F494897
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1582 | 438 | 3166 | 166 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100041046|Ga0070680_1000410462 |
| Length | 197 |
| Sequence | MSYVNISPSVLLPTFGPGIIFTFVGIKCVIMGAPEFNQLLVSNADFLKPFAITLTRDSEAAKDLFQETLYRAIANKEKYNVGTNIKAWLYTIMRNIFINNYRRKSKQKTIFDASPNDYLLNNSQSAVISDSAESNLRIRDIQGAIHNLPDIFRNPFLLYFDGYKYHEIADMLREPLGTIKSRIHFARKLLKAQIQLF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 2 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 87 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 121 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 128 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 130 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 194 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 195 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 197 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 198 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 200 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 201 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 202 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 204 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 205 | 3300031814 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 207 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 208 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 209 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 210 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 211 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 212 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 213 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 215 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 216 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 220 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 223 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 224 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 227 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 228 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 229 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 230 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 231 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 232 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 240 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 241 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 242 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 243 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 244 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 245 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 246 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 247 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 248 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 249 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 250 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 251 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 252 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 253 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 254 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 255 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 256 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 257 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 258 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 259 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 260 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 261 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 262 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 263 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 264 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 265 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 266 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 267 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 268 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 269 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 270 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 309 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 310 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 311 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 312 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 313 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 314 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 315 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 316 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300049133 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300049163 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 328 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 329 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 365 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 371 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 372 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 373 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 374 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 375 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 380 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 381 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 382 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 383 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 384 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 385 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 386 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 387 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 388 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 389 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 390 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 391 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 392 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 393 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 394 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 395 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 396 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 397 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 398 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 399 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 400 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 401 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 402 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 403 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 404 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 405 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 406 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 407 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 437 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 438 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.28 |
| Metatranscriptomes | 8.6 |
| Isolates | 0.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.36 |
| Nodule | 0 |
| Rhizoplane | 1.58 |
| Rhizosphere | 91.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070680_100041046 | 3300005336 | Bacteria | 3751 |
| 2 | ARSoilOldRDRAFT_c002956 | 3300000044 | Bacteria | 1474 |
| 3 | JGI24740J21852_10017260 | 3300001979 | Bacteria | 2585 |
| 4 | JGI24743J22301_10043241 | 3300001991 | Bacteria | 908 |
| 5 | JGI24744J21845_10044495 | 3300002077 | Bacteria | 825 |
| 6 | JGI24751J29686_10083622 | 3300002459 | Bacteria | 662 |
| 7 | Ga0006758J48902_1010223 | 3300003300 | Bacteria | 681 |
| 8 | Ga0006770J48903_1024384 | 3300003305 | Bacteria | 706 |
| 9 | rootH1_10032312 | 3300003316 | Bacteria | 7632 |
| 10 | rootH1_10183904 | 3300003316 | Bacteria | 1324 |
| 11 | rootH2_10010709 | 3300003320 | Bacteria | 8116 |
| 12 | rootH2_10012234 | 3300003320 | Bacteria | 6053 |
| 13 | rootH2_10013030 | 3300003320 | Bacteria | 7264 |
| 14 | rootH2_10140117 | 3300003320 | Bacteria | 1209 |
| 15 | rootH2_10262330 | 3300003320 | Bacteria | 2965 |
| 16 | rootH2_10299253 | 3300003320 | Bacteria | 1136 |
| 17 | rootL2_10029799 | 3300003322 | Bacteria | 5218 |
| 18 | rootL2_10068385 | 3300003322 | Bacteria | 5147 |
| 19 | rootL2_10358562 | 3300003322 | Bacteria | 1500 |
| 20 | rootH1_10012052 | 3300003316 | Bacteria | 7951 |
| 21 | rootH1_10012052 | 3300003323 | Bacteria | 55556 |
| 22 | rootH1_10021882 | 3300003323 | Bacteria | 5598 |
| 23 | rootH1_10077153 | 3300003323 | Bacteria | 2260 |
| 24 | rootH1_10113418 | 3300003316 | Bacteria | 2315 |
| 25 | rootH1_10113418 | 3300003323 | Bacteria | 10728 |
| 26 | rootH1_10205358 | 3300003323 | Bacteria | 3597 |
| 27 | Ga0007429J51699_1027948 | 3300003579 | Bacteria | 620 |
| 28 | Ga0065714_10111103 | 3300005288 | Bacteria | 1475 |
| 29 | Ga0065712_10095869 | 3300005290 | Bacteria | 2192 |
| 30 | Ga0065715_10185105 | 3300005293 | Bacteria | 1450 |
| 31 | Ga0065715_10330196 | 3300005293 | Bacteria | 985 |
| 32 | Ga0065715_10503462 | 3300005293 | Bacteria | 777 |
| 33 | Ga0065707_10133431 | 3300005295 | Bacteria | 1844 |
| 34 | Ga0070658_10045494 | 3300005327 | Unclassified | 3549 |
| 35 | Ga0070658_10056607 | 3300005327 | Bacteria | 3188 |
| 36 | Ga0070658_10549210 | 3300005327 | Bacteria | 1000 |
| 37 | Ga0070658_11005114 | 3300005327 | Bacteria | 725 |
| 38 | Ga0070676_10002621 | 3300005328 | Bacteria | 9253 |
| 39 | Ga0070676_10004336 | 3300005328 | Bacteria | 7453 |
| 40 | Ga0070676_10051756 | 3300005328 | Bacteria | 2412 |
| 41 | Ga0070676_10085879 | 3300005328 | Bacteria | 1918 |
| 42 | Ga0070676_10088645 | 3300005328 | Bacteria | 1891 |
| 43 | Ga0070676_10124096 | 3300005328 | Unclassified | 1625 |
| 44 | Ga0070676_10237666 | 3300005328 | Bacteria | 1210 |
| 45 | Ga0070683_100001188 | 3300005329 | Bacteria | 19784 |
| 46 | Ga0070683_100017900 | 3300005329 | Bacteria | 6264 |
| 47 | Ga0070683_100042954 | 3300005329 | Bacteria | 4164 |
| 48 | Ga0070683_100430377 | 3300005329 | Bacteria | 1259 |
| 49 | Ga0070683_100622796 | 3300005329 | Bacteria | 1033 |
| 50 | Ga0070690_100004203 | 3300005330 | Bacteria | 7967 |
| 51 | Ga0070690_100078347 | 3300005330 | Bacteria | 2159 |
| 52 | Ga0070690_100226398 | 3300005330 | Bacteria | 1312 |
| 53 | Ga0070690_100579057 | 3300005330 | Bacteria | 850 |
| 54 | Ga0070690_100812064 | 3300005330 | Unclassified | 726 |
| 55 | Ga0070670_100004105 | 3300005331 | Bacteria | 12167 |
| 56 | Ga0070670_100078263 | 3300005331 | Bacteria | 2840 |
| 57 | Ga0070670_100089178 | 3300005331 | Bacteria | 2651 |
| 58 | Ga0070670_100128773 | 3300005331 | Bacteria | 2185 |
| 59 | Ga0070670_100139038 | 3300005331 | Bacteria | 2100 |
| 60 | Ga0070670_100159745 | 3300005331 | Bacteria | 1953 |
| 61 | Ga0070670_100170069 | 3300005331 | Bacteria | 1890 |
| 62 | Ga0070670_100257504 | 3300005331 | Bacteria | 1521 |
| 63 | Ga0070670_100284893 | 3300005331 | Bacteria | 1443 |
| 64 | Ga0070670_100330777 | 3300005331 | Bacteria | 1336 |
| 65 | Ga0070670_100746009 | 3300005331 | Unclassified | 882 |
| 66 | Ga0070670_100762962 | 3300005331 | Bacteria | 872 |
| 67 | Ga0070670_100950710 | 3300005331 | Bacteria | 780 |
| 68 | Ga0070670_101181105 | 3300005331 | Bacteria | 699 |
| 69 | Ga0070677_10073220 | 3300005333 | Bacteria | 1447 |
| 70 | Ga0070677_10087130 | 3300005333 | Bacteria | 1350 |
| 71 | Ga0070677_10237420 | 3300005333 | Bacteria | 898 |
| 72 | Ga0068869_100003261 | 3300005334 | Bacteria | 9915 |
| 73 | Ga0068869_100005652 | 3300005334 | Bacteria | 7881 |
| 74 | Ga0068869_100009654 | 3300005334 | Bacteria | 6267 |
| 75 | Ga0068869_100011899 | 3300005334 | Bacteria | 5724 |
| 76 | Ga0068869_100043566 | 3300005334 | Bacteria | 3224 |
| 77 | Ga0068869_100054291 | 3300005334 | Bacteria | 2916 |
| 78 | Ga0068869_100068795 | 3300005334 | Bacteria | 2616 |
| 79 | Ga0068869_100073099 | 3300005334 | Unclassified | 2542 |
| 80 | Ga0068869_100121653 | 3300005334 | Bacteria | 1997 |
| 81 | Ga0070666_10000050 | 3300005335 | Bacteria | 100280 |
| 82 | Ga0070666_10013296 | 3300005335 | Bacteria | 5219 |
| 83 | Ga0070666_10075155 | 3300005335 | Unclassified | 2304 |
| 84 | Ga0070666_10105517 | 3300005335 | Bacteria | 1946 |
| 85 | Ga0070666_10126016 | 3300005335 | Bacteria | 1778 |
| 86 | Ga0070666_10416283 | 3300005335 | Bacteria | 967 |
| 87 | Ga0070666_10504604 | 3300005335 | Bacteria | 877 |
| 88 | Ga0070666_10584328 | 3300005335 | Bacteria | 814 |
| 89 | Ga0070680_100066036 | 3300005336 | Bacteria | 2966 |
| 90 | Ga0070680_100160066 | 3300005336 | Bacteria | 1892 |
| 91 | Ga0070682_100000019 | 3300005337 | Bacteria | 220844 |
| 92 | Ga0070682_100003137 | 3300005337 | Bacteria | 9155 |
| 93 | Ga0070682_100004566 | 3300005337 | Bacteria | 7699 |
| 94 | Ga0070682_100010606 | 3300005337 | Bacteria | 5233 |
| 95 | Ga0070682_100098274 | 3300005337 | Unclassified | 1928 |
| 96 | Ga0070682_100249292 | 3300005337 | Bacteria | 1279 |
| 97 | Ga0068868_100001389 | 3300005338 | Bacteria | 16714 |
| 98 | Ga0068868_100002193 | 3300005338 | Bacteria | 13467 |
| 99 | Ga0068868_100020680 | 3300005338 | Bacteria | 4950 |
| 100 | Ga0068868_100208769 | 3300005338 | Bacteria | 1631 |
| 101 | Ga0068868_100528593 | 3300005338 | Bacteria | 1037 |
| 102 | Ga0068868_101297443 | 3300005338 | Bacteria | 676 |
| 103 | Ga0068868_101524847 | 3300005338 | Bacteria | 626 |
| 104 | Ga0070660_100030338 | 3300005339 | Bacteria | 4056 |
| 105 | Ga0070660_100095968 | 3300005339 | Unclassified | 2344 |
| 106 | Ga0070660_100172150 | 3300005339 | Bacteria | 1749 |
| 107 | Ga0070660_101057994 | 3300005339 | Unclassified | 686 |
| 108 | Ga0070689_100004250 | 3300005340 | Bacteria | 9651 |
| 109 | Ga0070689_100010789 | 3300005340 | Bacteria | 6528 |
| 110 | Ga0070689_100022658 | 3300005340 | Bacteria | 4692 |
| 111 | Ga0070689_100114036 | 3300005340 | Bacteria | 2153 |
| 112 | Ga0070689_100301205 | 3300005340 | Bacteria | 1334 |
| 113 | Ga0070691_10041815 | 3300005341 | Bacteria | 2168 |
| 114 | Ga0070691_10109066 | 3300005341 | Bacteria | 1383 |
| 115 | Ga0070687_100117034 | 3300005343 | Bacteria | 1518 |
| 116 | Ga0070687_100305408 | 3300005343 | Bacteria | 1011 |
| 117 | Ga0070661_100000521 | 3300005344 | Bacteria | 29488 |
| 118 | Ga0070661_100008647 | 3300005344 | Bacteria | 7043 |
| 119 | Ga0070661_100020346 | 3300005344 | Bacteria | 4731 |
| 120 | Ga0070661_100148133 | 3300005344 | Bacteria | 1773 |
| 121 | Ga0070661_100583596 | 3300005344 | Bacteria | 902 |
| 122 | Ga0070668_100015362 | 3300005347 | Bacteria | 5722 |
| 123 | Ga0070668_100092617 | 3300005347 | Bacteria | 2384 |
| 124 | Ga0070668_100120610 | 3300005347 | Bacteria | 2095 |
| 125 | Ga0070668_100276622 | 3300005347 | Bacteria | 1401 |
| 126 | Ga0070668_100392605 | 3300005347 | Bacteria | 1183 |
| 127 | Ga0070668_100494914 | 3300005347 | Bacteria | 1057 |
| 128 | Ga0070668_101321528 | 3300005347 | Bacteria | 656 |
| 129 | Ga0070669_100007084 | 3300005353 | Bacteria | 8054 |
| 130 | Ga0070669_100064076 | 3300005353 | Unclassified | 2706 |
| 131 | Ga0070669_100228827 | 3300005353 | Bacteria | 1473 |
| 132 | Ga0070669_100271156 | 3300005353 | Bacteria | 1357 |
| 133 | Ga0070669_100682382 | 3300005353 | Bacteria | 866 |
| 134 | Ga0070669_100986643 | 3300005353 | Bacteria | 722 |
| 135 | Ga0070669_101494879 | 3300005353 | Bacteria | 587 |
| 136 | Ga0070675_100009761 | 3300005354 | Bacteria | 7476 |
| 137 | Ga0070675_100053362 | 3300005354 | Bacteria | 3325 |
| 138 | Ga0070675_100095781 | 3300005354 | Bacteria | 2493 |
| 139 | Ga0070675_100451048 | 3300005354 | Bacteria | 1153 |
| 140 | Ga0070675_100645777 | 3300005354 | Bacteria | 961 |
| 141 | Ga0070675_100653155 | 3300005354 | Unclassified | 956 |
| 142 | Ga0070675_100726638 | 3300005354 | Bacteria | 905 |
| 143 | Ga0070675_101036401 | 3300005354 | Unclassified | 754 |
| 144 | Ga0070671_100015427 | 3300005355 | Bacteria | 6172 |
| 145 | Ga0070671_100038053 | 3300005355 | Bacteria | 3993 |
| 146 | Ga0070671_100059111 | 3300005355 | Bacteria | 3190 |
| 147 | Ga0070671_100072533 | 3300005355 | Bacteria | 2876 |
| 148 | Ga0070671_100121636 | 3300005355 | Bacteria | 2197 |
| 149 | Ga0070671_100215932 | 3300005355 | Bacteria | 1627 |
| 150 | Ga0070674_100035222 | 3300005356 | Bacteria | 3351 |
| 151 | Ga0070674_100115713 | 3300005356 | Unclassified | 1977 |
| 152 | Ga0070674_100127185 | 3300005356 | Bacteria | 1895 |
| 153 | Ga0070674_100146462 | 3300005356 | Bacteria | 1778 |
| 154 | Ga0070674_100222072 | 3300005356 | Bacteria | 1470 |
| 155 | Ga0070674_100223381 | 3300005356 | Bacteria | 1466 |
| 156 | Ga0070673_100019908 | 3300005364 | Bacteria | 4828 |
| 157 | Ga0070673_100043192 | 3300005364 | Bacteria | 3481 |
| 158 | Ga0070673_100183060 | 3300005364 | Bacteria | 1794 |
| 159 | Ga0070673_100188551 | 3300005364 | Bacteria | 1770 |
| 160 | Ga0070673_100321768 | 3300005364 | Bacteria | 1366 |
| 161 | Ga0070673_100454444 | 3300005364 | Bacteria | 1153 |
| 162 | Ga0070673_100919470 | 3300005364 | Bacteria | 812 |
| 163 | Ga0070673_101122036 | 3300005364 | Bacteria | 735 |
| 164 | Ga0070688_100000950 | 3300005365 | Bacteria | 14486 |
| 165 | Ga0070688_100221759 | 3300005365 | Bacteria | 1333 |
| 166 | Ga0070688_100377262 | 3300005365 | Bacteria | 1044 |
| 167 | Ga0070688_100386989 | 3300005365 | Unclassified | 1032 |
| 168 | Ga0070688_100421083 | 3300005365 | Bacteria | 993 |
| 169 | Ga0070659_100006321 | 3300005366 | Bacteria | 8555 |
| 170 | Ga0070659_100015108 | 3300005366 | Bacteria | 5776 |
| 171 | Ga0070667_100000240 | 3300005367 | Bacteria | 62100 |
| 172 | Ga0070667_100004077 | 3300005367 | Bacteria | 12356 |
| 173 | Ga0070667_100019648 | 3300005367 | Bacteria | 5604 |
| 174 | Ga0070667_100032749 | 3300005367 | Bacteria | 4337 |
| 175 | Ga0070667_100060370 | 3300005367 | Bacteria | 3208 |
| 176 | Ga0070667_100087983 | 3300005367 | Bacteria | 2667 |
| 177 | Ga0070667_100105447 | 3300005367 | Bacteria | 2439 |
| 178 | Ga0070667_100225565 | 3300005367 | Bacteria | 1669 |
| 179 | Ga0070667_100443397 | 3300005367 | Bacteria | 1186 |
| 180 | Ga0070667_100485482 | 3300005367 | Bacteria | 1131 |
| 181 | Ga0070667_100534574 | 3300005367 | Bacteria | 1076 |
| 182 | Ga0070667_100819055 | 3300005367 | Bacteria | 865 |
| 183 | Ga0070667_100903124 | 3300005367 | Bacteria | 822 |
| 184 | Ga0070701_10666900 | 3300005438 | Bacteria | 696 |
| 185 | Ga0070700_100647491 | 3300005441 | Bacteria | 834 |
| 186 | Ga0070700_100664238 | 3300005441 | Bacteria | 824 |
| 187 | Ga0070663_100545270 | 3300005455 | Bacteria | 969 |
| 188 | Ga0070663_100711789 | 3300005455 | Bacteria | 854 |
| 189 | Ga0070678_100026957 | 3300005456 | Bacteria | 3894 |
| 190 | Ga0070678_100034684 | 3300005456 | Bacteria | 3516 |
| 191 | Ga0070678_100194798 | 3300005456 | Bacteria | 1668 |
| 192 | Ga0070678_100408415 | 3300005456 | Bacteria | 1181 |
| 193 | Ga0070678_100545084 | 3300005456 | Bacteria | 1029 |
| 194 | Ga0070678_100657857 | 3300005456 | Bacteria | 940 |
| 195 | Ga0070662_100011043 | 3300005457 | Bacteria | 5947 |
| 196 | Ga0070662_100068957 | 3300005457 | Unclassified | 2601 |
| 197 | Ga0070662_100084868 | 3300005457 | Bacteria | 2366 |
| 198 | Ga0070662_100127760 | 3300005457 | Bacteria | 1956 |
| 199 | Ga0070662_100297892 | 3300005457 | Bacteria | 1309 |
| 200 | Ga0070681_10035416 | 3300005458 | Bacteria | 5014 |
| 201 | Ga0070681_10040017 | 3300005458 | Bacteria | 4700 |
| 202 | Ga0070681_10073049 | 3300005458 | Bacteria | 3392 |
| 203 | Ga0070681_10241122 | 3300005458 | Bacteria | 1721 |
| 204 | Ga0070681_10272292 | 3300005458 | Unclassified | 1605 |
| 205 | Ga0070681_11250561 | 3300005458 | Bacteria | 665 |
| 206 | Ga0068867_100007586 | 3300005459 | Bacteria | 7677 |
| 207 | Ga0068867_100027529 | 3300005459 | Bacteria | 4086 |
| 208 | Ga0068867_100054642 | 3300005459 | Unclassified | 2950 |
| 209 | Ga0068867_100124969 | 3300005459 | Bacteria | 1992 |
| 210 | Ga0068867_100126218 | 3300005459 | Bacteria | 1983 |
| 211 | Ga0068867_100256063 | 3300005459 | Bacteria | 1425 |
| 212 | Ga0068867_100303354 | 3300005459 | Bacteria | 1317 |
| 213 | Ga0068867_100313999 | 3300005459 | Bacteria | 1296 |
| 214 | Ga0068867_100681821 | 3300005459 | Bacteria | 905 |
| 215 | Ga0068867_100692973 | 3300005459 | Bacteria | 898 |
| 216 | Ga0070685_10011927 | 3300005466 | Bacteria | 4557 |
| 217 | Ga0070685_10043939 | 3300005466 | Bacteria | 2556 |
| 218 | Ga0070685_10044583 | 3300005466 | Bacteria | 2539 |
| 219 | Ga0070685_10252501 | 3300005466 | Bacteria | 1169 |
| 220 | Ga0070698_100038199 | 3300005471 | Bacteria | 4947 |
| 221 | Ga0070698_100646882 | 3300005471 | Bacteria | 998 |
| 222 | Ga0070679_100028954 | 3300005530 | Bacteria | 5463 |
| 223 | Ga0070679_100402634 | 3300005530 | Bacteria | 1314 |
| 224 | Ga0070684_100001055 | 3300005535 | Bacteria | 19689 |
| 225 | Ga0070684_100009989 | 3300005535 | Bacteria | 7504 |
| 226 | Ga0070684_100083885 | 3300005535 | Bacteria | 2824 |
| 227 | Ga0070684_100405921 | 3300005535 | Bacteria | 1256 |
| 228 | Ga0070684_101223109 | 3300005535 | Bacteria | 706 |
| 229 | Ga0068853_100000422 | 3300005539 | Bacteria | 28780 |
| 230 | Ga0068853_100005510 | 3300005539 | Bacteria | 9925 |
| 231 | Ga0068853_100009975 | 3300005539 | Bacteria | 7670 |
| 232 | Ga0068853_100023984 | 3300005539 | Bacteria | 5114 |
| 233 | Ga0068853_100026506 | 3300005539 | Bacteria | 4866 |
| 234 | Ga0068853_100051580 | 3300005539 | Unclassified | 3541 |
| 235 | Ga0068853_100099675 | 3300005539 | Bacteria | 2567 |
| 236 | Ga0068853_100138689 | 3300005539 | Bacteria | 2182 |
| 237 | Ga0068853_100155255 | 3300005539 | Bacteria | 2062 |
| 238 | Ga0068853_100157921 | 3300005539 | Bacteria | 2044 |
| 239 | Ga0068853_100384100 | 3300005539 | Bacteria | 1312 |
| 240 | Ga0068853_100564309 | 3300005539 | Bacteria | 1079 |
| 241 | Ga0068853_100804465 | 3300005539 | Bacteria | 900 |
| 242 | Ga0070672_100013181 | 3300005543 | Bacteria | 5831 |
| 243 | Ga0070672_100017583 | 3300005543 | Bacteria | 5150 |
| 244 | Ga0070672_100045111 | 3300005543 | Bacteria | 3407 |
| 245 | Ga0070672_100048441 | 3300005543 | Bacteria | 3302 |
| 246 | Ga0070672_100142908 | 3300005543 | Bacteria | 1975 |
| 247 | Ga0070672_100413836 | 3300005543 | Bacteria | 1157 |
| 248 | Ga0070672_100569190 | 3300005543 | Bacteria | 985 |
| 249 | Ga0070672_100694463 | 3300005543 | Bacteria | 891 |
| 250 | Ga0070672_101126248 | 3300005543 | Bacteria | 698 |
| 251 | Ga0070686_100095829 | 3300005544 | Bacteria | 1994 |
| 252 | Ga0070686_100116717 | 3300005544 | Bacteria | 1827 |
| 253 | Ga0070686_100300570 | 3300005544 | Bacteria | 1190 |
| 254 | Ga0070686_100330065 | 3300005544 | Bacteria | 1140 |
| 255 | Ga0070693_100050727 | 3300005547 | Bacteria | 2373 |
| 256 | Ga0070693_100088450 | 3300005547 | Bacteria | 1862 |
| 257 | Ga0070693_100218917 | 3300005547 | Bacteria | 1246 |
| 258 | Ga0070665_100000014 | 3300005548 | Bacteria | 484881 |
| 259 | Ga0070665_100010319 | 3300005548 | Bacteria | 9448 |
| 260 | Ga0070665_100063719 | 3300005548 | Bacteria | 3696 |
| 261 | Ga0070665_100350904 | 3300005548 | Bacteria | 1481 |
| 262 | Ga0070665_100410831 | 3300005548 | Bacteria | 1362 |
| 263 | Ga0070665_100840123 | 3300005548 | Bacteria | 931 |
| 264 | Ga0070665_100935316 | 3300005548 | Bacteria | 879 |
| 265 | Ga0070665_100967016 | 3300005548 | Bacteria | 864 |
| 266 | Ga0070704_100372062 | 3300005549 | Bacteria | 1212 |
| 267 | Ga0068855_100000284 | 3300005563 | Bacteria | 62592 |
| 268 | Ga0068855_100014854 | 3300005563 | Bacteria | 9377 |
| 269 | Ga0068855_100022141 | 3300005563 | Bacteria | 7616 |
| 270 | Ga0068855_100047133 | 3300005563 | Bacteria | 5093 |
| 271 | Ga0068855_100071901 | 3300005563 | Unclassified | 4021 |
| 272 | Ga0068855_100184999 | 3300005563 | Bacteria | 2353 |
| 273 | Ga0068855_100281507 | 3300005563 | Bacteria | 1846 |
| 274 | Ga0068855_100624529 | 3300005563 | Unclassified | 1160 |
| 275 | Ga0068855_100933231 | 3300005563 | Bacteria | 915 |
| 276 | Ga0070664_100003640 | 3300005564 | Bacteria | 12413 |
| 277 | Ga0070664_100134641 | 3300005564 | Bacteria | 2172 |
| 278 | Ga0070664_100401548 | 3300005564 | Bacteria | 1253 |
| 279 | Ga0070664_100521208 | 3300005564 | Unclassified | 1097 |
| 280 | Ga0070664_101269385 | 3300005564 | Bacteria | 695 |
| 281 | Ga0068857_100000997 | 3300005577 | Bacteria | 21768 |
| 282 | Ga0068857_100026116 | 3300005577 | Bacteria | 5145 |
| 283 | Ga0068857_100039979 | 3300005577 | Bacteria | 4158 |
| 284 | Ga0068857_100058363 | 3300005577 | Bacteria | 3427 |
| 285 | Ga0068857_100077626 | 3300005577 | Bacteria | 2964 |
| 286 | Ga0068857_100114646 | 3300005577 | Bacteria | 2424 |
| 287 | Ga0068857_100833932 | 3300005577 | Bacteria | 882 |
| 288 | Ga0068857_100867978 | 3300005577 | Bacteria | 864 |
| 289 | Ga0068857_101634986 | 3300005577 | Bacteria | 629 |
| 290 | Ga0068854_100013099 | 3300005578 | Bacteria | 5435 |
| 291 | Ga0068854_100013860 | 3300005578 | Bacteria | 5301 |
| 292 | Ga0068854_100029069 | 3300005578 | Bacteria | 3823 |
| 293 | Ga0068854_100093898 | 3300005578 | Bacteria | 2237 |
| 294 | Ga0068854_100123458 | 3300005578 | Unclassified | 1969 |
| 295 | Ga0068854_100124714 | 3300005578 | Bacteria | 1960 |
| 296 | Ga0068854_100148615 | 3300005578 | Bacteria | 1804 |
| 297 | Ga0068854_100435320 | 3300005578 | Bacteria | 1092 |
| 298 | Ga0068854_100954495 | 3300005578 | Bacteria | 756 |
| 299 | Ga0068854_101256088 | 3300005578 | Unclassified | 665 |
| 300 | Ga0068854_101404214 | 3300005578 | Bacteria | 631 |
| 301 | Ga0068856_100004457 | 3300005614 | Bacteria | 13946 |
| 302 | Ga0068856_100021107 | 3300005614 | Bacteria | 6329 |
| 303 | Ga0068856_100158995 | 3300005614 | Unclassified | 2270 |
| 304 | Ga0068856_100159602 | 3300005614 | Bacteria | 2265 |
| 305 | Ga0068856_100441983 | 3300005614 | Bacteria | 1321 |
| 306 | Ga0068856_100990977 | 3300005614 | Bacteria | 859 |
| 307 | Ga0070702_100626949 | 3300005615 | Bacteria | 810 |
| 308 | Ga0070702_101477493 | 3300005615 | Bacteria | 558 |
| 309 | Ga0068852_100004569 | 3300005616 | Bacteria | 9798 |
| 310 | Ga0068852_100005952 | 3300005616 | Bacteria | 8777 |
| 311 | Ga0068852_100023569 | 3300005616 | Bacteria | 4957 |
| 312 | Ga0068852_100052562 | 3300005616 | Bacteria | 3502 |
| 313 | Ga0068852_100095801 | 3300005616 | Bacteria | 2666 |
| 314 | Ga0068852_100114031 | 3300005616 | Bacteria | 2462 |
| 315 | Ga0068852_100167642 | 3300005616 | Bacteria | 2056 |
| 316 | Ga0068852_100168318 | 3300005616 | Unclassified | 2052 |
| 317 | Ga0068852_100229965 | 3300005616 | Bacteria | 1767 |
| 318 | Ga0068852_100364853 | 3300005616 | Bacteria | 1413 |
| 319 | Ga0068852_100377424 | 3300005616 | Bacteria | 1390 |
| 320 | Ga0068852_100708269 | 3300005616 | Bacteria | 1017 |
| 321 | Ga0068852_100713804 | 3300005616 | Bacteria | 1013 |
| 322 | Ga0068852_100816887 | 3300005616 | Bacteria | 947 |
| 323 | Ga0068852_100848629 | 3300005616 | Bacteria | 929 |
| 324 | Ga0068852_100853406 | 3300005616 | Bacteria | 926 |
| 325 | Ga0068852_101052638 | 3300005616 | Unclassified | 833 |
| 326 | Ga0068859_100000025 | 3300005617 | Bacteria | 191679 |
| 327 | Ga0068859_100011247 | 3300005617 | Bacteria | 9003 |
| 328 | Ga0068859_100021012 | 3300005617 | Bacteria | 6552 |
| 329 | Ga0068859_100037181 | 3300005617 | Bacteria | 4886 |
| 330 | Ga0068859_100043053 | 3300005617 | Bacteria | 4537 |
| 331 | Ga0068859_100097716 | 3300005617 | Bacteria | 2989 |
| 332 | Ga0068859_100150915 | 3300005617 | Bacteria | 2399 |
| 333 | Ga0068859_100167071 | 3300005617 | Bacteria | 2280 |
| 334 | Ga0068859_100204155 | 3300005617 | Bacteria | 2061 |
| 335 | Ga0068859_100231414 | 3300005617 | Bacteria | 1936 |
| 336 | Ga0068859_100374398 | 3300005617 | Unclassified | 1520 |
| 337 | Ga0068859_100395580 | 3300005617 | Bacteria | 1477 |
| 338 | Ga0068859_100553384 | 3300005617 | Bacteria | 1245 |
| 339 | Ga0068859_100767695 | 3300005617 | Bacteria | 1052 |
| 340 | Ga0068859_101377470 | 3300005617 | Bacteria | 778 |
| 341 | Ga0068859_102445076 | 3300005617 | Unclassified | 575 |
| 342 | Ga0068864_100011190 | 3300005618 | Bacteria | 7415 |
| 343 | Ga0068864_100027400 | 3300005618 | Unclassified | 4813 |
| 344 | Ga0068864_100031001 | 3300005618 | Unclassified | 4535 |
| 345 | Ga0068864_100196428 | 3300005618 | Bacteria | 1852 |
| 346 | Ga0068864_100313562 | 3300005618 | Bacteria | 1471 |
| 347 | Ga0068864_100343921 | 3300005618 | Bacteria | 1406 |
| 348 | Ga0068864_100648386 | 3300005618 | Bacteria | 1028 |
| 349 | Ga0068864_100993763 | 3300005618 | Bacteria | 832 |
| 350 | Ga0068864_101058369 | 3300005618 | Bacteria | 806 |
| 351 | Ga0068864_101113970 | 3300005618 | Bacteria | 786 |
| 352 | Ga0068866_10003836 | 3300005718 | Bacteria | 6169 |
| 353 | Ga0068866_10010825 | 3300005718 | Bacteria | 3924 |
| 354 | Ga0068866_10108214 | 3300005718 | Bacteria | 1546 |
| 355 | Ga0068866_10156800 | 3300005718 | Bacteria | 1324 |
| 356 | Ga0068861_100006242 | 3300005719 | Bacteria | 8107 |
| 357 | Ga0068861_100012159 | 3300005719 | Bacteria | 5999 |
| 358 | Ga0068861_100135032 | 3300005719 | Bacteria | 2006 |
| 359 | Ga0068861_100266649 | 3300005719 | Bacteria | 1468 |
| 360 | Ga0068861_100432091 | 3300005719 | Bacteria | 1176 |
| 361 | Ga0068851_10007997 | 3300005834 | Bacteria | 4877 |
| 362 | Ga0068851_10033795 | 3300005834 | Bacteria | 2550 |
| 363 | Ga0068851_10115544 | 3300005834 | Bacteria | 1437 |
| 364 | Ga0068870_10002683 | 3300005840 | Bacteria | 7454 |
| 365 | Ga0068870_10015498 | 3300005840 | Bacteria | 3617 |
| 366 | Ga0068870_10036736 | 3300005840 | Bacteria | 2521 |
| 367 | Ga0068870_10085287 | 3300005840 | Bacteria | 1755 |
| 368 | Ga0068863_100002841 | 3300005841 | Bacteria | 17144 |
| 369 | Ga0068863_100009555 | 3300005841 | Bacteria | 9456 |
| 370 | Ga0068863_100015478 | 3300005841 | Bacteria | 7331 |
| 371 | Ga0068863_100022990 | 3300005841 | Bacteria | 5959 |
| 372 | Ga0068863_100211538 | 3300005841 | Bacteria | 1868 |
| 373 | Ga0068863_100391394 | 3300005841 | Bacteria | 1358 |
| 374 | Ga0068863_100429059 | 3300005841 | Bacteria | 1295 |
| 375 | Ga0068863_100462989 | 3300005841 | Bacteria | 1245 |
| 376 | Ga0068863_101025571 | 3300005841 | Bacteria | 828 |
| 377 | Ga0068858_100042829 | 3300005842 | Bacteria | 4197 |
| 378 | Ga0068858_100045256 | 3300005842 | Bacteria | 4077 |
| 379 | Ga0068858_100099117 | 3300005842 | Bacteria | 2717 |
| 380 | Ga0068858_100311113 | 3300005842 | Bacteria | 1504 |
| 381 | Ga0068858_100323117 | 3300005842 | Bacteria | 1475 |
| 382 | Ga0068858_100370212 | 3300005842 | Bacteria | 1374 |
| 383 | Ga0068858_100438336 | 3300005842 | Unclassified | 1258 |
| 384 | Ga0068858_100654865 | 3300005842 | Bacteria | 1021 |
| 385 | Ga0068858_100698461 | 3300005842 | Bacteria | 987 |
| 386 | Ga0068858_101146589 | 3300005842 | Bacteria | 764 |
| 387 | Ga0068860_100000061 | 3300005843 | Bacteria | 192548 |
| 388 | Ga0068860_100003010 | 3300005843 | Bacteria | 17411 |
| 389 | Ga0068860_100019031 | 3300005843 | Bacteria | 6668 |
| 390 | Ga0068860_100114924 | 3300005843 | Bacteria | 2573 |
| 391 | Ga0068860_100153923 | 3300005843 | Bacteria | 2215 |
| 392 | Ga0068860_100160687 | 3300005843 | Bacteria | 2166 |
| 393 | Ga0068860_100205908 | 3300005843 | Bacteria | 1908 |
| 394 | Ga0068860_100302078 | 3300005843 | Bacteria | 1568 |
| 395 | Ga0068860_100332627 | 3300005843 | Bacteria | 1492 |
| 396 | Ga0068860_100352433 | 3300005843 | Bacteria | 1449 |
| 397 | Ga0068860_100405663 | 3300005843 | Bacteria | 1349 |
| 398 | Ga0068860_100434216 | 3300005843 | Bacteria | 1303 |
| 399 | Ga0068860_100519053 | 3300005843 | Bacteria | 1191 |
| 400 | Ga0068860_100622361 | 3300005843 | Bacteria | 1086 |
| 401 | Ga0068860_100656102 | 3300005843 | Bacteria | 1057 |
| 402 | Ga0068860_100659135 | 3300005843 | Bacteria | 1055 |
| 403 | Ga0068860_100950695 | 3300005843 | Bacteria | 876 |
| 404 | Ga0068860_101308498 | 3300005843 | Bacteria | 745 |
| 405 | Ga0068860_101793729 | 3300005843 | Bacteria | 635 |
| 406 | Ga0068860_101973380 | 3300005843 | Unclassified | 605 |
| 407 | Ga0068862_100023190 | 3300005844 | Bacteria | 5197 |
| 408 | Ga0068862_100029075 | 3300005844 | Bacteria | 4655 |
| 409 | Ga0068862_100250636 | 3300005844 | Bacteria | 1613 |
| 410 | Ga0068862_100252716 | 3300005844 | Unclassified | 1607 |
| 411 | Ga0068862_100313195 | 3300005844 | Bacteria | 1447 |
| 412 | Ga0068862_100728059 | 3300005844 | Bacteria | 963 |
| 413 | Ga0068862_101005248 | 3300005844 | Bacteria | 825 |
| 414 | Ga0068862_101229978 | 3300005844 | Bacteria | 748 |
| 415 | Ga0081540_1024808 | 3300005983 | Bacteria | 3469 |
| 416 | Ga0075364_10439631 | 3300006051 | Bacteria | 891 |
| 417 | Ga0070715_10010886 | 3300006163 | Bacteria | 3256 |
| 418 | Ga0075366_10002847 | 3300006195 | Bacteria | 8960 |
| 419 | Ga0075366_10018639 | 3300006195 | Bacteria | 4009 |
| 420 | Ga0075366_10021764 | 3300006195 | Bacteria | 3728 |
| 421 | Ga0075366_10067537 | 3300006195 | Bacteria | 2128 |
| 422 | Ga0075366_10103210 | 3300006195 | Bacteria | 1712 |
| 423 | Ga0075366_10302664 | 3300006195 | Bacteria | 978 |
| 424 | Ga0075366_10519459 | 3300006195 | Unclassified | 737 |
| 425 | Ga0097621_100000465 | 3300006237 | Bacteria | 28387 |
| 426 | Ga0097621_100007122 | 3300006237 | Bacteria | 7973 |
| 427 | Ga0097621_100011137 | 3300006237 | Bacteria | 6617 |
| 428 | Ga0097621_100022862 | 3300006237 | Bacteria | 4858 |
| 429 | Ga0097621_100048247 | 3300006237 | Bacteria | 3454 |
| 430 | Ga0097621_100055128 | 3300006237 | Bacteria | 3245 |
| 431 | Ga0097621_100100770 | 3300006237 | Bacteria | 2430 |
| 432 | Ga0097621_100113847 | 3300006237 | Bacteria | 2288 |
| 433 | Ga0097621_100147290 | 3300006237 | Bacteria | 2017 |
| 434 | Ga0097621_100160720 | 3300006237 | Bacteria | 1931 |
| 435 | Ga0097621_100204450 | 3300006237 | Bacteria | 1716 |
| 436 | Ga0097621_100478577 | 3300006237 | Bacteria | 1125 |
| 437 | Ga0097621_100724406 | 3300006237 | Bacteria | 917 |
| 438 | Ga0097621_101049945 | 3300006237 | Bacteria | 763 |
| 439 | Ga0097621_101202598 | 3300006237 | Unclassified | 714 |
| 440 | Ga0097621_101379502 | 3300006237 | Bacteria | 667 |
| 441 | Ga0097621_101555984 | 3300006237 | Bacteria | 628 |
| 442 | Ga0068871_100001644 | 3300006358 | Bacteria | 15052 |
| 443 | Ga0068871_100008210 | 3300006358 | Bacteria | 7499 |
| 444 | Ga0068871_100017469 | 3300006358 | Bacteria | 5429 |
| 445 | Ga0068871_100023517 | 3300006358 | Bacteria | 4769 |
| 446 | Ga0068871_100047473 | 3300006358 | Bacteria | 3463 |
| 447 | Ga0068871_100068734 | 3300006358 | Bacteria | 2909 |
| 448 | Ga0068871_100128755 | 3300006358 | Bacteria | 2144 |
| 449 | Ga0068871_100187840 | 3300006358 | Bacteria | 1778 |
| 450 | Ga0068871_100284107 | 3300006358 | Unclassified | 1448 |
| 451 | Ga0068871_100312350 | 3300006358 | Bacteria | 1382 |
| 452 | Ga0068871_100611021 | 3300006358 | Bacteria | 992 |
| 453 | Ga0068871_100613802 | 3300006358 | Bacteria | 990 |
| 454 | Ga0068871_100815909 | 3300006358 | Bacteria | 861 |
| 455 | Ga0068871_100820835 | 3300006358 | Bacteria | 858 |
| 456 | Ga0068871_101009170 | 3300006358 | Unclassified | 775 |
| 457 | Ga0075434_100084958 | 3300006871 | Bacteria | 3164 |
| 458 | Ga0068865_100007033 | 3300006881 | Bacteria | 6907 |
| 459 | Ga0068865_100027470 | 3300006881 | Bacteria | 3760 |
| 460 | Ga0068865_100037175 | 3300006881 | Bacteria | 3286 |
| 461 | Ga0068865_100041865 | 3300006881 | Bacteria | 3120 |
| 462 | Ga0068865_100343549 | 3300006881 | Bacteria | 1207 |
| 463 | Ga0068865_100440478 | 3300006881 | Bacteria | 1075 |
| 464 | Ga0068865_100478164 | 3300006881 | Bacteria | 1035 |
| 465 | Ga0068865_100663977 | 3300006881 | Bacteria | 887 |
| 466 | Ga0068865_100802134 | 3300006881 | Bacteria | 812 |
| 467 | Ga0068865_100866263 | 3300006881 | Bacteria | 783 |
| 468 | Ga0068865_100986991 | 3300006881 | Bacteria | 737 |
| 469 | Ga0097620_100000025 | 3300006931 | Bacteria | 191679 |
| 470 | Ga0097620_100011247 | 3300006931 | Bacteria | 9003 |
| 471 | Ga0097620_100021012 | 3300006931 | Bacteria | 6552 |
| 472 | Ga0097620_100037181 | 3300006931 | Bacteria | 4886 |
| 473 | Ga0097620_100043054 | 3300006931 | Bacteria | 4537 |
| 474 | Ga0097620_100097715 | 3300006931 | Bacteria | 2989 |
| 475 | Ga0097620_100150911 | 3300006931 | Bacteria | 2399 |
| 476 | Ga0097620_100167075 | 3300006931 | Bacteria | 2280 |
| 477 | Ga0097620_100204141 | 3300006931 | Bacteria | 2061 |
| 478 | Ga0097620_100231415 | 3300006931 | Bacteria | 1936 |
| 479 | Ga0097620_100374422 | 3300006931 | Unclassified | 1520 |
| 480 | Ga0097620_100395586 | 3300006931 | Bacteria | 1477 |
| 481 | Ga0097620_100553401 | 3300006931 | Bacteria | 1245 |
| 482 | Ga0097620_100767715 | 3300006931 | Bacteria | 1052 |
| 483 | Ga0097620_101377436 | 3300006931 | Bacteria | 778 |
| 484 | Ga0097620_102445847 | 3300006931 | Unclassified | 575 |
| 485 | Ga0075435_100911868 | 3300007076 | Bacteria | 766 |
| 486 | Ga0099795_10197078 | 3300007788 | Bacteria | 848 |
| 487 | Ga0105251_10121983 | 3300009011 | Bacteria | 1183 |
| 488 | Ga0105251_10488448 | 3300009011 | Unclassified | 574 |
| 489 | Ga0105240_10000198 | 3300009093 | Bacteria | 122388 |
| 490 | Ga0105240_10015994 | 3300009093 | Bacteria | 10170 |
| 491 | Ga0105240_10027122 | 3300009093 | Bacteria | 7505 |
| 492 | Ga0105240_10034622 | 3300009093 | Bacteria | 6513 |
| 493 | Ga0105240_10046395 | 3300009093 | Bacteria | 5506 |
| 494 | Ga0105240_10049957 | 3300009093 | Bacteria | 5275 |
| 495 | Ga0105240_10098017 | 3300009093 | Bacteria | 3571 |
| 496 | Ga0105240_10114329 | 3300009093 | Bacteria | 3260 |
| 497 | Ga0105240_10154049 | 3300009093 | Bacteria | 2735 |
| 498 | Ga0105240_10344372 | 3300009093 | Bacteria | 1692 |
| 499 | Ga0105240_10514428 | 3300009093 | Bacteria | 1329 |
| 500 | Ga0105240_10514890 | 3300009093 | Bacteria | 1328 |
| 501 | Ga0111539_10001644 | 3300009094 | Bacteria | 29841 |
| 502 | Ga0111539_10444323 | 3300009094 | Bacteria | 1510 |
| 503 | Ga0111539_10824223 | 3300009094 | Bacteria | 1080 |
| 504 | Ga0105245_10349519 | 3300009098 | Bacteria | 1464 |
| 505 | Ga0105247_10002225 | 3300009101 | Bacteria | 13361 |
| 506 | Ga0105247_10005450 | 3300009101 | Bacteria | 8017 |
| 507 | Ga0105247_10050542 | 3300009101 | Bacteria | 2558 |
| 508 | Ga0105247_10059813 | 3300009101 | Unclassified | 2360 |
| 509 | Ga0105247_10290865 | 3300009101 | Bacteria | 1130 |
| 510 | Ga0105247_10727643 | 3300009101 | Bacteria | 750 |
| 511 | Ga0114129_10072767 | 3300009147 | Bacteria | 4791 |
| 512 | Ga0105243_10452829 | 3300009148 | Bacteria | 1205 |
| 513 | Ga0105243_10667404 | 3300009148 | Unclassified | 1009 |
| 514 | Ga0105243_11120059 | 3300009148 | Unclassified | 796 |
| 515 | Ga0105241_10002300 | 3300009174 | Bacteria | 14357 |
| 516 | Ga0105241_10006585 | 3300009174 | Bacteria | 8557 |
| 517 | Ga0105241_10006947 | 3300009174 | Bacteria | 8332 |
| 518 | Ga0105241_10083775 | 3300009174 | Bacteria | 2502 |
| 519 | Ga0105241_10302383 | 3300009174 | Bacteria | 1373 |
| 520 | Ga0105241_10427724 | 3300009174 | Bacteria | 1167 |
| 521 | Ga0105241_10488066 | 3300009174 | Bacteria | 1096 |
| 522 | Ga0105241_10731076 | 3300009174 | Bacteria | 906 |
| 523 | Ga0105241_11040507 | 3300009174 | Bacteria | 768 |
| 524 | Ga0105241_11413056 | 3300009174 | Bacteria | 667 |
| 525 | Ga0105242_10032792 | 3300009176 | Bacteria | 4155 |
| 526 | Ga0105242_10082475 | 3300009176 | Unclassified | 2691 |
| 527 | Ga0105242_10224094 | 3300009176 | Bacteria | 1682 |
| 528 | Ga0105242_10503567 | 3300009176 | Bacteria | 1152 |
| 529 | Ga0105242_10836365 | 3300009176 | Bacteria | 915 |
| 530 | Ga0105242_10850890 | 3300009176 | Bacteria | 908 |
| 531 | Ga0105242_10883030 | 3300009176 | Bacteria | 892 |
| 532 | Ga0105242_11136377 | 3300009176 | Bacteria | 797 |
| 533 | Ga0105242_11759863 | 3300009176 | Bacteria | 657 |
| 534 | Ga0105248_10027947 | 3300009177 | Bacteria | 6281 |
| 535 | Ga0105248_10060553 | 3300009177 | Unclassified | 4250 |
| 536 | Ga0105248_10591575 | 3300009177 | Bacteria | 1252 |
| 537 | Ga0105248_10811422 | 3300009177 | Bacteria | 1056 |
| 538 | Ga0105248_11124136 | 3300009177 | Bacteria | 888 |
| 539 | Ga0105237_10000409 | 3300009545 | Bacteria | 61096 |
| 540 | Ga0105237_10000577 | 3300009545 | Bacteria | 51264 |
| 541 | Ga0105237_10005234 | 3300009545 | Bacteria | 14676 |
| 542 | Ga0105237_10005617 | 3300009545 | Bacteria | 14137 |
| 543 | Ga0105237_10006807 | 3300009545 | Bacteria | 12603 |
| 544 | Ga0105237_10009021 | 3300009545 | Bacteria | 10719 |
| 545 | Ga0105237_10010186 | 3300009545 | Bacteria | 10017 |
| 546 | Ga0105237_10010415 | 3300009545 | Bacteria | 9893 |
| 547 | Ga0105237_10120174 | 3300009545 | Bacteria | 2621 |
| 548 | Ga0105237_10129325 | 3300009545 | Bacteria | 2520 |
| 549 | Ga0105237_10483019 | 3300009545 | Bacteria | 1245 |
| 550 | Ga0105237_10809517 | 3300009545 | Bacteria | 944 |
| 551 | Ga0105237_10969481 | 3300009545 | Bacteria | 857 |
| 552 | Ga0105237_11173636 | 3300009545 | Bacteria | 774 |
| 553 | Ga0105237_11818588 | 3300009545 | Bacteria | 617 |
| 554 | Ga0105238_10007301 | 3300009551 | Bacteria | 11064 |
| 555 | Ga0105238_10084102 | 3300009551 | Bacteria | 3171 |
| 556 | Ga0105238_10098761 | 3300009551 | Bacteria | 2903 |
| 557 | Ga0105238_10170233 | 3300009551 | Bacteria | 2154 |
| 558 | Ga0105249_10020448 | 3300009553 | Bacteria | 5917 |
| 559 | Ga0105249_10021479 | 3300009553 | Bacteria | 5779 |
| 560 | Ga0105249_10032930 | 3300009553 | Bacteria | 4691 |
| 561 | Ga0105249_10049926 | 3300009553 | Bacteria | 3815 |
| 562 | Ga0105249_10110043 | 3300009553 | Bacteria | 2603 |
| 563 | Ga0105249_10112374 | 3300009553 | Bacteria | 2576 |
| 564 | Ga0105249_10121976 | 3300009553 | Bacteria | 2478 |
| 565 | Ga0105249_10169249 | 3300009553 | Bacteria | 2118 |
| 566 | Ga0105249_10176424 | 3300009553 | Bacteria | 2076 |
| 567 | Ga0105249_10181883 | 3300009553 | Unclassified | 2046 |
| 568 | Ga0105249_10383106 | 3300009553 | Bacteria | 1433 |
| 569 | Ga0105249_10608287 | 3300009553 | Bacteria | 1148 |
| 570 | Ga0105249_11227097 | 3300009553 | Bacteria | 821 |
| 571 | Ga0105249_12666249 | 3300009553 | Bacteria | 572 |
| 572 | Ga0105239_10000019 | 3300010375 | Bacteria | 273836 |
| 573 | Ga0105239_10000343 | 3300010375 | Bacteria | 67956 |
| 574 | Ga0105239_10000659 | 3300010375 | Bacteria | 49123 |
| 575 | Ga0105239_10001227 | 3300010375 | Bacteria | 34941 |
| 576 | Ga0105239_10005439 | 3300010375 | Bacteria | 14944 |
| 577 | Ga0105239_10014750 | 3300010375 | Bacteria | 8665 |
| 578 | Ga0105239_10041485 | 3300010375 | Bacteria | 5043 |
| 579 | Ga0105239_10053665 | 3300010375 | Bacteria | 4421 |
| 580 | Ga0105239_10093829 | 3300010375 | Bacteria | 3314 |
| 581 | Ga0105239_10120279 | 3300010375 | Bacteria | 2916 |
| 582 | Ga0105239_10191856 | 3300010375 | Bacteria | 2287 |
| 583 | Ga0105239_10253293 | 3300010375 | Bacteria | 1978 |
| 584 | Ga0105239_10265527 | 3300010375 | Bacteria | 1930 |
| 585 | Ga0105239_10305490 | 3300010375 | Bacteria | 1792 |
| 586 | Ga0105239_10560199 | 3300010375 | Bacteria | 1302 |
| 587 | Ga0105239_10599380 | 3300010375 | Bacteria | 1257 |
| 588 | Ga0105239_11129094 | 3300010375 | Bacteria | 902 |
| 589 | Ga0105246_10032151 | 3300011119 | Bacteria | 3478 |
| 590 | Ga0105246_10084639 | 3300011119 | Bacteria | 2269 |
| 591 | Ga0105246_10127719 | 3300011119 | Bacteria | 1894 |
| 592 | Ga0105246_10130463 | 3300011119 | Bacteria | 1877 |
| 593 | Ga0105246_10329089 | 3300011119 | Unclassified | 1244 |
| 594 | Ga0105246_10512057 | 3300011119 | Bacteria | 1021 |
| 595 | Ga0157373_10007794 | 3300013100 | Bacteria | 7960 |
| 596 | Ga0157373_10008801 | 3300013100 | Bacteria | 7478 |
| 597 | Ga0157373_10011698 | 3300013100 | Bacteria | 6444 |
| 598 | Ga0157373_10483018 | 3300013100 | Bacteria | 894 |
| 599 | Ga0157371_10029953 | 3300013102 | Bacteria | 3929 |
| 600 | Ga0157371_10357213 | 3300013102 | Bacteria | 1064 |
| 601 | Ga0157370_10002115 | 3300013104 | Bacteria | 24264 |
| 602 | Ga0157370_10010926 | 3300013104 | Bacteria | 9533 |
| 603 | Ga0157370_10012060 | 3300013104 | Bacteria | 8996 |
| 604 | Ga0157370_10100635 | 3300013104 | Bacteria | 2708 |
| 605 | Ga0157370_10307518 | 3300013104 | Unclassified | 1463 |
| 606 | Ga0157370_10757721 | 3300013104 | Bacteria | 884 |
| 607 | Ga0157370_11023994 | 3300013104 | Unclassified | 747 |
| 608 | Ga0157370_11267000 | 3300013104 | Bacteria | 664 |
| 609 | Ga0157369_10008539 | 3300013105 | Bacteria | 11746 |
| 610 | Ga0157369_10023988 | 3300013105 | Bacteria | 6786 |
| 611 | Ga0157369_10044786 | 3300013105 | Bacteria | 4815 |
| 612 | Ga0157369_10311980 | 3300013105 | Bacteria | 1635 |
| 613 | Ga0157369_10980657 | 3300013105 | Unclassified | 865 |
| 614 | Ga0157369_11156009 | 3300013105 | Unclassified | 790 |
| 615 | Ga0157374_10000011 | 3300013296 | Bacteria | 466749 |
| 616 | Ga0157374_10003749 | 3300013296 | Bacteria | 12771 |
| 617 | Ga0157374_10004107 | 3300013296 | Bacteria | 12225 |
| 618 | Ga0157374_10004768 | 3300013296 | Bacteria | 11371 |
| 619 | Ga0157374_10012057 | 3300013296 | Bacteria | 7505 |
| 620 | Ga0157374_10025377 | 3300013296 | Bacteria | 5321 |
| 621 | Ga0157374_10028328 | 3300013296 | Bacteria | 5061 |
| 622 | Ga0157374_10036793 | 3300013296 | Bacteria | 4487 |
| 623 | Ga0157374_10046057 | 3300013296 | Bacteria | 4037 |
| 624 | Ga0157374_10080774 | 3300013296 | Bacteria | 3084 |
| 625 | Ga0157374_10107499 | 3300013296 | Unclassified | 2681 |
| 626 | Ga0157374_10169500 | 3300013296 | Bacteria | 2129 |
| 627 | Ga0157374_10833283 | 3300013296 | Unclassified | 939 |
| 628 | Ga0157374_10929497 | 3300013296 | Bacteria | 888 |
| 629 | Ga0157374_10962872 | 3300013296 | Bacteria | 872 |
| 630 | Ga0157374_11113769 | 3300013296 | Bacteria | 810 |
| 631 | Ga0157378_10002905 | 3300013297 | Bacteria | 15257 |
| 632 | Ga0157378_10012666 | 3300013297 | Bacteria | 7378 |
| 633 | Ga0157378_10035819 | 3300013297 | Unclassified | 4392 |
| 634 | Ga0157378_10044839 | 3300013297 | Bacteria | 3928 |
| 635 | Ga0157378_10089113 | 3300013297 | Bacteria | 2801 |
| 636 | Ga0157378_10095139 | 3300013297 | Bacteria | 2713 |
| 637 | Ga0157378_10120123 | 3300013297 | Bacteria | 2421 |
| 638 | Ga0157378_10139797 | 3300013297 | Bacteria | 2248 |
| 639 | Ga0157378_10189621 | 3300013297 | Unclassified | 1938 |
| 640 | Ga0157378_10209824 | 3300013297 | Unclassified | 1846 |
| 641 | Ga0157378_10220287 | 3300013297 | Bacteria | 1804 |
| 642 | Ga0157378_10223040 | 3300013297 | Unclassified | 1793 |
| 643 | Ga0157378_10225657 | 3300013297 | Unclassified | 1783 |
| 644 | Ga0157378_10275097 | 3300013297 | Bacteria | 1621 |
| 645 | Ga0157378_10789674 | 3300013297 | Bacteria | 975 |
| 646 | Ga0163162_10000151 | 3300013306 | Bacteria | 64454 |
| 647 | Ga0163162_10000344 | 3300013306 | Bacteria | 42218 |
| 648 | Ga0163162_10000782 | 3300013306 | Bacteria | 29601 |
| 649 | Ga0163162_10000827 | 3300013306 | Bacteria | 28791 |
| 650 | Ga0163162_10002957 | 3300013306 | Bacteria | 16219 |
| 651 | Ga0163162_10010911 | 3300013306 | Bacteria | 8846 |
| 652 | Ga0163162_10014906 | 3300013306 | Bacteria | 7590 |
| 653 | Ga0163162_10021159 | 3300013306 | Bacteria | 6399 |
| 654 | Ga0163162_10068998 | 3300013306 | Bacteria | 3587 |
| 655 | Ga0163162_10089929 | 3300013306 | Bacteria | 3151 |
| 656 | Ga0163162_10136540 | 3300013306 | Bacteria | 2563 |
| 657 | Ga0163162_10251118 | 3300013306 | Bacteria | 1901 |
| 658 | Ga0163162_10263138 | 3300013306 | Bacteria | 1856 |
| 659 | Ga0163162_10575924 | 3300013306 | Bacteria | 1253 |
| 660 | Ga0163162_10796723 | 3300013306 | Bacteria | 1062 |
| 661 | Ga0163162_10852866 | 3300013306 | Bacteria | 1026 |
| 662 | Ga0163162_11086642 | 3300013306 | Bacteria | 906 |
| 663 | Ga0163162_11122652 | 3300013306 | Bacteria | 891 |
| 664 | Ga0163162_11122755 | 3300013306 | Unclassified | 891 |
| 665 | Ga0163162_11584769 | 3300013306 | Bacteria | 747 |
| 666 | Ga0163162_11584770 | 3300013306 | Bacteria | 747 |
| 667 | Ga0163162_12417306 | 3300013306 | Bacteria | 604 |
| 668 | Ga0157372_10003342 | 3300013307 | Bacteria | 17320 |
| 669 | Ga0157372_10050769 | 3300013307 | Bacteria | 4614 |
| 670 | Ga0157372_10056150 | 3300013307 | Bacteria | 4399 |
| 671 | Ga0157372_10098575 | 3300013307 | Bacteria | 3334 |
| 672 | Ga0157372_10127461 | 3300013307 | Unclassified | 2926 |
| 673 | Ga0157372_10216330 | 3300013307 | Unclassified | 2221 |
| 674 | Ga0157372_10220399 | 3300013307 | Bacteria | 2199 |
| 675 | Ga0157372_10715884 | 3300013307 | Unclassified | 1165 |
| 676 | Ga0157372_10847590 | 3300013307 | Bacteria | 1061 |
| 677 | Ga0157372_11669407 | 3300013307 | Unclassified | 733 |
| 678 | Ga0157375_10000911 | 3300013308 | Bacteria | 25700 |
| 679 | Ga0157375_10003934 | 3300013308 | Bacteria | 12883 |
| 680 | Ga0157375_10052035 | 3300013308 | Bacteria | 4024 |
| 681 | Ga0157375_10060880 | 3300013308 | Bacteria | 3746 |
| 682 | Ga0157375_10103328 | 3300013308 | Unclassified | 2936 |
| 683 | Ga0157375_10137861 | 3300013308 | Unclassified | 2565 |
| 684 | Ga0157375_10202726 | 3300013308 | Bacteria | 2140 |
| 685 | Ga0157375_10251467 | 3300013308 | Bacteria | 1928 |
| 686 | Ga0157375_10257424 | 3300013308 | Bacteria | 1907 |
| 687 | Ga0157375_10390622 | 3300013308 | Bacteria | 1558 |
| 688 | Ga0157375_10875850 | 3300013308 | Bacteria | 1043 |
| 689 | Ga0157375_11423458 | 3300013308 | Bacteria | 817 |
| 690 | Ga0157375_13006033 | 3300013308 | Unclassified | 563 |
| 691 | Ga0163163_10000215 | 3300014325 | Bacteria | 60028 |
| 692 | Ga0163163_10007541 | 3300014325 | Bacteria | 9606 |
| 693 | Ga0163163_10011287 | 3300014325 | Bacteria | 8096 |
| 694 | Ga0163163_10090713 | 3300014325 | Bacteria | 3070 |
| 695 | Ga0163163_10147060 | 3300014325 | Bacteria | 2401 |
| 696 | Ga0163163_10189538 | 3300014325 | Bacteria | 2105 |
| 697 | Ga0163163_10226380 | 3300014325 | Bacteria | 1919 |
| 698 | Ga0163163_10259849 | 3300014325 | Bacteria | 1787 |
| 699 | Ga0163163_10314707 | 3300014325 | Bacteria | 1619 |
| 700 | Ga0163163_10336472 | 3300014325 | Bacteria | 1564 |
| 701 | Ga0163163_10809863 | 3300014325 | Bacteria | 1000 |
| 702 | Ga0163163_10951994 | 3300014325 | Unclassified | 922 |
| 703 | Ga0163163_10955758 | 3300014325 | Bacteria | 920 |
| 704 | Ga0163163_11219158 | 3300014325 | Bacteria | 815 |
| 705 | Ga0163163_11298999 | 3300014325 | Bacteria | 790 |
| 706 | Ga0157380_10004165 | 3300014326 | Bacteria | 9990 |
| 707 | Ga0157380_10015686 | 3300014326 | Bacteria | 5571 |
| 708 | Ga0157380_10057056 | 3300014326 | Unclassified | 3108 |
| 709 | Ga0157380_10253140 | 3300014326 | Bacteria | 1595 |
| 710 | Ga0157380_10276805 | 3300014326 | Bacteria | 1533 |
| 711 | Ga0157380_10296999 | 3300014326 | Bacteria | 1486 |
| 712 | Ga0157380_10451809 | 3300014326 | Bacteria | 1234 |
| 713 | Ga0157380_10863772 | 3300014326 | Bacteria | 928 |
| 714 | Ga0157380_11101733 | 3300014326 | Bacteria | 833 |
| 715 | Ga0157380_11466641 | 3300014326 | Bacteria | 734 |
| 716 | Ga0157377_10005894 | 3300014745 | Bacteria | 5799 |
| 717 | Ga0157377_10091088 | 3300014745 | Bacteria | 1801 |
| 718 | Ga0157377_10104700 | 3300014745 | Unclassified | 1692 |
| 719 | Ga0157377_10207421 | 3300014745 | Unclassified | 1248 |
| 720 | Ga0157377_10261232 | 3300014745 | Bacteria | 1127 |
| 721 | Ga0157377_10714477 | 3300014745 | Bacteria | 729 |
| 722 | Ga0157379_10001465 | 3300014968 | Bacteria | 19448 |
| 723 | Ga0157379_10025037 | 3300014968 | Bacteria | 5298 |
| 724 | Ga0157379_10085296 | 3300014968 | Bacteria | 2830 |
| 725 | Ga0157379_10132218 | 3300014968 | Bacteria | 2246 |
| 726 | Ga0157379_10147775 | 3300014968 | Bacteria | 2119 |
| 727 | Ga0157379_10154542 | 3300014968 | Bacteria | 2070 |
| 728 | Ga0157379_10184606 | 3300014968 | Bacteria | 1884 |
| 729 | Ga0157379_10226909 | 3300014968 | Bacteria | 1693 |
| 730 | Ga0157379_10252836 | 3300014968 | Bacteria | 1600 |
| 731 | Ga0157379_10380509 | 3300014968 | Bacteria | 1295 |
| 732 | Ga0157379_10418814 | 3300014968 | Bacteria | 1233 |
| 733 | Ga0157379_10814892 | 3300014968 | Bacteria | 882 |
| 734 | Ga0157376_10003091 | 3300014969 | Bacteria | 11426 |
| 735 | Ga0157376_10003806 | 3300014969 | Bacteria | 10437 |
| 736 | Ga0157376_10009971 | 3300014969 | Bacteria | 6932 |
| 737 | Ga0157376_10033522 | 3300014969 | Bacteria | 4135 |
| 738 | Ga0157376_10037872 | 3300014969 | Bacteria | 3920 |
| 739 | Ga0157376_10050256 | 3300014969 | Bacteria | 3458 |
| 740 | Ga0157376_10103479 | 3300014969 | Unclassified | 2493 |
| 741 | Ga0157376_10183788 | 3300014969 | Bacteria | 1913 |
| 742 | Ga0157376_10211903 | 3300014969 | Bacteria | 1789 |
| 743 | Ga0157376_10537169 | 3300014969 | Unclassified | 1155 |
| 744 | Ga0157376_10676587 | 3300014969 | Bacteria | 1035 |
| 745 | Ga0157376_11363165 | 3300014969 | Bacteria | 740 |
| 746 | Ga0157376_11844482 | 3300014969 | Bacteria | 641 |
| 747 | Ga0163161_10006068 | 3300017792 | Bacteria | 8374 |
| 748 | Ga0163161_10015639 | 3300017792 | Bacteria | 5292 |
| 749 | Ga0163161_10017879 | 3300017792 | Bacteria | 4967 |
| 750 | Ga0163161_10022905 | 3300017792 | Bacteria | 4401 |
| 751 | Ga0163161_10034766 | 3300017792 | Bacteria | 3605 |
| 752 | Ga0163161_10063649 | 3300017792 | Bacteria | 2689 |
| 753 | Ga0163161_10190044 | 3300017792 | Unclassified | 1578 |
| 754 | Ga0163161_10192794 | 3300017792 | Bacteria | 1567 |
| 755 | Ga0163161_10227210 | 3300017792 | Bacteria | 1447 |
| 756 | Ga0163161_10386491 | 3300017792 | Bacteria | 1119 |
| 757 | Ga0163161_10487437 | 3300017792 | Bacteria | 1002 |
| 758 | Ga0163161_10605179 | 3300017792 | Bacteria | 904 |
| 759 | Ga0197907_10995076 | 3300020069 | Bacteria | 786 |
| 760 | Ga0197907_11045296 | 3300020069 | Bacteria | 1000 |
| 761 | Ga0197907_11115152 | 3300020069 | Bacteria | 1423 |
| 762 | Ga0206356_10869258 | 3300020070 | Bacteria | 1996 |
| 763 | Ga0206356_11038156 | 3300020070 | Bacteria | 715 |
| 764 | Ga0206356_11208083 | 3300020070 | Bacteria | 807 |
| 765 | Ga0206356_11287791 | 3300020070 | Unclassified | 689 |
| 766 | Ga0206356_11576714 | 3300020070 | Bacteria | 578 |
| 767 | Ga0206356_11620720 | 3300020070 | Bacteria | 899 |
| 768 | Ga0206349_1234662 | 3300020075 | Bacteria | 900 |
| 769 | Ga0206349_1272832 | 3300020075 | Bacteria | 1515 |
| 770 | Ga0206349_1793318 | 3300020075 | Bacteria | 701 |
| 771 | Ga0206355_1288808 | 3300020076 | Bacteria | 787 |
| 772 | Ga0206355_1701830 | 3300020076 | Bacteria | 707 |
| 773 | Ga0206351_10840370 | 3300020077 | Bacteria | 901 |
| 774 | Ga0206351_10857268 | 3300020077 | Unclassified | 826 |
| 775 | Ga0206352_10259686 | 3300020078 | Bacteria | 736 |
| 776 | Ga0206352_10359923 | 3300020078 | Unclassified | 2094 |
| 777 | Ga0206352_10615519 | 3300020078 | Bacteria | 635 |
| 778 | Ga0206352_10977901 | 3300020078 | Unclassified | 839 |
| 779 | Ga0206352_11013407 | 3300020078 | Bacteria | 1033 |
| 780 | Ga0206352_11155741 | 3300020078 | Bacteria | 1200 |
| 781 | Ga0206350_10482065 | 3300020080 | Bacteria | 657 |
| 782 | Ga0206350_10497323 | 3300020080 | Bacteria | 851 |
| 783 | Ga0206350_10802927 | 3300020080 | Bacteria | 702 |
| 784 | Ga0206350_11247711 | 3300020080 | Unclassified | 1748 |
| 785 | Ga0206350_11629336 | 3300020080 | Bacteria | 641 |
| 786 | Ga0206354_10457372 | 3300020081 | Bacteria | 1067 |
| 787 | Ga0206354_10909307 | 3300020081 | Bacteria | 576 |
| 788 | Ga0206354_11042613 | 3300020081 | Bacteria | 962 |
| 789 | Ga0206353_11122960 | 3300020082 | Bacteria | 1064 |
| 790 | Ga0206353_12050348 | 3300020082 | Bacteria | 719 |
| 791 | Ga0154015_1552988 | 3300020610 | Unclassified | 984 |
| 792 | Ga0213876_10005782 | 3300021384 | Bacteria | 6773 |
| 793 | Ga0224712_10040477 | 3300022467 | Unclassified | 1754 |
| 794 | Ga0224712_10117179 | 3300022467 | Bacteria | 1149 |
| 795 | Ga0209646_1002933 | 3300025246 | Bacteria | 3550 |
| 796 | Ga0207673_1038215 | 3300025290 | Bacteria | 672 |
| 797 | Ga0207697_10105069 | 3300025315 | Bacteria | 1206 |
| 798 | Ga0207656_10012744 | 3300025321 | Bacteria | 3202 |
| 799 | Ga0207656_10130031 | 3300025321 | Bacteria | 1179 |
| 800 | Ga0207656_10144775 | 3300025321 | Bacteria | 1122 |
| 801 | Ga0207656_10285700 | 3300025321 | Bacteria | 814 |
| 802 | Ga0207713_1098921 | 3300025735 | Bacteria | 1010 |
| 803 | Ga0207682_10057890 | 3300025893 | Bacteria | 1617 |
| 804 | Ga0207682_10062397 | 3300025893 | Bacteria | 1562 |
| 805 | Ga0207682_10078561 | 3300025893 | Bacteria | 1410 |
| 806 | Ga0207642_10093236 | 3300025899 | Unclassified | 1493 |
| 807 | Ga0207642_10321094 | 3300025899 | Bacteria | 904 |
| 808 | Ga0207642_10391464 | 3300025899 | Bacteria | 829 |
| 809 | Ga0207642_10730793 | 3300025899 | Bacteria | 626 |
| 810 | Ga0207710_10010275 | 3300025900 | Bacteria | 3940 |
| 811 | Ga0207710_10204929 | 3300025900 | Bacteria | 975 |
| 812 | Ga0207688_10052388 | 3300025901 | Bacteria | 2287 |
| 813 | Ga0207680_10000032 | 3300025903 | Bacteria | 77485 |
| 814 | Ga0207680_10001858 | 3300025903 | Bacteria | 9924 |
| 815 | Ga0207680_10065662 | 3300025903 | Bacteria | 2229 |
| 816 | Ga0207680_10173601 | 3300025903 | Bacteria | 1453 |
| 817 | Ga0207680_10270317 | 3300025903 | Bacteria | 1179 |
| 818 | Ga0207680_10695424 | 3300025903 | Unclassified | 729 |
| 819 | Ga0207680_10770023 | 3300025903 | Unclassified | 690 |
| 820 | Ga0207647_10008403 | 3300025904 | Bacteria | 7405 |
| 821 | Ga0207647_10015067 | 3300025904 | Bacteria | 5313 |
| 822 | Ga0207647_10020104 | 3300025904 | Bacteria | 4482 |
| 823 | Ga0207647_10084937 | 3300025904 | Bacteria | 1894 |
| 824 | Ga0207647_10499755 | 3300025904 | Bacteria | 678 |
| 825 | Ga0207645_10001037 | 3300025907 | Bacteria | 22957 |
| 826 | Ga0207645_10015523 | 3300025907 | Bacteria | 5057 |
| 827 | Ga0207645_10017482 | 3300025907 | Bacteria | 4733 |
| 828 | Ga0207645_10020806 | 3300025907 | Unclassified | 4287 |
| 829 | Ga0207645_10047256 | 3300025907 | Bacteria | 2748 |
| 830 | Ga0207645_10051420 | 3300025907 | Bacteria | 2633 |
| 831 | Ga0207645_10136914 | 3300025907 | Bacteria | 1595 |
| 832 | Ga0207643_10032899 | 3300025908 | Bacteria | 2899 |
| 833 | Ga0207643_10037977 | 3300025908 | Bacteria | 2704 |
| 834 | Ga0207643_10061490 | 3300025908 | Bacteria | 2145 |
| 835 | Ga0207643_10241248 | 3300025908 | Bacteria | 1111 |
| 836 | Ga0207705_10018695 | 3300025909 | Bacteria | 4958 |
| 837 | Ga0207705_10081762 | 3300025909 | Bacteria | 2355 |
| 838 | Ga0207705_10084378 | 3300025909 | Bacteria | 2319 |
| 839 | Ga0207654_10003193 | 3300025911 | Bacteria | 8286 |
| 840 | Ga0207654_10011353 | 3300025911 | Bacteria | 4545 |
| 841 | Ga0207654_10051196 | 3300025911 | Bacteria | 2376 |
| 842 | Ga0207654_10298556 | 3300025911 | Bacteria | 1095 |
| 843 | Ga0207654_10339453 | 3300025911 | Bacteria | 1032 |
| 844 | Ga0207707_10012036 | 3300025912 | Bacteria | 7521 |
| 845 | Ga0207707_10049929 | 3300025912 | Bacteria | 3645 |
| 846 | Ga0207707_10176805 | 3300025912 | Bacteria | 1865 |
| 847 | Ga0207695_10000212 | 3300025913 | Bacteria | 156450 |
| 848 | Ga0207695_10000346 | 3300025913 | Bacteria | 107028 |
| 849 | Ga0207695_10001638 | 3300025913 | Bacteria | 36175 |
| 850 | Ga0207695_10050880 | 3300025913 | Bacteria | 4355 |
| 851 | Ga0207695_10054308 | 3300025913 | Bacteria | 4185 |
| 852 | Ga0207695_10062575 | 3300025913 | Bacteria | 3841 |
| 853 | Ga0207695_10079628 | 3300025913 | Bacteria | 3320 |
| 854 | Ga0207695_10996822 | 3300025913 | Bacteria | 717 |
| 855 | Ga0207671_10000402 | 3300025914 | Bacteria | 60371 |
| 856 | Ga0207671_10001317 | 3300025914 | Bacteria | 29052 |
| 857 | Ga0207671_10002977 | 3300025914 | Bacteria | 17383 |
| 858 | Ga0207671_10013351 | 3300025914 | Bacteria | 6545 |
| 859 | Ga0207671_10013961 | 3300025914 | Bacteria | 6374 |
| 860 | Ga0207671_10071447 | 3300025914 | Bacteria | 2589 |
| 861 | Ga0207671_10093965 | 3300025914 | Bacteria | 2263 |
| 862 | Ga0207671_10115538 | 3300025914 | Bacteria | 2046 |
| 863 | Ga0207671_10226165 | 3300025914 | Bacteria | 1467 |
| 864 | Ga0207671_10713587 | 3300025914 | Bacteria | 797 |
| 865 | Ga0207671_10896111 | 3300025914 | Bacteria | 701 |
| 866 | Ga0207660_10084322 | 3300025917 | Bacteria | 2342 |
| 867 | Ga0207660_10129589 | 3300025917 | Bacteria | 1919 |
| 868 | Ga0207662_10107448 | 3300025918 | Bacteria | 1736 |
| 869 | Ga0207662_10143487 | 3300025918 | Bacteria | 1514 |
| 870 | Ga0207662_10252308 | 3300025918 | Bacteria | 1158 |
| 871 | Ga0207657_10004720 | 3300025919 | Bacteria | 14380 |
| 872 | Ga0207657_10353903 | 3300025919 | Bacteria | 1158 |
| 873 | Ga0207657_10363098 | 3300025919 | Bacteria | 1141 |
| 874 | Ga0207649_10001499 | 3300025920 | Bacteria | 13709 |
| 875 | Ga0207649_10054800 | 3300025920 | Bacteria | 2483 |
| 876 | Ga0207649_10112777 | 3300025920 | Bacteria | 1820 |
| 877 | Ga0207649_10524291 | 3300025920 | Bacteria | 904 |
| 878 | Ga0207649_10810143 | 3300025920 | Bacteria | 731 |
| 879 | Ga0207649_11281419 | 3300025920 | Bacteria | 580 |
| 880 | Ga0207652_10292723 | 3300025921 | Bacteria | 1469 |
| 881 | Ga0207681_10069963 | 3300025923 | Bacteria | 2443 |
| 882 | Ga0207681_10090697 | 3300025923 | Unclassified | 2182 |
| 883 | Ga0207681_10248616 | 3300025923 | Bacteria | 1387 |
| 884 | Ga0207681_10299388 | 3300025923 | Bacteria | 1272 |
| 885 | Ga0207681_10804460 | 3300025923 | Bacteria | 785 |
| 886 | Ga0207681_11121260 | 3300025923 | Bacteria | 661 |
| 887 | Ga0207681_11228748 | 3300025923 | Bacteria | 629 |
| 888 | Ga0207694_10006626 | 3300025924 | Bacteria | 8801 |
| 889 | Ga0207694_10180164 | 3300025924 | Bacteria | 1713 |
| 890 | Ga0207694_10307992 | 3300025924 | Bacteria | 1305 |
| 891 | Ga0207694_10517761 | 3300025924 | Bacteria | 999 |
| 892 | Ga0207650_10018439 | 3300025925 | Bacteria | 4898 |
| 893 | Ga0207650_10064928 | 3300025925 | Bacteria | 2733 |
| 894 | Ga0207650_10088885 | 3300025925 | Bacteria | 2357 |
| 895 | Ga0207650_10136667 | 3300025925 | Bacteria | 1923 |
| 896 | Ga0207650_10182983 | 3300025925 | Bacteria | 1671 |
| 897 | Ga0207650_10193656 | 3300025925 | Bacteria | 1625 |
| 898 | Ga0207650_10212060 | 3300025925 | Bacteria | 1555 |
| 899 | Ga0207650_10247907 | 3300025925 | Bacteria | 1441 |
| 900 | Ga0207650_10314320 | 3300025925 | Bacteria | 1282 |
| 901 | Ga0207650_10621260 | 3300025925 | Bacteria | 909 |
| 902 | Ga0207650_11455151 | 3300025925 | Bacteria | 583 |
| 903 | Ga0207659_10005427 | 3300025926 | Bacteria | 7726 |
| 904 | Ga0207659_10022872 | 3300025926 | Bacteria | 4167 |
| 905 | Ga0207659_10064313 | 3300025926 | Bacteria | 2654 |
| 906 | Ga0207659_10131521 | 3300025926 | Bacteria | 1932 |
| 907 | Ga0207659_10141105 | 3300025926 | Bacteria | 1870 |
| 908 | Ga0207659_10633080 | 3300025926 | Bacteria | 913 |
| 909 | Ga0207659_10750568 | 3300025926 | Unclassified | 837 |
| 910 | Ga0207659_10986683 | 3300025926 | Bacteria | 725 |
| 911 | Ga0207644_10011068 | 3300025931 | Bacteria | 5959 |
| 912 | Ga0207644_10049616 | 3300025931 | Bacteria | 3006 |
| 913 | Ga0207644_10056362 | 3300025931 | Bacteria | 2836 |
| 914 | Ga0207644_10058563 | 3300025931 | Bacteria | 2785 |
| 915 | Ga0207644_10253986 | 3300025931 | Bacteria | 1404 |
| 916 | Ga0207644_10413004 | 3300025931 | Bacteria | 1105 |
| 917 | Ga0207644_10657001 | 3300025931 | Bacteria | 873 |
| 918 | Ga0207690_10081996 | 3300025932 | Bacteria | 2255 |
| 919 | Ga0207690_10359899 | 3300025932 | Unclassified | 1152 |
| 920 | Ga0207706_10019629 | 3300025933 | Bacteria | 6080 |
| 921 | Ga0207706_10024662 | 3300025933 | Bacteria | 5390 |
| 922 | Ga0207706_10032960 | 3300025933 | Bacteria | 4610 |
| 923 | Ga0207706_10051313 | 3300025933 | Bacteria | 3642 |
| 924 | Ga0207706_10052481 | 3300025933 | Bacteria | 3600 |
| 925 | Ga0207706_10058898 | 3300025933 | Bacteria | 3383 |
| 926 | Ga0207706_10189648 | 3300025933 | Bacteria | 1805 |
| 927 | Ga0207686_10047655 | 3300025934 | Bacteria | 2650 |
| 928 | Ga0207686_10110306 | 3300025934 | Bacteria | 1854 |
| 929 | Ga0207686_10247829 | 3300025934 | Bacteria | 1300 |
| 930 | Ga0207686_10976831 | 3300025934 | Bacteria | 686 |
| 931 | Ga0207709_10404473 | 3300025935 | Unclassified | 1044 |
| 932 | Ga0207670_10002959 | 3300025936 | Bacteria | 8969 |
| 933 | Ga0207670_10060183 | 3300025936 | Bacteria | 2586 |
| 934 | Ga0207670_10344085 | 3300025936 | Bacteria | 1179 |
| 935 | Ga0207669_10100583 | 3300025937 | Unclassified | 1910 |
| 936 | Ga0207669_10124225 | 3300025937 | Bacteria | 1759 |
| 937 | Ga0207669_10204591 | 3300025937 | Unclassified | 1436 |
| 938 | Ga0207669_10366340 | 3300025937 | Bacteria | 1118 |
| 939 | Ga0207669_10477447 | 3300025937 | Bacteria | 993 |
| 940 | Ga0207704_10017234 | 3300025938 | Bacteria | 3738 |
| 941 | Ga0207704_10052814 | 3300025938 | Bacteria | 2466 |
| 942 | Ga0207704_10104999 | 3300025938 | Bacteria | 1894 |
| 943 | Ga0207704_10105173 | 3300025938 | Unclassified | 1893 |
| 944 | Ga0207704_10163266 | 3300025938 | Bacteria | 1588 |
| 945 | Ga0207704_10329125 | 3300025938 | Bacteria | 1181 |
| 946 | Ga0207704_10354290 | 3300025938 | Bacteria | 1144 |
| 947 | Ga0207704_10374328 | 3300025938 | Bacteria | 1116 |
| 948 | Ga0207704_10834726 | 3300025938 | Bacteria | 771 |
| 949 | Ga0207691_10000076 | 3300025940 | Bacteria | 83005 |
| 950 | Ga0207691_10050794 | 3300025940 | Bacteria | 3794 |
| 951 | Ga0207691_10054463 | 3300025940 | Bacteria | 3648 |
| 952 | Ga0207691_10058866 | 3300025940 | Bacteria | 3494 |
| 953 | Ga0207691_10065911 | 3300025940 | Bacteria | 3277 |
| 954 | Ga0207691_10083028 | 3300025940 | Bacteria | 2877 |
| 955 | Ga0207691_10233946 | 3300025940 | Bacteria | 1590 |
| 956 | Ga0207691_10282896 | 3300025940 | Bacteria | 1427 |
| 957 | Ga0207691_10392539 | 3300025940 | Bacteria | 1184 |
| 958 | Ga0207691_10593283 | 3300025940 | Bacteria | 938 |
| 959 | Ga0207691_10951916 | 3300025940 | Bacteria | 718 |
| 960 | Ga0207711_10047631 | 3300025941 | Bacteria | 3666 |
| 961 | Ga0207711_10335400 | 3300025941 | Bacteria | 1399 |
| 962 | Ga0207711_10649584 | 3300025941 | Bacteria | 984 |
| 963 | Ga0207711_11107212 | 3300025941 | Bacteria | 733 |
| 964 | Ga0207689_10001853 | 3300025942 | Bacteria | 20012 |
| 965 | Ga0207689_10002225 | 3300025942 | Bacteria | 18170 |
| 966 | Ga0207689_10003970 | 3300025942 | Bacteria | 13455 |
| 967 | Ga0207689_10009828 | 3300025942 | Bacteria | 8245 |
| 968 | Ga0207689_10013487 | 3300025942 | Bacteria | 6981 |
| 969 | Ga0207689_10016179 | 3300025942 | Bacteria | 6316 |
| 970 | Ga0207689_10030548 | 3300025942 | Unclassified | 4490 |
| 971 | Ga0207689_10065690 | 3300025942 | Unclassified | 2984 |
| 972 | Ga0207689_10082022 | 3300025942 | Unclassified | 2651 |
| 973 | Ga0207689_10083732 | 3300025942 | Bacteria | 2622 |
| 974 | Ga0207689_10092853 | 3300025942 | Bacteria | 2479 |
| 975 | Ga0207689_10095473 | 3300025942 | Bacteria | 2442 |
| 976 | Ga0207689_10114825 | 3300025942 | Bacteria | 2213 |
| 977 | Ga0207689_10318562 | 3300025942 | Bacteria | 1290 |
| 978 | Ga0207661_10007676 | 3300025944 | Bacteria | 7676 |
| 979 | Ga0207661_10074126 | 3300025944 | Bacteria | 2790 |
| 980 | Ga0207661_10134065 | 3300025944 | Bacteria | 2125 |
| 981 | Ga0207661_10204533 | 3300025944 | Unclassified | 1737 |
| 982 | Ga0207661_10435425 | 3300025944 | Bacteria | 1192 |
| 983 | Ga0207679_10000159 | 3300025945 | Bacteria | 55990 |
| 984 | Ga0207679_10011961 | 3300025945 | Bacteria | 5640 |
| 985 | Ga0207679_10091755 | 3300025945 | Bacteria | 2351 |
| 986 | Ga0207679_10439790 | 3300025945 | Bacteria | 1155 |
| 987 | Ga0207679_10488798 | 3300025945 | Unclassified | 1097 |
| 988 | Ga0207679_10775443 | 3300025945 | Bacteria | 873 |
| 989 | Ga0207679_11071114 | 3300025945 | Bacteria | 739 |
| 990 | Ga0207667_10000414 | 3300025949 | Bacteria | 57815 |
| 991 | Ga0207667_10006159 | 3300025949 | Bacteria | 14576 |
| 992 | Ga0207667_10006640 | 3300025949 | Bacteria | 13981 |
| 993 | Ga0207667_10018745 | 3300025949 | Bacteria | 7750 |
| 994 | Ga0207667_10043492 | 3300025949 | Bacteria | 4766 |
| 995 | Ga0207667_10179079 | 3300025949 | Bacteria | 2177 |
| 996 | Ga0207667_10456143 | 3300025949 | Bacteria | 1299 |
| 997 | Ga0207667_10953695 | 3300025949 | Bacteria | 847 |
| 998 | Ga0207651_10006374 | 3300025960 | Bacteria | 6171 |
| 999 | Ga0207651_10067155 | 3300025960 | Bacteria | 2522 |
| 1000 | Ga0207651_10084255 | 3300025960 | Bacteria | 2302 |
| 1001 | Ga0207651_10084359 | 3300025960 | Unclassified | 2301 |
| 1002 | Ga0207651_10155585 | 3300025960 | Bacteria | 1785 |
| 1003 | Ga0207651_10245204 | 3300025960 | Bacteria | 1463 |
| 1004 | Ga0207651_10317385 | 3300025960 | Bacteria | 1301 |
| 1005 | Ga0207651_10323206 | 3300025960 | Bacteria | 1290 |
| 1006 | Ga0207651_10473966 | 3300025960 | Bacteria | 1078 |
| 1007 | Ga0207651_11013462 | 3300025960 | Bacteria | 742 |
| 1008 | Ga0207712_10010020 | 3300025961 | Bacteria | 6007 |
| 1009 | Ga0207712_10066018 | 3300025961 | Bacteria | 2585 |
| 1010 | Ga0207712_10080961 | 3300025961 | Bacteria | 2363 |
| 1011 | Ga0207712_10119385 | 3300025961 | Bacteria | 1992 |
| 1012 | Ga0207712_10169635 | 3300025961 | Bacteria | 1704 |
| 1013 | Ga0207712_10172080 | 3300025961 | Bacteria | 1694 |
| 1014 | Ga0207712_10188807 | 3300025961 | Unclassified | 1625 |
| 1015 | Ga0207712_10204977 | 3300025961 | Bacteria | 1566 |
| 1016 | Ga0207712_10232661 | 3300025961 | Bacteria | 1480 |
| 1017 | Ga0207712_10372763 | 3300025961 | Unclassified | 1192 |
| 1018 | Ga0207668_10044565 | 3300025972 | Unclassified | 3019 |
| 1019 | Ga0207668_10109202 | 3300025972 | Bacteria | 2072 |
| 1020 | Ga0207668_10121465 | 3300025972 | Unclassified | 1979 |
| 1021 | Ga0207668_10166582 | 3300025972 | Bacteria | 1723 |
| 1022 | Ga0207668_10310758 | 3300025972 | Unclassified | 1304 |
| 1023 | Ga0207668_10364071 | 3300025972 | Bacteria | 1212 |
| 1024 | Ga0207668_10455724 | 3300025972 | Bacteria | 1092 |
| 1025 | Ga0207668_11216751 | 3300025972 | Bacteria | 677 |
| 1026 | Ga0207640_10010753 | 3300025981 | Bacteria | 5163 |
| 1027 | Ga0207640_10099604 | 3300025981 | Bacteria | 2034 |
| 1028 | Ga0207640_10160459 | 3300025981 | Bacteria | 1663 |
| 1029 | Ga0207640_10184971 | 3300025981 | Bacteria | 1566 |
| 1030 | Ga0207640_10389178 | 3300025981 | Bacteria | 1132 |
| 1031 | Ga0207640_10567969 | 3300025981 | Bacteria | 956 |
| 1032 | Ga0207640_10967919 | 3300025981 | Bacteria | 747 |
| 1033 | Ga0207640_11076881 | 3300025981 | Bacteria | 710 |
| 1034 | Ga0207658_10008424 | 3300025986 | Bacteria | 7019 |
| 1035 | Ga0207658_10066629 | 3300025986 | Bacteria | 2709 |
| 1036 | Ga0207658_10120749 | 3300025986 | Bacteria | 2089 |
| 1037 | Ga0207658_10286395 | 3300025986 | Bacteria | 1414 |
| 1038 | Ga0207658_10293237 | 3300025986 | Bacteria | 1399 |
| 1039 | Ga0207658_10306699 | 3300025986 | Bacteria | 1370 |
| 1040 | Ga0207658_10309279 | 3300025986 | Bacteria | 1364 |
| 1041 | Ga0207658_10337813 | 3300025986 | Bacteria | 1308 |
| 1042 | Ga0207658_10411796 | 3300025986 | Bacteria | 1190 |
| 1043 | Ga0207658_10678139 | 3300025986 | Bacteria | 930 |
| 1044 | Ga0207658_10810434 | 3300025986 | Bacteria | 850 |
| 1045 | Ga0207658_10840490 | 3300025986 | Bacteria | 835 |
| 1046 | Ga0207658_11078671 | 3300025986 | Bacteria | 733 |
| 1047 | Ga0207677_10003307 | 3300026023 | Bacteria | 8525 |
| 1048 | Ga0207677_10043994 | 3300026023 | Unclassified | 2972 |
| 1049 | Ga0207677_10054520 | 3300026023 | Bacteria | 2729 |
| 1050 | Ga0207677_10062680 | 3300026023 | Bacteria | 2580 |
| 1051 | Ga0207677_10074356 | 3300026023 | Unclassified | 2411 |
| 1052 | Ga0207677_10183855 | 3300026023 | Bacteria | 1646 |
| 1053 | Ga0207677_10807523 | 3300026023 | Bacteria | 840 |
| 1054 | Ga0207677_11051138 | 3300026023 | Bacteria | 740 |
| 1055 | Ga0207677_11261764 | 3300026023 | Bacteria | 678 |
| 1056 | Ga0207703_10051094 | 3300026035 | Bacteria | 3349 |
| 1057 | Ga0207703_10144851 | 3300026035 | Unclassified | 2065 |
| 1058 | Ga0207703_10172139 | 3300026035 | Bacteria | 1905 |
| 1059 | Ga0207703_10255085 | 3300026035 | Bacteria | 1583 |
| 1060 | Ga0207703_10314055 | 3300026035 | Bacteria | 1433 |
| 1061 | Ga0207703_10400728 | 3300026035 | Unclassified | 1273 |
| 1062 | Ga0207703_10612624 | 3300026035 | Bacteria | 1031 |
| 1063 | Ga0207703_10657660 | 3300026035 | Bacteria | 994 |
| 1064 | Ga0207703_11058663 | 3300026035 | Bacteria | 779 |
| 1065 | Ga0207639_10003794 | 3300026041 | Bacteria | 10171 |
| 1066 | Ga0207639_10067276 | 3300026041 | Bacteria | 2787 |
| 1067 | Ga0207639_10083233 | 3300026041 | Bacteria | 2539 |
| 1068 | Ga0207639_10167410 | 3300026041 | Bacteria | 1858 |
| 1069 | Ga0207639_10211589 | 3300026041 | Bacteria | 1669 |
| 1070 | Ga0207639_10229390 | 3300026041 | Bacteria | 1608 |
| 1071 | Ga0207639_10242431 | 3300026041 | Bacteria | 1568 |
| 1072 | Ga0207639_10244092 | 3300026041 | Bacteria | 1563 |
| 1073 | Ga0207639_10338536 | 3300026041 | Bacteria | 1341 |
| 1074 | Ga0207639_10536705 | 3300026041 | Bacteria | 1073 |
| 1075 | Ga0207678_10271375 | 3300026067 | Bacteria | 1455 |
| 1076 | Ga0207678_10514694 | 3300026067 | Bacteria | 1044 |
| 1077 | Ga0207678_10979479 | 3300026067 | Unclassified | 748 |
| 1078 | Ga0207708_10597580 | 3300026075 | Unclassified | 934 |
| 1079 | Ga0207702_10020850 | 3300026078 | Bacteria | 5422 |
| 1080 | Ga0207702_10080465 | 3300026078 | Bacteria | 2827 |
| 1081 | Ga0207702_10759369 | 3300026078 | Bacteria | 957 |
| 1082 | Ga0207641_10000111 | 3300026088 | Bacteria | 120527 |
| 1083 | Ga0207641_10000661 | 3300026088 | Bacteria | 37590 |
| 1084 | Ga0207641_10033650 | 3300026088 | Bacteria | 4258 |
| 1085 | Ga0207641_10138975 | 3300026088 | Bacteria | 2189 |
| 1086 | Ga0207641_10240177 | 3300026088 | Bacteria | 1688 |
| 1087 | Ga0207641_10335249 | 3300026088 | Bacteria | 1438 |
| 1088 | Ga0207641_10363845 | 3300026088 | Bacteria | 1382 |
| 1089 | Ga0207641_10439788 | 3300026088 | Bacteria | 1259 |
| 1090 | Ga0207641_10468528 | 3300026088 | Bacteria | 1219 |
| 1091 | Ga0207641_10767568 | 3300026088 | Bacteria | 952 |
| 1092 | Ga0207641_10886595 | 3300026088 | Bacteria | 885 |
| 1093 | Ga0207648_10001550 | 3300026089 | Bacteria | 25309 |
| 1094 | Ga0207648_10002106 | 3300026089 | Bacteria | 21685 |
| 1095 | Ga0207648_10002777 | 3300026089 | Bacteria | 18581 |
| 1096 | Ga0207648_10021535 | 3300026089 | Bacteria | 5794 |
| 1097 | Ga0207648_10082006 | 3300026089 | Bacteria | 2812 |
| 1098 | Ga0207648_10118716 | 3300026089 | Bacteria | 2324 |
| 1099 | Ga0207648_10188889 | 3300026089 | Bacteria | 1825 |
| 1100 | Ga0207648_10224355 | 3300026089 | Bacteria | 1671 |
| 1101 | Ga0207648_10533323 | 3300026089 | Bacteria | 1076 |
| 1102 | Ga0207648_10537286 | 3300026089 | Bacteria | 1073 |
| 1103 | Ga0207648_10618409 | 3300026089 | Bacteria | 999 |
| 1104 | Ga0207648_10641433 | 3300026089 | Bacteria | 981 |
| 1105 | Ga0207648_10837418 | 3300026089 | Bacteria | 858 |
| 1106 | Ga0207676_10050667 | 3300026095 | Unclassified | 3238 |
| 1107 | Ga0207676_10053119 | 3300026095 | Bacteria | 3170 |
| 1108 | Ga0207676_10065397 | 3300026095 | Bacteria | 2895 |
| 1109 | Ga0207676_10093940 | 3300026095 | Bacteria | 2470 |
| 1110 | Ga0207676_10511272 | 3300026095 | Bacteria | 1142 |
| 1111 | Ga0207676_10521235 | 3300026095 | Bacteria | 1131 |
| 1112 | Ga0207676_10606465 | 3300026095 | Bacteria | 1052 |
| 1113 | Ga0207676_10650081 | 3300026095 | Bacteria | 1017 |
| 1114 | Ga0207676_10718557 | 3300026095 | Bacteria | 969 |
| 1115 | Ga0207676_12089784 | 3300026095 | Bacteria | 565 |
| 1116 | Ga0207674_10003288 | 3300026116 | Bacteria | 19877 |
| 1117 | Ga0207674_10003475 | 3300026116 | Bacteria | 19268 |
| 1118 | Ga0207674_10048957 | 3300026116 | Bacteria | 4323 |
| 1119 | Ga0207674_10083735 | 3300026116 | Unclassified | 3188 |
| 1120 | Ga0207674_10095134 | 3300026116 | Bacteria | 2965 |
| 1121 | Ga0207674_10107427 | 3300026116 | Bacteria | 2768 |
| 1122 | Ga0207674_10147535 | 3300026116 | Bacteria | 2310 |
| 1123 | Ga0207674_10230182 | 3300026116 | Bacteria | 1801 |
| 1124 | Ga0207674_10682528 | 3300026116 | Bacteria | 992 |
| 1125 | Ga0207675_100001864 | 3300026118 | Bacteria | 21105 |
| 1126 | Ga0207675_100009737 | 3300026118 | Bacteria | 8998 |
| 1127 | Ga0207675_100015472 | 3300026118 | Bacteria | 7116 |
| 1128 | Ga0207675_100068468 | 3300026118 | Unclassified | 3317 |
| 1129 | Ga0207675_100192217 | 3300026118 | Bacteria | 1958 |
| 1130 | Ga0207675_100229178 | 3300026118 | Bacteria | 1792 |
| 1131 | Ga0207675_100531824 | 3300026118 | Bacteria | 1173 |
| 1132 | Ga0207675_100839473 | 3300026118 | Bacteria | 933 |
| 1133 | Ga0207675_101028849 | 3300026118 | Bacteria | 842 |
| 1134 | Ga0207675_101044009 | 3300026118 | Unclassified | 836 |
| 1135 | Ga0207675_101077052 | 3300026118 | Bacteria | 823 |
| 1136 | Ga0207675_101177511 | 3300026118 | Bacteria | 787 |
| 1137 | Ga0207675_102263589 | 3300026118 | Bacteria | 558 |
| 1138 | Ga0207683_10003417 | 3300026121 | Bacteria | 13829 |
| 1139 | Ga0207683_10010127 | 3300026121 | Bacteria | 8044 |
| 1140 | Ga0207683_10054465 | 3300026121 | Bacteria | 3508 |
| 1141 | Ga0207683_10068803 | 3300026121 | Bacteria | 3126 |
| 1142 | Ga0207683_10112602 | 3300026121 | Bacteria | 2437 |
| 1143 | Ga0207683_10297195 | 3300026121 | Bacteria | 1477 |
| 1144 | Ga0207683_10559009 | 3300026121 | Bacteria | 1058 |
| 1145 | Ga0207683_10581102 | 3300026121 | Bacteria | 1036 |
| 1146 | Ga0207683_10700970 | 3300026121 | Unclassified | 939 |
| 1147 | Ga0207683_11810061 | 3300026121 | Unclassified | 560 |
| 1148 | Ga0207698_10003425 | 3300026142 | Bacteria | 9545 |
| 1149 | Ga0207698_10009487 | 3300026142 | Bacteria | 6209 |
| 1150 | Ga0207698_10021613 | 3300026142 | Bacteria | 4455 |
| 1151 | Ga0207698_10046965 | 3300026142 | Bacteria | 3266 |
| 1152 | Ga0207698_10081677 | 3300026142 | Bacteria | 2610 |
| 1153 | Ga0207698_10182854 | 3300026142 | Unclassified | 1859 |
| 1154 | Ga0207698_10250726 | 3300026142 | Bacteria | 1620 |
| 1155 | Ga0207698_10278190 | 3300026142 | Bacteria | 1546 |
| 1156 | Ga0207698_10319386 | 3300026142 | Bacteria | 1453 |
| 1157 | Ga0207698_10320148 | 3300026142 | Bacteria | 1452 |
| 1158 | Ga0207698_10419572 | 3300026142 | Bacteria | 1284 |
| 1159 | Ga0207698_10517869 | 3300026142 | Bacteria | 1163 |
| 1160 | Ga0207698_10607661 | 3300026142 | Bacteria | 1079 |
| 1161 | Ga0207698_10971626 | 3300026142 | Bacteria | 859 |
| 1162 | Ga0207698_10998083 | 3300026142 | Bacteria | 848 |
| 1163 | Ga0209996_1048052 | 3300027395 | Bacteria | 643 |
| 1164 | Ga0207428_10009365 | 3300027907 | Bacteria | 8785 |
| 1165 | Ga0268266_10000068 | 3300028379 | Bacteria | 241100 |
| 1166 | Ga0268266_10024264 | 3300028379 | Bacteria | 5160 |
| 1167 | Ga0268266_10113619 | 3300028379 | Bacteria | 2402 |
| 1168 | Ga0268266_10365168 | 3300028379 | Bacteria | 1359 |
| 1169 | Ga0268266_10403331 | 3300028379 | Bacteria | 1293 |
| 1170 | Ga0268266_10591881 | 3300028379 | Bacteria | 1065 |
| 1171 | Ga0268266_11890212 | 3300028379 | Bacteria | 571 |
| 1172 | Ga0268265_10006095 | 3300028380 | Bacteria | 8186 |
| 1173 | Ga0268265_10099857 | 3300028380 | Bacteria | 2341 |
| 1174 | Ga0268265_10334141 | 3300028380 | Bacteria | 1377 |
| 1175 | Ga0268265_10341654 | 3300028380 | Unclassified | 1363 |
| 1176 | Ga0268265_10362237 | 3300028380 | Bacteria | 1328 |
| 1177 | Ga0268265_10616475 | 3300028380 | Bacteria | 1039 |
| 1178 | Ga0268265_11817972 | 3300028380 | Bacteria | 616 |
| 1179 | Ga0268264_10000079 | 3300028381 | Bacteria | 249516 |
| 1180 | Ga0268264_10002203 | 3300028381 | Bacteria | 17296 |
| 1181 | Ga0268264_10004438 | 3300028381 | Bacteria | 11968 |
| 1182 | Ga0268264_10008001 | 3300028381 | Bacteria | 8792 |
| 1183 | Ga0268264_10019796 | 3300028381 | Bacteria | 5498 |
| 1184 | Ga0268264_10078043 | 3300028381 | Bacteria | 2822 |
| 1185 | Ga0268264_10113975 | 3300028381 | Bacteria | 2373 |
| 1186 | Ga0268264_10133846 | 3300028381 | Bacteria | 2201 |
| 1187 | Ga0268264_10144967 | 3300028381 | Bacteria | 2122 |
| 1188 | Ga0268264_10230957 | 3300028381 | Unclassified | 1709 |
| 1189 | Ga0268264_10286460 | 3300028381 | Bacteria | 1545 |
| 1190 | Ga0268264_10303017 | 3300028381 | Bacteria | 1505 |
| 1191 | Ga0268264_10310894 | 3300028381 | Bacteria | 1487 |
| 1192 | Ga0268264_10797505 | 3300028381 | Bacteria | 943 |
| 1193 | Ga0268264_10880282 | 3300028381 | Bacteria | 898 |
| 1194 | Ga0268264_11324138 | 3300028381 | Bacteria | 730 |
| 1195 | Ga0307517_10002947 | 3300028786 | Bacteria | 26911 |
| 1196 | Ga0307517_10063397 | 3300028786 | Bacteria | 3457 |
| 1197 | Ga0307515_10000162 | 3300028794 | Bacteria | 163720 |
| 1198 | Ga0265338_10085655 | 3300028800 | Bacteria | 2626 |
| 1199 | Ga0307511_10002426 | 3300030521 | Bacteria | 19480 |
| 1200 | Ga0307512_10242718 | 3300030522 | Bacteria | 909 |
| 1201 | Ga0265762_1028110 | 3300030760 | Bacteria | 1058 |
| 1202 | Ga0265327_10000211 | 3300031251 | Bacteria | 121722 |
| 1203 | Ga0265327_10056221 | 3300031251 | Bacteria | 2028 |
| 1204 | Ga0265327_10164882 | 3300031251 | Bacteria | 1021 |
| 1205 | Ga0307513_10011825 | 3300031456 | Bacteria | 10818 |
| 1206 | Ga0307513_10030364 | 3300031456 | Bacteria | 6141 |
| 1207 | Ga0307513_10424886 | 3300031456 | Bacteria | 1058 |
| 1208 | Ga0307513_10440001 | 3300031456 | Bacteria | 1030 |
| 1209 | Ga0307513_10470463 | 3300031456 | Bacteria | 978 |
| 1210 | Ga0307509_10025814 | 3300031507 | Bacteria | 6561 |
| 1211 | Ga0307509_10068967 | 3300031507 | Bacteria | 3698 |
| 1212 | Ga0307509_10073437 | 3300031507 | Bacteria | 3561 |
| 1213 | Ga0265313_10009958 | 3300031595 | Bacteria | 6099 |
| 1214 | Ga0307508_10000686 | 3300031616 | Bacteria | 40604 |
| 1215 | Ga0307516_10003590 | 3300031730 | Bacteria | 19774 |
| 1216 | Ga0307516_10109739 | 3300031730 | Bacteria | 2563 |
| 1217 | Ga0247548_103414 | 3300031814 | Bacteria | 715 |
| 1218 | Ga0307413_10437849 | 3300031824 | Bacteria | 1034 |
| 1219 | Ga0307410_10032504 | 3300031852 | Unclassified | 3359 |
| 1220 | Ga0307410_10542314 | 3300031852 | Bacteria | 963 |
| 1221 | Ga0307407_10346717 | 3300031903 | Unclassified | 1050 |
| 1222 | Ga0307416_101792331 | 3300032002 | Bacteria | 718 |
| 1223 | Ga0307411_11041394 | 3300032005 | Bacteria | 735 |
| 1224 | Ga0316053_106418 | 3300032120 | Bacteria | 765 |
| 1225 | Ga0307510_10009449 | 3300033180 | Bacteria | 11612 |
| 1226 | Ga0373934_0024384 | 3300035086 | Bacteria | 2339 |
| 1227 | Ga0373952_0031785 | 3300035092 | Unclassified | 1175 |
| 1228 | Ga0373953_0062896 | 3300035117 | Bacteria | 1520 |
| 1229 | Ga0373956_0014883 | 3300035119 | Bacteria | 3253 |
| 1230 | Ga0373943_0200393 | 3300035170 | Bacteria | 1105 |
| 1231 | Ga0373955_0362955 | 3300035172 | Bacteria | 878 |
| 1232 | Ga0373924_0047247 | 3300035410 | Unclassified | 1776 |
| 1233 | Ga0373931_0200936 | 3300035691 | Bacteria | 1191 |
| 1234 | Ga0373935_0188483 | 3300035692 | Bacteria | 1420 |
| 1235 | Ga0373927_0421245 | 3300035695 | Bacteria | 881 |
| 1236 | Ga0373947_0417939 | 3300035725 | Bacteria | 906 |
| 1237 | Ga0373937_1165108 | 3300036401 | Bacteria | 719 |
| 1238 | Ga0265778_009790 | 3300036457 | Bacteria | 1083 |
| 1239 | Ga0395899_0302972 | 3300037312 | Bacteria | 1081 |
| 1240 | Ga0395900_0860640 | 3300037418 | Bacteria | 832 |
| 1241 | Ga0395901_0264140 | 3300038443 | Bacteria | 1791 |
| 1242 | Ga0436365_1006175 | 3300039437 | Bacteria | 964 |
| 1243 | Ga0439436_0001808 | 3300041404 | Bacteria | 6298 |
| 1244 | Ga0439436_0068781 | 3300041404 | Bacteria | 988 |
| 1245 | Ga0439439_0073858 | 3300041406 | Bacteria | 916 |
| 1246 | Ga0451791_0561649 | 3300041451 | Bacteria | 1216 |
| 1247 | Ga0451791_0610277 | 3300041451 | Bacteria | 927 |
| 1248 | Ga0451797_1589118 | 3300041453 | Bacteria | 1067 |
| 1249 | Ga0451795_0658710 | 3300041456 | Bacteria | 641 |
| 1250 | Ga0451800_0870425 | 3300041459 | Bacteria | 660 |
| 1251 | Ga0451802_1270985 | 3300041460 | Bacteria | 547 |
| 1252 | Ga0451804_1163584 | 3300041463 | Bacteria | 2034 |
| 1253 | Ga0451807_2034630 | 3300041486 | Bacteria | 634 |
| 1254 | Ga0451807_2520669 | 3300041486 | Bacteria | 929 |
| 1255 | Ga0451835_0796468 | 3300041492 | Bacteria | 644 |
| 1256 | Ga0451837_0151272 | 3300041494 | Bacteria | 663 |
| 1257 | Ga0451839_0417715 | 3300041496 | Bacteria | 730 |
| 1258 | Ga0451841_0638555 | 3300041498 | Unclassified | 624 |
| 1259 | Ga0451851_1315133 | 3300041507 | Bacteria | 1817 |
| 1260 | Ga0451843_0280491 | 3300041509 | Bacteria | 1080 |
| 1261 | Ga0451853_2369279 | 3300041512 | Bacteria | 836 |
| 1262 | Ga0451853_3113474 | 3300041512 | Bacteria | 797 |
| 1263 | Ga0452271_00284 | 3300041916 | Bacteria | 804 |
| 1264 | Ga0439449_0017943 | 3300042007 | Bacteria | 2656 |
| 1265 | Ga0439454_022306 | 3300042011 | Bacteria | 942 |
| 1266 | Ga0439455_0093612 | 3300042012 | Bacteria | 826 |
| 1267 | Ga0439457_007741 | 3300042014 | Bacteria | 2567 |
| 1268 | Ga0439462_0000316 | 3300042015 | Bacteria | 8967 |
| 1269 | Ga0439462_0016281 | 3300042015 | Bacteria | 1921 |
| 1270 | Ga0450894_003510 | 3300042131 | Bacteria | 2049 |
| 1271 | Ga0439434_0031310 | 3300042435 | Bacteria | 1617 |
| 1272 | Ga0450893_0034783 | 3300042532 | Bacteria | 908 |
| 1273 | Ga0451577_0010418 | 3300042876 | Bacteria | 8892 |
| 1274 | Ga0451577_0077486 | 3300042876 | Bacteria | 2964 |
| 1275 | Ga0451577_0115853 | 3300042876 | Bacteria | 2400 |
| 1276 | Ga0466969_0001839 | 3300044656 | Bacteria | 11340 |
| 1277 | Ga0466972_0000026 | 3300044658 | Bacteria | 184739 |
| 1278 | Ga0466972_0000047 | 3300044658 | Bacteria | 122901 |
| 1279 | Ga0466972_0016295 | 3300044658 | Bacteria | 3714 |
| 1280 | Ga0466972_0020214 | 3300044658 | Unclassified | 3327 |
| 1281 | Ga0466972_0245505 | 3300044658 | Unclassified | 837 |
| 1282 | Ga0453683_0512605 | 3300044673 | Unclassified | 779 |
| 1283 | Ga0466965_0041591 | 3300044683 | Bacteria | 2265 |
| 1284 | Ga0466965_0687980 | 3300044683 | Bacteria | 586 |
| 1285 | Ga0466966_0000047 | 3300044684 | Bacteria | 91962 |
| 1286 | Ga0466961_0143690 | 3300044693 | Bacteria | 1493 |
| 1287 | Ga0466961_0233268 | 3300044693 | Bacteria | 1132 |
| 1288 | Ga0466964_0064418 | 3300044706 | Bacteria | 1533 |
| 1289 | Ga0453684_0457166 | 3300044712 | Bacteria | 1420 |
| 1290 | Ga0453684_0906061 | 3300044712 | Unclassified | 944 |
| 1291 | Ga0466971_0473029 | 3300044719 | Bacteria | 616 |
| 1292 | Ga0466968_0269485 | 3300044735 | Bacteria | 812 |
| 1293 | Ga0466970_0015920 | 3300044765 | Bacteria | 3872 |
| 1294 | Ga0466970_0290958 | 3300044765 | Unclassified | 920 |
| 1295 | Ga0466957_0000937 | 3300044842 | Bacteria | 14932 |
| 1296 | Ga0466957_0023370 | 3300044842 | Bacteria | 3655 |
| 1297 | Ga0466957_0690407 | 3300044842 | Bacteria | 720 |
| 1298 | Ga0466959_0000065 | 3300045049 | Bacteria | 73931 |
| 1299 | Ga0466967_0202462 | 3300045976 | Bacteria | 1881 |
| 1300 | Ga0495592_0143158 | 3300046454 | Bacteria | 1660 |
| 1301 | Ga0495592_0551554 | 3300046454 | Bacteria | 709 |
| 1302 | Ga0495638_0087756 | 3300046460 | Bacteria | 1879 |
| 1303 | Ga0495638_0147545 | 3300046460 | Bacteria | 1367 |
| 1304 | Ga0495638_0437710 | 3300046460 | Bacteria | 670 |
| 1305 | Ga0495653_0072165 | 3300046463 | Bacteria | 2579 |
| 1306 | Ga0495650_0014356 | 3300046471 | Bacteria | 4128 |
| 1307 | Ga0495580_0160391 | 3300046472 | Bacteria | 1557 |
| 1308 | Ga0495582_0279297 | 3300046473 | Bacteria | 959 |
| 1309 | Ga0495594_0474533 | 3300046499 | Bacteria | 711 |
| 1310 | Ga0495608_0142584 | 3300046511 | Bacteria | 1529 |
| 1311 | Ga0495618_0179402 | 3300046514 | Bacteria | 1346 |
| 1312 | Ga0495628_0046468 | 3300046516 | Bacteria | 3448 |
| 1313 | Ga0495630_0043935 | 3300046517 | Bacteria | 3339 |
| 1314 | Ga0495630_0273931 | 3300046517 | Bacteria | 1289 |
| 1315 | Ga0495632_0273517 | 3300046519 | Bacteria | 753 |
| 1316 | Ga0495643_0107254 | 3300046522 | Bacteria | 1424 |
| 1317 | Ga0495648_0003925 | 3300046524 | Bacteria | 12873 |
| 1318 | Ga0495652_0654985 | 3300046529 | Bacteria | 711 |
| 1319 | Ga0495640_0527989 | 3300046533 | Bacteria | 717 |
| 1320 | Ga0495587_0077150 | 3300046536 | Bacteria | 1935 |
| 1321 | Ga0495609_0233480 | 3300046538 | Unclassified | 761 |
| 1322 | Ga0495633_0166331 | 3300046558 | Bacteria | 1017 |
| 1323 | Ga0495668_0001854 | 3300046616 | Bacteria | 19009 |
| 1324 | Ga0495634_0099901 | 3300046642 | Bacteria | 1876 |
| 1325 | Ga0495611_0000435 | 3300046648 | Bacteria | 25748 |
| 1326 | Ga0495611_0054059 | 3300046648 | Bacteria | 1814 |
| 1327 | Ga0495611_0172206 | 3300046648 | Unclassified | 1012 |
| 1328 | Ga0495625_0171459 | 3300046660 | Unclassified | 1449 |
| 1329 | Ga0495625_0235621 | 3300046660 | Bacteria | 1194 |
| 1330 | Ga0495646_0185718 | 3300046680 | Bacteria | 1139 |
| 1331 | Ga0495647_0183159 | 3300046681 | Bacteria | 912 |
| 1332 | Ga0495658_0577004 | 3300046683 | Bacteria | 720 |
| 1333 | Ga0495658_0605059 | 3300046683 | Bacteria | 702 |
| 1334 | Ga0495613_0241201 | 3300046689 | Bacteria | 1264 |
| 1335 | Ga0495670_0284332 | 3300046691 | Bacteria | 885 |
| 1336 | Ga0495649_0020964 | 3300046694 | Bacteria | 3663 |
| 1337 | Ga0495649_0165133 | 3300046694 | Bacteria | 1160 |
| 1338 | Ga0495649_0359783 | 3300046694 | Unclassified | 734 |
| 1339 | Ga0495600_0210469 | 3300046809 | Bacteria | 1246 |
| 1340 | Ga0495674_0516196 | 3300047319 | Unclassified | 954 |
| 1341 | Ga0495672_0032233 | 3300047320 | Bacteria | 3263 |
| 1342 | Ga0495672_0045647 | 3300047320 | Bacteria | 2620 |
| 1343 | Ga0495687_000058 | 3300047443 | Bacteria | 185830 |
| 1344 | Ga0495675_0164974 | 3300047444 | Bacteria | 1363 |
| 1345 | Ga0495686_0000005 | 3300047472 | Bacteria | 827143 |
| 1346 | Ga0495686_0314362 | 3300047472 | Bacteria | 860 |
| 1347 | Ga0495593_0465706 | 3300047673 | Bacteria | 633 |
| 1348 | Ga0496100_0022116 | 3300048903 | Bacteria | 3843 |
| 1349 | Ga0496100_1071295 | 3300048903 | Bacteria | 635 |
| 1350 | Ga0496101_0078704 | 3300048904 | Bacteria | 2433 |
| 1351 | Ga0496102_0431248 | 3300048905 | Bacteria | 1238 |
| 1352 | Ga0496102_0785145 | 3300048905 | Bacteria | 875 |
| 1353 | Ga0496104_0102316 | 3300048907 | Bacteria | 2744 |
| 1354 | Ga0496104_0294681 | 3300048907 | Bacteria | 1535 |
| 1355 | Ga0496104_0562736 | 3300048907 | Bacteria | 1051 |
| 1356 | Ga0496104_0690172 | 3300048907 | Unclassified | 929 |
| 1357 | Ga0496105_0104890 | 3300048908 | Bacteria | 2333 |
| 1358 | Ga0496110_0009120 | 3300048913 | Bacteria | 8009 |
| 1359 | Ga0496110_0583184 | 3300048913 | Bacteria | 1015 |
| 1360 | Ga0496111_0888989 | 3300048914 | Bacteria | 642 |
| 1361 | Ga0496114_0060428 | 3300048917 | Bacteria | 3168 |
| 1362 | Ga0496114_0542910 | 3300048917 | Bacteria | 1027 |
| 1363 | Ga0496115_0311462 | 3300048918 | Bacteria | 1289 |
| 1364 | Ga0496124_0025722 | 3300048927 | Bacteria | 5324 |
| 1365 | Ga0501306_020602 | 3300049127 | Bacteria | 918 |
| 1366 | Ga0501306_023486 | 3300049127 | Bacteria | 876 |
| 1367 | Ga0501306_029430 | 3300049127 | Bacteria | 810 |
| 1368 | Ga0501306_029588 | 3300049127 | Bacteria | 808 |
| 1369 | Ga0501306_073237 | 3300049127 | Bacteria | 581 |
| 1370 | Ga0501306_076822 | 3300049127 | Bacteria | 571 |
| 1371 | Ga0501306_095068 | 3300049127 | Bacteria | 527 |
| 1372 | Ga0501308_015523 | 3300049128 | Bacteria | 903 |
| 1373 | Ga0501308_019267 | 3300049128 | Bacteria | 841 |
| 1374 | Ga0501308_044528 | 3300049128 | Bacteria | 634 |
| 1375 | Ga0501308_048431 | 3300049128 | Bacteria | 616 |
| 1376 | Ga0501308_085917 | 3300049128 | Bacteria | 506 |
| 1377 | Ga0501309_026316 | 3300049129 | Unclassified | 839 |
| 1378 | Ga0501309_045566 | 3300049129 | Bacteria | 679 |
| 1379 | Ga0501309_083157 | 3300049129 | Unclassified | 539 |
| 1380 | Ga0501310_035532 | 3300049130 | Bacteria | 677 |
| 1381 | Ga0501310_038151 | 3300049130 | Bacteria | 661 |
| 1382 | Ga0501341_16378 | 3300049131 | Bacteria | 526 |
| 1383 | Ga0501343_014432 | 3300049132 | Bacteria | 667 |
| 1384 | Ga0501343_017103 | 3300049132 | Bacteria | 625 |
| 1385 | Ga0501343_025956 | 3300049132 | Bacteria | 530 |
| 1386 | Ga0501344_06775 | 3300049133 | Bacteria | 666 |
| 1387 | Ga0501304_009793 | 3300049160 | Bacteria | 828 |
| 1388 | Ga0501304_030658 | 3300049160 | Bacteria | 571 |
| 1389 | Ga0501305_011364 | 3300049161 | Bacteria | 1201 |
| 1390 | Ga0501305_023982 | 3300049161 | Bacteria | 916 |
| 1391 | Ga0501305_060459 | 3300049161 | Bacteria | 651 |
| 1392 | Ga0501307_015588 | 3300049162 | Bacteria | 939 |
| 1393 | Ga0501307_071311 | 3300049162 | Bacteria | 554 |
| 1394 | Ga0501342_04422 | 3300049163 | Bacteria | 517 |
| 1395 | Ga0501290_023419 | 3300049513 | Bacteria | 856 |
| 1396 | Ga0501300_024987 | 3300049523 | Bacteria | 875 |
| 1397 | Ga0501311_039794 | 3300049527 | Bacteria | 709 |
| 1398 | Ga0501311_051601 | 3300049527 | Bacteria | 646 |
| 1399 | Ga0501311_091461 | 3300049527 | Bacteria | 529 |
| 1400 | Ga0501312_020191 | 3300049528 | Bacteria | 984 |
| 1401 | Ga0501312_036407 | 3300049528 | Bacteria | 790 |
| 1402 | Ga0501312_057184 | 3300049528 | Bacteria | 669 |
| 1403 | Ga0501312_082985 | 3300049528 | Bacteria | 582 |
| 1404 | Ga0501313_020182 | 3300049529 | Bacteria | 819 |
| 1405 | Ga0501313_036866 | 3300049529 | Bacteria | 648 |
| 1406 | Ga0501314_019372 | 3300049530 | Bacteria | 698 |
| 1407 | Ga0501314_027304 | 3300049530 | Bacteria | 621 |
| 1408 | Ga0501315_006608 | 3300049531 | Bacteria | 1296 |
| 1409 | Ga0501315_029210 | 3300049531 | Bacteria | 786 |
| 1410 | Ga0501315_034424 | 3300049531 | Bacteria | 743 |
| 1411 | Ga0501315_038411 | 3300049531 | Bacteria | 716 |
| 1412 | Ga0501316_038392 | 3300049532 | Bacteria | 661 |
| 1413 | Ga0501317_023266 | 3300049533 | Bacteria | 854 |
| 1414 | Ga0501317_073580 | 3300049533 | Bacteria | 580 |
| 1415 | Ga0501319_013389 | 3300049535 | Bacteria | 680 |
| 1416 | Ga0501321_032085 | 3300049537 | Bacteria | 706 |
| 1417 | Ga0501321_055231 | 3300049537 | Bacteria | 589 |
| 1418 | Ga0501322_030399 | 3300049538 | Bacteria | 508 |
| 1419 | Ga0501323_068822 | 3300049539 | Bacteria | 564 |
| 1420 | Ga0501324_018982 | 3300049540 | Bacteria | 692 |
| 1421 | Ga0501334_08988 | 3300049550 | Bacteria | 706 |
| 1422 | Ga0501336_013424 | 3300049552 | Bacteria | 685 |
| 1423 | Ga0501336_023667 | 3300049552 | Bacteria | 572 |
| 1424 | Ga0501336_024268 | 3300049552 | Bacteria | 568 |
| 1425 | Ga0501340_011543 | 3300049556 | Bacteria | 660 |
| 1426 | Ga0501031_0011346 | 3300049568 | Bacteria | 5804 |
| 1427 | Ga0501032_0016212 | 3300049569 | Bacteria | 5242 |
| 1428 | Ga0501033_0148587 | 3300049570 | Bacteria | 1692 |
| 1429 | Ga0501034_0000004 | 3300049571 | Bacteria | 382255 |
| 1430 | Ga0501034_0038295 | 3300049571 | Bacteria | 4856 |
| 1431 | Ga0501034_0156703 | 3300049571 | Bacteria | 2250 |
| 1432 | Ga0501034_0221323 | 3300049571 | Bacteria | 1845 |
| 1433 | Ga0501036_0064864 | 3300049572 | Bacteria | 3090 |
| 1434 | Ga0501037_0073362 | 3300049573 | Bacteria | 2488 |
| 1435 | Ga0501037_0094630 | 3300049573 | Bacteria | 2160 |
| 1436 | Ga0501038_0031875 | 3300049574 | Bacteria | 4655 |
| 1437 | Ga0501038_0160713 | 3300049574 | Bacteria | 1826 |
| 1438 | Ga0501038_0341423 | 3300049574 | Bacteria | 1168 |
| 1439 | Ga0501039_0069150 | 3300049575 | Bacteria | 2742 |
| 1440 | Ga0501039_0440216 | 3300049575 | Bacteria | 1023 |
| 1441 | Ga0501042_0667506 | 3300049578 | Bacteria | 756 |
| 1442 | Ga0501043_0182147 | 3300049579 | Bacteria | 1636 |
| 1443 | Ga0501043_0696340 | 3300049579 | Bacteria | 742 |
| 1444 | Ga0501046_0059769 | 3300049580 | Bacteria | 2985 |
| 1445 | Ga0501046_0070301 | 3300049580 | Bacteria | 2721 |
| 1446 | Ga0501047_0104968 | 3300049581 | Bacteria | 2706 |
| 1447 | Ga0501047_0324513 | 3300049581 | Bacteria | 1379 |
| 1448 | Ga0501047_0684518 | 3300049581 | Bacteria | 843 |
| 1449 | Ga0501048_0052768 | 3300049582 | Bacteria | 2894 |
| 1450 | Ga0501048_0166124 | 3300049582 | Bacteria | 1563 |
| 1451 | Ga0501067_0078807 | 3300049583 | Bacteria | 1826 |
| 1452 | Ga0501067_0178652 | 3300049583 | Bacteria | 1182 |
| 1453 | Ga0501067_0605946 | 3300049583 | Bacteria | 614 |
| 1454 | Ga0501068_0116026 | 3300049584 | Bacteria | 1668 |
| 1455 | Ga0501069_0265062 | 3300049585 | Bacteria | 1003 |
| 1456 | Ga0501071_0079981 | 3300049587 | Bacteria | 2390 |
| 1457 | Ga0501072_0378227 | 3300049588 | Bacteria | 1124 |
| 1458 | Ga0501072_0839155 | 3300049588 | Bacteria | 719 |
| 1459 | Ga0501073_0136283 | 3300049589 | Bacteria | 1701 |
| 1460 | Ga0501074_0016995 | 3300049590 | Bacteria | 5277 |
| 1461 | Ga0501225_0004193 | 3300049705 | Bacteria | 4309 |
| 1462 | Ga0501079_1426242 | 3300049741 | Bacteria | 545 |
| 1463 | Ga0501080_0241525 | 3300049742 | Unclassified | 1649 |
| 1464 | Ga0501080_0665087 | 3300049742 | Bacteria | 921 |
| 1465 | Ga0501080_0697459 | 3300049742 | Unclassified | 895 |
| 1466 | Ga0501083_0038490 | 3300049744 | Bacteria | 3251 |
| 1467 | Ga0501083_0066762 | 3300049744 | Unclassified | 2395 |
| 1468 | Ga0501083_0075836 | 3300049744 | Bacteria | 2232 |
| 1469 | Ga0501035_0082386 | 3300049822 | Bacteria | 2839 |
| 1470 | Ga0501035_0216770 | 3300049822 | Bacteria | 1636 |
| 1471 | Ga0501035_0326710 | 3300049822 | Bacteria | 1288 |
| 1472 | Ga0501035_0486912 | 3300049822 | Bacteria | 1017 |
| 1473 | Ga0501035_0488862 | 3300049822 | Bacteria | 1014 |
| 1474 | Ga0501044_0092260 | 3300049823 | Bacteria | 3054 |
| 1475 | Ga0501044_0209997 | 3300049823 | Bacteria | 1901 |
| 1476 | Ga0501044_0709142 | 3300049823 | Bacteria | 891 |
| 1477 | Ga0501044_0846074 | 3300049823 | Bacteria | 792 |
| 1478 | Ga0501204_047562 | 3300049850 | Bacteria | 648 |
| 1479 | Ga0501284_00017 | 3300050005 | Bacteria | 96362 |
| 1480 | nmdc:mga00v17_468702_c1 | 3300050491 | Bacteria | 817 |
| 1481 | nmdc:mga0k408_15433_c1 | 3300050493 | Bacteria | 4225 |
| 1482 | nmdc:mga0k408_173576_c1 | 3300050493 | Bacteria | 1285 |
| 1483 | nmdc:mga0k408_210511_c1 | 3300050493 | Bacteria | 1161 |
| 1484 | nmdc:mga0k408_57726_c1 | 3300050493 | Unclassified | 2254 |
| 1485 | nmdc:mga0k408_60000_c1 | 3300050493 | Bacteria | 2210 |
| 1486 | nmdc:mga0k408_71296_c1 | 3300050493 | Bacteria | 2028 |
| 1487 | nmdc:mga0k408_849998_c1 | 3300050493 | Bacteria | 531 |
| 1488 | nmdc:mga0k408_88131_c1 | 3300050493 | Bacteria | 1823 |
| 1489 | nmdc:mga07m45_285829_c1 | 3300050496 | Bacteria | 959 |
| 1490 | nmdc:mga07m45_424286_c1 | 3300050496 | Bacteria | 771 |
| 1491 | nmdc:mga05p37_450122_c1 | 3300050507 | Bacteria | 1491 |
| 1492 | nmdc:mga08y16_13908_c1 | 3300050511 | Bacteria | 8469 |
| 1493 | nmdc:mga08y16_181367_c1 | 3300050511 | Bacteria | 2186 |
| 1494 | nmdc:mga0n895_26949_c1 | 3300050512 | Bacteria | 5452 |
| 1495 | nmdc:mga0rr50_521263_c1 | 3300050513 | Bacteria | 1011 |
| 1496 | nmdc:mga0rr50_804147_c1 | 3300050513 | Bacteria | 802 |
| 1497 | Ga0500578_0000765 | 3300053086 | Bacteria | 37890 |
| 1498 | Ga0500578_0071393 | 3300053086 | Bacteria | 2213 |
| 1499 | Ga0500578_0461766 | 3300053086 | Bacteria | 721 |
| 1500 | Ga0500643_166056 | 3300053087 | Unclassified | 592 |
| 1501 | Ga0500646_0005187 | 3300053090 | Bacteria | 3299 |
| 1502 | Ga0500646_0023739 | 3300053090 | Unclassified | 1647 |
| 1503 | Ga0500646_0111081 | 3300053090 | Bacteria | 871 |
| 1504 | Ga0500583_0000003 | 3300053092 | Bacteria | 229587 |
| 1505 | Ga0500583_0008462 | 3300053092 | Unclassified | 3693 |
| 1506 | Ga0500583_0242794 | 3300053092 | Bacteria | 890 |
| 1507 | Ga0500641_0008479 | 3300053096 | Bacteria | 3670 |
| 1508 | Ga0500641_0292843 | 3300053096 | Bacteria | 671 |
| 1509 | Ga0500650_0011604 | 3300053098 | Bacteria | 3635 |
| 1510 | Ga0500654_199620 | 3300053099 | Unclassified | 605 |
| 1511 | Ga0500555_002160 | 3300053103 | Bacteria | 5763 |
| 1512 | Ga0500556_0016645 | 3300053104 | Bacteria | 2290 |
| 1513 | Ga0500562_032145 | 3300053108 | Unclassified | 1385 |
| 1514 | Ga0500594_0166233 | 3300053118 | Bacteria | 715 |
| 1515 | Ga0500621_129805 | 3300053126 | Bacteria | 967 |
| 1516 | Ga0500642_0006418 | 3300053130 | Bacteria | 3871 |
| 1517 | Ga0500642_0008766 | 3300053130 | Bacteria | 3478 |
| 1518 | Ga0500642_0176466 | 3300053130 | Bacteria | 999 |
| 1519 | Ga0500642_0291480 | 3300053130 | Bacteria | 739 |
| 1520 | Ga0500652_089437 | 3300053131 | Bacteria | 1285 |
| 1521 | Ga0500652_126792 | 3300053131 | Bacteria | 1066 |
| 1522 | Ga0500655_004076 | 3300053133 | Bacteria | 2631 |
| 1523 | Ga0500655_016378 | 3300053133 | Bacteria | 1365 |
| 1524 | Ga0500658_0092683 | 3300053134 | Bacteria | 1309 |
| 1525 | Ga0500559_0096701 | 3300053136 | Bacteria | 1357 |
| 1526 | Ga0500568_0033671 | 3300053139 | Unclassified | 2101 |
| 1527 | Ga0500568_0136927 | 3300053139 | Bacteria | 909 |
| 1528 | Ga0500573_0318135 | 3300053140 | Bacteria | 770 |
| 1529 | Ga0500588_0000576 | 3300053146 | Bacteria | 6002 |
| 1530 | Ga0500588_0011679 | 3300053146 | Bacteria | 2157 |
| 1531 | Ga0500589_051369 | 3300053147 | Bacteria | 1911 |
| 1532 | Ga0500589_149284 | 3300053147 | Bacteria | 953 |
| 1533 | Ga0500604_0004024 | 3300053151 | Bacteria | 3920 |
| 1534 | Ga0500604_0065920 | 3300053151 | Bacteria | 1146 |
| 1535 | Ga0500604_0066789 | 3300053151 | Bacteria | 1140 |
| 1536 | Ga0500616_0003349 | 3300053153 | Bacteria | 12329 |
| 1537 | Ga0500616_0187851 | 3300053153 | Bacteria | 925 |
| 1538 | Ga0500622_0020789 | 3300053156 | Unclassified | 3483 |
| 1539 | Ga0500622_0046969 | 3300053156 | Bacteria | 2230 |
| 1540 | Ga0500622_0398529 | 3300053156 | Unclassified | 559 |
| 1541 | Ga0500633_0240254 | 3300053160 | Bacteria | 674 |
| 1542 | Ga0500639_102242 | 3300053163 | Bacteria | 1408 |
| 1543 | Ga0500637_0042051 | 3300053178 | Bacteria | 2583 |
| 1544 | Ga0500637_0042775 | 3300053178 | Bacteria | 2562 |
| 1545 | Ga0500637_0199242 | 3300053178 | Bacteria | 1141 |
| 1546 | Ga0500611_000155 | 3300053727 | Bacteria | 10865 |
| 1547 | Ga0501084_0456261 | 3300054114 | Unclassified | 1080 |
| 1548 | Ga0587084_018264 | 3300059477 | Bacteria | 1021 |
| 1549 | Ga0587073_0065816 | 3300059492 | Unclassified | 863 |
| 1550 | Ga0587077_026657 | 3300059493 | Bacteria | 1069 |
| 1551 | Ga0587080_052881 | 3300059503 | Bacteria | 772 |
| 1552 | Ga0587080_058819 | 3300059503 | Bacteria | 744 |
| 1553 | Ga0587082_067543 | 3300059504 | Bacteria | 719 |
| 1554 | Ga0587083_0035801 | 3300059505 | Bacteria | 1014 |
| 1555 | Ga0587085_033012 | 3300059506 | Bacteria | 862 |
| 1556 | Ga0587086_033745 | 3300059507 | Bacteria | 765 |
| 1557 | Ga0587088_014397 | 3300059508 | Bacteria | 1231 |
| 1558 | Ga0587088_058532 | 3300059508 | Bacteria | 774 |
| 1559 | Ga0587088_059318 | 3300059508 | Unclassified | 771 |
| 1560 | Ga0587089_072571 | 3300059509 | Bacteria | 587 |
| 1561 | Ga0587090_018239 | 3300059510 | Bacteria | 1070 |
| 1562 | Ga0587090_105753 | 3300059510 | Bacteria | 594 |
| 1563 | Ga0587098_045543 | 3300059604 | Bacteria | 651 |
| 1564 | Ga0587106_081430 | 3300059605 | Bacteria | 631 |
| 1565 | Ga0587099_027090 | 3300059622 | Bacteria | 679 |
| 1566 | Ga0587101_009100 | 3300059623 | Bacteria | 1218 |
| 1567 | Ga0587109_048730 | 3300059624 | Bacteria | 862 |
| 1568 | Ga0587113_034899 | 3300059625 | Bacteria | 584 |
| 1569 | Ga0587128_049683 | 3300059630 | Bacteria | 762 |
| 1570 | Ga0587130_015633 | 3300059631 | Bacteria | 784 |
| 1571 | Ga0587062_008766 | 3300059639 | Bacteria | 1215 |
| 1572 | Ga0587067_029795 | 3300059640 | Bacteria | 999 |
| 1573 | Ga0587067_081838 | 3300059640 | Bacteria | 716 |
| 1574 | Ga0587076_010100 | 3300059645 | Bacteria | 1356 |
| 1575 | Ga0587100_020743 | 3300059648 | Bacteria | 640 |
| 1576 | Ga0587107_021210 | 3300059652 | Bacteria | 908 |
| 1577 | Ga0587107_083939 | 3300059652 | Bacteria | 604 |
| 1578 | Ga0587108_009588 | 3300059653 | Bacteria | 801 |
| 1579 | Ga0587114_088944 | 3300059655 | Bacteria | 586 |
| 1580 | Ga0587124_023954 | 3300059660 | Bacteria | 640 |
| 1581 | Ga0587111_0050904 | 3300060346 | Bacteria | 914 |
| 1582 | Ga0501082_0531371 | 3300060353 | Bacteria | 1028 |
| 1583 | 2819589768 | 2818991444 | Bacteria | 6968812 |
| 1584 | 2914763715 | 2914759650 | Bacteria | 4701441 |
| 1585 | Ga0070680_100041046 | |||
| 1586 | ARSoilOldRDRAFT_c002956 | |||
| 1587 | JGI24740J21852_10017260 | |||
| 1588 | JGI24743J22301_10043241 | |||
| 1589 | JGI24744J21845_10044495 | |||
| 1590 | JGI24751J29686_10083622 | |||
| 1591 | Ga0006758J48902_1010223 | |||
| 1592 | Ga0006770J48903_1024384 | |||
| 1593 | rootH1_10032312 | |||
| 1594 | rootH1_10183904 | |||
| 1595 | rootH2_10010709 | |||
| 1596 | rootH2_10012234 | |||
| 1597 | rootH2_10013030 | |||
| 1598 | rootH2_10140117 | |||
| 1599 | rootH2_10262330 | |||
| 1600 | rootH2_10299253 | |||
| 1601 | rootL2_10029799 | |||
| 1602 | rootL2_10068385 | |||
| 1603 | rootL2_10358562 | |||
| 1604 | rootH1_10012052 | |||
| 1605 | rootH1_10021882 | |||
| 1606 | rootH1_10077153 | |||
| 1607 | rootH1_10113418 | |||
| 1608 | rootH1_10205358 | |||
| 1609 | Ga0007429J51699_1027948 | |||
| 1610 | Ga0065714_10111103 | |||
| 1611 | Ga0065712_10095869 | |||
| 1612 | Ga0065715_10185105 | |||
| 1613 | Ga0065715_10330196 | |||
| 1614 | Ga0065715_10503462 | |||
| 1615 | Ga0065707_10133431 | |||
| 1616 | Ga0070658_10045494 | |||
| 1617 | Ga0070658_10056607 | |||
| 1618 | Ga0070658_10549210 | |||
| 1619 | Ga0070658_11005114 | |||
| 1620 | Ga0070676_10002621 | |||
| 1621 | Ga0070676_10004336 | |||
| 1622 | Ga0070676_10051756 | |||
| 1623 | Ga0070676_10085879 | |||
| 1624 | Ga0070676_10088645 | |||
| 1625 | Ga0070676_10124096 | |||
| 1626 | Ga0070676_10237666 | |||
| 1627 | Ga0070683_100001188 | |||
| 1628 | Ga0070683_100017900 | |||
| 1629 | Ga0070683_100042954 | |||
| 1630 | Ga0070683_100430377 | |||
| 1631 | Ga0070683_100622796 | |||
| 1632 | Ga0070690_100004203 | |||
| 1633 | Ga0070690_100078347 | |||
| 1634 | Ga0070690_100226398 | |||
| 1635 | Ga0070690_100579057 | |||
| 1636 | Ga0070690_100812064 | |||
| 1637 | Ga0070670_100004105 | |||
| 1638 | Ga0070670_100078263 | |||
| 1639 | Ga0070670_100089178 | |||
| 1640 | Ga0070670_100128773 | |||
| 1641 | Ga0070670_100139038 | |||
| 1642 | Ga0070670_100159745 | |||
| 1643 | Ga0070670_100170069 | |||
| 1644 | Ga0070670_100257504 | |||
| 1645 | Ga0070670_100284893 | |||
| 1646 | Ga0070670_100330777 | |||
| 1647 | Ga0070670_100746009 | |||
| 1648 | Ga0070670_100762962 | |||
| 1649 | Ga0070670_100950710 | |||
| 1650 | Ga0070670_101181105 | |||
| 1651 | Ga0070677_10073220 | |||
| 1652 | Ga0070677_10087130 | |||
| 1653 | Ga0070677_10237420 | |||
| 1654 | Ga0068869_100003261 | |||
| 1655 | Ga0068869_100005652 | |||
| 1656 | Ga0068869_100009654 | |||
| 1657 | Ga0068869_100011899 | |||
| 1658 | Ga0068869_100043566 | |||
| 1659 | Ga0068869_100054291 | |||
| 1660 | Ga0068869_100068795 | |||
| 1661 | Ga0068869_100073099 | |||
| 1662 | Ga0068869_100121653 | |||
| 1663 | Ga0070666_10000050 | |||
| 1664 | Ga0070666_10013296 | |||
| 1665 | Ga0070666_10075155 | |||
| 1666 | Ga0070666_10105517 | |||
| 1667 | Ga0070666_10126016 | |||
| 1668 | Ga0070666_10416283 | |||
| 1669 | Ga0070666_10504604 | |||
| 1670 | Ga0070666_10584328 | |||
| 1671 | Ga0070680_100066036 | |||
| 1672 | Ga0070680_100160066 | |||
| 1673 | Ga0070682_100000019 | |||
| 1674 | Ga0070682_100003137 | |||
| 1675 | Ga0070682_100004566 | |||
| 1676 | Ga0070682_100010606 | |||
| 1677 | Ga0070682_100098274 | |||
| 1678 | Ga0070682_100249292 | |||
| 1679 | Ga0068868_100001389 | |||
| 1680 | Ga0068868_100002193 | |||
| 1681 | Ga0068868_100020680 | |||
| 1682 | Ga0068868_100208769 | |||
| 1683 | Ga0068868_100528593 | |||
| 1684 | Ga0068868_101297443 | |||
| 1685 | Ga0068868_101524847 | |||
| 1686 | Ga0070660_100030338 | |||
| 1687 | Ga0070660_100095968 | |||
| 1688 | Ga0070660_100172150 | |||
| 1689 | Ga0070660_101057994 | |||
| 1690 | Ga0070689_100004250 | |||
| 1691 | Ga0070689_100010789 | |||
| 1692 | Ga0070689_100022658 | |||
| 1693 | Ga0070689_100114036 | |||
| 1694 | Ga0070689_100301205 | |||
| 1695 | Ga0070691_10041815 | |||
| 1696 | Ga0070691_10109066 | |||
| 1697 | Ga0070687_100117034 | |||
| 1698 | Ga0070687_100305408 | |||
| 1699 | Ga0070661_100000521 | |||
| 1700 | Ga0070661_100008647 | |||
| 1701 | Ga0070661_100020346 | |||
| 1702 | Ga0070661_100148133 | |||
| 1703 | Ga0070661_100583596 | |||
| 1704 | Ga0070668_100015362 | |||
| 1705 | Ga0070668_100092617 | |||
| 1706 | Ga0070668_100120610 | |||
| 1707 | Ga0070668_100276622 | |||
| 1708 | Ga0070668_100392605 | |||
| 1709 | Ga0070668_100494914 | |||
| 1710 | Ga0070668_101321528 | |||
| 1711 | Ga0070669_100007084 | |||
| 1712 | Ga0070669_100064076 | |||
| 1713 | Ga0070669_100228827 | |||
| 1714 | Ga0070669_100271156 | |||
| 1715 | Ga0070669_100682382 | |||
| 1716 | Ga0070669_100986643 | |||
| 1717 | Ga0070669_101494879 | |||
| 1718 | Ga0070675_100009761 | |||
| 1719 | Ga0070675_100053362 | |||
| 1720 | Ga0070675_100095781 | |||
| 1721 | Ga0070675_100451048 | |||
| 1722 | Ga0070675_100645777 | |||
| 1723 | Ga0070675_100653155 | |||
| 1724 | Ga0070675_100726638 | |||
| 1725 | Ga0070675_101036401 | |||
| 1726 | Ga0070671_100015427 | |||
| 1727 | Ga0070671_100038053 | |||
| 1728 | Ga0070671_100059111 | |||
| 1729 | Ga0070671_100072533 | |||
| 1730 | Ga0070671_100121636 | |||
| 1731 | Ga0070671_100215932 | |||
| 1732 | Ga0070674_100035222 | |||
| 1733 | Ga0070674_100115713 | |||
| 1734 | Ga0070674_100127185 | |||
| 1735 | Ga0070674_100146462 | |||
| 1736 | Ga0070674_100222072 | |||
| 1737 | Ga0070674_100223381 | |||
| 1738 | Ga0070673_100019908 | |||
| 1739 | Ga0070673_100043192 | |||
| 1740 | Ga0070673_100183060 | |||
| 1741 | Ga0070673_100188551 | |||
| 1742 | Ga0070673_100321768 | |||
| 1743 | Ga0070673_100454444 | |||
| 1744 | Ga0070673_100919470 | |||
| 1745 | Ga0070673_101122036 | |||
| 1746 | Ga0070688_100000950 | |||
| 1747 | Ga0070688_100221759 | |||
| 1748 | Ga0070688_100377262 | |||
| 1749 | Ga0070688_100386989 | |||
| 1750 | Ga0070688_100421083 | |||
| 1751 | Ga0070659_100006321 | |||
| 1752 | Ga0070659_100015108 | |||
| 1753 | Ga0070667_100000240 | |||
| 1754 | Ga0070667_100004077 | |||
| 1755 | Ga0070667_100019648 | |||
| 1756 | Ga0070667_100032749 | |||
| 1757 | Ga0070667_100060370 | |||
| 1758 | Ga0070667_100087983 | |||
| 1759 | Ga0070667_100105447 | |||
| 1760 | Ga0070667_100225565 | |||
| 1761 | Ga0070667_100443397 | |||
| 1762 | Ga0070667_100485482 | |||
| 1763 | Ga0070667_100534574 | |||
| 1764 | Ga0070667_100819055 | |||
| 1765 | Ga0070667_100903124 | |||
| 1766 | Ga0070701_10666900 | |||
| 1767 | Ga0070700_100647491 | |||
| 1768 | Ga0070700_100664238 | |||
| 1769 | Ga0070663_100545270 | |||
| 1770 | Ga0070663_100711789 | |||
| 1771 | Ga0070678_100026957 | |||
| 1772 | Ga0070678_100034684 | |||
| 1773 | Ga0070678_100194798 | |||
| 1774 | Ga0070678_100408415 | |||
| 1775 | Ga0070678_100545084 | |||
| 1776 | Ga0070678_100657857 | |||
| 1777 | Ga0070662_100011043 | |||
| 1778 | Ga0070662_100068957 | |||
| 1779 | Ga0070662_100084868 | |||
| 1780 | Ga0070662_100127760 | |||
| 1781 | Ga0070662_100297892 | |||
| 1782 | Ga0070681_10035416 | |||
| 1783 | Ga0070681_10040017 | |||
| 1784 | Ga0070681_10073049 | |||
| 1785 | Ga0070681_10241122 | |||
| 1786 | Ga0070681_10272292 | |||
| 1787 | Ga0070681_11250561 | |||
| 1788 | Ga0068867_100007586 | |||
| 1789 | Ga0068867_100027529 | |||
| 1790 | Ga0068867_100054642 | |||
| 1791 | Ga0068867_100124969 | |||
| 1792 | Ga0068867_100126218 | |||
| 1793 | Ga0068867_100256063 | |||
| 1794 | Ga0068867_100303354 | |||
| 1795 | Ga0068867_100313999 | |||
| 1796 | Ga0068867_100681821 | |||
| 1797 | Ga0068867_100692973 | |||
| 1798 | Ga0070685_10011927 | |||
| 1799 | Ga0070685_10043939 | |||
| 1800 | Ga0070685_10044583 | |||
| 1801 | Ga0070685_10252501 | |||
| 1802 | Ga0070698_100038199 | |||
| 1803 | Ga0070698_100646882 | |||
| 1804 | Ga0070679_100028954 | |||
| 1805 | Ga0070679_100402634 | |||
| 1806 | Ga0070684_100001055 | |||
| 1807 | Ga0070684_100009989 | |||
| 1808 | Ga0070684_100083885 | |||
| 1809 | Ga0070684_100405921 | |||
| 1810 | Ga0070684_101223109 | |||
| 1811 | Ga0068853_100000422 | |||
| 1812 | Ga0068853_100005510 | |||
| 1813 | Ga0068853_100009975 | |||
| 1814 | Ga0068853_100023984 | |||
| 1815 | Ga0068853_100026506 | |||
| 1816 | Ga0068853_100051580 | |||
| 1817 | Ga0068853_100099675 | |||
| 1818 | Ga0068853_100138689 | |||
| 1819 | Ga0068853_100155255 | |||
| 1820 | Ga0068853_100157921 | |||
| 1821 | Ga0068853_100384100 | |||
| 1822 | Ga0068853_100564309 | |||
| 1823 | Ga0068853_100804465 | |||
| 1824 | Ga0070672_100013181 | |||
| 1825 | Ga0070672_100017583 | |||
| 1826 | Ga0070672_100045111 | |||
| 1827 | Ga0070672_100048441 | |||
| 1828 | Ga0070672_100142908 | |||
| 1829 | Ga0070672_100413836 | |||
| 1830 | Ga0070672_100569190 | |||
| 1831 | Ga0070672_100694463 | |||
| 1832 | Ga0070672_101126248 | |||
| 1833 | Ga0070686_100095829 | |||
| 1834 | Ga0070686_100116717 | |||
| 1835 | Ga0070686_100300570 | |||
| 1836 | Ga0070686_100330065 | |||
| 1837 | Ga0070693_100050727 | |||
| 1838 | Ga0070693_100088450 | |||
| 1839 | Ga0070693_100218917 | |||
| 1840 | Ga0070665_100000014 | |||
| 1841 | Ga0070665_100010319 | |||
| 1842 | Ga0070665_100063719 | |||
| 1843 | Ga0070665_100350904 | |||
| 1844 | Ga0070665_100410831 | |||
| 1845 | Ga0070665_100840123 | |||
| 1846 | Ga0070665_100935316 | |||
| 1847 | Ga0070665_100967016 | |||
| 1848 | Ga0070704_100372062 | |||
| 1849 | Ga0068855_100000284 | |||
| 1850 | Ga0068855_100014854 | |||
| 1851 | Ga0068855_100022141 | |||
| 1852 | Ga0068855_100047133 | |||
| 1853 | Ga0068855_100071901 | |||
| 1854 | Ga0068855_100184999 | |||
| 1855 | Ga0068855_100281507 | |||
| 1856 | Ga0068855_100624529 | |||
| 1857 | Ga0068855_100933231 | |||
| 1858 | Ga0070664_100003640 | |||
| 1859 | Ga0070664_100134641 | |||
| 1860 | Ga0070664_100401548 | |||
| 1861 | Ga0070664_100521208 | |||
| 1862 | Ga0070664_101269385 | |||
| 1863 | Ga0068857_100000997 | |||
| 1864 | Ga0068857_100026116 | |||
| 1865 | Ga0068857_100039979 | |||
| 1866 | Ga0068857_100058363 | |||
| 1867 | Ga0068857_100077626 | |||
| 1868 | Ga0068857_100114646 | |||
| 1869 | Ga0068857_100833932 | |||
| 1870 | Ga0068857_100867978 | |||
| 1871 | Ga0068857_101634986 | |||
| 1872 | Ga0068854_100013099 | |||
| 1873 | Ga0068854_100013860 | |||
| 1874 | Ga0068854_100029069 | |||
| 1875 | Ga0068854_100093898 | |||
| 1876 | Ga0068854_100123458 | |||
| 1877 | Ga0068854_100124714 | |||
| 1878 | Ga0068854_100148615 | |||
| 1879 | Ga0068854_100435320 | |||
| 1880 | Ga0068854_100954495 | |||
| 1881 | Ga0068854_101256088 | |||
| 1882 | Ga0068854_101404214 | |||
| 1883 | Ga0068856_100004457 | |||
| 1884 | Ga0068856_100021107 | |||
| 1885 | Ga0068856_100158995 | |||
| 1886 | Ga0068856_100159602 | |||
| 1887 | Ga0068856_100441983 | |||
| 1888 | Ga0068856_100990977 | |||
| 1889 | Ga0070702_100626949 | |||
| 1890 | Ga0070702_101477493 | |||
| 1891 | Ga0068852_100004569 | |||
| 1892 | Ga0068852_100005952 | |||
| 1893 | Ga0068852_100023569 | |||
| 1894 | Ga0068852_100052562 | |||
| 1895 | Ga0068852_100095801 | |||
| 1896 | Ga0068852_100114031 | |||
| 1897 | Ga0068852_100167642 | |||
| 1898 | Ga0068852_100168318 | |||
| 1899 | Ga0068852_100229965 | |||
| 1900 | Ga0068852_100364853 | |||
| 1901 | Ga0068852_100377424 | |||
| 1902 | Ga0068852_100708269 | |||
| 1903 | Ga0068852_100713804 | |||
| 1904 | Ga0068852_100816887 | |||
| 1905 | Ga0068852_100848629 | |||
| 1906 | Ga0068852_100853406 | |||
| 1907 | Ga0068852_101052638 | |||
| 1908 | Ga0068859_100000025 | |||
| 1909 | Ga0068859_100011247 | |||
| 1910 | Ga0068859_100021012 | |||
| 1911 | Ga0068859_100037181 | |||
| 1912 | Ga0068859_100043053 | |||
| 1913 | Ga0068859_100097716 | |||
| 1914 | Ga0068859_100150915 | |||
| 1915 | Ga0068859_100167071 | |||
| 1916 | Ga0068859_100204155 | |||
| 1917 | Ga0068859_100231414 | |||
| 1918 | Ga0068859_100374398 | |||
| 1919 | Ga0068859_100395580 | |||
| 1920 | Ga0068859_100553384 | |||
| 1921 | Ga0068859_100767695 | |||
| 1922 | Ga0068859_101377470 | |||
| 1923 | Ga0068859_102445076 | |||
| 1924 | Ga0068864_100011190 | |||
| 1925 | Ga0068864_100027400 | |||
| 1926 | Ga0068864_100031001 | |||
| 1927 | Ga0068864_100196428 | |||
| 1928 | Ga0068864_100313562 | |||
| 1929 | Ga0068864_100343921 | |||
| 1930 | Ga0068864_100648386 | |||
| 1931 | Ga0068864_100993763 | |||
| 1932 | Ga0068864_101058369 | |||
| 1933 | Ga0068864_101113970 | |||
| 1934 | Ga0068866_10003836 | |||
| 1935 | Ga0068866_10010825 | |||
| 1936 | Ga0068866_10108214 | |||
| 1937 | Ga0068866_10156800 | |||
| 1938 | Ga0068861_100006242 | |||
| 1939 | Ga0068861_100012159 | |||
| 1940 | Ga0068861_100135032 | |||
| 1941 | Ga0068861_100266649 | |||
| 1942 | Ga0068861_100432091 | |||
| 1943 | Ga0068851_10007997 | |||
| 1944 | Ga0068851_10033795 | |||
| 1945 | Ga0068851_10115544 | |||
| 1946 | Ga0068870_10002683 | |||
| 1947 | Ga0068870_10015498 | |||
| 1948 | Ga0068870_10036736 | |||
| 1949 | Ga0068870_10085287 | |||
| 1950 | Ga0068863_100002841 | |||
| 1951 | Ga0068863_100009555 | |||
| 1952 | Ga0068863_100015478 | |||
| 1953 | Ga0068863_100022990 | |||
| 1954 | Ga0068863_100211538 | |||
| 1955 | Ga0068863_100391394 | |||
| 1956 | Ga0068863_100429059 | |||
| 1957 | Ga0068863_100462989 | |||
| 1958 | Ga0068863_101025571 | |||
| 1959 | Ga0068858_100042829 | |||
| 1960 | Ga0068858_100045256 | |||
| 1961 | Ga0068858_100099117 | |||
| 1962 | Ga0068858_100311113 | |||
| 1963 | Ga0068858_100323117 | |||
| 1964 | Ga0068858_100370212 | |||
| 1965 | Ga0068858_100438336 | |||
| 1966 | Ga0068858_100654865 | |||
| 1967 | Ga0068858_100698461 | |||
| 1968 | Ga0068858_101146589 | |||
| 1969 | Ga0068860_100000061 | |||
| 1970 | Ga0068860_100003010 | |||
| 1971 | Ga0068860_100019031 | |||
| 1972 | Ga0068860_100114924 | |||
| 1973 | Ga0068860_100153923 | |||
| 1974 | Ga0068860_100160687 | |||
| 1975 | Ga0068860_100205908 | |||
| 1976 | Ga0068860_100302078 | |||
| 1977 | Ga0068860_100332627 | |||
| 1978 | Ga0068860_100352433 | |||
| 1979 | Ga0068860_100405663 | |||
| 1980 | Ga0068860_100434216 | |||
| 1981 | Ga0068860_100519053 | |||
| 1982 | Ga0068860_100622361 | |||
| 1983 | Ga0068860_100656102 | |||
| 1984 | Ga0068860_100659135 | |||
| 1985 | Ga0068860_100950695 | |||
| 1986 | Ga0068860_101308498 | |||
| 1987 | Ga0068860_101793729 | |||
| 1988 | Ga0068860_101973380 | |||
| 1989 | Ga0068862_100023190 | |||
| 1990 | Ga0068862_100029075 | |||
| 1991 | Ga0068862_100250636 | |||
| 1992 | Ga0068862_100252716 | |||
| 1993 | Ga0068862_100313195 | |||
| 1994 | Ga0068862_100728059 | |||
| 1995 | Ga0068862_101005248 | |||
| 1996 | Ga0068862_101229978 | |||
| 1997 | Ga0081540_1024808 | |||
| 1998 | Ga0075364_10439631 | |||
| 1999 | Ga0070715_10010886 | |||
| 2000 | Ga0075366_10002847 | |||
| 2001 | Ga0075366_10018639 | |||
| 2002 | Ga0075366_10021764 | |||
| 2003 | Ga0075366_10067537 | |||
| 2004 | Ga0075366_10103210 | |||
| 2005 | Ga0075366_10302664 | |||
| 2006 | Ga0075366_10519459 | |||
| 2007 | Ga0097621_100000465 | |||
| 2008 | Ga0097621_100007122 | |||
| 2009 | Ga0097621_100011137 | |||
| 2010 | Ga0097621_100022862 | |||
| 2011 | Ga0097621_100048247 | |||
| 2012 | Ga0097621_100055128 | |||
| 2013 | Ga0097621_100100770 | |||
| 2014 | Ga0097621_100113847 | |||
| 2015 | Ga0097621_100147290 | |||
| 2016 | Ga0097621_100160720 | |||
| 2017 | Ga0097621_100204450 | |||
| 2018 | Ga0097621_100478577 | |||
| 2019 | Ga0097621_100724406 | |||
| 2020 | Ga0097621_101049945 | |||
| 2021 | Ga0097621_101202598 | |||
| 2022 | Ga0097621_101379502 | |||
| 2023 | Ga0097621_101555984 | |||
| 2024 | Ga0068871_100001644 | |||
| 2025 | Ga0068871_100008210 | |||
| 2026 | Ga0068871_100017469 | |||
| 2027 | Ga0068871_100023517 | |||
| 2028 | Ga0068871_100047473 | |||
| 2029 | Ga0068871_100068734 | |||
| 2030 | Ga0068871_100128755 | |||
| 2031 | Ga0068871_100187840 | |||
| 2032 | Ga0068871_100284107 | |||
| 2033 | Ga0068871_100312350 | |||
| 2034 | Ga0068871_100611021 | |||
| 2035 | Ga0068871_100613802 | |||
| 2036 | Ga0068871_100815909 | |||
| 2037 | Ga0068871_100820835 | |||
| 2038 | Ga0068871_101009170 | |||
| 2039 | Ga0075434_100084958 | |||
| 2040 | Ga0068865_100007033 | |||
| 2041 | Ga0068865_100027470 | |||
| 2042 | Ga0068865_100037175 | |||
| 2043 | Ga0068865_100041865 | |||
| 2044 | Ga0068865_100343549 | |||
| 2045 | Ga0068865_100440478 | |||
| 2046 | Ga0068865_100478164 | |||
| 2047 | Ga0068865_100663977 | |||
| 2048 | Ga0068865_100802134 | |||
| 2049 | Ga0068865_100866263 | |||
| 2050 | Ga0068865_100986991 | |||
| 2051 | Ga0097620_100000025 | |||
| 2052 | Ga0097620_100011247 | |||
| 2053 | Ga0097620_100021012 | |||
| 2054 | Ga0097620_100037181 | |||
| 2055 | Ga0097620_100043054 | |||
| 2056 | Ga0097620_100097715 | |||
| 2057 | Ga0097620_100150911 | |||
| 2058 | Ga0097620_100167075 | |||
| 2059 | Ga0097620_100204141 | |||
| 2060 | Ga0097620_100231415 | |||
| 2061 | Ga0097620_100374422 | |||
| 2062 | Ga0097620_100395586 | |||
| 2063 | Ga0097620_100553401 | |||
| 2064 | Ga0097620_100767715 | |||
| 2065 | Ga0097620_101377436 | |||
| 2066 | Ga0097620_102445847 | |||
| 2067 | Ga0075435_100911868 | |||
| 2068 | Ga0099795_10197078 | |||
| 2069 | Ga0105251_10121983 | |||
| 2070 | Ga0105251_10488448 | |||
| 2071 | Ga0105240_10000198 | |||
| 2072 | Ga0105240_10015994 | |||
| 2073 | Ga0105240_10027122 | |||
| 2074 | Ga0105240_10034622 | |||
| 2075 | Ga0105240_10046395 | |||
| 2076 | Ga0105240_10049957 | |||
| 2077 | Ga0105240_10098017 | |||
| 2078 | Ga0105240_10114329 | |||
| 2079 | Ga0105240_10154049 | |||
| 2080 | Ga0105240_10344372 | |||
| 2081 | Ga0105240_10514428 | |||
| 2082 | Ga0105240_10514890 | |||
| 2083 | Ga0111539_10001644 | |||
| 2084 | Ga0111539_10444323 | |||
| 2085 | Ga0111539_10824223 | |||
| 2086 | Ga0105245_10349519 | |||
| 2087 | Ga0105247_10002225 | |||
| 2088 | Ga0105247_10005450 | |||
| 2089 | Ga0105247_10050542 | |||
| 2090 | Ga0105247_10059813 | |||
| 2091 | Ga0105247_10290865 | |||
| 2092 | Ga0105247_10727643 | |||
| 2093 | Ga0114129_10072767 | |||
| 2094 | Ga0105243_10452829 | |||
| 2095 | Ga0105243_10667404 | |||
| 2096 | Ga0105243_11120059 | |||
| 2097 | Ga0105241_10002300 | |||
| 2098 | Ga0105241_10006585 | |||
| 2099 | Ga0105241_10006947 | |||
| 2100 | Ga0105241_10083775 | |||
| 2101 | Ga0105241_10302383 | |||
| 2102 | Ga0105241_10427724 | |||
| 2103 | Ga0105241_10488066 | |||
| 2104 | Ga0105241_10731076 | |||
| 2105 | Ga0105241_11040507 | |||
| 2106 | Ga0105241_11413056 | |||
| 2107 | Ga0105242_10032792 | |||
| 2108 | Ga0105242_10082475 | |||
| 2109 | Ga0105242_10224094 | |||
| 2110 | Ga0105242_10503567 | |||
| 2111 | Ga0105242_10836365 | |||
| 2112 | Ga0105242_10850890 | |||
| 2113 | Ga0105242_10883030 | |||
| 2114 | Ga0105242_11136377 | |||
| 2115 | Ga0105242_11759863 | |||
| 2116 | Ga0105248_10027947 | |||
| 2117 | Ga0105248_10060553 | |||
| 2118 | Ga0105248_10591575 | |||
| 2119 | Ga0105248_10811422 | |||
| 2120 | Ga0105248_11124136 | |||
| 2121 | Ga0105237_10000409 | |||
| 2122 | Ga0105237_10000577 | |||
| 2123 | Ga0105237_10005234 | |||
| 2124 | Ga0105237_10005617 | |||
| 2125 | Ga0105237_10006807 | |||
| 2126 | Ga0105237_10009021 | |||
| 2127 | Ga0105237_10010186 | |||
| 2128 | Ga0105237_10010415 | |||
| 2129 | Ga0105237_10120174 | |||
| 2130 | Ga0105237_10129325 | |||
| 2131 | Ga0105237_10483019 | |||
| 2132 | Ga0105237_10809517 | |||
| 2133 | Ga0105237_10969481 | |||
| 2134 | Ga0105237_11173636 | |||
| 2135 | Ga0105237_11818588 | |||
| 2136 | Ga0105238_10007301 | |||
| 2137 | Ga0105238_10084102 | |||
| 2138 | Ga0105238_10098761 | |||
| 2139 | Ga0105238_10170233 | |||
| 2140 | Ga0105249_10020448 | |||
| 2141 | Ga0105249_10021479 | |||
| 2142 | Ga0105249_10032930 | |||
| 2143 | Ga0105249_10049926 | |||
| 2144 | Ga0105249_10110043 | |||
| 2145 | Ga0105249_10112374 | |||
| 2146 | Ga0105249_10121976 | |||
| 2147 | Ga0105249_10169249 | |||
| 2148 | Ga0105249_10176424 | |||
| 2149 | Ga0105249_10181883 | |||
| 2150 | Ga0105249_10383106 | |||
| 2151 | Ga0105249_10608287 | |||
| 2152 | Ga0105249_11227097 | |||
| 2153 | Ga0105249_12666249 | |||
| 2154 | Ga0105239_10000019 | |||
| 2155 | Ga0105239_10000343 | |||
| 2156 | Ga0105239_10000659 | |||
| 2157 | Ga0105239_10001227 | |||
| 2158 | Ga0105239_10005439 | |||
| 2159 | Ga0105239_10014750 | |||
| 2160 | Ga0105239_10041485 | |||
| 2161 | Ga0105239_10053665 | |||
| 2162 | Ga0105239_10093829 | |||
| 2163 | Ga0105239_10120279 | |||
| 2164 | Ga0105239_10191856 | |||
| 2165 | Ga0105239_10253293 | |||
| 2166 | Ga0105239_10265527 | |||
| 2167 | Ga0105239_10305490 | |||
| 2168 | Ga0105239_10560199 | |||
| 2169 | Ga0105239_10599380 | |||
| 2170 | Ga0105239_11129094 | |||
| 2171 | Ga0105246_10032151 | |||
| 2172 | Ga0105246_10084639 | |||
| 2173 | Ga0105246_10127719 | |||
| 2174 | Ga0105246_10130463 | |||
| 2175 | Ga0105246_10329089 | |||
| 2176 | Ga0105246_10512057 | |||
| 2177 | Ga0157373_10007794 | |||
| 2178 | Ga0157373_10008801 | |||
| 2179 | Ga0157373_10011698 | |||
| 2180 | Ga0157373_10483018 | |||
| 2181 | Ga0157371_10029953 | |||
| 2182 | Ga0157371_10357213 | |||
| 2183 | Ga0157370_10002115 | |||
| 2184 | Ga0157370_10010926 | |||
| 2185 | Ga0157370_10012060 | |||
| 2186 | Ga0157370_10100635 | |||
| 2187 | Ga0157370_10307518 | |||
| 2188 | Ga0157370_10757721 | |||
| 2189 | Ga0157370_11023994 | |||
| 2190 | Ga0157370_11267000 | |||
| 2191 | Ga0157369_10008539 | |||
| 2192 | Ga0157369_10023988 | |||
| 2193 | Ga0157369_10044786 | |||
| 2194 | Ga0157369_10311980 | |||
| 2195 | Ga0157369_10980657 | |||
| 2196 | Ga0157369_11156009 | |||
| 2197 | Ga0157374_10000011 | |||
| 2198 | Ga0157374_10003749 | |||
| 2199 | Ga0157374_10004107 | |||
| 2200 | Ga0157374_10004768 | |||
| 2201 | Ga0157374_10012057 | |||
| 2202 | Ga0157374_10025377 | |||
| 2203 | Ga0157374_10028328 | |||
| 2204 | Ga0157374_10036793 | |||
| 2205 | Ga0157374_10046057 | |||
| 2206 | Ga0157374_10080774 | |||
| 2207 | Ga0157374_10107499 | |||
| 2208 | Ga0157374_10169500 | |||
| 2209 | Ga0157374_10833283 | |||
| 2210 | Ga0157374_10929497 | |||
| 2211 | Ga0157374_10962872 | |||
| 2212 | Ga0157374_11113769 | |||
| 2213 | Ga0157378_10002905 | |||
| 2214 | Ga0157378_10012666 | |||
| 2215 | Ga0157378_10035819 | |||
| 2216 | Ga0157378_10044839 | |||
| 2217 | Ga0157378_10089113 | |||
| 2218 | Ga0157378_10095139 | |||
| 2219 | Ga0157378_10120123 | |||
| 2220 | Ga0157378_10139797 | |||
| 2221 | Ga0157378_10189621 | |||
| 2222 | Ga0157378_10209824 | |||
| 2223 | Ga0157378_10220287 | |||
| 2224 | Ga0157378_10223040 | |||
| 2225 | Ga0157378_10225657 | |||
| 2226 | Ga0157378_10275097 | |||
| 2227 | Ga0157378_10789674 | |||
| 2228 | Ga0163162_10000151 | |||
| 2229 | Ga0163162_10000344 | |||
| 2230 | Ga0163162_10000782 | |||
| 2231 | Ga0163162_10000827 | |||
| 2232 | Ga0163162_10002957 | |||
| 2233 | Ga0163162_10010911 | |||
| 2234 | Ga0163162_10014906 | |||
| 2235 | Ga0163162_10021159 | |||
| 2236 | Ga0163162_10068998 | |||
| 2237 | Ga0163162_10089929 | |||
| 2238 | Ga0163162_10136540 | |||
| 2239 | Ga0163162_10251118 | |||
| 2240 | Ga0163162_10263138 | |||
| 2241 | Ga0163162_10575924 | |||
| 2242 | Ga0163162_10796723 | |||
| 2243 | Ga0163162_10852866 | |||
| 2244 | Ga0163162_11086642 | |||
| 2245 | Ga0163162_11122652 | |||
| 2246 | Ga0163162_11122755 | |||
| 2247 | Ga0163162_11584769 | |||
| 2248 | Ga0163162_11584770 | |||
| 2249 | Ga0163162_12417306 | |||
| 2250 | Ga0157372_10003342 | |||
| 2251 | Ga0157372_10050769 | |||
| 2252 | Ga0157372_10056150 | |||
| 2253 | Ga0157372_10098575 | |||
| 2254 | Ga0157372_10127461 | |||
| 2255 | Ga0157372_10216330 | |||
| 2256 | Ga0157372_10220399 | |||
| 2257 | Ga0157372_10715884 | |||
| 2258 | Ga0157372_10847590 | |||
| 2259 | Ga0157372_11669407 | |||
| 2260 | Ga0157375_10000911 | |||
| 2261 | Ga0157375_10003934 | |||
| 2262 | Ga0157375_10052035 | |||
| 2263 | Ga0157375_10060880 | |||
| 2264 | Ga0157375_10103328 | |||
| 2265 | Ga0157375_10137861 | |||
| 2266 | Ga0157375_10202726 | |||
| 2267 | Ga0157375_10251467 | |||
| 2268 | Ga0157375_10257424 | |||
| 2269 | Ga0157375_10390622 | |||
| 2270 | Ga0157375_10875850 | |||
| 2271 | Ga0157375_11423458 | |||
| 2272 | Ga0157375_13006033 | |||
| 2273 | Ga0163163_10000215 | |||
| 2274 | Ga0163163_10007541 | |||
| 2275 | Ga0163163_10011287 | |||
| 2276 | Ga0163163_10090713 | |||
| 2277 | Ga0163163_10147060 | |||
| 2278 | Ga0163163_10189538 | |||
| 2279 | Ga0163163_10226380 | |||
| 2280 | Ga0163163_10259849 | |||
| 2281 | Ga0163163_10314707 | |||
| 2282 | Ga0163163_10336472 | |||
| 2283 | Ga0163163_10809863 | |||
| 2284 | Ga0163163_10951994 | |||
| 2285 | Ga0163163_10955758 | |||
| 2286 | Ga0163163_11219158 | |||
| 2287 | Ga0163163_11298999 | |||
| 2288 | Ga0157380_10004165 | |||
| 2289 | Ga0157380_10015686 | |||
| 2290 | Ga0157380_10057056 | |||
| 2291 | Ga0157380_10253140 | |||
| 2292 | Ga0157380_10276805 | |||
| 2293 | Ga0157380_10296999 | |||
| 2294 | Ga0157380_10451809 | |||
| 2295 | Ga0157380_10863772 | |||
| 2296 | Ga0157380_11101733 | |||
| 2297 | Ga0157380_11466641 | |||
| 2298 | Ga0157377_10005894 | |||
| 2299 | Ga0157377_10091088 | |||
| 2300 | Ga0157377_10104700 | |||
| 2301 | Ga0157377_10207421 | |||
| 2302 | Ga0157377_10261232 | |||
| 2303 | Ga0157377_10714477 | |||
| 2304 | Ga0157379_10001465 | |||
| 2305 | Ga0157379_10025037 | |||
| 2306 | Ga0157379_10085296 | |||
| 2307 | Ga0157379_10132218 | |||
| 2308 | Ga0157379_10147775 | |||
| 2309 | Ga0157379_10154542 | |||
| 2310 | Ga0157379_10184606 | |||
| 2311 | Ga0157379_10226909 | |||
| 2312 | Ga0157379_10252836 | |||
| 2313 | Ga0157379_10380509 | |||
| 2314 | Ga0157379_10418814 | |||
| 2315 | Ga0157379_10814892 | |||
| 2316 | Ga0157376_10003091 | |||
| 2317 | Ga0157376_10003806 | |||
| 2318 | Ga0157376_10009971 | |||
| 2319 | Ga0157376_10033522 | |||
| 2320 | Ga0157376_10037872 | |||
| 2321 | Ga0157376_10050256 | |||
| 2322 | Ga0157376_10103479 | |||
| 2323 | Ga0157376_10183788 | |||
| 2324 | Ga0157376_10211903 | |||
| 2325 | Ga0157376_10537169 | |||
| 2326 | Ga0157376_10676587 | |||
| 2327 | Ga0157376_11363165 | |||
| 2328 | Ga0157376_11844482 | |||
| 2329 | Ga0163161_10006068 | |||
| 2330 | Ga0163161_10015639 | |||
| 2331 | Ga0163161_10017879 | |||
| 2332 | Ga0163161_10022905 | |||
| 2333 | Ga0163161_10034766 | |||
| 2334 | Ga0163161_10063649 | |||
| 2335 | Ga0163161_10190044 | |||
| 2336 | Ga0163161_10192794 | |||
| 2337 | Ga0163161_10227210 | |||
| 2338 | Ga0163161_10386491 | |||
| 2339 | Ga0163161_10487437 | |||
| 2340 | Ga0163161_10605179 | |||
| 2341 | Ga0197907_10995076 | |||
| 2342 | Ga0197907_11045296 | |||
| 2343 | Ga0197907_11115152 | |||
| 2344 | Ga0206356_10869258 | |||
| 2345 | Ga0206356_11038156 | |||
| 2346 | Ga0206356_11208083 | |||
| 2347 | Ga0206356_11287791 | |||
| 2348 | Ga0206356_11576714 | |||
| 2349 | Ga0206356_11620720 | |||
| 2350 | Ga0206349_1234662 | |||
| 2351 | Ga0206349_1272832 | |||
| 2352 | Ga0206349_1793318 | |||
| 2353 | Ga0206355_1288808 | |||
| 2354 | Ga0206355_1701830 | |||
| 2355 | Ga0206351_10840370 | |||
| 2356 | Ga0206351_10857268 | |||
| 2357 | Ga0206352_10259686 | |||
| 2358 | Ga0206352_10359923 | |||
| 2359 | Ga0206352_10615519 | |||
| 2360 | Ga0206352_10977901 | |||
| 2361 | Ga0206352_11013407 | |||
| 2362 | Ga0206352_11155741 | |||
| 2363 | Ga0206350_10482065 | |||
| 2364 | Ga0206350_10497323 | |||
| 2365 | Ga0206350_10802927 | |||
| 2366 | Ga0206350_11247711 | |||
| 2367 | Ga0206350_11629336 | |||
| 2368 | Ga0206354_10457372 | |||
| 2369 | Ga0206354_10909307 | |||
| 2370 | Ga0206354_11042613 | |||
| 2371 | Ga0206353_11122960 | |||
| 2372 | Ga0206353_12050348 | |||
| 2373 | Ga0154015_1552988 | |||
| 2374 | Ga0213876_10005782 | |||
| 2375 | Ga0224712_10040477 | |||
| 2376 | Ga0224712_10117179 | |||
| 2377 | Ga0209646_1002933 | |||
| 2378 | Ga0207673_1038215 | |||
| 2379 | Ga0207697_10105069 | |||
| 2380 | Ga0207656_10012744 | |||
| 2381 | Ga0207656_10130031 | |||
| 2382 | Ga0207656_10144775 | |||
| 2383 | Ga0207656_10285700 | |||
| 2384 | Ga0207713_1098921 | |||
| 2385 | Ga0207682_10057890 | |||
| 2386 | Ga0207682_10062397 | |||
| 2387 | Ga0207682_10078561 | |||
| 2388 | Ga0207642_10093236 | |||
| 2389 | Ga0207642_10321094 | |||
| 2390 | Ga0207642_10391464 | |||
| 2391 | Ga0207642_10730793 | |||
| 2392 | Ga0207710_10010275 | |||
| 2393 | Ga0207710_10204929 | |||
| 2394 | Ga0207688_10052388 | |||
| 2395 | Ga0207680_10000032 | |||
| 2396 | Ga0207680_10001858 | |||
| 2397 | Ga0207680_10065662 | |||
| 2398 | Ga0207680_10173601 | |||
| 2399 | Ga0207680_10270317 | |||
| 2400 | Ga0207680_10695424 | |||
| 2401 | Ga0207680_10770023 | |||
| 2402 | Ga0207647_10008403 | |||
| 2403 | Ga0207647_10015067 | |||
| 2404 | Ga0207647_10020104 | |||
| 2405 | Ga0207647_10084937 | |||
| 2406 | Ga0207647_10499755 | |||
| 2407 | Ga0207645_10001037 | |||
| 2408 | Ga0207645_10015523 | |||
| 2409 | Ga0207645_10017482 | |||
| 2410 | Ga0207645_10020806 | |||
| 2411 | Ga0207645_10047256 | |||
| 2412 | Ga0207645_10051420 | |||
| 2413 | Ga0207645_10136914 | |||
| 2414 | Ga0207643_10032899 | |||
| 2415 | Ga0207643_10037977 | |||
| 2416 | Ga0207643_10061490 | |||
| 2417 | Ga0207643_10241248 | |||
| 2418 | Ga0207705_10018695 | |||
| 2419 | Ga0207705_10081762 | |||
| 2420 | Ga0207705_10084378 | |||
| 2421 | Ga0207654_10003193 | |||
| 2422 | Ga0207654_10011353 | |||
| 2423 | Ga0207654_10051196 | |||
| 2424 | Ga0207654_10298556 | |||
| 2425 | Ga0207654_10339453 | |||
| 2426 | Ga0207707_10012036 | |||
| 2427 | Ga0207707_10049929 | |||
| 2428 | Ga0207707_10176805 | |||
| 2429 | Ga0207695_10000212 | |||
| 2430 | Ga0207695_10000346 | |||
| 2431 | Ga0207695_10001638 | |||
| 2432 | Ga0207695_10050880 | |||
| 2433 | Ga0207695_10054308 | |||
| 2434 | Ga0207695_10062575 | |||
| 2435 | Ga0207695_10079628 | |||
| 2436 | Ga0207695_10996822 | |||
| 2437 | Ga0207671_10000402 | |||
| 2438 | Ga0207671_10001317 | |||
| 2439 | Ga0207671_10002977 | |||
| 2440 | Ga0207671_10013351 | |||
| 2441 | Ga0207671_10013961 | |||
| 2442 | Ga0207671_10071447 | |||
| 2443 | Ga0207671_10093965 | |||
| 2444 | Ga0207671_10115538 | |||
| 2445 | Ga0207671_10226165 | |||
| 2446 | Ga0207671_10713587 | |||
| 2447 | Ga0207671_10896111 | |||
| 2448 | Ga0207660_10084322 | |||
| 2449 | Ga0207660_10129589 | |||
| 2450 | Ga0207662_10107448 | |||
| 2451 | Ga0207662_10143487 | |||
| 2452 | Ga0207662_10252308 | |||
| 2453 | Ga0207657_10004720 | |||
| 2454 | Ga0207657_10353903 | |||
| 2455 | Ga0207657_10363098 | |||
| 2456 | Ga0207649_10001499 | |||
| 2457 | Ga0207649_10054800 | |||
| 2458 | Ga0207649_10112777 | |||
| 2459 | Ga0207649_10524291 | |||
| 2460 | Ga0207649_10810143 | |||
| 2461 | Ga0207649_11281419 | |||
| 2462 | Ga0207652_10292723 | |||
| 2463 | Ga0207681_10069963 | |||
| 2464 | Ga0207681_10090697 | |||
| 2465 | Ga0207681_10248616 | |||
| 2466 | Ga0207681_10299388 | |||
| 2467 | Ga0207681_10804460 | |||
| 2468 | Ga0207681_11121260 | |||
| 2469 | Ga0207681_11228748 | |||
| 2470 | Ga0207694_10006626 | |||
| 2471 | Ga0207694_10180164 | |||
| 2472 | Ga0207694_10307992 | |||
| 2473 | Ga0207694_10517761 | |||
| 2474 | Ga0207650_10018439 | |||
| 2475 | Ga0207650_10064928 | |||
| 2476 | Ga0207650_10088885 | |||
| 2477 | Ga0207650_10136667 | |||
| 2478 | Ga0207650_10182983 | |||
| 2479 | Ga0207650_10193656 | |||
| 2480 | Ga0207650_10212060 | |||
| 2481 | Ga0207650_10247907 | |||
| 2482 | Ga0207650_10314320 | |||
| 2483 | Ga0207650_10621260 | |||
| 2484 | Ga0207650_11455151 | |||
| 2485 | Ga0207659_10005427 | |||
| 2486 | Ga0207659_10022872 | |||
| 2487 | Ga0207659_10064313 | |||
| 2488 | Ga0207659_10131521 | |||
| 2489 | Ga0207659_10141105 | |||
| 2490 | Ga0207659_10633080 | |||
| 2491 | Ga0207659_10750568 | |||
| 2492 | Ga0207659_10986683 | |||
| 2493 | Ga0207644_10011068 | |||
| 2494 | Ga0207644_10049616 | |||
| 2495 | Ga0207644_10056362 | |||
| 2496 | Ga0207644_10058563 | |||
| 2497 | Ga0207644_10253986 | |||
| 2498 | Ga0207644_10413004 | |||
| 2499 | Ga0207644_10657001 | |||
| 2500 | Ga0207690_10081996 | |||
| 2501 | Ga0207690_10359899 | |||
| 2502 | Ga0207706_10019629 | |||
| 2503 | Ga0207706_10024662 | |||
| 2504 | Ga0207706_10032960 | |||
| 2505 | Ga0207706_10051313 | |||
| 2506 | Ga0207706_10052481 | |||
| 2507 | Ga0207706_10058898 | |||
| 2508 | Ga0207706_10189648 | |||
| 2509 | Ga0207686_10047655 | |||
| 2510 | Ga0207686_10110306 | |||
| 2511 | Ga0207686_10247829 | |||
| 2512 | Ga0207686_10976831 | |||
| 2513 | Ga0207709_10404473 | |||
| 2514 | Ga0207670_10002959 | |||
| 2515 | Ga0207670_10060183 | |||
| 2516 | Ga0207670_10344085 | |||
| 2517 | Ga0207669_10100583 | |||
| 2518 | Ga0207669_10124225 | |||
| 2519 | Ga0207669_10204591 | |||
| 2520 | Ga0207669_10366340 | |||
| 2521 | Ga0207669_10477447 | |||
| 2522 | Ga0207704_10017234 | |||
| 2523 | Ga0207704_10052814 | |||
| 2524 | Ga0207704_10104999 | |||
| 2525 | Ga0207704_10105173 | |||
| 2526 | Ga0207704_10163266 | |||
| 2527 | Ga0207704_10329125 | |||
| 2528 | Ga0207704_10354290 | |||
| 2529 | Ga0207704_10374328 | |||
| 2530 | Ga0207704_10834726 | |||
| 2531 | Ga0207691_10000076 | |||
| 2532 | Ga0207691_10050794 | |||
| 2533 | Ga0207691_10054463 | |||
| 2534 | Ga0207691_10058866 | |||
| 2535 | Ga0207691_10065911 | |||
| 2536 | Ga0207691_10083028 | |||
| 2537 | Ga0207691_10233946 | |||
| 2538 | Ga0207691_10282896 | |||
| 2539 | Ga0207691_10392539 | |||
| 2540 | Ga0207691_10593283 | |||
| 2541 | Ga0207691_10951916 | |||
| 2542 | Ga0207711_10047631 | |||
| 2543 | Ga0207711_10335400 | |||
| 2544 | Ga0207711_10649584 | |||
| 2545 | Ga0207711_11107212 | |||
| 2546 | Ga0207689_10001853 | |||
| 2547 | Ga0207689_10002225 | |||
| 2548 | Ga0207689_10003970 | |||
| 2549 | Ga0207689_10009828 | |||
| 2550 | Ga0207689_10013487 | |||
| 2551 | Ga0207689_10016179 | |||
| 2552 | Ga0207689_10030548 | |||
| 2553 | Ga0207689_10065690 | |||
| 2554 | Ga0207689_10082022 | |||
| 2555 | Ga0207689_10083732 | |||
| 2556 | Ga0207689_10092853 | |||
| 2557 | Ga0207689_10095473 | |||
| 2558 | Ga0207689_10114825 | |||
| 2559 | Ga0207689_10318562 | |||
| 2560 | Ga0207661_10007676 | |||
| 2561 | Ga0207661_10074126 | |||
| 2562 | Ga0207661_10134065 | |||
| 2563 | Ga0207661_10204533 | |||
| 2564 | Ga0207661_10435425 | |||
| 2565 | Ga0207679_10000159 | |||
| 2566 | Ga0207679_10011961 | |||
| 2567 | Ga0207679_10091755 | |||
| 2568 | Ga0207679_10439790 | |||
| 2569 | Ga0207679_10488798 | |||
| 2570 | Ga0207679_10775443 | |||
| 2571 | Ga0207679_11071114 | |||
| 2572 | Ga0207667_10000414 | |||
| 2573 | Ga0207667_10006159 | |||
| 2574 | Ga0207667_10006640 | |||
| 2575 | Ga0207667_10018745 | |||
| 2576 | Ga0207667_10043492 | |||
| 2577 | Ga0207667_10179079 | |||
| 2578 | Ga0207667_10456143 | |||
| 2579 | Ga0207667_10953695 | |||
| 2580 | Ga0207651_10006374 | |||
| 2581 | Ga0207651_10067155 | |||
| 2582 | Ga0207651_10084255 | |||
| 2583 | Ga0207651_10084359 | |||
| 2584 | Ga0207651_10155585 | |||
| 2585 | Ga0207651_10245204 | |||
| 2586 | Ga0207651_10317385 | |||
| 2587 | Ga0207651_10323206 | |||
| 2588 | Ga0207651_10473966 | |||
| 2589 | Ga0207651_11013462 | |||
| 2590 | Ga0207712_10010020 | |||
| 2591 | Ga0207712_10066018 | |||
| 2592 | Ga0207712_10080961 | |||
| 2593 | Ga0207712_10119385 | |||
| 2594 | Ga0207712_10169635 | |||
| 2595 | Ga0207712_10172080 | |||
| 2596 | Ga0207712_10188807 | |||
| 2597 | Ga0207712_10204977 | |||
| 2598 | Ga0207712_10232661 | |||
| 2599 | Ga0207712_10372763 | |||
| 2600 | Ga0207668_10044565 | |||
| 2601 | Ga0207668_10109202 | |||
| 2602 | Ga0207668_10121465 | |||
| 2603 | Ga0207668_10166582 | |||
| 2604 | Ga0207668_10310758 | |||
| 2605 | Ga0207668_10364071 | |||
| 2606 | Ga0207668_10455724 | |||
| 2607 | Ga0207668_11216751 | |||
| 2608 | Ga0207640_10010753 | |||
| 2609 | Ga0207640_10099604 | |||
| 2610 | Ga0207640_10160459 | |||
| 2611 | Ga0207640_10184971 | |||
| 2612 | Ga0207640_10389178 | |||
| 2613 | Ga0207640_10567969 | |||
| 2614 | Ga0207640_10967919 | |||
| 2615 | Ga0207640_11076881 | |||
| 2616 | Ga0207658_10008424 | |||
| 2617 | Ga0207658_10066629 | |||
| 2618 | Ga0207658_10120749 | |||
| 2619 | Ga0207658_10286395 | |||
| 2620 | Ga0207658_10293237 | |||
| 2621 | Ga0207658_10306699 | |||
| 2622 | Ga0207658_10309279 | |||
| 2623 | Ga0207658_10337813 | |||
| 2624 | Ga0207658_10411796 | |||
| 2625 | Ga0207658_10678139 | |||
| 2626 | Ga0207658_10810434 | |||
| 2627 | Ga0207658_10840490 | |||
| 2628 | Ga0207658_11078671 | |||
| 2629 | Ga0207677_10003307 | |||
| 2630 | Ga0207677_10043994 | |||
| 2631 | Ga0207677_10054520 | |||
| 2632 | Ga0207677_10062680 | |||
| 2633 | Ga0207677_10074356 | |||
| 2634 | Ga0207677_10183855 | |||
| 2635 | Ga0207677_10807523 | |||
| 2636 | Ga0207677_11051138 | |||
| 2637 | Ga0207677_11261764 | |||
| 2638 | Ga0207703_10051094 | |||
| 2639 | Ga0207703_10144851 | |||
| 2640 | Ga0207703_10172139 | |||
| 2641 | Ga0207703_10255085 | |||
| 2642 | Ga0207703_10314055 | |||
| 2643 | Ga0207703_10400728 | |||
| 2644 | Ga0207703_10612624 | |||
| 2645 | Ga0207703_10657660 | |||
| 2646 | Ga0207703_11058663 | |||
| 2647 | Ga0207639_10003794 | |||
| 2648 | Ga0207639_10067276 | |||
| 2649 | Ga0207639_10083233 | |||
| 2650 | Ga0207639_10167410 | |||
| 2651 | Ga0207639_10211589 | |||
| 2652 | Ga0207639_10229390 | |||
| 2653 | Ga0207639_10242431 | |||
| 2654 | Ga0207639_10244092 | |||
| 2655 | Ga0207639_10338536 | |||
| 2656 | Ga0207639_10536705 | |||
| 2657 | Ga0207678_10271375 | |||
| 2658 | Ga0207678_10514694 | |||
| 2659 | Ga0207678_10979479 | |||
| 2660 | Ga0207708_10597580 | |||
| 2661 | Ga0207702_10020850 | |||
| 2662 | Ga0207702_10080465 | |||
| 2663 | Ga0207702_10759369 | |||
| 2664 | Ga0207641_10000111 | |||
| 2665 | Ga0207641_10000661 | |||
| 2666 | Ga0207641_10033650 | |||
| 2667 | Ga0207641_10138975 | |||
| 2668 | Ga0207641_10240177 | |||
| 2669 | Ga0207641_10335249 | |||
| 2670 | Ga0207641_10363845 | |||
| 2671 | Ga0207641_10439788 | |||
| 2672 | Ga0207641_10468528 | |||
| 2673 | Ga0207641_10767568 | |||
| 2674 | Ga0207641_10886595 | |||
| 2675 | Ga0207648_10001550 | |||
| 2676 | Ga0207648_10002106 | |||
| 2677 | Ga0207648_10002777 | |||
| 2678 | Ga0207648_10021535 | |||
| 2679 | Ga0207648_10082006 | |||
| 2680 | Ga0207648_10118716 | |||
| 2681 | Ga0207648_10188889 | |||
| 2682 | Ga0207648_10224355 | |||
| 2683 | Ga0207648_10533323 | |||
| 2684 | Ga0207648_10537286 | |||
| 2685 | Ga0207648_10618409 | |||
| 2686 | Ga0207648_10641433 | |||
| 2687 | Ga0207648_10837418 | |||
| 2688 | Ga0207676_10050667 | |||
| 2689 | Ga0207676_10053119 | |||
| 2690 | Ga0207676_10065397 | |||
| 2691 | Ga0207676_10093940 | |||
| 2692 | Ga0207676_10511272 | |||
| 2693 | Ga0207676_10521235 | |||
| 2694 | Ga0207676_10606465 | |||
| 2695 | Ga0207676_10650081 | |||
| 2696 | Ga0207676_10718557 | |||
| 2697 | Ga0207676_12089784 | |||
| 2698 | Ga0207674_10003288 | |||
| 2699 | Ga0207674_10003475 | |||
| 2700 | Ga0207674_10048957 | |||
| 2701 | Ga0207674_10083735 | |||
| 2702 | Ga0207674_10095134 | |||
| 2703 | Ga0207674_10107427 | |||
| 2704 | Ga0207674_10147535 | |||
| 2705 | Ga0207674_10230182 | |||
| 2706 | Ga0207674_10682528 | |||
| 2707 | Ga0207675_100001864 | |||
| 2708 | Ga0207675_100009737 | |||
| 2709 | Ga0207675_100015472 | |||
| 2710 | Ga0207675_100068468 | |||
| 2711 | Ga0207675_100192217 | |||
| 2712 | Ga0207675_100229178 | |||
| 2713 | Ga0207675_100531824 | |||
| 2714 | Ga0207675_100839473 | |||
| 2715 | Ga0207675_101028849 | |||
| 2716 | Ga0207675_101044009 | |||
| 2717 | Ga0207675_101077052 | |||
| 2718 | Ga0207675_101177511 | |||
| 2719 | Ga0207675_102263589 | |||
| 2720 | Ga0207683_10003417 | |||
| 2721 | Ga0207683_10010127 | |||
| 2722 | Ga0207683_10054465 | |||
| 2723 | Ga0207683_10068803 | |||
| 2724 | Ga0207683_10112602 | |||
| 2725 | Ga0207683_10297195 | |||
| 2726 | Ga0207683_10559009 | |||
| 2727 | Ga0207683_10581102 | |||
| 2728 | Ga0207683_10700970 | |||
| 2729 | Ga0207683_11810061 | |||
| 2730 | Ga0207698_10003425 | |||
| 2731 | Ga0207698_10009487 | |||
| 2732 | Ga0207698_10021613 | |||
| 2733 | Ga0207698_10046965 | |||
| 2734 | Ga0207698_10081677 | |||
| 2735 | Ga0207698_10182854 | |||
| 2736 | Ga0207698_10250726 | |||
| 2737 | Ga0207698_10278190 | |||
| 2738 | Ga0207698_10319386 | |||
| 2739 | Ga0207698_10320148 | |||
| 2740 | Ga0207698_10419572 | |||
| 2741 | Ga0207698_10517869 | |||
| 2742 | Ga0207698_10607661 | |||
| 2743 | Ga0207698_10971626 | |||
| 2744 | Ga0207698_10998083 | |||
| 2745 | Ga0209996_1048052 | |||
| 2746 | Ga0207428_10009365 | |||
| 2747 | Ga0268266_10000068 | |||
| 2748 | Ga0268266_10024264 | |||
| 2749 | Ga0268266_10113619 | |||
| 2750 | Ga0268266_10365168 | |||
| 2751 | Ga0268266_10403331 | |||
| 2752 | Ga0268266_10591881 | |||
| 2753 | Ga0268266_11890212 | |||
| 2754 | Ga0268265_10006095 | |||
| 2755 | Ga0268265_10099857 | |||
| 2756 | Ga0268265_10334141 | |||
| 2757 | Ga0268265_10341654 | |||
| 2758 | Ga0268265_10362237 | |||
| 2759 | Ga0268265_10616475 | |||
| 2760 | Ga0268265_11817972 | |||
| 2761 | Ga0268264_10000079 | |||
| 2762 | Ga0268264_10002203 | |||
| 2763 | Ga0268264_10004438 | |||
| 2764 | Ga0268264_10008001 | |||
| 2765 | Ga0268264_10019796 | |||
| 2766 | Ga0268264_10078043 | |||
| 2767 | Ga0268264_10113975 | |||
| 2768 | Ga0268264_10133846 | |||
| 2769 | Ga0268264_10144967 | |||
| 2770 | Ga0268264_10230957 | |||
| 2771 | Ga0268264_10286460 | |||
| 2772 | Ga0268264_10303017 | |||
| 2773 | Ga0268264_10310894 | |||
| 2774 | Ga0268264_10797505 | |||
| 2775 | Ga0268264_10880282 | |||
| 2776 | Ga0268264_11324138 | |||
| 2777 | Ga0307517_10002947 | |||
| 2778 | Ga0307517_10063397 | |||
| 2779 | Ga0307515_10000162 | |||
| 2780 | Ga0265338_10085655 | |||
| 2781 | Ga0307511_10002426 | |||
| 2782 | Ga0307512_10242718 | |||
| 2783 | Ga0265762_1028110 | |||
| 2784 | Ga0265327_10000211 | |||
| 2785 | Ga0265327_10056221 | |||
| 2786 | Ga0265327_10164882 | |||
| 2787 | Ga0307513_10011825 | |||
| 2788 | Ga0307513_10030364 | |||
| 2789 | Ga0307513_10424886 | |||
| 2790 | Ga0307513_10440001 | |||
| 2791 | Ga0307513_10470463 | |||
| 2792 | Ga0307509_10025814 | |||
| 2793 | Ga0307509_10068967 | |||
| 2794 | Ga0307509_10073437 | |||
| 2795 | Ga0265313_10009958 | |||
| 2796 | Ga0307508_10000686 | |||
| 2797 | Ga0307516_10003590 | |||
| 2798 | Ga0307516_10109739 | |||
| 2799 | Ga0247548_103414 | |||
| 2800 | Ga0307413_10437849 | |||
| 2801 | Ga0307410_10032504 | |||
| 2802 | Ga0307410_10542314 | |||
| 2803 | Ga0307407_10346717 | |||
| 2804 | Ga0307416_101792331 | |||
| 2805 | Ga0307411_11041394 | |||
| 2806 | Ga0316053_106418 | |||
| 2807 | Ga0307510_10009449 | |||
| 2808 | Ga0373934_0024384 | |||
| 2809 | Ga0373952_0031785 | |||
| 2810 | Ga0373953_0062896 | |||
| 2811 | Ga0373956_0014883 | |||
| 2812 | Ga0373943_0200393 | |||
| 2813 | Ga0373955_0362955 | |||
| 2814 | Ga0373924_0047247 | |||
| 2815 | Ga0373931_0200936 | |||
| 2816 | Ga0373935_0188483 | |||
| 2817 | Ga0373927_0421245 | |||
| 2818 | Ga0373947_0417939 | |||
| 2819 | Ga0373937_1165108 | |||
| 2820 | Ga0265778_009790 | |||
| 2821 | Ga0395899_0302972 | |||
| 2822 | Ga0395900_0860640 | |||
| 2823 | Ga0395901_0264140 | |||
| 2824 | Ga0436365_1006175 | |||
| 2825 | Ga0439436_0001808 | |||
| 2826 | Ga0439436_0068781 | |||
| 2827 | Ga0439439_0073858 | |||
| 2828 | Ga0451791_0561649 | |||
| 2829 | Ga0451791_0610277 | |||
| 2830 | Ga0451797_1589118 | |||
| 2831 | Ga0451795_0658710 | |||
| 2832 | Ga0451800_0870425 | |||
| 2833 | Ga0451802_1270985 | |||
| 2834 | Ga0451804_1163584 | |||
| 2835 | Ga0451807_2034630 | |||
| 2836 | Ga0451807_2520669 | |||
| 2837 | Ga0451835_0796468 | |||
| 2838 | Ga0451837_0151272 | |||
| 2839 | Ga0451839_0417715 | |||
| 2840 | Ga0451841_0638555 | |||
| 2841 | Ga0451851_1315133 | |||
| 2842 | Ga0451843_0280491 | |||
| 2843 | Ga0451853_2369279 | |||
| 2844 | Ga0451853_3113474 | |||
| 2845 | Ga0452271_00284 | |||
| 2846 | Ga0439449_0017943 | |||
| 2847 | Ga0439454_022306 | |||
| 2848 | Ga0439455_0093612 | |||
| 2849 | Ga0439457_007741 | |||
| 2850 | Ga0439462_0000316 | |||
| 2851 | Ga0439462_0016281 | |||
| 2852 | Ga0450894_003510 | |||
| 2853 | Ga0439434_0031310 | |||
| 2854 | Ga0450893_0034783 | |||
| 2855 | Ga0451577_0010418 | |||
| 2856 | Ga0451577_0077486 | |||
| 2857 | Ga0451577_0115853 | |||
| 2858 | Ga0466969_0001839 | |||
| 2859 | Ga0466972_0000026 | |||
| 2860 | Ga0466972_0000047 | |||
| 2861 | Ga0466972_0016295 | |||
| 2862 | Ga0466972_0020214 | |||
| 2863 | Ga0466972_0245505 | |||
| 2864 | Ga0453683_0512605 | |||
| 2865 | Ga0466965_0041591 | |||
| 2866 | Ga0466965_0687980 | |||
| 2867 | Ga0466966_0000047 | |||
| 2868 | Ga0466961_0143690 | |||
| 2869 | Ga0466961_0233268 | |||
| 2870 | Ga0466964_0064418 | |||
| 2871 | Ga0453684_0457166 | |||
| 2872 | Ga0453684_0906061 | |||
| 2873 | Ga0466971_0473029 | |||
| 2874 | Ga0466968_0269485 | |||
| 2875 | Ga0466970_0015920 | |||
| 2876 | Ga0466970_0290958 | |||
| 2877 | Ga0466957_0000937 | |||
| 2878 | Ga0466957_0023370 | |||
| 2879 | Ga0466957_0690407 | |||
| 2880 | Ga0466959_0000065 | |||
| 2881 | Ga0466967_0202462 | |||
| 2882 | Ga0495592_0143158 | |||
| 2883 | Ga0495592_0551554 | |||
| 2884 | Ga0495638_0087756 | |||
| 2885 | Ga0495638_0147545 | |||
| 2886 | Ga0495638_0437710 | |||
| 2887 | Ga0495653_0072165 | |||
| 2888 | Ga0495650_0014356 | |||
| 2889 | Ga0495580_0160391 | |||
| 2890 | Ga0495582_0279297 | |||
| 2891 | Ga0495594_0474533 | |||
| 2892 | Ga0495608_0142584 | |||
| 2893 | Ga0495618_0179402 | |||
| 2894 | Ga0495628_0046468 | |||
| 2895 | Ga0495630_0043935 | |||
| 2896 | Ga0495630_0273931 | |||
| 2897 | Ga0495632_0273517 | |||
| 2898 | Ga0495643_0107254 | |||
| 2899 | Ga0495648_0003925 | |||
| 2900 | Ga0495652_0654985 | |||
| 2901 | Ga0495640_0527989 | |||
| 2902 | Ga0495587_0077150 | |||
| 2903 | Ga0495609_0233480 | |||
| 2904 | Ga0495633_0166331 | |||
| 2905 | Ga0495668_0001854 | |||
| 2906 | Ga0495634_0099901 | |||
| 2907 | Ga0495611_0000435 | |||
| 2908 | Ga0495611_0054059 | |||
| 2909 | Ga0495611_0172206 | |||
| 2910 | Ga0495625_0171459 | |||
| 2911 | Ga0495625_0235621 | |||
| 2912 | Ga0495646_0185718 | |||
| 2913 | Ga0495647_0183159 | |||
| 2914 | Ga0495658_0577004 | |||
| 2915 | Ga0495658_0605059 | |||
| 2916 | Ga0495613_0241201 | |||
| 2917 | Ga0495670_0284332 | |||
| 2918 | Ga0495649_0020964 | |||
| 2919 | Ga0495649_0165133 | |||
| 2920 | Ga0495649_0359783 | |||
| 2921 | Ga0495600_0210469 | |||
| 2922 | Ga0495674_0516196 | |||
| 2923 | Ga0495672_0032233 | |||
| 2924 | Ga0495672_0045647 | |||
| 2925 | Ga0495687_000058 | |||
| 2926 | Ga0495675_0164974 | |||
| 2927 | Ga0495686_0000005 | |||
| 2928 | Ga0495686_0314362 | |||
| 2929 | Ga0495593_0465706 | |||
| 2930 | Ga0496100_0022116 | |||
| 2931 | Ga0496100_1071295 | |||
| 2932 | Ga0496101_0078704 | |||
| 2933 | Ga0496102_0431248 | |||
| 2934 | Ga0496102_0785145 | |||
| 2935 | Ga0496104_0102316 | |||
| 2936 | Ga0496104_0294681 | |||
| 2937 | Ga0496104_0562736 | |||
| 2938 | Ga0496104_0690172 | |||
| 2939 | Ga0496105_0104890 | |||
| 2940 | Ga0496110_0009120 | |||
| 2941 | Ga0496110_0583184 | |||
| 2942 | Ga0496111_0888989 | |||
| 2943 | Ga0496114_0060428 | |||
| 2944 | Ga0496114_0542910 | |||
| 2945 | Ga0496115_0311462 | |||
| 2946 | Ga0496124_0025722 | |||
| 2947 | Ga0501306_020602 | |||
| 2948 | Ga0501306_023486 | |||
| 2949 | Ga0501306_029430 | |||
| 2950 | Ga0501306_029588 | |||
| 2951 | Ga0501306_073237 | |||
| 2952 | Ga0501306_076822 | |||
| 2953 | Ga0501306_095068 | |||
| 2954 | Ga0501308_015523 | |||
| 2955 | Ga0501308_019267 | |||
| 2956 | Ga0501308_044528 | |||
| 2957 | Ga0501308_048431 | |||
| 2958 | Ga0501308_085917 | |||
| 2959 | Ga0501309_026316 | |||
| 2960 | Ga0501309_045566 | |||
| 2961 | Ga0501309_083157 | |||
| 2962 | Ga0501310_035532 | |||
| 2963 | Ga0501310_038151 | |||
| 2964 | Ga0501341_16378 | |||
| 2965 | Ga0501343_014432 | |||
| 2966 | Ga0501343_017103 | |||
| 2967 | Ga0501343_025956 | |||
| 2968 | Ga0501344_06775 | |||
| 2969 | Ga0501304_009793 | |||
| 2970 | Ga0501304_030658 | |||
| 2971 | Ga0501305_011364 | |||
| 2972 | Ga0501305_023982 | |||
| 2973 | Ga0501305_060459 | |||
| 2974 | Ga0501307_015588 | |||
| 2975 | Ga0501307_071311 | |||
| 2976 | Ga0501342_04422 | |||
| 2977 | Ga0501290_023419 | |||
| 2978 | Ga0501300_024987 | |||
| 2979 | Ga0501311_039794 | |||
| 2980 | Ga0501311_051601 | |||
| 2981 | Ga0501311_091461 | |||
| 2982 | Ga0501312_020191 | |||
| 2983 | Ga0501312_036407 | |||
| 2984 | Ga0501312_057184 | |||
| 2985 | Ga0501312_082985 | |||
| 2986 | Ga0501313_020182 | |||
| 2987 | Ga0501313_036866 | |||
| 2988 | Ga0501314_019372 | |||
| 2989 | Ga0501314_027304 | |||
| 2990 | Ga0501315_006608 | |||
| 2991 | Ga0501315_029210 | |||
| 2992 | Ga0501315_034424 | |||
| 2993 | Ga0501315_038411 | |||
| 2994 | Ga0501316_038392 | |||
| 2995 | Ga0501317_023266 | |||
| 2996 | Ga0501317_073580 | |||
| 2997 | Ga0501319_013389 | |||
| 2998 | Ga0501321_032085 | |||
| 2999 | Ga0501321_055231 | |||
| 3000 | Ga0501322_030399 | |||
| 3001 | Ga0501323_068822 | |||
| 3002 | Ga0501324_018982 | |||
| 3003 | Ga0501334_08988 | |||
| 3004 | Ga0501336_013424 | |||
| 3005 | Ga0501336_023667 | |||
| 3006 | Ga0501336_024268 | |||
| 3007 | Ga0501340_011543 | |||
| 3008 | Ga0501031_0011346 | |||
| 3009 | Ga0501032_0016212 | |||
| 3010 | Ga0501033_0148587 | |||
| 3011 | Ga0501034_0000004 | |||
| 3012 | Ga0501034_0038295 | |||
| 3013 | Ga0501034_0156703 | |||
| 3014 | Ga0501034_0221323 | |||
| 3015 | Ga0501036_0064864 | |||
| 3016 | Ga0501037_0073362 | |||
| 3017 | Ga0501037_0094630 | |||
| 3018 | Ga0501038_0031875 | |||
| 3019 | Ga0501038_0160713 | |||
| 3020 | Ga0501038_0341423 | |||
| 3021 | Ga0501039_0069150 | |||
| 3022 | Ga0501039_0440216 | |||
| 3023 | Ga0501042_0667506 | |||
| 3024 | Ga0501043_0182147 | |||
| 3025 | Ga0501043_0696340 | |||
| 3026 | Ga0501046_0059769 | |||
| 3027 | Ga0501046_0070301 | |||
| 3028 | Ga0501047_0104968 | |||
| 3029 | Ga0501047_0324513 | |||
| 3030 | Ga0501047_0684518 | |||
| 3031 | Ga0501048_0052768 | |||
| 3032 | Ga0501048_0166124 | |||
| 3033 | Ga0501067_0078807 | |||
| 3034 | Ga0501067_0178652 | |||
| 3035 | Ga0501067_0605946 | |||
| 3036 | Ga0501068_0116026 | |||
| 3037 | Ga0501069_0265062 | |||
| 3038 | Ga0501071_0079981 | |||
| 3039 | Ga0501072_0378227 | |||
| 3040 | Ga0501072_0839155 | |||
| 3041 | Ga0501073_0136283 | |||
| 3042 | Ga0501074_0016995 | |||
| 3043 | Ga0501225_0004193 | |||
| 3044 | Ga0501079_1426242 | |||
| 3045 | Ga0501080_0241525 | |||
| 3046 | Ga0501080_0665087 | |||
| 3047 | Ga0501080_0697459 | |||
| 3048 | Ga0501083_0038490 | |||
| 3049 | Ga0501083_0066762 | |||
| 3050 | Ga0501083_0075836 | |||
| 3051 | Ga0501035_0082386 | |||
| 3052 | Ga0501035_0216770 | |||
| 3053 | Ga0501035_0326710 | |||
| 3054 | Ga0501035_0486912 | |||
| 3055 | Ga0501035_0488862 | |||
| 3056 | Ga0501044_0092260 | |||
| 3057 | Ga0501044_0209997 | |||
| 3058 | Ga0501044_0709142 | |||
| 3059 | Ga0501044_0846074 | |||
| 3060 | Ga0501204_047562 | |||
| 3061 | Ga0501284_00017 | |||
| 3062 | nmdc:mga00v17_468702_c1 | |||
| 3063 | nmdc:mga0k408_15433_c1 | |||
| 3064 | nmdc:mga0k408_173576_c1 | |||
| 3065 | nmdc:mga0k408_210511_c1 | |||
| 3066 | nmdc:mga0k408_57726_c1 | |||
| 3067 | nmdc:mga0k408_60000_c1 | |||
| 3068 | nmdc:mga0k408_71296_c1 | |||
| 3069 | nmdc:mga0k408_849998_c1 | |||
| 3070 | nmdc:mga0k408_88131_c1 | |||
| 3071 | nmdc:mga07m45_285829_c1 | |||
| 3072 | nmdc:mga07m45_424286_c1 | |||
| 3073 | nmdc:mga05p37_450122_c1 | |||
| 3074 | nmdc:mga08y16_13908_c1 | |||
| 3075 | nmdc:mga08y16_181367_c1 | |||
| 3076 | nmdc:mga0n895_26949_c1 | |||
| 3077 | nmdc:mga0rr50_521263_c1 | |||
| 3078 | nmdc:mga0rr50_804147_c1 | |||
| 3079 | Ga0500578_0000765 | |||
| 3080 | Ga0500578_0071393 | |||
| 3081 | Ga0500578_0461766 | |||
| 3082 | Ga0500643_166056 | |||
| 3083 | Ga0500646_0005187 | |||
| 3084 | Ga0500646_0023739 | |||
| 3085 | Ga0500646_0111081 | |||
| 3086 | Ga0500583_0000003 | |||
| 3087 | Ga0500583_0008462 | |||
| 3088 | Ga0500583_0242794 | |||
| 3089 | Ga0500641_0008479 | |||
| 3090 | Ga0500641_0292843 | |||
| 3091 | Ga0500650_0011604 | |||
| 3092 | Ga0500654_199620 | |||
| 3093 | Ga0500555_002160 | |||
| 3094 | Ga0500556_0016645 | |||
| 3095 | Ga0500562_032145 | |||
| 3096 | Ga0500594_0166233 | |||
| 3097 | Ga0500621_129805 | |||
| 3098 | Ga0500642_0006418 | |||
| 3099 | Ga0500642_0008766 | |||
| 3100 | Ga0500642_0176466 | |||
| 3101 | Ga0500642_0291480 | |||
| 3102 | Ga0500652_089437 | |||
| 3103 | Ga0500652_126792 | |||
| 3104 | Ga0500655_004076 | |||
| 3105 | Ga0500655_016378 | |||
| 3106 | Ga0500658_0092683 | |||
| 3107 | Ga0500559_0096701 | |||
| 3108 | Ga0500568_0033671 | |||
| 3109 | Ga0500568_0136927 | |||
| 3110 | Ga0500573_0318135 | |||
| 3111 | Ga0500588_0000576 | |||
| 3112 | Ga0500588_0011679 | |||
| 3113 | Ga0500589_051369 | |||
| 3114 | Ga0500589_149284 | |||
| 3115 | Ga0500604_0004024 | |||
| 3116 | Ga0500604_0065920 | |||
| 3117 | Ga0500604_0066789 | |||
| 3118 | Ga0500616_0003349 | |||
| 3119 | Ga0500616_0187851 | |||
| 3120 | Ga0500622_0020789 | |||
| 3121 | Ga0500622_0046969 | |||
| 3122 | Ga0500622_0398529 | |||
| 3123 | Ga0500633_0240254 | |||
| 3124 | Ga0500639_102242 | |||
| 3125 | Ga0500637_0042051 | |||
| 3126 | Ga0500637_0042775 | |||
| 3127 | Ga0500637_0199242 | |||
| 3128 | Ga0500611_000155 | |||
| 3129 | Ga0501084_0456261 | |||
| 3130 | Ga0587084_018264 | |||
| 3131 | Ga0587073_0065816 | |||
| 3132 | Ga0587077_026657 | |||
| 3133 | Ga0587080_052881 | |||
| 3134 | Ga0587080_058819 | |||
| 3135 | Ga0587082_067543 | |||
| 3136 | Ga0587083_0035801 | |||
| 3137 | Ga0587085_033012 | |||
| 3138 | Ga0587086_033745 | |||
| 3139 | Ga0587088_014397 | |||
| 3140 | Ga0587088_058532 | |||
| 3141 | Ga0587088_059318 | |||
| 3142 | Ga0587089_072571 | |||
| 3143 | Ga0587090_018239 | |||
| 3144 | Ga0587090_105753 | |||
| 3145 | Ga0587098_045543 | |||
| 3146 | Ga0587106_081430 | |||
| 3147 | Ga0587099_027090 | |||
| 3148 | Ga0587101_009100 | |||
| 3149 | Ga0587109_048730 | |||
| 3150 | Ga0587113_034899 | |||
| 3151 | Ga0587128_049683 | |||
| 3152 | Ga0587130_015633 | |||
| 3153 | Ga0587062_008766 | |||
| 3154 | Ga0587067_029795 | |||
| 3155 | Ga0587067_081838 | |||
| 3156 | Ga0587076_010100 | |||
| 3157 | Ga0587100_020743 | |||
| 3158 | Ga0587107_021210 | |||
| 3159 | Ga0587107_083939 | |||
| 3160 | Ga0587108_009588 | |||
| 3161 | Ga0587114_088944 | |||
| 3162 | Ga0587124_023954 | |||
| 3163 | Ga0587111_0050904 | |||
| 3164 | Ga0501082_0531371 | |||
| 3165 | 2819589768 | |||
| 3166 | 2914763715 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy