0207660_10054812 | |||
| 2142 | Ga0207660_10094455 | |||
| 2143 | Ga0207660_10138442 | |||
| 2144 | Ga0207662_10001074 | |||
| 2145 | Ga0207662_10011994 | |||
| 2146 | Ga0207662_10013455 | |||
| 2147 | Ga0207662_10049759 | |||
| 2148 | Ga0207662_10082683 | |||
| 2149 | Ga0207657_10000294 | |||
| 2150 | Ga0207657_10017327 | |||
| 2151 | Ga0207657_10019363 | |||
| 2152 | Ga0207657_10044754 | |||
| 2153 | Ga0207657_10065546 | |||
| 2154 | Ga0207657_10071664 | |||
| 2155 | Ga0207649_10000429 | |||
| 2156 | Ga0207649_10050379 | |||
| 2157 | Ga0207652_10044984 | |||
| 2158 | Ga0207652_10045984 | |||
| 2159 | Ga0207652_10129523 | |||
| 2160 | Ga0207652_10207576 | |||
| 2161 | Ga0207652_10422727 | |||
| 2162 | Ga0207652_10502035 | |||
| 2163 | Ga0207646_10655492 | |||
| 2164 | Ga0207681_10000035 | |||
| 2165 | Ga0207681_10043294 | |||
| 2166 | Ga0207681_10094415 | |||
| 2167 | Ga0207681_10147070 | |||
| 2168 | Ga0207681_10184442 | |||
| 2169 | Ga0207694_10006222 | |||
| 2170 | Ga0207694_10292956 | |||
| 2171 | Ga0207694_10409336 | |||
| 2172 | Ga0207650_10009941 | |||
| 2173 | Ga0207650_10063852 | |||
| 2174 | Ga0207650_10088741 | |||
| 2175 | Ga0207659_10000027 | |||
| 2176 | Ga0207659_10012080 | |||
| 2177 | Ga0207659_10075169 | |||
| 2178 | Ga0207659_10153856 | |||
| 2179 | Ga0207659_10407600 | |||
| 2180 | Ga0207687_10000551 | |||
| 2181 | Ga0207687_10008252 | |||
| 2182 | Ga0207687_10375268 | |||
| 2183 | Ga0207687_10438217 | |||
| 2184 | Ga0207687_10589573 | |||
| 2185 | Ga0207700_10016032 | |||
| 2186 | Ga0207700_10020626 | |||
| 2187 | Ga0207664_10024052 | |||
| 2188 | Ga0207664_10068193 | |||
| 2189 | Ga0207664_10210958 | |||
| 2190 | Ga0207664_10218888 | |||
| 2191 | Ga0207664_10770232 | |||
| 2192 | Ga0207644_10003065 | |||
| 2193 | Ga0207644_10024126 | |||
| 2194 | Ga0207644_10024425 | |||
| 2195 | Ga0207644_10053710 | |||
| 2196 | Ga0207690_10000056 | |||
| 2197 | Ga0207690_10065219 | |||
| 2198 | Ga0207690_10067561 | |||
| 2199 | Ga0207690_10728654 | |||
| 2200 | Ga0207706_10000307 | |||
| 2201 | Ga0207706_10019938 | |||
| 2202 | Ga0207706_10020976 | |||
| 2203 | Ga0207706_10058718 | |||
| 2204 | Ga0207706_10158375 | |||
| 2205 | Ga0207706_10299417 | |||
| 2206 | Ga0207686_10001582 | |||
| 2207 | Ga0207686_10020326 | |||
| 2208 | Ga0207686_10057612 | |||
| 2209 | Ga0207686_10171744 | |||
| 2210 | Ga0207686_10212601 | |||
| 2211 | Ga0207686_10355561 | |||
| 2212 | Ga0207709_10000087 | |||
| 2213 | Ga0207709_10009741 | |||
| 2214 | Ga0207709_10100890 | |||
| 2215 | Ga0207709_10199865 | |||
| 2216 | Ga0207709_10485754 | |||
| 2217 | Ga0207670_10000263 | |||
| 2218 | Ga0207670_10006655 | |||
| 2219 | Ga0207670_10008975 | |||
| 2220 | Ga0207670_10083194 | |||
| 2221 | Ga0207670_10280398 | |||
| 2222 | Ga0207670_10381171 | |||
| 2223 | Ga0207669_10000052 | |||
| 2224 | Ga0207669_10036794 | |||
| 2225 | Ga0207669_10076172 | |||
| 2226 | Ga0207669_10167638 | |||
| 2227 | Ga0207669_10571722 | |||
| 2228 | Ga0207704_10000063 | |||
| 2229 | Ga0207704_10008777 | |||
| 2230 | Ga0207704_10044292 | |||
| 2231 | Ga0207704_10071364 | |||
| 2232 | Ga0207704_10221861 | |||
| 2233 | Ga0207665_10017994 | |||
| 2234 | Ga0207691_10000167 | |||
| 2235 | Ga0207691_10121820 | |||
| 2236 | Ga0207691_10144301 | |||
| 2237 | Ga0207711_10017811 | |||
| 2238 | Ga0207711_10025629 | |||
| 2239 | Ga0207711_10538050 | |||
| 2240 | Ga0207689_10000155 | |||
| 2241 | Ga0207689_10330343 | |||
| 2242 | Ga0207661_10000072 | |||
| 2243 | Ga0207661_10089894 | |||
| 2244 | Ga0207661_10299170 | |||
| 2245 | Ga0207661_10444650 | |||
| 2246 | Ga0207679_10000057 | |||
| 2247 | Ga0207679_10017981 | |||
| 2248 | Ga0207679_10119066 | |||
| 2249 | Ga0207679_10228952 | |||
| 2250 | Ga0207679_10259106 | |||
| 2251 | Ga0207667_10010749 | |||
| 2252 | Ga0207667_10027211 | |||
| 2253 | Ga0207667_10199854 | |||
| 2254 | Ga0207667_10235146 | |||
| 2255 | Ga0207667_10289964 | |||
| 2256 | Ga0207667_10652522 | |||
| 2257 | Ga0207651_10000087 | |||
| 2258 | Ga0207651_10118903 | |||
| 2259 | Ga0207651_10420012 | |||
| 2260 | Ga0207651_10476253 | |||
| 2261 | Ga0207712_10000122 | |||
| 2262 | Ga0207712_10009565 | |||
| 2263 | Ga0207712_10010640 | |||
| 2264 | Ga0207712_10227563 | |||
| 2265 | Ga0207668_10000084 | |||
| 2266 | Ga0207668_10013912 | |||
| 2267 | Ga0207668_10026818 | |||
| 2268 | Ga0207668_10187872 | |||
| 2269 | Ga0207668_10223093 | |||
| 2270 | Ga0207640_10001027 | |||
| 2271 | Ga0207640_10076067 | |||
| 2272 | Ga0207640_10117964 | |||
| 2273 | Ga0207658_10003107 | |||
| 2274 | Ga0207658_10140058 | |||
| 2275 | Ga0207658_10188724 | |||
| 2276 | Ga0207677_10012206 | |||
| 2277 | Ga0207703_10001870 | |||
| 2278 | Ga0207703_10003716 | |||
| 2279 | Ga0207703_10022833 | |||
| 2280 | Ga0207703_10324813 | |||
| 2281 | Ga0207639_10001925 | |||
| 2282 | Ga0207639_10690883 | |||
| 2283 | Ga0207678_10000187 | |||
| 2284 | Ga0207678_10027928 | |||
| 2285 | Ga0207678_10037590 | |||
| 2286 | Ga0207678_10055576 | |||
| 2287 | Ga0207678_10066744 | |||
| 2288 | Ga0207708_10000158 | |||
| 2289 | Ga0207708_10000296 | |||
| 2290 | Ga0207708_10002015 | |||
| 2291 | Ga0207708_10002641 | |||
| 2292 | Ga0207708_10058689 | |||
| 2293 | Ga0207708_10629646 | |||
| 2294 | Ga0207702_10001960 | |||
| 2295 | Ga0207702_10063916 | |||
| 2296 | Ga0207702_10172352 | |||
| 2297 | Ga0207702_10248625 | |||
| 2298 | Ga0207702_10340705 | |||
| 2299 | Ga0207702_10342006 | |||
| 2300 | Ga0207702_10415663 | |||
| 2301 | Ga0207641_10000896 | |||
| 2302 | Ga0207641_10031874 | |||
| 2303 | Ga0207648_10001167 | |||
| 2304 | Ga0207648_10003124 | |||
| 2305 | Ga0207648_10094370 | |||
| 2306 | Ga0207648_10156264 | |||
| 2307 | Ga0207676_10000089 | |||
| 2308 | Ga0207676_10018700 | |||
| 2309 | Ga0207676_10127658 | |||
| 2310 | Ga0207674_10001478 | |||
| 2311 | Ga0207674_10012981 | |||
| 2312 | Ga0207674_10048193 | |||
| 2313 | Ga0207674_10055121 | |||
| 2314 | Ga0207674_10146357 | |||
| 2315 | Ga0207674_10289726 | |||
| 2316 | Ga0207675_100000229 | |||
| 2317 | Ga0207675_100111466 | |||
| 2318 | Ga0207675_100134223 | |||
| 2319 | Ga0207683_10000525 | |||
| 2320 | Ga0207683_10006495 | |||
| 2321 | Ga0207683_10010816 | |||
| 2322 | Ga0207683_10022729 | |||
| 2323 | Ga0207683_10319679 | |||
| 2324 | Ga0207698_10000474 | |||
| 2325 | Ga0207698_10089517 | |||
| 2326 | Ga0207698_10365216 | |||
| 2327 | Ga0207698_10503186 | |||
| 2328 | Ga0209982_1006987 | |||
| 2329 | Ga0210002_1006040 | |||
| 2330 | Ga0209971_1004003 | |||
| 2331 | Ga0209971_1014968 | |||
| 2332 | Ga0209998_10001800 | |||
| 2333 | Ga0209998_10002157 | |||
| 2334 | Ga0209813_10007333 | |||
| 2335 | Ga0209813_10007971 | |||
| 2336 | Ga0209813_10122766 | |||
| 2337 | Ga0209974_10019819 | |||
| 2338 | Ga0209974_10027444 | |||
| 2339 | Ga0207428_10000037 | |||
| 2340 | Ga0207428_10000308 | |||
| 2341 | Ga0207428_10000474 | |||
| 2342 | Ga0207428_10063820 | |||
| 2343 | Ga0207428_10105304 | |||
| 2344 | Ga0207428_10113451 | |||
| 2345 | Ga0268266_10024123 | |||
| 2346 | Ga0268266_10033960 | |||
| 2347 | Ga0268266_10578734 | |||
| 2348 | Ga0268265_10000195 | |||
| 2349 | Ga0268265_10000508 | |||
| 2350 | Ga0268265_10014611 | |||
| 2351 | Ga0268265_10293639 | |||
| 2352 | Ga0268264_10000526 | |||
| 2353 | Ga0268264_10005989 | |||
| 2354 | Ga0268264_10052107 | |||
| 2355 | Ga0268264_10220840 | |||
| 2356 | Ga0265337_1002502 | |||
| 2357 | Ga0265318_10004336 | |||
| 2358 | Ga0265338_10022782 | |||
| 2359 | Ga0265330_10029811 | |||
| 2360 | Ga0265330_10086147 | |||
| 2361 | Ga0265332_10006780 | |||
| 2362 | Ga0265332_10102177 | |||
| 2363 | Ga0265320_10031514 | |||
| 2364 | Ga0265325_10000126 | |||
| 2365 | Ga0265325_10000352 | |||
| 2366 | Ga0265325_10010060 | |||
| 2367 | Ga0265325_10016900 | |||
| 2368 | Ga0265329_10029030 | |||
| 2369 | Ga0265329_10034663 | |||
| 2370 | Ga0265340_10000192 | |||
| 2371 | Ga0265340_10018794 | |||
| 2372 | Ga0265340_10026222 | |||
| 2373 | Ga0265340_10033433 | |||
| 2374 | Ga0265340_10056591 | |||
| 2375 | Ga0265340_10146659 | |||
| 2376 | Ga0265339_10007994 | |||
| 2377 | Ga0265339_10010090 | |||
| 2378 | Ga0265339_10124935 | |||
| 2379 | Ga0265339_10150565 | |||
| 2380 | Ga0265316_10278928 | |||
| 2381 | Ga0265313_10000106 | |||
| 2382 | Ga0265313_10006310 | |||
| 2383 | Ga0265313_10014074 | |||
| 2384 | Ga0265313_10020932 | |||
| 2385 | Ga0265313_10097307 | |||
| 2386 | Ga0307508_10016695 | |||
| 2387 | Ga0316575_10111479 | |||
| 2388 | Ga0316579_10109015 | |||
| 2389 | Ga0265314_10005573 | |||
| 2390 | Ga0265314_10107268 | |||
| 2391 | Ga0265342_10000100 | |||
| 2392 | Ga0265342_10000882 | |||
| 2393 | Ga0265342_10039481 | |||
| 2394 | Ga0307413_10774705 | |||
| 2395 | Ga0307416_100724120 | |||
| 2396 | Ga0307416_100811174 | |||
| 2397 | Ga0307411_10153015 | |||
| 2398 | Ga0307415_100381532 | |||
| 2399 | Ga0316583_10000161 | |||
| 2400 | Ga0316583_10093777 | |||
| 2401 | Ga0307510_10260030 | |||
| 2402 | Ga0373930_0000020 | |||
| 2403 | Ga0373930_0001897 | |||
| 2404 | Ga0373948_0000775 | |||
| 2405 | Ga0373948_0003627 | |||
| 2406 | Ga0373950_0002092 | |||
| 2407 | Ga0373950_0002937 | |||
| 2408 | Ga0373958_0000679 | |||
| 2409 | Ga0373958_0000892 | |||
| 2410 | Ga0373959_0002322 | |||
| 2411 | Ga0373959_0004634 | |||
| 2412 | Ga0373938_0000321 | |||
| 2413 | Ga0373938_0001943 | |||
| 2414 | Ga0373926_0005663 | |||
| 2415 | Ga0373926_0031996 | |||
| 2416 | Ga0373926_0047484 | |||
| 2417 | Ga0373926_0102616 | |||
| 2418 | Ga0373928_0003285 | |||
| 2419 | Ga0373928_0007867 | |||
| 2420 | Ga0373929_0000042 | |||
| 2421 | Ga0373934_0031395 | |||
| 2422 | Ga0373934_0048369 | |||
| 2423 | Ga0373940_0002473 | |||
| 2424 | Ga0373940_0008037 | |||
| 2425 | Ga0373940_0026599 | |||
| 2426 | Ga0373944_0008477 | |||
| 2427 | Ga0373944_0021423 | |||
| 2428 | Ga0373944_0027193 | |||
| 2429 | Ga0373944_0071706 | |||
| 2430 | Ga0373949_0005028 | |||
| 2431 | Ga0373949_0008824 | |||
| 2432 | Ga0373949_0019983 | |||
| 2433 | Ga0373951_0003336 | |||
| 2434 | Ga0373951_0010103 | |||
| 2435 | Ga0373952_0000102 | |||
| 2436 | Ga0373952_0002076 | |||
| 2437 | Ga0373952_0003332 | |||
| 2438 | Ga0373923_0002700 | |||
| 2439 | Ga0373923_0004197 | |||
| 2440 | Ga0373923_0075405 | |||
| 2441 | Ga0373932_0002320 | |||
| 2442 | Ga0373932_0002582 | |||
| 2443 | Ga0373936_0003041 | |||
| 2444 | Ga0373936_0164967 | |||
| 2445 | Ga0373939_0000261 | |||
| 2446 | Ga0373939_0000299 | |||
| 2447 | Ga0373939_0002349 | |||
| 2448 | Ga0373939_0040056 | |||
| 2449 | Ga0373939_0041631 | |||
| 2450 | Ga0373941_0004117 | |||
| 2451 | Ga0373941_0010894 | |||
| 2452 | Ga0373941_0032409 | |||
| 2453 | Ga0373945_0002982 | |||
| 2454 | Ga0373953_0001408 | |||
| 2455 | Ga0373953_0017950 | |||
| 2456 | Ga0373953_0040072 | |||
| 2457 | Ga0373954_0003125 | |||
| 2458 | Ga0373954_0011821 | |||
| 2459 | Ga0373954_0046561 | |||
| 2460 | Ga0373954_0124163 | |||
| 2461 | Ga0373956_0004874 | |||
| 2462 | Ga0373956_0014969 | |||
| 2463 | Ga0373956_0033597 | |||
| 2464 | Ga0373956_0178018 | |||
| 2465 | Ga0373957_0011372 | |||
| 2466 | Ga0373957_0019808 | |||
| 2467 | Ga0373957_0028596 | |||
| 2468 | Ga0373957_0090234 | |||
| 2469 | Ga0373960_0001113 | |||
| 2470 | Ga0373960_0005022 | |||
| 2471 | Ga0373960_0029703 | |||
| 2472 | Ga0373960_0043313 | |||
| 2473 | Ga0373960_0083640 | |||
| 2474 | Ga0373943_0001959 | |||
| 2475 | Ga0373943_0043498 | |||
| 2476 | Ga0373943_0045730 | |||
| 2477 | Ga0373943_0149170 | |||
| 2478 | Ga0373946_0000552 | |||
| 2479 | Ga0373946_0008023 | |||
| 2480 | Ga0373946_0024168 | |||
| 2481 | Ga0373955_0000513 | |||
| 2482 | Ga0373955_0000862 | |||
| 2483 | Ga0373955_0034680 | |||
| 2484 | Ga0373942_0001283 | |||
| 2485 | Ga0373942_0008995 | |||
| 2486 | Ga0373942_0039604 | |||
| 2487 | Ga0373961_0002305 | |||
| 2488 | Ga0373961_0002581 | |||
| 2489 | Ga0373961_0052384 | |||
| 2490 | Ga0373962_0036853 | |||
| 2491 | Ga0316574_0076088 | |||
| 2492 | Ga0373924_0000240 | |||
| 2493 | Ga0373924_0007693 | |||
| 2494 | Ga0373924_0016808 | |||
| 2495 | Ga0373931_0003801 | |||
| 2496 | Ga0373931_0004468 | |||
| 2497 | Ga0373931_0005387 | |||
| 2498 | Ga0373931_0008666 | |||
| 2499 | Ga0373935_0000088 | |||
| 2500 | Ga0373935_0003255 | |||
| 2501 | Ga0373935_0040467 | |||
| 2502 | Ga0373935_0058215 | |||
| 2503 | Ga0373927_0027363 | |||
| 2504 | Ga0373927_0027573 | |||
| 2505 | Ga0373927_0038709 | |||
| 2506 | Ga0373927_0263465 | |||
| 2507 | Ga0373933_0003120 | |||
| 2508 | Ga0373933_0011012 | |||
| 2509 | Ga0373933_0013709 | |||
| 2510 | Ga0373933_0013911 | |||
| 2511 | Ga0373933_0018113 | |||
| 2512 | Ga0373933_0229796 | |||
| 2513 | Ga0373933_0269808 | |||
| 2514 | Ga0373933_0436289 | |||
| 2515 | Ga0373947_0001466 | |||
| 2516 | Ga0373947_0001608 | |||
| 2517 | Ga0373947_0007595 | |||
| 2518 | Ga0373947_0077321 | |||
| 2519 | Ga0373947_0160029 | |||
| 2520 | Ga0373947_0333368 | |||
| 2521 | Ga0373937_0000124 | |||
| 2522 | Ga0373937_0007923 | |||
| 2523 | Ga0373937_0010800 | |||
| 2524 | Ga0373937_0049008 | |||
| 2525 | Ga0373937_0067527 | |||
| 2526 | Ga0373937_0096758 | |||
| 2527 | Ga0373937_0309262 | |||
| 2528 | Ga0373937_0730241 | |||
| 2529 | Ga0373925_0000929 | |||
| 2530 | Ga0373925_0025220 | |||
| 2531 | Ga0373925_0030267 | |||
| 2532 | Ga0373925_0131102 | |||
| 2533 | Ga0373925_0200772 | |||
| 2534 | Ga0373925_0618602 | |||
| 2535 | Ga0395899_0007959 | |||
| 2536 | Ga0395899_0065556 | |||
| 2537 | Ga0395900_0005074 | |||
| 2538 | Ga0395900_0008149 | |||
| 2539 | Ga0395898_0012968 | |||
| 2540 | Ga0395898_0019972 | |||
| 2541 | Ga0395898_0044004 | |||
| 2542 | Ga0436364_0320537 | |||
| 2543 | Ga0436364_0461857 | |||
| 2544 | Ga0436364_0934985 | |||
| 2545 | Ga0395901_0048458 | |||
| 2546 | Ga0395901_0104341 | |||
| 2547 | Ga0436365_0067390 | |||
| 2548 | Ga0436365_0459020 | |||
| 2549 | Ga0436365_1235938 | |||
| 2550 | Ga0436361_0431504 | |||
| 2551 | Ga0436363_0565062 | |||
| 2552 | Ga0436363_0588048 | |||
| 2553 | Ga0436362_1201994 | |||
| 2554 | Ga0439453_0000484 | |||
| 2555 | Ga0439453_0012281 | |||
| 2556 | Ga0439441_024967 | |||
| 2557 | Ga0439450_092512 | |||
| 2558 | Ga0439455_0011472 | |||
| 2559 | Ga0439463_043431 | |||
| 2560 | Ga0439446_0096249 | |||
| 2561 | Ga0451577_0130165 | |||
| 2562 | Ga0439440_0004213 | |||
| 2563 | Ga0466966_0119120 | |||
| 2564 | Ga0466963_0319141 | |||
| 2565 | Ga0466971_0123601 | |||
| 2566 | Ga0451576_0052301 | |||
| 2567 | Ga0466967_0051512 | |||
| 2568 | Ga0466967_0294143 | |||
| 2569 | Ga0495617_039107 | |||
| 2570 | Ga0495617_060812 | |||
| 2571 | Ga0495592_0000020 | |||
| 2572 | Ga0495592_0009547 | |||
| 2573 | Ga0495592_0012703 | |||
| 2574 | Ga0495592_0221622 | |||
| 2575 | Ga0495592_0503038 | |||
| 2576 | Ga0495603_0025279 | |||
| 2577 | Ga0495603_0034874 | |||
| 2578 | Ga0495603_0106974 | |||
| 2579 | Ga0495603_0132770 | |||
| 2580 | Ga0495590_0050857 | |||
| 2581 | Ga0495590_0103288 | |||
| 2582 | Ga0495629_0000222 | |||
| 2583 | Ga0495629_0005609 | |||
| 2584 | Ga0495629_0073719 | |||
| 2585 | Ga0495629_0108030 | |||
| 2586 | Ga0495638_0012075 | |||
| 2587 | Ga0495641_0016360 | |||
| 2588 | Ga0495641_0031517 | |||
| 2589 | Ga0495641_0041306 | |||
| 2590 | Ga0495641_0052185 | |||
| 2591 | Ga0495651_0001798 | |||
| 2592 | Ga0495651_0019865 | |||
| 2593 | Ga0495651_0035254 | |||
| 2594 | Ga0495651_0051434 | |||
| 2595 | Ga0495653_0000046 | |||
| 2596 | Ga0495653_0007380 | |||
| 2597 | Ga0495653_0007877 | |||
| 2598 | Ga0495653_0052601 | |||
| 2599 | Ga0495580_0014500 | |||
| 2600 | Ga0495580_0122946 | |||
| 2601 | Ga0495582_0006030 | |||
| 2602 | Ga0495582_0006417 | |||
| 2603 | Ga0495582_0010354 | |||
| 2604 | Ga0495582_0068540 | |||
| 2605 | Ga0495605_0037445 | |||
| 2606 | Ga0495639_0003996 | |||
| 2607 | Ga0495639_0217033 | |||
| 2608 | Ga0495662_0001624 | |||
| 2609 | Ga0495662_0052690 | |||
| 2610 | Ga0495664_0000017 | |||
| 2611 | Ga0495664_0011559 | |||
| 2612 | Ga0495664_0096799 | |||
| 2613 | Ga0495664_0210115 | |||
| 2614 | Ga0495584_0027260 | |||
| 2615 | Ga0495584_0104369 | |||
| 2616 | Ga0495584_0123394 | |||
| 2617 | Ga0495585_0001425 | |||
| 2618 | Ga0495585_0190219 | |||
| 2619 | Ga0495594_0017590 | |||
| 2620 | Ga0495594_0066849 | |||
| 2621 | Ga0495594_0210889 | |||
| 2622 | Ga0495607_0260264 | |||
| 2623 | Ga0495608_0000560 | |||
| 2624 | Ga0495608_0041445 | |||
| 2625 | Ga0495608_0054768 | |||
| 2626 | Ga0495608_0088003 | |||
| 2627 | Ga0495608_0122712 | |||
| 2628 | Ga0495608_0354044 | |||
| 2629 | Ga0495618_0000059 | |||
| 2630 | Ga0495618_0037132 | |||
| 2631 | Ga0495618_0107847 | |||
| 2632 | Ga0495628_0000530 | |||
| 2633 | Ga0495628_0014379 | |||
| 2634 | Ga0495628_0017502 | |||
| 2635 | Ga0495628_0033051 | |||
| 2636 | Ga0495628_0121222 | |||
| 2637 | Ga0495628_0148709 | |||
| 2638 | Ga0495628_0337056 | |||
| 2639 | Ga0495630_0003755 | |||
| 2640 | Ga0495630_0086059 | |||
| 2641 | Ga0495630_0249689 | |||
| 2642 | Ga0495630_0712051 | |||
| 2643 | Ga0495644_0000656 | |||
| 2644 | Ga0495644_0012285 | |||
| 2645 | Ga0495648_0227049 | |||
| 2646 | Ga0495652_0001393 | |||
| 2647 | Ga0495652_0023653 | |||
| 2648 | Ga0495652_0081945 | |||
| 2649 | Ga0495652_0268227 | |||
| 2650 | Ga0495640_0000029 | |||
| 2651 | Ga0495640_0088868 | |||
| 2652 | Ga0495586_0049786 | |||
| 2653 | Ga0495586_0076203 | |||
| 2654 | Ga0495587_0000019 | |||
| 2655 | Ga0495587_0082282 | |||
| 2656 | Ga0495587_0103407 | |||
| 2657 | Ga0495587_0109249 | |||
| 2658 | Ga0495587_0139470 | |||
| 2659 | Ga0495598_0174008 | |||
| 2660 | Ga0495621_0032491 | |||
| 2661 | Ga0495621_0064463 | |||
| 2662 | Ga0495645_0000006 | |||
| 2663 | Ga0495645_0007306 | |||
| 2664 | Ga0495645_0092181 | |||
| 2665 | Ga0495645_0214999 | |||
| 2666 | Ga0495622_0006881 | |||
| 2667 | Ga0495622_0029858 | |||
| 2668 | Ga0495622_0175983 | |||
| 2669 | Ga0495633_0005034 | |||
| 2670 | Ga0495633_0093209 | |||
| 2671 | Ga0495633_0125223 | |||
| 2672 | Ga0495667_0000061 | |||
| 2673 | Ga0495667_0003512 | |||
| 2674 | Ga0495667_0012058 | |||
| 2675 | Ga0495667_0016658 | |||
| 2676 | Ga0495667_0045437 | |||
| 2677 | Ga0495656_0000262 | |||
| 2678 | Ga0495656_0009406 | |||
| 2679 | Ga0495656_0016353 | |||
| 2680 | Ga0495634_0003572 | |||
| 2681 | Ga0495634_0153734 | |||
| 2682 | Ga0495611_0042526 | |||
| 2683 | Ga0495635_0005209 | |||
| 2684 | Ga0495635_0020959 | |||
| 2685 | Ga0495635_0064668 | |||
| 2686 | Ga0495635_0076067 | |||
| 2687 | Ga0495659_0001142 | |||
| 2688 | Ga0495659_0152606 | |||
| 2689 | Ga0495659_0170287 | |||
| 2690 | Ga0495588_0003364 | |||
| 2691 | Ga0495588_0016789 | |||
| 2692 | Ga0495657_0000306 | |||
| 2693 | Ga0495657_0058110 | |||
| 2694 | Ga0495657_0065747 | |||
| 2695 | Ga0495599_0000066 | |||
| 2696 | Ga0495599_0004314 | |||
| 2697 | Ga0495599_0024348 | |||
| 2698 | Ga0495623_0000428 | |||
| 2699 | Ga0495623_0001394 | |||
| 2700 | Ga0495623_0055303 | |||
| 2701 | Ga0495646_0000108 | |||
| 2702 | Ga0495646_0016683 | |||
| 2703 | Ga0495646_0021361 | |||
| 2704 | Ga0495646_0038478 | |||
| 2705 | Ga0495647_0008348 | |||
| 2706 | Ga0495647_0010525 | |||
| 2707 | Ga0495647_0035128 | |||
| 2708 | Ga0495658_0000656 | |||
| 2709 | Ga0495658_0081876 | |||
| 2710 | Ga0495658_0131742 | |||
| 2711 | Ga0495613_0238001 | |||
| 2712 | Ga0495624_0025941 | |||
| 2713 | Ga0495624_0044494 | |||
| 2714 | Ga0495624_0045160 | |||
| 2715 | Ga0495624_0212293 | |||
| 2716 | Ga0495670_0003236 | |||
| 2717 | Ga0495670_0126797 | |||
| 2718 | Ga0495600_0000030 | |||
| 2719 | Ga0495600_0000708 | |||
| 2720 | Ga0495600_0003719 | |||
| 2721 | Ga0495600_0040446 | |||
| 2722 | Ga0495600_0083709 | |||
| 2723 | Ga0495581_0005847 | |||
| 2724 | Ga0495581_0010274 | |||
| 2725 | Ga0495604_0000501 | |||
| 2726 | Ga0495604_0013476 | |||
| 2727 | Ga0495604_0014927 | |||
| 2728 | Ga0495604_0048949 | |||
| 2729 | Ga0495604_0105282 | |||
| 2730 | Ga0495604_0147904 | |||
| 2731 | Ga0495604_0187197 | |||
| 2732 | Ga0495674_0001027 | |||
| 2733 | Ga0495674_0087251 | |||
| 2734 | Ga0495674_0145588 | |||
| 2735 | Ga0495674_0152441 | |||
| 2736 | Ga0495674_0438209 | |||
| 2737 | Ga0495674_0623251 | |||
| 2738 | Ga0495676_0038571 | |||
| 2739 | Ga0495676_0039314 | |||
| 2740 | Ga0495676_0091203 | |||
| 2741 | Ga0495676_0187718 | |||
| 2742 | Ga0495680_0002301 | |||
| 2743 | Ga0495680_0002894 | |||
| 2744 | Ga0495680_0007421 | |||
| 2745 | Ga0495680_0018474 | |||
| 2746 | Ga0495680_0024681 | |||
| 2747 | Ga0495680_0027756 | |||
| 2748 | Ga0495675_0000719 | |||
| 2749 | Ga0495675_0011635 | |||
| 2750 | Ga0495675_0021716 | |||
| 2751 | Ga0495675_0169067 | |||
| 2752 | Ga0495675_0203873 | |||
| 2753 | Ga0495679_020243 | |||
| 2754 | Ga0495685_010564 | |||
| 2755 | Ga0495685_044762 | |||
| 2756 | Ga0495673_0084059 | |||
| 2757 | Ga0495684_0000056 | |||
| 2758 | Ga0495684_0045090 | |||
| 2759 | Ga0495684_0280439 | |||
| 2760 | Ga0495593_0001400 | |||
| 2761 | Ga0495593_0009436 | |||
| 2762 | Ga0495602_0000006 | |||
| 2763 | Ga0495602_0004878 | |||
| 2764 | Ga0495602_0028646 | |||
| 2765 | Ga0495602_0318501 | |||
| 2766 | Ga0495614_0230748 | |||
| 2767 | Ga0496100_0000189 | |||
| 2768 | Ga0496100_0001161 | |||
| 2769 | Ga0496100_0004954 | |||
| 2770 | Ga0496100_0049689 | |||
| 2771 | Ga0496100_0068743 | |||
| 2772 | Ga0496100_0086288 | |||
| 2773 | Ga0496100_0315268 | |||
| 2774 | Ga0496101_0000367 | |||
| 2775 | Ga0496101_0002673 | |||
| 2776 | Ga0496101_0224841 | |||
| 2777 | Ga0496101_0248825 | |||
| 2778 | Ga0496101_0290753 | |||
| 2779 | Ga0496101_0299396 | |||
| 2780 | Ga0496102_0000967 | |||
| 2781 | Ga0496102_0002863 | |||
| 2782 | Ga0496102_0002928 | |||
| 2783 | Ga0496102_0009278 | |||
| 2784 | Ga0496102_0013770 | |||
| 2785 | Ga0496102_0017017 | |||
| 2786 | Ga0496102_0091527 | |||
| 2787 | Ga0496102_0244805 | |||
| 2788 | Ga0496102_0302506 | |||
| 2789 | Ga0496102_0307262 | |||
| 2790 | Ga0496103_0001608 | |||
| 2791 | Ga0496103_0001665 | |||
| 2792 | Ga0496103_0005379 | |||
| 2793 | Ga0496103_0013937 | |||
| 2794 | Ga0496103_0030811 | |||
| 2795 | Ga0496103_0032609 | |||
| 2796 | Ga0496103_0052684 | |||
| 2797 | Ga0496103_0054457 | |||
| 2798 | Ga0496103_0242930 | |||
| 2799 | Ga0496104_0000116 | |||
| 2800 | Ga0496104_0001806 | |||
| 2801 | Ga0496104_0003787 | |||
| 2802 | Ga0496104_0003981 | |||
| 2803 | Ga0496104_0004377 | |||
| 2804 | Ga0496104_0005021 | |||
| 2805 | Ga0496104_0006644 | |||
| 2806 | Ga0496104_0087226 | |||
| 2807 | Ga0496104_0141339 | |||
| 2808 | Ga0496104_0163210 | |||
| 2809 | Ga0496104_0190266 | |||
| 2810 | Ga0496104_0208931 | |||
| 2811 | Ga0496104_0304314 | |||
| 2812 | Ga0496104_0348595 | |||
| 2813 | Ga0496105_0000550 | |||
| 2814 | Ga0496105_0008839 | |||
| 2815 | Ga0496105_0009845 | |||
| 2816 | Ga0496105_0014629 | |||
| 2817 | Ga0496105_0025397 | |||
| 2818 | Ga0496105_0049329 | |||
| 2819 | Ga0496105_0056463 | |||
| 2820 | Ga0496105_0062353 | |||
| 2821 | Ga0496105_0106070 | |||
| 2822 | Ga0496105_0132699 | |||
| 2823 | Ga0496106_0000736 | |||
| 2824 | Ga0496106_0004342 | |||
| 2825 | Ga0496106_0007993 | |||
| 2826 | Ga0496106_0008120 | |||
| 2827 | Ga0496106_0011796 | |||
| 2828 | Ga0496106_0069576 | |||
| 2829 | Ga0496106_0288303 | |||
| 2830 | Ga0496106_0358592 | |||
| 2831 | Ga0496106_0780538 | |||
| 2832 | Ga0496107_0000061 | |||
| 2833 | Ga0496107_0000646 | |||
| 2834 | Ga0496107_0006231 | |||
| 2835 | Ga0496107_0024408 | |||
| 2836 | Ga0496107_0085808 | |||
| 2837 | Ga0496107_0110341 | |||
| 2838 | Ga0496107_0114464 | |||
| 2839 | Ga0496107_0220588 | |||
| 2840 | Ga0496107_0254201 | |||
| 2841 | Ga0496108_0001716 | |||
| 2842 | Ga0496108_0006940 | |||
| 2843 | Ga0496108_0010675 | |||
| 2844 | Ga0496108_0017108 | |||
| 2845 | Ga0496108_0076752 | |||
| 2846 | Ga0496108_0102200 | |||
| 2847 | Ga0496108_0142582 | |||
| 2848 | Ga0496108_0256175 | |||
| 2849 | Ga0496108_0658237 | |||
| 2850 | Ga0496109_0004602 | |||
| 2851 | Ga0496109_0019595 | |||
| 2852 | Ga0496109_0023516 | |||
| 2853 | Ga0496109_0024181 | |||
| 2854 | Ga0496109_0029321 | |||
| 2855 | Ga0496109_0307433 | |||
| 2856 | Ga0496109_0324443 | |||
| 2857 | Ga0496109_0371279 | |||
| 2858 | Ga0496109_0406192 | |||
| 2859 | Ga0496109_0511437 | |||
| 2860 | Ga0496110_0000401 | |||
| 2861 | Ga0496110_0010675 | |||
| 2862 | Ga0496110_0011385 | |||
| 2863 | Ga0496110_0019695 | |||
| 2864 | Ga0496110_0043780 | |||
| 2865 | Ga0496110_0067983 | |||
| 2866 | Ga0496110_0106673 | |||
| 2867 | Ga0496110_0361501 | |||
| 2868 | Ga0496110_0783945 | |||
| 2869 | Ga0496110_0784061 | |||
| 2870 | Ga0496111_0001881 | |||
| 2871 | Ga0496111_0005191 | |||
| 2872 | Ga0496111_0010028 | |||
| 2873 | Ga0496111_0016147 | |||
| 2874 | Ga0496111_0020730 | |||
| 2875 | Ga0496111_0090586 | |||
| 2876 | Ga0496111_0143854 | |||
| 2877 | Ga0496111_0198765 | |||
| 2878 | Ga0496111_0494186 | |||
| 2879 | Ga0496112_0004013 | |||
| 2880 | Ga0496112_0010313 | |||
| 2881 | Ga0496112_0014330 | |||
| 2882 | Ga0496112_0055743 | |||
| 2883 | Ga0496112_0168031 | |||
| 2884 | Ga0496112_0235313 | |||
| 2885 | Ga0496112_0244231 | |||
| 2886 | Ga0496112_0299223 | |||
| 2887 | Ga0496112_0407761 | |||
| 2888 | Ga0496112_0797196 | |||
| 2889 | Ga0496113_0000682 | |||
| 2890 | Ga0496113_0001738 | |||
| 2891 | Ga0496113_0009613 | |||
| 2892 | Ga0496113_0013969 | |||
| 2893 | Ga0496113_0025336 | |||
| 2894 | Ga0496113_0028906 | |||
| 2895 | Ga0496113_0054399 | |||
| 2896 | Ga0496113_0074021 | |||
| 2897 | Ga0496113_0080065 | |||
| 2898 | Ga0496113_0115486 | |||
| 2899 | Ga0496113_0254450 | |||
| 2900 | Ga0496113_0256902 | |||
| 2901 | Ga0496114_0002405 | |||
| 2902 | Ga0496114_0022492 | |||
| 2903 | Ga0496114_0080545 | |||
| 2904 | Ga0496114_0091730 | |||
| 2905 | Ga0496114_0195968 | |||
| 2906 | Ga0496114_0512036 | |||
| 2907 | Ga0496114_0544833 | |||
| 2908 | Ga0496114_0864952 | |||
| 2909 | Ga0496115_0001413 | |||
| 2910 | Ga0496115_0005844 | |||
| 2911 | Ga0496115_0011047 | |||
| 2912 | Ga0496115_0037310 | |||
| 2913 | Ga0496115_0056246 | |||
| 2914 | Ga0496115_0088276 | |||
| 2915 | Ga0496115_0119638 | |||
| 2916 | Ga0496115_0132658 | |||
| 2917 | Ga0496115_0161503 | |||
| 2918 | Ga0496115_0199591 | |||
| 2919 | Ga0496115_0261008 | |||
| 2920 | Ga0496115_0650563 | |||
| 2921 | Ga0501031_0075121 | |||
| 2922 | Ga0501032_0028317 | |||
| 2923 | Ga0501033_0062792 | |||
| 2924 | Ga0501033_0087148 | |||
| 2925 | Ga0501033_0142433 | |||
| 2926 | Ga0501033_0304194 | |||
| 2927 | Ga0501033_0436067 | |||
| 2928 | Ga0501034_0010159 | |||
| 2929 | Ga0501034_0079854 | |||
| 2930 | Ga0501034_0085139 | |||
| 2931 | Ga0501034_0132421 | |||
| 2932 | Ga0501034_0143267 | |||
| 2933 | Ga0501034_0447997 | |||
| 2934 | Ga0501034_0460039 | |||
| 2935 | Ga0501036_0226905 | |||
| 2936 | Ga0501036_0480384 | |||
| 2937 | Ga0501037_0355219 | |||
| 2938 | Ga0501038_0081122 | |||
| 2939 | Ga0501038_0108560 | |||
| 2940 | Ga0501039_0190702 | |||
| 2941 | Ga0501039_0307517 | |||
| 2942 | Ga0501040_0120998 | |||
| 2943 | Ga0501040_0272705 | |||
| 2944 | Ga0501042_0099390 | |||
| 2945 | Ga0501042_0585421 | |||
| 2946 | Ga0501043_0126167 | |||
| 2947 | Ga0501046_0007129 | |||
| 2948 | Ga0501046_0164719 | |||
| 2949 | Ga0501046_0268667 | |||
| 2950 | Ga0501047_0144982 | |||
| 2951 | Ga0501047_0190645 | |||
| 2952 | Ga0501047_0212962 | |||
| 2953 | Ga0501047_0228869 | |||
| 2954 | Ga0501047_0672002 | |||
| 2955 | Ga0501067_0011699 | |||
| 2956 | Ga0501068_0436238 | |||
| 2957 | Ga0501069_0014533 | |||
| 2958 | Ga0501069_0166874 | |||
| 2959 | Ga0501069_0381786 | |||
| 2960 | Ga0501070_0004928 | |||
| 2961 | Ga0501070_0014873 | |||
| 2962 | Ga0501070_0056756 | |||
| 2963 | Ga0501070_0234137 | |||
| 2964 | Ga0501070_0367048 | |||
| 2965 | Ga0501071_0118866 | |||
| 2966 | Ga0501071_0315633 | |||
| 2967 | Ga0501071_0334638 | |||
| 2968 | Ga0501072_0002038 | |||
| 2969 | Ga0501072_0019373 | |||
| 2970 | Ga0501072_0037372 | |||
| 2971 | Ga0501072_0303621 | |||
| 2972 | Ga0501072_0583136 | |||
| 2973 | Ga0501073_0036871 | |||
| 2974 | Ga0501073_0099501 | |||
| 2975 | Ga0501073_0169412 | |||
| 2976 | Ga0501073_0187189 | |||
| 2977 | Ga0501073_0228696 | |||
| 2978 | Ga0501073_0246889 | |||
| 2979 | Ga0501073_0358376 | |||
| 2980 | Ga0501073_0500869 | |||
| 2981 | Ga0501074_0019000 | |||
| 2982 | Ga0501074_0159471 | |||
| 2983 | Ga0501075_0142426 | |||
| 2984 | Ga0501075_0376191 | |||
| 2985 | Ga0501076_0018369 | |||
| 2986 | Ga0501076_0215484 | |||
| 2987 | Ga0501076_0527835 | |||
| 2988 | Ga0501077_0051623 | |||
| 2989 | Ga0501077_0235239 | |||
| 2990 | Ga0501079_0136730 | |||
| 2991 | Ga0501079_0185104 | |||
| 2992 | Ga0501079_0224161 | |||
| 2993 | Ga0501079_0615253 | |||
| 2994 | Ga0501080_0024499 | |||
| 2995 | Ga0501080_0058737 | |||
| 2996 | Ga0501080_0244216 | |||
| 2997 | Ga0501080_0836015 | |||
| 2998 | Ga0501081_0019804 | |||
| 2999 | Ga0501081_0218557 | |||
| 3000 | Ga0501083_0186510 | |||
| 3001 | Ga0501083_0251072 | |||
| 3002 | Ga0501083_0449813 | |||
| 3003 | Ga0501035_0030762 | |||
| 3004 | Ga0501035_0072293 | |||
| 3005 | Ga0501035_0109445 | |||
| 3006 | Ga0501035_0114638 | |||
| 3007 | Ga0501035_0299793 | |||
| 3008 | Ga0501035_0324078 | |||
| 3009 | Ga0501044_0028950 | |||
| 3010 | Ga0501044_0072558 | |||
| 3011 | Ga0501044_0203977 | |||
| 3012 | Ga0501044_0226346 | |||
| 3013 | Ga0501045_0128592 | |||
| 3014 | Ga0501045_0183171 | |||
| 3015 | nmdc:mga03683_103889_c1 | |||
| 3016 | nmdc:mga03683_115443_c1 | |||
| 3017 | nmdc:mga03683_218358_c1 | |||
| 3018 | nmdc:mga03n38_21992_c1 | |||
| 3019 | nmdc:mga00v17_37939_c1 | |||
| 3020 | nmdc:mga00v17_50495_c1 | |||
| 3021 | nmdc:mga00v17_87957_c1 | |||
| 3022 | nmdc:mga0yw44_13887_c1 | |||
| 3023 | nmdc:mga0yw44_21791_c1 | |||
| 3024 | nmdc:mga0yw44_26127_c1 | |||
| 3025 | nmdc:mga0yw44_26235_c1 | |||
| 3026 | nmdc:mga0k408_332832_c1 | |||
| 3027 | nmdc:mga0k408_33623_c1 | |||
| 3028 | nmdc:mga0k408_65306_c1 | |||
| 3029 | nmdc:mga06z11_162684_c1 | |||
| 3030 | nmdc:mga06z11_197446_c1 | |||
| 3031 | nmdc:mga06z11_273540_c1 | |||
| 3032 | nmdc:mga06z11_28241_c1 | |||
| 3033 | nmdc:mga06z11_3236_c1 | |||
| 3034 | nmdc:mga06z11_9556_c1 | |||
| 3035 | nmdc:mga04h51_3168_c1 | |||
| 3036 | nmdc:mga04h51_59634_c1 | |||
| 3037 | nmdc:mga04h51_83023_c1 | |||
| 3038 | nmdc:mga04h51_8529_c1 | |||
| 3039 | nmdc:mga07m45_35650_c1 | |||
| 3040 | nmdc:mga07m45_59262_c1 | |||
| 3041 | nmdc:mga05p37_297809_c1 | |||
| 3042 | nmdc:mga05p37_344158_c1 | |||
| 3043 | nmdc:mga05p37_5632_c1 | |||
| 3044 | nmdc:mga05p37_5665_c1 | |||
| 3045 | nmdc:mga05p37_61997_c1 | |||
| 3046 | nmdc:mga05p37_685734_c1 | |||
| 3047 | nmdc:mga05p37_7070_c1 | |||
| 3048 | nmdc:mga05p37_96432_c1 | |||
| 3049 | nmdc:mga09592_1148_c1 | |||
| 3050 | nmdc:mga09592_19266_c1 | |||
| 3051 | nmdc:mga09592_199977_c1 | |||
| 3052 | nmdc:mga09592_5879_c1 | |||
| 3053 | nmdc:mga0qj67_124296_c1 | |||
| 3054 | nmdc:mga0qj67_161801_c1 | |||
| 3055 | nmdc:mga0qj67_36752_c1 | |||
| 3056 | nmdc:mga0qj67_48972_c1 | |||
| 3057 | nmdc:mga06r32_10189_c1 | |||
| 3058 | nmdc:mga06r32_10472_c1 | |||
| 3059 | nmdc:mga06r32_105411_c1 | |||
| 3060 | nmdc:mga06r32_167234_c1 | |||
| 3061 | nmdc:mga06r32_275684_c1 | |||
| 3062 | nmdc:mga06r32_4222_c1 | |||
| 3063 | nmdc:mga06r32_452809_c1 | |||
| 3064 | nmdc:mga06r32_88292_c1 | |||
| 3065 | nmdc:mga08y16_116995_c1 | |||
| 3066 | nmdc:mga08y16_185355_c1 | |||
| 3067 | nmdc:mga08y16_2503_c1 | |||
| 3068 | nmdc:mga08y16_42495_c1 | |||
| 3069 | nmdc:mga08y16_4316_c1 | |||
| 3070 | nmdc:mga08y16_433528_c1 | |||
| 3071 | nmdc:mga08y16_51194_c1 | |||
| 3072 | nmdc:mga08y16_548540_c1 | |||
| 3073 | nmdc:mga08y16_56282_c1 | |||
| 3074 | nmdc:mga08y16_5824_c1 | |||
| 3075 | nmdc:mga08y16_738_c1 | |||
| 3076 | nmdc:mga0n895_141479_c1 | |||
| 3077 | nmdc:mga0n895_30978_c1 | |||
| 3078 | nmdc:mga0n895_312707_c1 | |||
| 3079 | nmdc:mga0n895_32029_c1 | |||
| 3080 | nmdc:mga0n895_403530_c1 | |||
| 3081 | nmdc:mga0n895_450314_c1 | |||
| 3082 | nmdc:mga0n895_562_c1 | |||
| 3083 | nmdc:mga0n895_563811_c1 | |||
| 3084 | nmdc:mga0n895_7736_c1 | |||
| 3085 | nmdc:mga0n895_776751_c1 | |||
| 3086 | nmdc:mga0n895_842_c1 | |||
| 3087 | nmdc:mga0n895_86453_c1 | |||
| 3088 | nmdc:mga0rr50_19224_c1 | |||
| 3089 | nmdc:mga0rr50_231452_c1 | |||
| 3090 | nmdc:mga0rr50_300730_c1 | |||
| 3091 | nmdc:mga0rr50_40314_c1 | |||
| 3092 | nmdc:mga0rr50_482837_c1 | |||
| 3093 | nmdc:mga0rr50_62434_c1 | |||
| 3094 | nmdc:mga08x19_127569_c1 | |||
| 3095 | nmdc:mga08x19_1998_c1 | |||
| 3096 | nmdc:mga08x19_44407_c1 | |||
| 3097 | nmdc:mga08x19_444205_c1 | |||
| 3098 | nmdc:mga0a205_1040_c1 | |||
| 3099 | nmdc:mga0a205_120013_c1 | |||
| 3100 | nmdc:mga0a205_253120_c1 | |||
| 3101 | nmdc:mga0a205_4522_c1 | |||
| 3102 | nmdc:mga0a205_6591_c1 | |||
| 3103 | nmdc:mga0sz30_15012_c2 | |||
| 3104 | Ga0495601_0000007 | |||
| 3105 | Ga0495601_0005686 | |||
| 3106 | Ga0495601_0010735 | |||
| 3107 | Ga0495601_0022399 | |||
| 3108 | Ga0495601_0048962 | |||
| 3109 | Ga0495601_0075987 | |||
| 3110 | Ga0495601_0193211 | |||
| 3111 | Ga0495612_0000108 | |||
| 3112 | Ga0495612_0002028 | |||
| 3113 | Ga0495612_0003773 | |||
| 3114 | Ga0495612_0056154 | |||
| 3115 | Ga0495612_0145782 | |||
| 3116 | Ga0495612_0246103 | |||
| 3117 | Ga0495655_0068436 | |||
| 3118 | Ga0495595_0000767 | |||
| 3119 | Ga0495595_0002857 | |||
| 3120 | Ga0495595_0005668 | |||
| 3121 | Ga0495595_0010908 | |||
| 3122 | Ga0495595_0035705 | |||
| 3123 | Ga0495595_0038499 | |||
| 3124 | Ga0495595_0094208 | |||
| 3125 | Ga0495595_0134525 | |||
| 3126 | Ga0495595_0153234 | |||
| 3127 | Ga0495619_0000023 | |||
| 3128 | Ga0495619_0000271 | |||
| 3129 | Ga0495619_0001755 | |||
| 3130 | Ga0495619_0002683 | |||
| 3131 | Ga0495619_0014923 | |||
| 3132 | Ga0495619_0042753 | |||
| 3133 | Ga0495619_0062377 | |||
| 3134 | Ga0495619_0091763 | |||
| 3135 | Ga0495619_0281220 | |||
| 3136 | Ga0495619_0296913 | |||
| 3137 | Ga0500595_011034 | |||
| 3138 | Ga0500652_129479 | |||
| 3139 | Ga0500655_024812 | |||
| 3140 | Ga0500658_0057936 | |||
| 3141 | Ga0500658_0070827 | |||
| 3142 | Ga0500568_0078430 | |||
| 3143 | Ga0500603_075444 | |||
| 3144 | Ga0501084_0015408 | |||
| 3145 | Ga0501084_0344307 | |||
| 3146 | Ga0501084_0718430 | |||
| 3147 | Ga0501082_0000046 | |||
| 3148 | Ga0501082_0056939 | |||
| 3149 | Ga0501082_0083985 | |||
| 3150 | Ga0501082_0102503 | |||
| 3151 | Ga0501082_0107237 | |||
| 3152 | Ga0501082_0199025 | |||
| 3153 | Ga0501082_0239246 | |||
| 3154 | Ga0501082_0314088 | |||
| 3155 | Ga0501082_0809073 | |||
| 3156 | Ga0530510_0030059 | |||
| 3157 | Ga0530510_0101477 | |||
| 3158 | 2643756546 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2zzg-assembly2.cif.gz_B | crystal structure of alanyl-trna synthetase in complex with 5''-o-(n-(l-alanyl)-sulfamyoxyl) adenine without oligomerization domain | 0.9096 | 1 | 237 |
| 2zzg-assembly1.cif.gz_A | crystal structure of alanyl-trna synthetase in complex with 5''-o-(n-(l-alanyl)-sulfamyoxyl) adenine without oligomerization domain | 0.9084 | 1 | 237 |
| 2zzg-assembly2.cif.gz_B | crystal structure of alanyl-trna synthetase in complex with 5''-o-(n-(l-alanyl)-sulfamyoxyl) adenine without oligomerization domain | 0.9059 | 1 | 237 |
| 2zzg-assembly1.cif.gz_A | crystal structure of alanyl-trna synthetase in complex with 5''-o-(n-(l-alanyl)-sulfamyoxyl) adenine without oligomerization domain | 0.9047 | 1 | 237 |
| 2zzf-assembly1.cif.gz_A | crystal structure of alanyl-trna synthetase without oligomerization domain | 0.903 | 1 | 237 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57984_485_578_2.40.30.130 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.9375 | 1 | 93 | 2.40.30.130 |
| 2ztgA03 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.9191 | 1 | 93 | 2.40.30.130 |
| 2zzeB03 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.8881 | 1 | 91 | 2.40.30.130 |
| af_Q559E5_5_168_3.30.980.10 | Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 | 0.8864 | 102 | 237 | 3.30.980.10 |
| af_Q57984_485_578_2.40.30.130 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; | 0.8805 | 1 | 93 | 2.40.30.130 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1V8RRL1-F1-model_v4 | Ala-tRNA(Pro) hydrolase | 0.9797 | 1 | 237 |
GO:0002161
GO:0003676 GO:0004813 GO:0005524 GO:0005737 GO:0006419 GO:0046872 |
| AF-A0A2E8TN12-F1-model_v4 | Ala-tRNA(Pro) hydrolase | 0.9784 | 3 | 237 |
GO:0002161
GO:0003676 GO:0004813 GO:0005524 GO:0005737 GO:0006419 GO:0046872 |
| AF-A0A084UA67-F1-model_v4 | Alanyl-tRNA synthetase | 0.9779 | 2 | 237 |
GO:0002161
GO:0003676 GO:0004813 GO:0005524 GO:0005737 GO:0006419 GO:0046872 |
| AF-A0A432V9A0-F1-model_v4 | Alanyl-tRNA editing protein | 0.9773 | 1 | 237 |
GO:0002161
GO:0003676 GO:0004813 GO:0005524 GO:0005737 GO:0006419 GO:0046872 |
| AF-A0A5Q8CLW3-F1-model_v4 | Alanyl-tRNA editing protein | 0.9773 | 2 | 237 |
GO:0002161
GO:0003676 GO:0004813 GO:0005524 GO:0005737 GO:0006419 GO:0046872 |