F494922

General Info

Members Datasets Scaffolds Average Seq Length
1588 344 1578 382

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10072705|Ga0163163_100727053
Length 432
Sequence MHPSVVQCPPPLRPNDGVRTTNLRELPLIDRYLARSIAIPLLGSLVLAAMLLVLDKMLRLFQYVVDAGGPVSVVWRMLANLLPEYLSLGIAFRKLALSSELDALRGIGVGYGRLLRIPYAYALPLMALNLFIVGYLEPWSHYRYEGLRFDLKSGALGAAIKVGEFNDLGHRLTLRIDRSEHKGTQLHGIFVRMDDKSGMTVAATADQGRFLSTDDPDTILFRLVKGRLVQDSPKFATPRTLSFDTYDLPISLPAIDQFRRRGGTESDELYLHELFRLGYQGGARDTHQKLENQSELNFRLVEVVRSSSSLGIFLSIVFVVAYHKVNQYAEQAGAQGRLNPLLALWVPLILFSGLIFWMYHVLAHRPGGQPIGALERAASKTWQFIRGLIPRRRFERSERAGKTVLWRYVNGAAGTRNFSIKISSTYCPRITA

Samples

Sample ID Description Type Environment
1 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
2 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
3 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
4 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
5 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
6 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
7 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
8 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
9 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
10 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
11 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
12 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
13 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
14 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
18 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
131 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
190 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
195 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
209 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
210 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
223 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
224 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
225 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
226 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
227 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
228 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
229 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
230 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
231 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
232 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
233 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
234 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
235 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
236 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
237 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
238 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
239 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
240 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
241 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
242 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
243 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
244 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
245 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
246 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
247 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
248 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
249 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
250 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
251 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
252 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
253 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
254 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
255 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
256 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
257 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
258 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
259 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
260 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
261 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
262 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
263 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
264 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
265 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
266 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
267 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
268 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
269 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
270 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
271 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
272 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
273 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
274 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
287 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
288 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
289 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
290 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
291 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
292 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
293 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
294 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
295 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
297 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
298 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
299 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
300 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
301 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
302 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
303 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
304 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
305 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
306 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
307 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
308 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
309 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
310 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
311 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
312 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
313 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
314 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
315 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
316 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
317 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
318 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
319 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
320 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
321 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
322 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
323 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
324 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
325 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
326 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
327 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
328 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
329 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
330 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
331 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
332 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
333 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
334 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
335 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
336 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
337 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
338 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
339 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
340 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
341 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
342 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
343 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
344 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0.06
Isolates 0.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.27
Nodule 0
Rhizoplane 3.21
Rhizosphere 92.7
Stem 0
Stem Tuber 0.06
Unclassified 1.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1002319 3300000549 Bacteria 2670
2 JGI24736J21556_1000687 3300001904 Bacteria 6188
3 JGI24736J21556_1000727 3300001904 Bacteria 6010
4 JGI24741J21665_1000569 3300001915 Bacteria 11239
5 JGI24741J21665_1002477 3300001915 Bacteria 4781
6 JGI24740J21852_10000514 3300001979 Bacteria 16647
7 JGI24740J21852_10001407 3300001979 Bacteria 11012
8 JGI24740J21852_10001639 3300001979 Bacteria 10296
9 JGI24740J21852_10003133 3300001979 Bacteria 7299
10 JGI24740J21852_10003249 3300001979 Bacteria 7179
11 JGI24740J21852_10015670 3300001979 Bacteria 2760
12 JGI24740J21852_10031021 3300001979 Bacteria 1730
13 JGI24739J22299_10000035 3300001989 Bacteria 37844
14 JGI24739J22299_10000429 3300001989 Bacteria 14581
15 JGI24739J22299_10003157 3300001989 Bacteria 6289
16 JGI24739J22299_10017565 3300001989 Bacteria 2579
17 JGI24737J22298_10000020 3300001990 Bacteria 46324
18 JGI24737J22298_10002336 3300001990 Bacteria 6764
19 JGI24737J22298_10003363 3300001990 Bacteria 5657
20 JGI24737J22298_10003911 3300001990 Bacteria 5223
21 JGI24737J22298_10006220 3300001990 Bacteria 4088
22 JGI24737J22298_10011579 3300001990 Bacteria 2888
23 JGI24737J22298_10013612 3300001990 Bacteria 2646
24 JGI24737J22298_10019500 3300001990 Bacteria 2169
25 JGI24735J21928_10001785 3300002067 Bacteria 7554
26 JGI24735J21928_10002483 3300002067 Bacteria 6400
27 JGI24735J21928_10010719 3300002067 Bacteria 2916
28 JGI24735J21928_10011665 3300002067 Bacteria 2783
29 JGI24738J21930_10004401 3300002075 Bacteria 3456
30 Ga0065704_10073450 3300005289 Bacteria 7156
31 Ga0065712_10111930 3300005290 Bacteria 1809
32 Ga0065715_10093918 3300005293 Bacteria 4491
33 Ga0065707_10088522 3300005295 Bacteria 4633
34 Ga0070658_10000782 3300005327 Bacteria 27329
35 Ga0070658_10001147 3300005327 Bacteria 22607
36 Ga0070658_10001533 3300005327 Bacteria 19572
37 Ga0070658_10004553 3300005327 Bacteria 11267
38 Ga0070658_10009142 3300005327 Bacteria 7966
39 Ga0070658_10009160 3300005327 Bacteria 7957
40 Ga0070658_10011486 3300005327 Bacteria 7103
41 Ga0070658_10014753 3300005327 Bacteria 6264
42 Ga0070658_10028263 3300005327 Bacteria 4501
43 Ga0070658_10030172 3300005327 Bacteria 4357
44 Ga0070658_10033989 3300005327 Bacteria 4103
45 Ga0070658_10039650 3300005327 Bacteria 3799
46 Ga0070658_10058532 3300005327 Bacteria 3136
47 Ga0070658_10072557 3300005327 Bacteria 2821
48 Ga0070658_10073360 3300005327 Bacteria 2806
49 Ga0070658_10098386 3300005327 Bacteria 2416
50 Ga0070658_10132502 3300005327 Bacteria 2077
51 Ga0070658_10160552 3300005327 Bacteria 1885
52 Ga0070676_10005691 3300005328 Bacteria 6638
53 Ga0070676_10021355 3300005328 Bacteria 3625
54 Ga0070683_100009091 3300005329 Bacteria 8480
55 Ga0070683_100009240 3300005329 Bacteria 8421
56 Ga0070683_100019472 3300005329 Bacteria 6028
57 Ga0070683_100021549 3300005329 Bacteria 5752
58 Ga0070683_100093309 3300005329 Bacteria 2828
59 Ga0070683_100094999 3300005329 Bacteria 2802
60 Ga0070690_100001926 3300005330 Bacteria 11028
61 Ga0070690_100045241 3300005330 Bacteria 2795
62 Ga0070670_100000210 3300005331 Bacteria 54177
63 Ga0070670_100002057 3300005331 Bacteria 16470
64 Ga0070670_100002444 3300005331 Bacteria 15321
65 Ga0070670_100006252 3300005331 Bacteria 10078
66 Ga0070670_100010976 3300005331 Bacteria 7738
67 Ga0070670_100021406 3300005331 Bacteria 5563
68 Ga0070670_100026282 3300005331 Bacteria 5011
69 Ga0070670_100077416 3300005331 Bacteria 2857
70 Ga0070670_100087282 3300005331 Bacteria 2681
71 Ga0070670_100105952 3300005331 Bacteria 2422
72 Ga0070670_100310567 3300005331 Bacteria 1380
73 Ga0070677_10012509 3300005333 Bacteria 2947
74 Ga0070677_10019687 3300005333 Bacteria 2448
75 Ga0070677_10036117 3300005333 Bacteria 1920
76 Ga0068869_100000043 3300005334 Bacteria 52392
77 Ga0070666_10000089 3300005335 Bacteria 64147
78 Ga0070666_10001550 3300005335 Bacteria 13958
79 Ga0070666_10001807 3300005335 Bacteria 13021
80 Ga0070666_10003096 3300005335 Bacteria 10099
81 Ga0070666_10009053 3300005335 Bacteria 6205
82 Ga0070666_10012588 3300005335 Bacteria 5342
83 Ga0070666_10016385 3300005335 Bacteria 4742
84 Ga0070666_10045046 3300005335 Bacteria 2957
85 Ga0070666_10063546 3300005335 Bacteria 2503
86 Ga0070666_10070114 3300005335 Bacteria 2384
87 Ga0070680_100004180 3300005336 Bacteria 10824
88 Ga0070680_100004527 3300005336 Bacteria 10467
89 Ga0070680_100014624 3300005336 Bacteria 6138
90 Ga0070680_100021563 3300005336 Bacteria 5121
91 Ga0070680_100028352 3300005336 Bacteria 4490
92 Ga0070680_100075002 3300005336 Bacteria 2784
93 Ga0068868_100000164 3300005338 Bacteria 43406
94 Ga0068868_100001402 3300005338 Bacteria 16620
95 Ga0068868_100002343 3300005338 Bacteria 13104
96 Ga0068868_100040654 3300005338 Bacteria 3620
97 Ga0068868_100046864 3300005338 Bacteria 3384
98 Ga0068868_100071727 3300005338 Bacteria 2762
99 Ga0070660_100000094 3300005339 Bacteria 53860
100 Ga0070660_100000139 3300005339 Bacteria 46729
101 Ga0070660_100000534 3300005339 Bacteria 25407
102 Ga0070660_100003370 3300005339 Bacteria 10992
103 Ga0070660_100006863 3300005339 Bacteria 7898
104 Ga0070660_100007769 3300005339 Bacteria 7478
105 Ga0070660_100009551 3300005339 Bacteria 6829
106 Ga0070660_100012648 3300005339 Bacteria 6032
107 Ga0070660_100013189 3300005339 Bacteria 5921
108 Ga0070660_100015485 3300005339 Bacteria 5509
109 Ga0070660_100019053 3300005339 Bacteria 5024
110 Ga0070660_100020862 3300005339 Bacteria 4823
111 Ga0070660_100027601 3300005339 Bacteria 4238
112 Ga0070660_100033373 3300005339 Bacteria 3880
113 Ga0070660_100058713 3300005339 Bacteria 2982
114 Ga0070660_100062519 3300005339 Bacteria 2892
115 Ga0070660_100093212 3300005339 Bacteria 2378
116 Ga0070660_100120616 3300005339 Bacteria 2092
117 Ga0070660_100171710 3300005339 Bacteria 1751
118 Ga0070660_100185696 3300005339 Bacteria 1683
119 Ga0070689_100077398 3300005340 Bacteria 2607
120 Ga0070689_100107485 3300005340 Bacteria 2215
121 Ga0070691_10000118 3300005341 Bacteria 23914
122 Ga0070687_100066750 3300005343 Bacteria 1918
123 Ga0070661_100000452 3300005344 Bacteria 31380
124 Ga0070661_100003827 3300005344 Bacteria 10361
125 Ga0070661_100004354 3300005344 Bacteria 9768
126 Ga0070661_100014219 3300005344 Bacteria 5607
127 Ga0070661_100016661 3300005344 Bacteria 5199
128 Ga0070661_100026078 3300005344 Bacteria 4200
129 Ga0070661_100038633 3300005344 Bacteria 3476
130 Ga0070661_100042242 3300005344 Bacteria 3327
131 Ga0070661_100061142 3300005344 Bacteria 2764
132 Ga0070661_100095393 3300005344 Bacteria 2206
133 Ga0070661_100135480 3300005344 Bacteria 1853
134 Ga0070692_10000531 3300005345 Bacteria 11841
135 Ga0070692_10003924 3300005345 Bacteria 6135
136 Ga0070692_10020867 3300005345 Bacteria 3181
137 Ga0070692_10038875 3300005345 Bacteria 2427
138 Ga0070668_100000014 3300005347 Bacteria 112374
139 Ga0070668_100000030 3300005347 Bacteria 87912
140 Ga0070668_100004094 3300005347 Bacteria 10798
141 Ga0070668_100004856 3300005347 Bacteria 9958
142 Ga0070668_100017913 3300005347 Bacteria 5313
143 Ga0070668_100051921 3300005347 Bacteria 3160
144 Ga0070668_100067246 3300005347 Bacteria 2783
145 Ga0070668_100143435 3300005347 Bacteria 1926
146 Ga0070669_100000024 3300005353 Bacteria 173107
147 Ga0070669_100000209 3300005353 Bacteria 48982
148 Ga0070669_100005288 3300005353 Bacteria 9320
149 Ga0070669_100011679 3300005353 Bacteria 6232
150 Ga0070669_100071740 3300005353 Bacteria 2563
151 Ga0070669_100092774 3300005353 Bacteria 2267
152 Ga0070669_100135345 3300005353 Bacteria 1895
153 Ga0070669_100217527 3300005353 Bacteria 1510
154 Ga0070669_100287846 3300005353 Bacteria 1318
155 Ga0070675_100006027 3300005354 Bacteria 9288
156 Ga0070675_100064636 3300005354 Bacteria 3025
157 Ga0070675_100164575 3300005354 Bacteria 1910
158 Ga0070675_100200711 3300005354 Bacteria 1731
159 Ga0070671_100000006 3300005355 Bacteria 250635
160 Ga0070671_100000125 3300005355 Bacteria 49771
161 Ga0070671_100002744 3300005355 Bacteria 13674
162 Ga0070671_100002863 3300005355 Bacteria 13424
163 Ga0070671_100002968 3300005355 Bacteria 13201
164 Ga0070671_100004366 3300005355 Bacteria 11182
165 Ga0070671_100011686 3300005355 Bacteria 7062
166 Ga0070671_100012961 3300005355 Bacteria 6717
167 Ga0070671_100013661 3300005355 Bacteria 6548
168 Ga0070671_100022393 3300005355 Bacteria 5160
169 Ga0070671_100029600 3300005355 Bacteria 4516
170 Ga0070671_100034749 3300005355 Bacteria 4174
171 Ga0070671_100048750 3300005355 Bacteria 3523
172 Ga0070671_100081916 3300005355 Bacteria 2698
173 Ga0070674_100005730 3300005356 Bacteria 7207
174 Ga0070674_100010449 3300005356 Bacteria 5612
175 Ga0070674_100017574 3300005356 Bacteria 4504
176 Ga0070674_100018834 3300005356 Bacteria 4374
177 Ga0070674_100039129 3300005356 Bacteria 3201
178 Ga0070673_100005908 3300005364 Bacteria 7902
179 Ga0070673_100007510 3300005364 Bacteria 7200
180 Ga0070673_100015203 3300005364 Bacteria 5397
181 Ga0070673_100040478 3300005364 Bacteria 3576
182 Ga0070673_100060329 3300005364 Bacteria 3005
183 Ga0070673_100077858 3300005364 Bacteria 2680
184 Ga0070673_100183530 3300005364 Bacteria 1792
185 Ga0070673_100240837 3300005364 Bacteria 1573
186 Ga0070659_100000021 3300005366 Bacteria 154212
187 Ga0070659_100000138 3300005366 Bacteria 56073
188 Ga0070659_100000903 3300005366 Bacteria 21708
189 Ga0070659_100002004 3300005366 Bacteria 14545
190 Ga0070659_100003653 3300005366 Bacteria 10963
191 Ga0070659_100007280 3300005366 Bacteria 8035
192 Ga0070659_100011874 3300005366 Bacteria 6447
193 Ga0070659_100012653 3300005366 Bacteria 6260
194 Ga0070659_100014730 3300005366 Bacteria 5849
195 Ga0070659_100023502 3300005366 Bacteria 4717
196 Ga0070659_100032502 3300005366 Bacteria 4047
197 Ga0070659_100074363 3300005366 Bacteria 2707
198 Ga0070659_100080716 3300005366 Bacteria 2597
199 Ga0070659_100081127 3300005366 Bacteria 2590
200 Ga0070659_100089286 3300005366 Bacteria 2469
201 Ga0070659_100118913 3300005366 Bacteria 2138
202 Ga0070667_100000071 3300005367 Bacteria 125713
203 Ga0070667_100001974 3300005367 Bacteria 18193
204 Ga0070667_100002316 3300005367 Bacteria 16687
205 Ga0070667_100002750 3300005367 Bacteria 15219
206 Ga0070667_100010117 3300005367 Bacteria 7803
207 Ga0070667_100011249 3300005367 Bacteria 7403
208 Ga0070667_100023036 3300005367 Bacteria 5165
209 Ga0070667_100052123 3300005367 Bacteria 3451
210 Ga0070667_100093656 3300005367 Bacteria 2587
211 Ga0070667_100183051 3300005367 Bacteria 1853
212 Ga0070667_100254536 3300005367 Bacteria 1570
213 Ga0070709_10039167 3300005434 Bacteria 2907
214 Ga0070714_100004704 3300005435 Bacteria 10321
215 Ga0070714_100030786 3300005435 Bacteria 4470
216 Ga0070714_100032704 3300005435 Bacteria 4344
217 Ga0070714_100225124 3300005435 Bacteria 1726
218 Ga0070714_100395282 3300005435 Bacteria 1305
219 Ga0070713_100006844 3300005436 Bacteria 7944
220 Ga0070713_100028763 3300005436 Bacteria 4392
221 Ga0070713_100170411 3300005436 Bacteria 1950
222 Ga0070694_100061068 3300005444 Bacteria 2572
223 Ga0070663_100001943 3300005455 Bacteria 11539
224 Ga0070663_100002833 3300005455 Bacteria 9849
225 Ga0070663_100006852 3300005455 Bacteria 6894
226 Ga0070663_100016124 3300005455 Bacteria 4841
227 Ga0070663_100032971 3300005455 Bacteria 3575
228 Ga0070663_100049590 3300005455 Bacteria 2982
229 Ga0070663_100061637 3300005455 Bacteria 2702
230 Ga0070663_100113764 3300005455 Bacteria 2037
231 Ga0070663_100125571 3300005455 Bacteria 1943
232 Ga0070663_100176425 3300005455 Bacteria 1655
233 Ga0070678_100084142 3300005456 Bacteria 2420
234 Ga0070662_100000324 3300005457 Bacteria 28542
235 Ga0070662_100000410 3300005457 Bacteria 25434
236 Ga0070662_100000513 3300005457 Bacteria 23294
237 Ga0070662_100002965 3300005457 Bacteria 10548
238 Ga0070662_100010024 3300005457 Bacteria 6206
239 Ga0070662_100013214 3300005457 Bacteria 5489
240 Ga0070662_100013967 3300005457 Bacteria 5351
241 Ga0070662_100017032 3300005457 Bacteria 4889
242 Ga0070662_100026834 3300005457 Bacteria 3992
243 Ga0070662_100032235 3300005457 Bacteria 3682
244 Ga0070662_100092811 3300005457 Bacteria 2270
245 Ga0070681_10062006 3300005458 Bacteria 3713
246 Ga0070681_10092039 3300005458 Bacteria 2982
247 Ga0070681_10104290 3300005458 Bacteria 2778
248 Ga0070681_10124690 3300005458 Bacteria 2508
249 Ga0068867_100001209 3300005459 Bacteria 17732
250 Ga0068867_100008265 3300005459 Bacteria 7347
251 Ga0068867_100042556 3300005459 Bacteria 3323
252 Ga0068867_100056646 3300005459 Bacteria 2900
253 Ga0068867_100105770 3300005459 Bacteria 2155
254 Ga0070685_10056541 3300005466 Bacteria 2281
255 Ga0070679_100005796 3300005530 Bacteria 11464
256 Ga0070679_100047584 3300005530 Bacteria 4274
257 Ga0070679_100115823 3300005530 Bacteria 2665
258 Ga0070679_100216118 3300005530 Bacteria 1879
259 Ga0070679_100221974 3300005530 Bacteria 1851
260 Ga0070679_100257478 3300005530 Bacteria 1700
261 Ga0070679_100439875 3300005530 Bacteria 1249
262 Ga0070684_100017451 3300005535 Bacteria 5892
263 Ga0070684_100017615 3300005535 Bacteria 5868
264 Ga0070684_100023512 3300005535 Bacteria 5157
265 Ga0070684_100046309 3300005535 Bacteria 3768
266 Ga0068853_100000479 3300005539 Bacteria 27267
267 Ga0068853_100003482 3300005539 Bacteria 12041
268 Ga0068853_100009890 3300005539 Bacteria 7698
269 Ga0068853_100038990 3300005539 Bacteria 4050
270 Ga0068853_100064708 3300005539 Bacteria 3172
271 Ga0068853_100085866 3300005539 Bacteria 2759
272 Ga0070672_100002918 3300005543 Bacteria 10997
273 Ga0070672_100002925 3300005543 Bacteria 10988
274 Ga0070672_100003604 3300005543 Bacteria 10038
275 Ga0070672_100004713 3300005543 Bacteria 8945
276 Ga0070672_100018137 3300005543 Bacteria 5081
277 Ga0070672_100071158 3300005543 Bacteria 2766
278 Ga0070672_100073233 3300005543 Bacteria 2730
279 Ga0070686_100005600 3300005544 Bacteria 6959
280 Ga0070686_100016826 3300005544 Bacteria 4259
281 Ga0070686_100158828 3300005544 Bacteria 1590
282 Ga0070695_100012845 3300005545 Bacteria 5027
283 Ga0070696_100001542 3300005546 Bacteria 15103
284 Ga0070693_100000672 3300005547 Bacteria 15145
285 Ga0070693_100072586 3300005547 Bacteria 2030
286 Ga0070693_100087802 3300005547 Bacteria 1868
287 Ga0070693_100095107 3300005547 Bacteria 1804
288 Ga0070665_100000207 3300005548 Bacteria 102416
289 Ga0070665_100000521 3300005548 Bacteria 54699
290 Ga0070665_100006945 3300005548 Bacteria 11508
291 Ga0070665_100021002 3300005548 Bacteria 6564
292 Ga0070665_100029703 3300005548 Bacteria 5500
293 Ga0070665_100044858 3300005548 Bacteria 4438
294 Ga0070665_100045231 3300005548 Bacteria 4421
295 Ga0070665_100054200 3300005548 Bacteria 4022
296 Ga0070665_100193605 3300005548 Bacteria 2034
297 Ga0068855_100000163 3300005563 Bacteria 85587
298 Ga0068855_100000433 3300005563 Bacteria 51890
299 Ga0068855_100000780 3300005563 Bacteria 39315
300 Ga0068855_100000962 3300005563 Bacteria 35800
301 Ga0068855_100004365 3300005563 Bacteria 17287
302 Ga0068855_100015155 3300005563 Bacteria 9283
303 Ga0068855_100028359 3300005563 Bacteria 6697
304 Ga0068855_100129902 3300005563 Bacteria 2878
305 Ga0068855_100262749 3300005563 Bacteria 1922
306 Ga0070664_100000717 3300005564 Bacteria 25407
307 Ga0070664_100003721 3300005564 Bacteria 12292
308 Ga0070664_100004827 3300005564 Bacteria 10798
309 Ga0070664_100005219 3300005564 Bacteria 10417
310 Ga0070664_100009475 3300005564 Bacteria 7895
311 Ga0070664_100009847 3300005564 Bacteria 7744
312 Ga0070664_100012664 3300005564 Bacteria 6866
313 Ga0070664_100016182 3300005564 Bacteria 6112
314 Ga0070664_100018639 3300005564 Bacteria 5706
315 Ga0070664_100026124 3300005564 Bacteria 4842
316 Ga0070664_100040526 3300005564 Bacteria 3927
317 Ga0070664_100044580 3300005564 Bacteria 3745
318 Ga0070664_100068767 3300005564 Bacteria 3028
319 Ga0070664_100096157 3300005564 Bacteria 2570
320 Ga0070664_100103703 3300005564 Bacteria 2476
321 Ga0070664_100159261 3300005564 Bacteria 1996
322 Ga0070664_100229060 3300005564 Bacteria 1665
323 Ga0070664_100353361 3300005564 Bacteria 1337
324 Ga0068857_100008240 3300005577 Bacteria 9005
325 Ga0068857_100017400 3300005577 Bacteria 6299
326 Ga0068857_100017571 3300005577 Bacteria 6271
327 Ga0068857_100018151 3300005577 Bacteria 6171
328 Ga0068857_100043976 3300005577 Bacteria 3961
329 Ga0068857_100054971 3300005577 Bacteria 3533
330 Ga0068857_100057645 3300005577 Bacteria 3447
331 Ga0068857_100063078 3300005577 Bacteria 3294
332 Ga0068857_100085587 3300005577 Bacteria 2818
333 Ga0068857_100108712 3300005577 Bacteria 2491
334 Ga0068857_100151335 3300005577 Bacteria 2102
335 Ga0068854_100000364 3300005578 Bacteria 28993
336 Ga0068854_100002461 3300005578 Bacteria 11467
337 Ga0068854_100004852 3300005578 Bacteria 8481
338 Ga0068854_100004964 3300005578 Bacteria 8385
339 Ga0068854_100033398 3300005578 Bacteria 3587
340 Ga0068854_100050526 3300005578 Bacteria 2975
341 Ga0068854_100053210 3300005578 Bacteria 2906
342 Ga0068854_100059901 3300005578 Bacteria 2752
343 Ga0068854_100065364 3300005578 Bacteria 2644
344 Ga0068854_100068462 3300005578 Bacteria 2588
345 Ga0068856_100000829 3300005614 Bacteria 33313
346 Ga0068856_100010860 3300005614 Bacteria 8841
347 Ga0068856_100046785 3300005614 Bacteria 4261
348 Ga0068856_100053048 3300005614 Bacteria 3999
349 Ga0068856_100059917 3300005614 Bacteria 3760
350 Ga0068856_100061887 3300005614 Bacteria 3697
351 Ga0068856_100066579 3300005614 Bacteria 3559
352 Ga0068856_100075471 3300005614 Bacteria 3339
353 Ga0068856_100094898 3300005614 Bacteria 2970
354 Ga0068856_100122582 3300005614 Bacteria 2602
355 Ga0068856_100136283 3300005614 Bacteria 2460
356 Ga0068856_100175132 3300005614 Bacteria 2158
357 Ga0068856_100200398 3300005614 Bacteria 2010
358 Ga0068856_100227336 3300005614 Bacteria 1881
359 Ga0070702_100046172 3300005615 Bacteria 2468
360 Ga0068852_100000562 3300005616 Bacteria 24464
361 Ga0068852_100000873 3300005616 Bacteria 19972
362 Ga0068852_100001212 3300005616 Bacteria 17137
363 Ga0068852_100001950 3300005616 Bacteria 14049
364 Ga0068852_100004387 3300005616 Bacteria 9969
365 Ga0068852_100006637 3300005616 Bacteria 8384
366 Ga0068852_100007117 3300005616 Bacteria 8149
367 Ga0068852_100054030 3300005616 Bacteria 3461
368 Ga0068852_100055228 3300005616 Bacteria 3427
369 Ga0068852_100090986 3300005616 Bacteria 2730
370 Ga0068852_100198971 3300005616 Bacteria 1895
371 Ga0068852_100216062 3300005616 Bacteria 1821
372 Ga0068852_100226779 3300005616 Bacteria 1779
373 Ga0068859_100000256 3300005617 Bacteria 52870
374 Ga0068859_100000934 3300005617 Bacteria 29961
375 Ga0068859_100011472 3300005617 Bacteria 8909
376 Ga0068859_100013301 3300005617 Bacteria 8258
377 Ga0068859_100021498 3300005617 Bacteria 6476
378 Ga0068859_100027722 3300005617 Bacteria 5681
379 Ga0068859_100027869 3300005617 Bacteria 5665
380 Ga0068859_100036265 3300005617 Bacteria 4950
381 Ga0068859_100039692 3300005617 Bacteria 4723
382 Ga0068859_100052253 3300005617 Bacteria 4108
383 Ga0068859_100059901 3300005617 Bacteria 3836
384 Ga0068859_100129835 3300005617 Bacteria 2591
385 Ga0068859_100163620 3300005617 Bacteria 2304
386 Ga0068864_100000181 3300005618 Bacteria 58221
387 Ga0068864_100000311 3300005618 Bacteria 42930
388 Ga0068864_100000557 3300005618 Bacteria 31825
389 Ga0068864_100001437 3300005618 Bacteria 19648
390 Ga0068864_100008287 3300005618 Bacteria 8572
391 Ga0068864_100008907 3300005618 Bacteria 8272
392 Ga0068864_100030651 3300005618 Bacteria 4560
393 Ga0068864_100037785 3300005618 Bacteria 4122
394 Ga0068864_100071293 3300005618 Bacteria 3025
395 Ga0068864_100085435 3300005618 Bacteria 2774
396 Ga0068864_100089377 3300005618 Bacteria 2714
397 Ga0068864_100128660 3300005618 Bacteria 2272
398 Ga0068866_10001658 3300005718 Bacteria 9387
399 Ga0068866_10015285 3300005718 Bacteria 3407
400 Ga0068866_10063023 3300005718 Bacteria 1931
401 Ga0068861_100000799 3300005719 Bacteria 18980
402 Ga0068861_100048671 3300005719 Bacteria 3206
403 Ga0068851_10000728 3300005834 Bacteria 14046
404 Ga0068851_10005529 3300005834 Bacteria 5728
405 Ga0068851_10013200 3300005834 Bacteria 3908
406 Ga0068870_10026956 3300005840 Bacteria 2870
407 Ga0068863_100000569 3300005841 Bacteria 37520
408 Ga0068863_100000719 3300005841 Bacteria 33262
409 Ga0068863_100006708 3300005841 Bacteria 11291
410 Ga0068863_100008083 3300005841 Bacteria 10273
411 Ga0068863_100012971 3300005841 Bacteria 8036
412 Ga0068863_100013287 3300005841 Bacteria 7946
413 Ga0068863_100015195 3300005841 Bacteria 7397
414 Ga0068863_100017467 3300005841 Bacteria 6878
415 Ga0068863_100039885 3300005841 Bacteria 4465
416 Ga0068863_100046237 3300005841 Bacteria 4131
417 Ga0068863_100066963 3300005841 Bacteria 3397
418 Ga0068863_100095941 3300005841 Bacteria 2815
419 Ga0068863_100118876 3300005841 Bacteria 2519
420 Ga0068863_100174588 3300005841 Bacteria 2062
421 Ga0068858_100000604 3300005842 Bacteria 37527
422 Ga0068858_100004720 3300005842 Bacteria 13342
423 Ga0068858_100004993 3300005842 Bacteria 12999
424 Ga0068858_100006789 3300005842 Bacteria 11135
425 Ga0068858_100011411 3300005842 Bacteria 8388
426 Ga0068858_100013651 3300005842 Bacteria 7666
427 Ga0068858_100018420 3300005842 Bacteria 6537
428 Ga0068858_100024570 3300005842 Bacteria 5614
429 Ga0068858_100039030 3300005842 Bacteria 4405
430 Ga0068858_100051078 3300005842 Bacteria 3825
431 Ga0068860_100000049 3300005843 Bacteria 208782
432 Ga0068860_100003135 3300005843 Bacteria 17080
433 Ga0068860_100005988 3300005843 Bacteria 12240
434 Ga0068860_100007356 3300005843 Bacteria 11009
435 Ga0068860_100021242 3300005843 Bacteria 6287
436 Ga0068860_100038262 3300005843 Bacteria 4589
437 Ga0068860_100043630 3300005843 Bacteria 4277
438 Ga0068860_100101412 3300005843 Bacteria 2746
439 Ga0068862_100000085 3300005844 Bacteria 110879
440 Ga0068862_100000310 3300005844 Bacteria 53315
441 Ga0068862_100002193 3300005844 Bacteria 17520
442 Ga0068862_100005678 3300005844 Bacteria 10412
443 Ga0068862_100009029 3300005844 Bacteria 8249
444 Ga0068862_100009905 3300005844 Bacteria 7871
445 Ga0068862_100023574 3300005844 Bacteria 5157
446 Ga0081539_10026310 3300005985 Bacteria 3716
447 Ga0070717_10009374 3300006028 Bacteria 7352
448 Ga0075368_10013040 3300006042 Bacteria 3048
449 Ga0075364_10029836 3300006051 Bacteria 3498
450 Ga0070712_100024403 3300006175 Bacteria 4007
451 Ga0075367_10000693 3300006178 Bacteria 12967
452 Ga0097621_100017686 3300006237 Bacteria 5422
453 Ga0097621_100049829 3300006237 Bacteria 3404
454 Ga0097621_100067298 3300006237 Bacteria 2952
455 Ga0097621_100105948 3300006237 Bacteria 2371
456 Ga0097621_100152642 3300006237 Bacteria 1981
457 Ga0075370_10031464 3300006353 Bacteria 2962
458 Ga0068871_100006264 3300006358 Bacteria 8393
459 Ga0068871_100009802 3300006358 Bacteria 6950
460 Ga0068871_100013480 3300006358 Bacteria 6068
461 Ga0068871_100025827 3300006358 Bacteria 4576
462 Ga0075431_100011561 3300006847 Bacteria 8904
463 Ga0075433_10052827 3300006852 Bacteria 3541
464 Ga0075434_100024751 3300006871 Bacteria 5871
465 Ga0075429_100240242 3300006880 Bacteria 1587
466 Ga0068865_100001641 3300006881 Bacteria 13103
467 Ga0068865_100040146 3300006881 Bacteria 3178
468 Ga0097620_100000256 3300006931 Bacteria 52870
469 Ga0097620_100000934 3300006931 Bacteria 29961
470 Ga0097620_100011472 3300006931 Bacteria 8909
471 Ga0097620_100013301 3300006931 Bacteria 8258
472 Ga0097620_100027720 3300006931 Bacteria 5681
473 Ga0097620_100027868 3300006931 Bacteria 5665
474 Ga0097620_100036261 3300006931 Bacteria 4950
475 Ga0097620_100039695 3300006931 Bacteria 4723
476 Ga0097620_100052249 3300006931 Bacteria 4108
477 Ga0097620_100059901 3300006931 Bacteria 3836
478 Ga0097620_100163621 3300006931 Bacteria 2304
479 Ga0097620_100421011 3300006931 Bacteria 1432
480 Ga0105251_10020072 3300009011 Bacteria 3517
481 Ga0105240_10011419 3300009093 Bacteria 12372
482 Ga0105240_10030632 3300009093 Bacteria 6991
483 Ga0105240_10041913 3300009093 Bacteria 5838
484 Ga0105240_10050298 3300009093 Bacteria 5255
485 Ga0105240_10195299 3300009093 Bacteria 2377
486 Ga0105240_10210415 3300009093 Bacteria 2273
487 Ga0105240_10348507 3300009093 Bacteria 1680
488 Ga0111539_10256101 3300009094 Bacteria 2038
489 Ga0111539_10532255 3300009094 Bacteria 1369
490 Ga0105245_10000120 3300009098 Bacteria 75923
491 Ga0105245_10020419 3300009098 Bacteria 5810
492 Ga0105245_10030338 3300009098 Bacteria 4780
493 Ga0105247_10000644 3300009101 Bacteria 27956
494 Ga0105247_10011390 3300009101 Bacteria 5362
495 Ga0105247_10086353 3300009101 Bacteria 1985
496 Ga0114129_10337894 3300009147 Bacteria 1998
497 Ga0114129_10405919 3300009147 Bacteria 1795
498 Ga0105243_10067773 3300009148 Bacteria 2874
499 Ga0105243_10091825 3300009148 Bacteria 2501
500 Ga0105243_10184287 3300009148 Bacteria 1818
501 Ga0105243_10286067 3300009148 Bacteria 1487
502 Ga0105241_10039269 3300009174 Bacteria 3570
503 Ga0105241_10041363 3300009174 Bacteria 3482
504 Ga0105241_10045673 3300009174 Bacteria 3325
505 Ga0105241_10054294 3300009174 Bacteria 3066
506 Ga0105241_10084562 3300009174 Bacteria 2491
507 Ga0105241_10085666 3300009174 Bacteria 2477
508 Ga0105241_10219380 3300009174 Bacteria 1597
509 Ga0105242_10010689 3300009176 Bacteria 7047
510 Ga0105248_10000070 3300009177 Bacteria 119985
511 Ga0105248_10000256 3300009177 Bacteria 62138
512 Ga0105248_10001737 3300009177 Bacteria 24220
513 Ga0105248_10002097 3300009177 Bacteria 22084
514 Ga0105248_10003558 3300009177 Bacteria 17262
515 Ga0105248_10007477 3300009177 Bacteria 11985
516 Ga0105248_10019537 3300009177 Bacteria 7499
517 Ga0105248_10019923 3300009177 Bacteria 7425
518 Ga0105248_10021968 3300009177 Bacteria 7071
519 Ga0105248_10026591 3300009177 Bacteria 6436
520 Ga0105248_10027530 3300009177 Bacteria 6329
521 Ga0105248_10032272 3300009177 Bacteria 5855
522 Ga0105248_10039049 3300009177 Bacteria 5315
523 Ga0105248_10060248 3300009177 Bacteria 4261
524 Ga0105248_10152983 3300009177 Bacteria 2603
525 Ga0105248_10177821 3300009177 Bacteria 2398
526 Ga0105248_10333120 3300009177 Bacteria 1709
527 Ga0105248_10446931 3300009177 Bacteria 1456
528 Ga0105237_10013388 3300009545 Bacteria 8605
529 Ga0105237_10020582 3300009545 Bacteria 6798
530 Ga0105237_10027818 3300009545 Bacteria 5762
531 Ga0105237_10329072 3300009545 Bacteria 1532
532 Ga0105238_10025796 3300009551 Bacteria 5992
533 Ga0105238_10047795 3300009551 Bacteria 4313
534 Ga0105238_10055862 3300009551 Bacteria 3962
535 Ga0105238_10065393 3300009551 Bacteria 3638
536 Ga0105238_10065954 3300009551 Bacteria 3621
537 Ga0105238_10068384 3300009551 Bacteria 3553
538 Ga0105238_10112342 3300009551 Bacteria 2704
539 Ga0105238_10136630 3300009551 Bacteria 2429
540 Ga0105249_10000038 3300009553 Bacteria 196425
541 Ga0105249_10002324 3300009553 Bacteria 16499
542 Ga0105249_10004370 3300009553 Bacteria 12222
543 Ga0105249_10029045 3300009553 Bacteria 4993
544 Ga0105148_100289 3300009978 Bacteria 6591
545 Ga0105239_10047199 3300010375 Bacteria 4720
546 Ga0105239_10094645 3300010375 Bacteria 3300
547 Ga0105239_10131513 3300010375 Bacteria 2784
548 Ga0105246_10001420 3300011119 Bacteria 14190
549 Ga0105246_10009720 3300011119 Bacteria 5928
550 Ga0105246_10048996 3300011119 Bacteria 2891
551 Ga0157373_10002630 3300013100 Bacteria 13620
552 Ga0157373_10005459 3300013100 Bacteria 9546
553 Ga0157373_10009971 3300013100 Bacteria 7000
554 Ga0157373_10010407 3300013100 Bacteria 6842
555 Ga0157373_10027525 3300013100 Bacteria 4102
556 Ga0157373_10027912 3300013100 Bacteria 4072
557 Ga0157373_10040401 3300013100 Bacteria 3338
558 Ga0157373_10048963 3300013100 Bacteria 3013
559 Ga0157373_10049670 3300013100 Bacteria 2988
560 Ga0157373_10127969 3300013100 Bacteria 1786
561 Ga0157373_10140883 3300013100 Bacteria 1696
562 Ga0157371_10000784 3300013102 Bacteria 36573
563 Ga0157371_10002887 3300013102 Bacteria 16074
564 Ga0157371_10008375 3300013102 Bacteria 8245
565 Ga0157371_10010504 3300013102 Bacteria 7200
566 Ga0157371_10014064 3300013102 Bacteria 6054
567 Ga0157371_10022054 3300013102 Bacteria 4672
568 Ga0157371_10027607 3300013102 Bacteria 4116
569 Ga0157371_10040907 3300013102 Bacteria 3309
570 Ga0157371_10049670 3300013102 Bacteria 2979
571 Ga0157371_10050162 3300013102 Bacteria 2965
572 Ga0157371_10052524 3300013102 Bacteria 2894
573 Ga0157371_10069443 3300013102 Bacteria 2495
574 Ga0157371_10102172 3300013102 Bacteria 2034
575 Ga0157371_10133674 3300013102 Bacteria 1765
576 Ga0157371_10143968 3300013102 Bacteria 1698
577 Ga0157370_10003273 3300013104 Bacteria 19092
578 Ga0157370_10008380 3300013104 Bacteria 11149
579 Ga0157370_10020698 3300013104 Bacteria 6564
580 Ga0157370_10080709 3300013104 Bacteria 3062
581 Ga0157370_10087520 3300013104 Bacteria 2926
582 Ga0157370_10095079 3300013104 Bacteria 2796
583 Ga0157370_10140919 3300013104 Bacteria 2246
584 Ga0157370_10143966 3300013104 Bacteria 2220
585 Ga0157370_10297870 3300013104 Bacteria 1489
586 Ga0157369_10000751 3300013105 Bacteria 41778
587 Ga0157369_10001571 3300013105 Bacteria 27954
588 Ga0157369_10003767 3300013105 Bacteria 18025
589 Ga0157369_10053506 3300013105 Bacteria 4363
590 Ga0157369_10082337 3300013105 Bacteria 3443
591 Ga0157369_10094651 3300013105 Bacteria 3188
592 Ga0157369_10102853 3300013105 Bacteria 3043
593 Ga0157369_10147134 3300013105 Bacteria 2491
594 Ga0157369_10183756 3300013105 Bacteria 2199
595 Ga0157369_10194677 3300013105 Bacteria 2129
596 Ga0157369_10243694 3300013105 Bacteria 1877
597 Ga0157369_10266977 3300013105 Bacteria 1784
598 Ga0157374_10005615 3300013296 Bacteria 10568
599 Ga0157374_10007053 3300013296 Bacteria 9568
600 Ga0157374_10027077 3300013296 Bacteria 5166
601 Ga0157374_10052142 3300013296 Bacteria 3809
602 Ga0157374_10066164 3300013296 Bacteria 3396
603 Ga0157374_10208434 3300013296 Bacteria 1916
604 Ga0157378_10002232 3300013297 Bacteria 17178
605 Ga0157378_10005483 3300013297 Bacteria 11119
606 Ga0157378_10057063 3300013297 Bacteria 3479
607 Ga0157378_10138353 3300013297 Bacteria 2259
608 Ga0163162_10001484 3300013306 Bacteria 21851
609 Ga0163162_10035573 3300013306 Bacteria 4961
610 Ga0163162_10065914 3300013306 Bacteria 3670
611 Ga0163162_10073877 3300013306 Bacteria 3467
612 Ga0163162_10107380 3300013306 Bacteria 2887
613 Ga0163162_10122828 3300013306 Bacteria 2701
614 Ga0163162_10145202 3300013306 Bacteria 2488
615 Ga0163162_10177166 3300013306 Bacteria 2258
616 Ga0163162_10192679 3300013306 Bacteria 2166
617 Ga0157372_10025167 3300013307 Bacteria 6468
618 Ga0157372_10025215 3300013307 Bacteria 6462
619 Ga0157372_10064461 3300013307 Bacteria 4111
620 Ga0157372_10181037 3300013307 Bacteria 2439
621 Ga0157372_10445933 3300013307 Bacteria 1508
622 Ga0157375_10000751 3300013308 Bacteria 28432
623 Ga0157375_10037868 3300013308 Bacteria 4626
624 Ga0157375_10067854 3300013308 Bacteria 3565
625 Ga0157375_10108245 3300013308 Bacteria 2874
626 Ga0157375_10154411 3300013308 Bacteria 2433
627 Ga0157375_10156917 3300013308 Bacteria 2415
628 Ga0157375_10171251 3300013308 Bacteria 2319
629 Ga0157375_10354575 3300013308 Bacteria 1633
630 Ga0157375_10519604 3300013308 Bacteria 1354
631 Ga0163163_10005302 3300014325 Bacteria 11130
632 Ga0163163_10022419 3300014325 Bacteria 5980
633 Ga0163163_10035865 3300014325 Bacteria 4815
634 Ga0163163_10039047 3300014325 Bacteria 4631
635 Ga0163163_10048817 3300014325 Bacteria 4164
636 Ga0163163_10072705 3300014325 Bacteria 3428
637 Ga0157380_10013211 3300014326 Bacteria 6014
638 Ga0157380_10119667 3300014326 Bacteria 2228
639 Ga0157380_10256620 3300014326 Bacteria 1585
640 Ga0157377_10004909 3300014745 Bacteria 6224
641 Ga0157379_10014941 3300014968 Bacteria 6808
642 Ga0157379_10027131 3300014968 Bacteria 5098
643 Ga0157379_10081005 3300014968 Bacteria 2908
644 Ga0157379_10085012 3300014968 Bacteria 2835
645 Ga0157376_10026327 3300014969 Bacteria 4594
646 Ga0157376_10425063 3300014969 Bacteria 1290
647 Ga0163161_10011142 3300017792 Bacteria 6230
648 Ga0163161_10042729 3300017792 Bacteria 3262
649 Ga0206356_10594826 3300020070 Bacteria 2182
650 Ga0213875_10000101 3300021388 Bacteria 96957
651 Ga0213875_10003385 3300021388 Bacteria 9085
652 Ga0209147_101153 3300025229 Bacteria 10857
653 Ga0207673_1001556 3300025290 Bacteria 2526
654 Ga0207697_10000260 3300025315 Bacteria 29097
655 Ga0207697_10000419 3300025315 Bacteria 24002
656 Ga0207656_10000908 3300025321 Bacteria 9633
657 Ga0207656_10000912 3300025321 Bacteria 9622
658 Ga0207656_10012002 3300025321 Bacteria 3286
659 Ga0207656_10018122 3300025321 Bacteria 2767
660 Ga0207656_10032163 3300025321 Bacteria 2178
661 Ga0207656_10049099 3300025321 Bacteria 1819
662 Ga0207656_10056269 3300025321 Bacteria 1714
663 Ga0207682_10003272 3300025893 Bacteria 7085
664 Ga0207682_10008944 3300025893 Bacteria 3959
665 Ga0207682_10024452 3300025893 Bacteria 2392
666 Ga0207682_10057038 3300025893 Bacteria 1627
667 Ga0207642_10002708 3300025899 Bacteria 5533
668 Ga0207642_10055655 3300025899 Bacteria 1811
669 Ga0207688_10000225 3300025901 Bacteria 25468
670 Ga0207688_10018057 3300025901 Bacteria 3839
671 Ga0207688_10053791 3300025901 Bacteria 2258
672 Ga0207680_10000517 3300025903 Bacteria 18430
673 Ga0207680_10001684 3300025903 Bacteria 10445
674 Ga0207680_10001861 3300025903 Bacteria 9902
675 Ga0207680_10009007 3300025903 Bacteria 4928
676 Ga0207680_10009702 3300025903 Bacteria 4787
677 Ga0207680_10034114 3300025903 Bacteria 2909
678 Ga0207680_10082110 3300025903 Bacteria 2027
679 Ga0207647_10000052 3300025904 Bacteria 87651
680 Ga0207647_10000744 3300025904 Bacteria 25574
681 Ga0207647_10000875 3300025904 Bacteria 23349
682 Ga0207647_10002329 3300025904 Bacteria 14424
683 Ga0207647_10005186 3300025904 Bacteria 9587
684 Ga0207647_10005198 3300025904 Bacteria 9575
685 Ga0207647_10010025 3300025904 Bacteria 6708
686 Ga0207647_10018506 3300025904 Bacteria 4708
687 Ga0207647_10022454 3300025904 Bacteria 4190
688 Ga0207647_10022826 3300025904 Bacteria 4150
689 Ga0207647_10024116 3300025904 Bacteria 4013
690 Ga0207647_10026391 3300025904 Bacteria 3802
691 Ga0207647_10027096 3300025904 Bacteria 3740
692 Ga0207647_10032704 3300025904 Bacteria 3338
693 Ga0207647_10039478 3300025904 Bacteria 2977
694 Ga0207647_10066391 3300025904 Bacteria 2187
695 Ga0207699_10183700 3300025906 Bacteria 1407
696 Ga0207645_10004643 3300025907 Bacteria 10116
697 Ga0207645_10011912 3300025907 Bacteria 5918
698 Ga0207645_10013998 3300025907 Bacteria 5381
699 Ga0207645_10019028 3300025907 Bacteria 4510
700 Ga0207645_10030780 3300025907 Bacteria 3458
701 Ga0207645_10084803 3300025907 Bacteria 2033
702 Ga0207645_10086938 3300025907 Bacteria 2008
703 Ga0207705_10000033 3300025909 Bacteria 223997
704 Ga0207705_10000082 3300025909 Bacteria 118194
705 Ga0207705_10000260 3300025909 Bacteria 51366
706 Ga0207705_10000333 3300025909 Bacteria 42908
707 Ga0207705_10000577 3300025909 Bacteria 30703
708 Ga0207705_10002565 3300025909 Bacteria 13966
709 Ga0207705_10003299 3300025909 Bacteria 12286
710 Ga0207705_10006631 3300025909 Bacteria 8569
711 Ga0207705_10009500 3300025909 Bacteria 7076
712 Ga0207705_10009543 3300025909 Bacteria 7061
713 Ga0207705_10010443 3300025909 Bacteria 6751
714 Ga0207705_10016173 3300025909 Bacteria 5352
715 Ga0207705_10026516 3300025909 Bacteria 4132
716 Ga0207705_10026931 3300025909 Bacteria 4097
717 Ga0207705_10051733 3300025909 Bacteria 2956
718 Ga0207705_10052820 3300025909 Bacteria 2927
719 Ga0207705_10063922 3300025909 Bacteria 2659
720 Ga0207705_10080356 3300025909 Bacteria 2376
721 Ga0207705_10087607 3300025909 Bacteria 2277
722 Ga0207654_10059079 3300025911 Bacteria 2235
723 Ga0207707_10072032 3300025912 Bacteria 3012
724 Ga0207707_10093603 3300025912 Bacteria 2625
725 Ga0207707_10119734 3300025912 Bacteria 2301
726 Ga0207695_10003918 3300025913 Bacteria 20595
727 Ga0207695_10007084 3300025913 Bacteria 14369
728 Ga0207695_10038671 3300025913 Bacteria 5133
729 Ga0207695_10092920 3300025913 Bacteria 3027
730 Ga0207695_10125657 3300025913 Bacteria 2527
731 Ga0207671_10090708 3300025914 Bacteria 2302
732 Ga0207671_10121996 3300025914 Bacteria 1993
733 Ga0207693_10016769 3300025915 Bacteria 5849
734 Ga0207693_10025441 3300025915 Bacteria 4693
735 Ga0207660_10000059 3300025917 Bacteria 56766
736 Ga0207660_10000092 3300025917 Bacteria 48931
737 Ga0207660_10001996 3300025917 Bacteria 13594
738 Ga0207660_10010582 3300025917 Bacteria 5991
739 Ga0207660_10012618 3300025917 Bacteria 5534
740 Ga0207660_10024076 3300025917 Bacteria 4118
741 Ga0207660_10062717 3300025917 Bacteria 2678
742 Ga0207660_10129287 3300025917 Bacteria 1921
743 Ga0207657_10000031 3300025919 Bacteria 132167
744 Ga0207657_10000058 3300025919 Bacteria 103811
745 Ga0207657_10000088 3300025919 Bacteria 88065
746 Ga0207657_10000228 3300025919 Bacteria 58838
747 Ga0207657_10001070 3300025919 Bacteria 28973
748 Ga0207657_10001318 3300025919 Bacteria 26369
749 Ga0207657_10001965 3300025919 Bacteria 22197
750 Ga0207657_10002036 3300025919 Bacteria 21865
751 Ga0207657_10003247 3300025919 Bacteria 17412
752 Ga0207657_10004138 3300025919 Bacteria 15384
753 Ga0207657_10005696 3300025919 Bacteria 12999
754 Ga0207657_10007120 3300025919 Bacteria 11485
755 Ga0207657_10007817 3300025919 Bacteria 10914
756 Ga0207657_10009829 3300025919 Bacteria 9583
757 Ga0207657_10015566 3300025919 Bacteria 7363
758 Ga0207657_10020019 3300025919 Bacteria 6338
759 Ga0207657_10022585 3300025919 Bacteria 5882
760 Ga0207657_10029188 3300025919 Bacteria 5024
761 Ga0207657_10030591 3300025919 Bacteria 4885
762 Ga0207657_10035242 3300025919 Bacteria 4489
763 Ga0207657_10037304 3300025919 Bacteria 4341
764 Ga0207657_10057146 3300025919 Bacteria 3364
765 Ga0207657_10059002 3300025919 Bacteria 3300
766 Ga0207657_10075937 3300025919 Bacteria 2836
767 Ga0207657_10092482 3300025919 Bacteria 2521
768 Ga0207657_10103227 3300025919 Bacteria 2363
769 Ga0207657_10130568 3300025919 Bacteria 2059
770 Ga0207657_10137229 3300025919 Bacteria 2000
771 Ga0207649_10000394 3300025920 Bacteria 32788
772 Ga0207649_10000848 3300025920 Bacteria 19645
773 Ga0207649_10002615 3300025920 Bacteria 10000
774 Ga0207649_10003528 3300025920 Bacteria 8552
775 Ga0207649_10008671 3300025920 Bacteria 5554
776 Ga0207649_10019851 3300025920 Bacteria 3847
777 Ga0207649_10021941 3300025920 Bacteria 3684
778 Ga0207649_10023587 3300025920 Bacteria 3565
779 Ga0207649_10032277 3300025920 Bacteria 3120
780 Ga0207649_10041003 3300025920 Bacteria 2817
781 Ga0207649_10072866 3300025920 Bacteria 2199
782 Ga0207649_10089651 3300025920 Bacteria 2011
783 Ga0207649_10108811 3300025920 Bacteria 1848
784 Ga0207652_10004032 3300025921 Bacteria 11988
785 Ga0207652_10074823 3300025921 Bacteria 2949
786 Ga0207652_10150646 3300025921 Bacteria 2083
787 Ga0207652_10167850 3300025921 Bacteria 1969
788 Ga0207681_10000004 3300025923 Bacteria 559005
789 Ga0207681_10029297 3300025923 Bacteria 3574
790 Ga0207681_10043401 3300025923 Bacteria 3009
791 Ga0207681_10076945 3300025923 Bacteria 2344
792 Ga0207681_10093205 3300025923 Bacteria 2155
793 Ga0207681_10256732 3300025923 Bacteria 1367
794 Ga0207694_10002110 3300025924 Bacteria 16396
795 Ga0207694_10024834 3300025924 Bacteria 4551
796 Ga0207694_10040314 3300025924 Bacteria 3595
797 Ga0207694_10080747 3300025924 Bacteria 2553
798 Ga0207694_10122497 3300025924 Bacteria 2077
799 Ga0207650_10004803 3300025925 Bacteria 9231
800 Ga0207650_10007330 3300025925 Bacteria 7511
801 Ga0207650_10009574 3300025925 Bacteria 6626
802 Ga0207650_10013470 3300025925 Bacteria 5663
803 Ga0207650_10015917 3300025925 Bacteria 5247
804 Ga0207650_10020528 3300025925 Bacteria 4659
805 Ga0207650_10023803 3300025925 Bacteria 4348
806 Ga0207650_10032014 3300025925 Bacteria 3803
807 Ga0207650_10043927 3300025925 Bacteria 3283
808 Ga0207650_10116166 3300025925 Bacteria 2078
809 Ga0207650_10202525 3300025925 Bacteria 1591
810 Ga0207650_10231506 3300025925 Bacteria 1490
811 Ga0207659_10002600 3300025926 Bacteria 10750
812 Ga0207659_10028462 3300025926 Bacteria 3798
813 Ga0207659_10042780 3300025926 Bacteria 3178
814 Ga0207659_10078622 3300025926 Bacteria 2431
815 Ga0207659_10124275 3300025926 Bacteria 1982
816 Ga0207687_10001946 3300025927 Bacteria 14206
817 Ga0207687_10017436 3300025927 Bacteria 4729
818 Ga0207687_10120019 3300025927 Bacteria 1965
819 Ga0207700_10018015 3300025928 Bacteria 4732
820 Ga0207664_10026604 3300025929 Bacteria 4375
821 Ga0207664_10154405 3300025929 Bacteria 1953
822 Ga0207664_10212956 3300025929 Bacteria 1673
823 Ga0207644_10000009 3300025931 Bacteria 251643
824 Ga0207644_10000541 3300025931 Bacteria 24562
825 Ga0207644_10000804 3300025931 Bacteria 19896
826 Ga0207644_10000960 3300025931 Bacteria 18405
827 Ga0207644_10001058 3300025931 Bacteria 17593
828 Ga0207644_10001995 3300025931 Bacteria 13214
829 Ga0207644_10003712 3300025931 Bacteria 9889
830 Ga0207644_10005104 3300025931 Bacteria 8574
831 Ga0207644_10005412 3300025931 Bacteria 8324
832 Ga0207644_10020682 3300025931 Bacteria 4477
833 Ga0207644_10023947 3300025931 Bacteria 4187
834 Ga0207644_10076022 3300025931 Bacteria 2469
835 Ga0207644_10122427 3300025931 Bacteria 1982
836 Ga0207690_10000030 3300025932 Bacteria 156832
837 Ga0207690_10000382 3300025932 Bacteria 29300
838 Ga0207690_10002468 3300025932 Bacteria 11176
839 Ga0207690_10003285 3300025932 Bacteria 9681
840 Ga0207690_10004823 3300025932 Bacteria 7958
841 Ga0207690_10004981 3300025932 Bacteria 7842
842 Ga0207690_10010152 3300025932 Bacteria 5593
843 Ga0207690_10012987 3300025932 Bacteria 4993
844 Ga0207690_10013257 3300025932 Bacteria 4949
845 Ga0207690_10019720 3300025932 Bacteria 4157
846 Ga0207690_10030137 3300025932 Bacteria 3457
847 Ga0207690_10061894 3300025932 Bacteria 2546
848 Ga0207690_10211005 3300025932 Bacteria 1480
849 Ga0207706_10000028 3300025933 Bacteria 149092
850 Ga0207706_10001051 3300025933 Bacteria 28061
851 Ga0207706_10001178 3300025933 Bacteria 26405
852 Ga0207706_10001436 3300025933 Bacteria 23850
853 Ga0207706_10003751 3300025933 Bacteria 14492
854 Ga0207706_10015864 3300025933 Bacteria 6810
855 Ga0207706_10023100 3300025933 Bacteria 5585
856 Ga0207706_10025601 3300025933 Bacteria 5285
857 Ga0207706_10027955 3300025933 Bacteria 5040
858 Ga0207706_10029636 3300025933 Bacteria 4885
859 Ga0207706_10029671 3300025933 Bacteria 4882
860 Ga0207706_10032125 3300025933 Bacteria 4674
861 Ga0207706_10033418 3300025933 Bacteria 4579
862 Ga0207706_10037742 3300025933 Bacteria 4288
863 Ga0207706_10046285 3300025933 Bacteria 3852
864 Ga0207706_10051673 3300025933 Bacteria 3629
865 Ga0207706_10057998 3300025933 Bacteria 3411
866 Ga0207706_10060755 3300025933 Bacteria 3328
867 Ga0207706_10073406 3300025933 Bacteria 3008
868 Ga0207706_10083819 3300025933 Bacteria 2803
869 Ga0207706_10134631 3300025933 Bacteria 2173
870 Ga0207709_10203590 3300025935 Bacteria 1415
871 Ga0207670_10066174 3300025936 Bacteria 2482
872 Ga0207669_10032241 3300025937 Bacteria 2940
873 Ga0207669_10050364 3300025937 Bacteria 2489
874 Ga0207669_10104841 3300025937 Bacteria 1879
875 Ga0207704_10025132 3300025938 Bacteria 3245
876 Ga0207691_10000114 3300025940 Bacteria 72745
877 Ga0207691_10000954 3300025940 Bacteria 28639
878 Ga0207691_10006076 3300025940 Bacteria 11667
879 Ga0207691_10006787 3300025940 Bacteria 11038
880 Ga0207691_10022747 3300025940 Bacteria 5909
881 Ga0207691_10038144 3300025940 Bacteria 4445
882 Ga0207691_10042720 3300025940 Bacteria 4178
883 Ga0207711_10000051 3300025941 Bacteria 140854
884 Ga0207711_10000055 3300025941 Bacteria 136126
885 Ga0207711_10001375 3300025941 Bacteria 22908
886 Ga0207711_10002646 3300025941 Bacteria 15840
887 Ga0207711_10003374 3300025941 Bacteria 13834
888 Ga0207711_10004639 3300025941 Bacteria 11676
889 Ga0207711_10006300 3300025941 Bacteria 10008
890 Ga0207711_10008690 3300025941 Bacteria 8497
891 Ga0207711_10009269 3300025941 Bacteria 8217
892 Ga0207711_10009982 3300025941 Bacteria 7890
893 Ga0207711_10010332 3300025941 Bacteria 7755
894 Ga0207711_10015900 3300025941 Bacteria 6241
895 Ga0207711_10028578 3300025941 Bacteria 4694
896 Ga0207711_10065132 3300025941 Bacteria 3149
897 Ga0207711_10186726 3300025941 Bacteria 1887
898 Ga0207689_10000014 3300025942 Bacteria 122534
899 Ga0207689_10008088 3300025942 Bacteria 9172
900 Ga0207689_10028006 3300025942 Bacteria 4713
901 Ga0207689_10058721 3300025942 Bacteria 3164
902 Ga0207689_10071424 3300025942 Bacteria 2851
903 Ga0207661_10007677 3300025944 Bacteria 7676
904 Ga0207661_10013121 3300025944 Bacteria 6046
905 Ga0207661_10040919 3300025944 Bacteria 3646
906 Ga0207661_10047145 3300025944 Bacteria 3419
907 Ga0207661_10067879 3300025944 Bacteria 2901
908 Ga0207661_10227561 3300025944 Bacteria 1650
909 Ga0207679_10000488 3300025945 Bacteria 27329
910 Ga0207679_10000876 3300025945 Bacteria 19206
911 Ga0207679_10012241 3300025945 Bacteria 5590
912 Ga0207679_10026128 3300025945 Bacteria 4024
913 Ga0207679_10056164 3300025945 Bacteria 2906
914 Ga0207679_10074125 3300025945 Bacteria 2578
915 Ga0207679_10124311 3300025945 Bacteria 2059
916 Ga0207679_10134726 3300025945 Bacteria 1987
917 Ga0207667_10000114 3300025949 Bacteria 128923
918 Ga0207667_10003386 3300025949 Bacteria 19669
919 Ga0207667_10004952 3300025949 Bacteria 16269
920 Ga0207667_10006779 3300025949 Bacteria 13834
921 Ga0207667_10013060 3300025949 Bacteria 9534
922 Ga0207667_10037725 3300025949 Bacteria 5165
923 Ga0207667_10038724 3300025949 Bacteria 5087
924 Ga0207667_10054220 3300025949 Bacteria 4217
925 Ga0207667_10077060 3300025949 Bacteria 3458
926 Ga0207667_10102280 3300025949 Bacteria 2956
927 Ga0207667_10130674 3300025949 Bacteria 2587
928 Ga0207667_10157632 3300025949 Bacteria 2336
929 Ga0207667_10165028 3300025949 Bacteria 2277
930 Ga0207651_10000066 3300025960 Bacteria 47049
931 Ga0207651_10000289 3300025960 Bacteria 21606
932 Ga0207651_10001715 3300025960 Bacteria 10118
933 Ga0207651_10017630 3300025960 Bacteria 4223
934 Ga0207651_10022534 3300025960 Bacteria 3853
935 Ga0207651_10036558 3300025960 Bacteria 3207
936 Ga0207651_10057592 3300025960 Bacteria 2681
937 Ga0207651_10200101 3300025960 Bacteria 1600
938 Ga0207651_10203315 3300025960 Bacteria 1589
939 Ga0207712_10000002 3300025961 Bacteria 706628
940 Ga0207712_10000629 3300025961 Bacteria 27931
941 Ga0207712_10011297 3300025961 Bacteria 5684
942 Ga0207712_10020582 3300025961 Bacteria 4323
943 Ga0207668_10000011 3300025972 Bacteria 184484
944 Ga0207668_10000047 3300025972 Bacteria 101453
945 Ga0207668_10000417 3300025972 Bacteria 26845
946 Ga0207668_10000956 3300025972 Bacteria 17416
947 Ga0207668_10002597 3300025972 Bacteria 10564
948 Ga0207668_10123263 3300025972 Bacteria 1966
949 Ga0207640_10000453 3300025981 Bacteria 24954
950 Ga0207640_10003310 3300025981 Bacteria 8688
951 Ga0207640_10011717 3300025981 Bacteria 4971
952 Ga0207640_10022085 3300025981 Bacteria 3803
953 Ga0207640_10023083 3300025981 Bacteria 3735
954 Ga0207640_10036931 3300025981 Bacteria 3070
955 Ga0207640_10121353 3300025981 Bacteria 1873
956 Ga0207640_10193624 3300025981 Bacteria 1534
957 Ga0207640_10261162 3300025981 Bacteria 1349
958 Ga0207658_10000014 3300025986 Bacteria 218248
959 Ga0207658_10001358 3300025986 Bacteria 19138
960 Ga0207658_10003250 3300025986 Bacteria 11554
961 Ga0207658_10005082 3300025986 Bacteria 9050
962 Ga0207658_10007781 3300025986 Bacteria 7300
963 Ga0207658_10018307 3300025986 Bacteria 4836
964 Ga0207658_10064785 3300025986 Bacteria 2742
965 Ga0207677_10000027 3300026023 Bacteria 125785
966 Ga0207677_10000776 3300026023 Bacteria 18351
967 Ga0207677_10005629 3300026023 Bacteria 6809
968 Ga0207677_10007710 3300026023 Bacteria 5974
969 Ga0207703_10001172 3300026035 Bacteria 24751
970 Ga0207703_10001634 3300026035 Bacteria 20198
971 Ga0207703_10001946 3300026035 Bacteria 18263
972 Ga0207703_10002884 3300026035 Bacteria 14642
973 Ga0207703_10004656 3300026035 Bacteria 11203
974 Ga0207703_10011512 3300026035 Bacteria 6881
975 Ga0207703_10026110 3300026035 Bacteria 4596
976 Ga0207703_10028588 3300026035 Bacteria 4396
977 Ga0207703_10052867 3300026035 Bacteria 3300
978 Ga0207703_10061129 3300026035 Bacteria 3083
979 Ga0207703_10074462 3300026035 Bacteria 2812
980 Ga0207703_10082276 3300026035 Bacteria 2686
981 Ga0207703_10084769 3300026035 Bacteria 2650
982 Ga0207639_10000131 3300026041 Bacteria 54681
983 Ga0207639_10000355 3300026041 Bacteria 31674
984 Ga0207639_10001817 3300026041 Bacteria 14354
985 Ga0207639_10017663 3300026041 Bacteria 5058
986 Ga0207639_10022588 3300026041 Bacteria 4532
987 Ga0207639_10034690 3300026041 Bacteria 3731
988 Ga0207639_10351591 3300026041 Bacteria 1316
989 Ga0207678_10000354 3300026067 Bacteria 41704
990 Ga0207678_10002137 3300026067 Bacteria 17903
991 Ga0207678_10002532 3300026067 Bacteria 16661
992 Ga0207678_10005050 3300026067 Bacteria 11841
993 Ga0207678_10005871 3300026067 Bacteria 10947
994 Ga0207678_10006731 3300026067 Bacteria 10191
995 Ga0207678_10006828 3300026067 Bacteria 10121
996 Ga0207678_10008822 3300026067 Bacteria 8875
997 Ga0207678_10009020 3300026067 Bacteria 8780
998 Ga0207678_10013532 3300026067 Bacteria 7165
999 Ga0207678_10023522 3300026067 Bacteria 5388
1000 Ga0207678_10037074 3300026067 Bacteria 4243
1001 Ga0207678_10037178 3300026067 Bacteria 4237
1002 Ga0207678_10084406 3300026067 Bacteria 2716
1003 Ga0207678_10115894 3300026067 Bacteria 2286
1004 Ga0207678_10132924 3300026067 Bacteria 2123
1005 Ga0207678_10176734 3300026067 Bacteria 1823
1006 Ga0207702_10000247 3300026078 Bacteria 62873
1007 Ga0207702_10002245 3300026078 Bacteria 18533
1008 Ga0207702_10005325 3300026078 Bacteria 11284
1009 Ga0207702_10023692 3300026078 Bacteria 5091
1010 Ga0207702_10036030 3300026078 Bacteria 4137
1011 Ga0207702_10072603 3300026078 Bacteria 2966
1012 Ga0207702_10086674 3300026078 Bacteria 2731
1013 Ga0207702_10196312 3300026078 Bacteria 1868
1014 Ga0207702_10222242 3300026078 Bacteria 1760
1015 Ga0207641_10002146 3300026088 Bacteria 18591
1016 Ga0207641_10002944 3300026088 Bacteria 15396
1017 Ga0207641_10007265 3300026088 Bacteria 9229
1018 Ga0207641_10007375 3300026088 Bacteria 9153
1019 Ga0207641_10015081 3300026088 Bacteria 6333
1020 Ga0207641_10018629 3300026088 Bacteria 5691
1021 Ga0207641_10022117 3300026088 Bacteria 5232
1022 Ga0207641_10034252 3300026088 Bacteria 4223
1023 Ga0207641_10146054 3300026088 Bacteria 2138
1024 Ga0207648_10001420 3300026089 Bacteria 26422
1025 Ga0207648_10004072 3300026089 Bacteria 15153
1026 Ga0207648_10005820 3300026089 Bacteria 12349
1027 Ga0207648_10010858 3300026089 Bacteria 8609
1028 Ga0207648_10011277 3300026089 Bacteria 8428
1029 Ga0207648_10051696 3300026089 Bacteria 3592
1030 Ga0207648_10245212 3300026089 Bacteria 1596
1031 Ga0207676_10000139 3300026095 Bacteria 63189
1032 Ga0207676_10000532 3300026095 Bacteria 31972
1033 Ga0207676_10000937 3300026095 Bacteria 22548
1034 Ga0207676_10003289 3300026095 Bacteria 11487
1035 Ga0207676_10007368 3300026095 Bacteria 7804
1036 Ga0207676_10046019 3300026095 Bacteria 3374
1037 Ga0207676_10136889 3300026095 Bacteria 2091
1038 Ga0207676_10165922 3300026095 Bacteria 1918
1039 Ga0207676_10231988 3300026095 Bacteria 1650
1040 Ga0207674_10000244 3300026116 Bacteria 67590
1041 Ga0207674_10000638 3300026116 Bacteria 45617
1042 Ga0207674_10001496 3300026116 Bacteria 30156
1043 Ga0207674_10003894 3300026116 Bacteria 18157
1044 Ga0207674_10004090 3300026116 Bacteria 17674
1045 Ga0207674_10004400 3300026116 Bacteria 16980
1046 Ga0207674_10006220 3300026116 Bacteria 14072
1047 Ga0207674_10007984 3300026116 Bacteria 12281
1048 Ga0207674_10016401 3300026116 Bacteria 8110
1049 Ga0207674_10018397 3300026116 Bacteria 7596
1050 Ga0207674_10032672 3300026116 Bacteria 5456
1051 Ga0207674_10048587 3300026116 Bacteria 4342
1052 Ga0207674_10063297 3300026116 Bacteria 3734
1053 Ga0207674_10073776 3300026116 Bacteria 3425
1054 Ga0207674_10085815 3300026116 Bacteria 3142
1055 Ga0207675_100000740 3300026118 Bacteria 32427
1056 Ga0207675_100120074 3300026118 Bacteria 2486
1057 Ga0207675_100196416 3300026118 Bacteria 1936
1058 Ga0207683_10001453 3300026121 Bacteria 21380
1059 Ga0207683_10003374 3300026121 Bacteria 13923
1060 Ga0207683_10022964 3300026121 Bacteria 5362
1061 Ga0207683_10036381 3300026121 Bacteria 4287
1062 Ga0207683_10044696 3300026121 Bacteria 3872
1063 Ga0207698_10000697 3300026142 Bacteria 19513
1064 Ga0207698_10000944 3300026142 Bacteria 16887
1065 Ga0207698_10001719 3300026142 Bacteria 12761
1066 Ga0207698_10001918 3300026142 Bacteria 12193
1067 Ga0207698_10003313 3300026142 Bacteria 9681
1068 Ga0207698_10011936 3300026142 Bacteria 5659
1069 Ga0207698_10043497 3300026142 Bacteria 3365
1070 Ga0207698_10058765 3300026142 Bacteria 2982
1071 Ga0207698_10066932 3300026142 Bacteria 2830
1072 Ga0207698_10098494 3300026142 Bacteria 2416
1073 Ga0207698_10101769 3300026142 Bacteria 2383
1074 Ga0207698_10109326 3300026142 Bacteria 2313
1075 Ga0207698_10142196 3300026142 Bacteria 2069
1076 Ga0209813_10000039 3300027866 Bacteria 55148
1077 Ga0209974_10001458 3300027876 Bacteria 8578
1078 Ga0209974_10015118 3300027876 Bacteria 2563
1079 Ga0268266_10000171 3300028379 Bacteria 118317
1080 Ga0268266_10002001 3300028379 Bacteria 22772
1081 Ga0268266_10005698 3300028379 Bacteria 11549
1082 Ga0268266_10013492 3300028379 Bacteria 7033
1083 Ga0268266_10118391 3300028379 Bacteria 2354
1084 Ga0268266_10131688 3300028379 Bacteria 2237
1085 Ga0268265_10000104 3300028380 Bacteria 105776
1086 Ga0268265_10001269 3300028380 Bacteria 21775
1087 Ga0268265_10001294 3300028380 Bacteria 21510
1088 Ga0268265_10001838 3300028380 Bacteria 16935
1089 Ga0268265_10002083 3300028380 Bacteria 15597
1090 Ga0268265_10010726 3300028380 Bacteria 6187
1091 Ga0268265_10037001 3300028380 Bacteria 3578
1092 Ga0268265_10050790 3300028380 Bacteria 3126
1093 Ga0268265_10051956 3300028380 Bacteria 3096
1094 Ga0268265_10290448 3300028380 Bacteria 1467
1095 Ga0268264_10000069 3300028381 Bacteria 270492
1096 Ga0268264_10000121 3300028381 Bacteria 190368
1097 Ga0268264_10002102 3300028381 Bacteria 17771
1098 Ga0268264_10005158 3300028381 Bacteria 11071
1099 Ga0268264_10005614 3300028381 Bacteria 10627
1100 Ga0268264_10008878 3300028381 Bacteria 8333
1101 Ga0268264_10045581 3300028381 Bacteria 3641
1102 Ga0268264_10121292 3300028381 Bacteria 2304
1103 Ga0316180_1129633 3300030736 Bacteria 1837
1104 Ga0316182_1203927 3300030745 Bacteria 3124
1105 Ga0307408_100018130 3300031548 Bacteria 4723
1106 Ga0307408_100034653 3300031548 Bacteria 3537
1107 Ga0307408_100042046 3300031548 Bacteria 3243
1108 Ga0307408_100088488 3300031548 Bacteria 2332
1109 Ga0307405_10002608 3300031731 Bacteria 8003
1110 Ga0307405_10009826 3300031731 Bacteria 4922
1111 Ga0307405_10028554 3300031731 Bacteria 3251
1112 Ga0307405_10064187 3300031731 Bacteria 2332
1113 Ga0307413_10000677 3300031824 Bacteria 11596
1114 Ga0307413_10001883 3300031824 Bacteria 8291
1115 Ga0307413_10006729 3300031824 Bacteria 5278
1116 Ga0307413_10009435 3300031824 Bacteria 4671
1117 Ga0307413_10011336 3300031824 Bacteria 4376
1118 Ga0307413_10016372 3300031824 Bacteria 3828
1119 Ga0307413_10050243 3300031824 Bacteria 2504
1120 Ga0307413_10062732 3300031824 Bacteria 2301
1121 Ga0307413_10075994 3300031824 Bacteria 2133
1122 Ga0307413_10133980 3300031824 Bacteria 1700
1123 Ga0307410_10000790 3300031852 Bacteria 13363
1124 Ga0307410_10001834 3300031852 Bacteria 9885
1125 Ga0307410_10002266 3300031852 Bacteria 9208
1126 Ga0307410_10008229 3300031852 Bacteria 5771
1127 Ga0307410_10011848 3300031852 Bacteria 5009
1128 Ga0307410_10012930 3300031852 Bacteria 4849
1129 Ga0307410_10020142 3300031852 Bacteria 4074
1130 Ga0307410_10028004 3300031852 Bacteria 3567
1131 Ga0307410_10028361 3300031852 Bacteria 3549
1132 Ga0307410_10041276 3300031852 Bacteria 3042
1133 Ga0307410_10053978 3300031852 Bacteria 2721
1134 Ga0307410_10054992 3300031852 Bacteria 2700
1135 Ga0307410_10065844 3300031852 Bacteria 2494
1136 Ga0307410_10067089 3300031852 Bacteria 2474
1137 Ga0307410_10072039 3300031852 Bacteria 2398
1138 Ga0307410_10111135 3300031852 Bacteria 1983
1139 Ga0307410_10140902 3300031852 Bacteria 1784
1140 Ga0307410_10242455 3300031852 Bacteria 1397
1141 Ga0307406_10006201 3300031901 Bacteria 6580
1142 Ga0307406_10024024 3300031901 Bacteria 3635
1143 Ga0307406_10024140 3300031901 Bacteria 3627
1144 Ga0307406_10024655 3300031901 Bacteria 3594
1145 Ga0307406_10075994 3300031901 Bacteria 2218
1146 Ga0307406_10080005 3300031901 Bacteria 2168
1147 Ga0307406_10085035 3300031901 Bacteria 2114
1148 Ga0307406_10198893 3300031901 Bacteria 1473
1149 Ga0307407_10002416 3300031903 Bacteria 7307
1150 Ga0307407_10002710 3300031903 Bacteria 7029
1151 Ga0307407_10005158 3300031903 Bacteria 5637
1152 Ga0307407_10016462 3300031903 Bacteria 3681
1153 Ga0307407_10023838 3300031903 Bacteria 3198
1154 Ga0307412_10005147 3300031911 Bacteria 7323
1155 Ga0307412_10013382 3300031911 Bacteria 4810
1156 Ga0307412_10020794 3300031911 Bacteria 3999
1157 Ga0307412_10024437 3300031911 Bacteria 3729
1158 Ga0307412_10025294 3300031911 Bacteria 3676
1159 Ga0307412_10069043 3300031911 Bacteria 2404
1160 Ga0307412_10132680 3300031911 Bacteria 1811
1161 Ga0307412_10172719 3300031911 Bacteria 1617
1162 Ga0307412_10204240 3300031911 Bacteria 1503
1163 Ga0307409_100013807 3300031995 Bacteria 5220
1164 Ga0307409_100017859 3300031995 Bacteria 4744
1165 Ga0307409_100043340 3300031995 Bacteria 3378
1166 Ga0307409_100044513 3300031995 Bacteria 3343
1167 Ga0307409_100052301 3300031995 Bacteria 3130
1168 Ga0307409_100063306 3300031995 Bacteria 2900
1169 Ga0307409_100063659 3300031995 Bacteria 2893
1170 Ga0307409_100087128 3300031995 Bacteria 2543
1171 Ga0307409_100103333 3300031995 Bacteria 2370
1172 Ga0307409_100114490 3300031995 Bacteria 2269
1173 Ga0307409_100147797 3300031995 Bacteria 2035
1174 Ga0307409_100187775 3300031995 Bacteria 1836
1175 Ga0307409_100233647 3300031995 Bacteria 1668
1176 Ga0307416_100000612 3300032002 Bacteria 18344
1177 Ga0307416_100015779 3300032002 Bacteria 5228
1178 Ga0307416_100044427 3300032002 Bacteria 3488
1179 Ga0307416_100054999 3300032002 Bacteria 3202
1180 Ga0307416_100090546 3300032002 Bacteria 2623
1181 Ga0307416_100138879 3300032002 Bacteria 2204
1182 Ga0307416_100196766 3300032002 Bacteria 1907
1183 Ga0307416_100234345 3300032002 Bacteria 1772
1184 Ga0307414_10000359 3300032004 Bacteria 25279
1185 Ga0307414_10002035 3300032004 Bacteria 10503
1186 Ga0307414_10002552 3300032004 Bacteria 9573
1187 Ga0307414_10003676 3300032004 Bacteria 8223
1188 Ga0307414_10005184 3300032004 Bacteria 7153
1189 Ga0307414_10008582 3300032004 Bacteria 5807
1190 Ga0307414_10016333 3300032004 Bacteria 4510
1191 Ga0307414_10043203 3300032004 Bacteria 3068
1192 Ga0307414_10106041 3300032004 Bacteria 2126
1193 Ga0307414_10145332 3300032004 Bacteria 1862
1194 Ga0307414_10252328 3300032004 Bacteria 1467
1195 Ga0307411_10001901 3300032005 Bacteria 8901
1196 Ga0307411_10002272 3300032005 Bacteria 8407
1197 Ga0307411_10014851 3300032005 Bacteria 4350
1198 Ga0307411_10015359 3300032005 Bacteria 4298
1199 Ga0307411_10026175 3300032005 Bacteria 3508
1200 Ga0307411_10033114 3300032005 Bacteria 3202
1201 Ga0307411_10046883 3300032005 Bacteria 2790
1202 Ga0307411_10063503 3300032005 Bacteria 2468
1203 Ga0307411_10078994 3300032005 Bacteria 2257
1204 Ga0307411_10105256 3300032005 Bacteria 2005
1205 Ga0307411_10123251 3300032005 Bacteria 1879
1206 Ga0307411_10129582 3300032005 Bacteria 1841
1207 Ga0307415_100004303 3300032126 Bacteria 7368
1208 Ga0307415_100009085 3300032126 Bacteria 5551
1209 Ga0307415_100010131 3300032126 Bacteria 5321
1210 Ga0307415_100013463 3300032126 Bacteria 4775
1211 Ga0307415_100202045 3300032126 Bacteria 1578
1212 Ga0307510_10008642 3300033180 Bacteria 12135
1213 Ga0307510_10029403 3300033180 Bacteria 6256
1214 Ga0373943_0008320 3300035170 Bacteria 4656
1215 Ga0373946_0007376 3300035171 Bacteria 4017
1216 Ga0373935_0048652 3300035692 Bacteria 2685
1217 Ga0373927_0081661 3300035695 Bacteria 2095
1218 Ga0373925_0241472 3300037068 Bacteria 1447
1219 Ga0395899_0000113 3300037312 Bacteria 136163
1220 Ga0395899_0000230 3300037312 Bacteria 76090
1221 Ga0395899_0002341 3300037312 Bacteria 15429
1222 Ga0395899_0003735 3300037312 Bacteria 12031
1223 Ga0395899_0009305 3300037312 Bacteria 7544
1224 Ga0395899_0015192 3300037312 Bacteria 5870
1225 Ga0395899_0021827 3300037312 Bacteria 4856
1226 Ga0395899_0034910 3300037312 Bacteria 3776
1227 Ga0395899_0046816 3300037312 Bacteria 3220
1228 Ga0395899_0051940 3300037312 Bacteria 3040
1229 Ga0395899_0070898 3300037312 Bacteria 2550
1230 Ga0395899_0078082 3300037312 Bacteria 2414
1231 Ga0395899_0128974 3300037312 Bacteria 1807
1232 Ga0395900_0000124 3300037418 Bacteria 133210
1233 Ga0395900_0000583 3300037418 Bacteria 50178
1234 Ga0395900_0003179 3300037418 Bacteria 17793
1235 Ga0395900_0003841 3300037418 Bacteria 16057
1236 Ga0395900_0005190 3300037418 Bacteria 13673
1237 Ga0395900_0006477 3300037418 Bacteria 12210
1238 Ga0395900_0006649 3300037418 Bacteria 12019
1239 Ga0395900_0014526 3300037418 Bacteria 8035
1240 Ga0395900_0022716 3300037418 Bacteria 6420
1241 Ga0395900_0024755 3300037418 Bacteria 6144
1242 Ga0395900_0035085 3300037418 Bacteria 5167
1243 Ga0395900_0038430 3300037418 Bacteria 4932
1244 Ga0395900_0055440 3300037418 Bacteria 4081
1245 Ga0395900_0056592 3300037418 Bacteria 4036
1246 Ga0395900_0061203 3300037418 Bacteria 3871
1247 Ga0395900_0063918 3300037418 Bacteria 3783
1248 Ga0395900_0089074 3300037418 Bacteria 3172
1249 Ga0395900_0093281 3300037418 Bacteria 3093
1250 Ga0395900_0096984 3300037418 Bacteria 3029
1251 Ga0395900_0117151 3300037418 Bacteria 2733
1252 Ga0395900_0122911 3300037418 Bacteria 2662
1253 Ga0395900_0123294 3300037418 Bacteria 2658
1254 Ga0395900_0124118 3300037418 Bacteria 2648
1255 Ga0395900_0138348 3300037418 Bacteria 2494
1256 Ga0395900_0155199 3300037418 Bacteria 2338
1257 Ga0395900_0164484 3300037418 Bacteria 2261
1258 Ga0395900_0214125 3300037418 Bacteria 1944
1259 Ga0395900_0267393 3300037418 Bacteria 1705
1260 Ga0395900_0320034 3300037418 Bacteria 1532
1261 Ga0395900_0330854 3300037418 Bacteria 1501
1262 Ga0395900_0350382 3300037418 Bacteria 1450
1263 Ga0395900_0406101 3300037418 Bacteria 1325
1264 Ga0395898_0001351 3300037466 Bacteria 35415
1265 Ga0395898_0002186 3300037466 Bacteria 23900
1266 Ga0395898_0002947 3300037466 Bacteria 19363
1267 Ga0395898_0004178 3300037466 Bacteria 15822
1268 Ga0395898_0015368 3300037466 Bacteria 7850
1269 Ga0395898_0025148 3300037466 Bacteria 6004
1270 Ga0395898_0027113 3300037466 Bacteria 5755
1271 Ga0395898_0029806 3300037466 Bacteria 5462
1272 Ga0395898_0037674 3300037466 Bacteria 4796
1273 Ga0395898_0060116 3300037466 Bacteria 3694
1274 Ga0395898_0138676 3300037466 Bacteria 2328
1275 Ga0395898_0291753 3300037466 Bacteria 1556
1276 Ga0395898_0332317 3300037466 Bacteria 1449
1277 Ga0395898_0350627 3300037466 Bacteria 1407
1278 Ga0395905_0000005 3300037471 Bacteria 557808
1279 Ga0395905_0000342 3300037471 Bacteria 66255
1280 Ga0395905_0000559 3300037471 Bacteria 50796
1281 Ga0395905_0001508 3300037471 Bacteria 27850
1282 Ga0395905_0002977 3300037471 Bacteria 18402
1283 Ga0395905_0003870 3300037471 Bacteria 15790
1284 Ga0395905_0005166 3300037471 Bacteria 13389
1285 Ga0395905_0006826 3300037471 Bacteria 11424
1286 Ga0395905_0007754 3300037471 Bacteria 10648
1287 Ga0395905_0010395 3300037471 Bacteria 9060
1288 Ga0395905_0012125 3300037471 Bacteria 8302
1289 Ga0395905_0014919 3300037471 Bacteria 7411
1290 Ga0395905_0017391 3300037471 Bacteria 6828
1291 Ga0395905_0033266 3300037471 Bacteria 4844
1292 Ga0395905_0043788 3300037471 Bacteria 4199
1293 Ga0395905_0044535 3300037471 Bacteria 4165
1294 Ga0395905_0045669 3300037471 Bacteria 4108
1295 Ga0395905_0054795 3300037471 Bacteria 3731
1296 Ga0395905_0056704 3300037471 Bacteria 3664
1297 Ga0395905_0059847 3300037471 Bacteria 3561
1298 Ga0395905_0062865 3300037471 Bacteria 3472
1299 Ga0395905_0078274 3300037471 Bacteria 3099
1300 Ga0395905_0094731 3300037471 Bacteria 2801
1301 Ga0395905_0101723 3300037471 Bacteria 2697
1302 Ga0395905_0106956 3300037471 Bacteria 2626
1303 Ga0395905_0110323 3300037471 Bacteria 2583
1304 Ga0395905_0160586 3300037471 Bacteria 2112
1305 Ga0395905_0175114 3300037471 Bacteria 2014
1306 Ga0395905_0195325 3300037471 Bacteria 1897
1307 Ga0395905_0195906 3300037471 Bacteria 1894
1308 Ga0395905_0269578 3300037471 Bacteria 1588
1309 Ga0436364_0188471 3300037853 Bacteria 43213
1310 Ga0436364_0354297 3300037853 Bacteria 35362
1311 Ga0395901_0000031 3300038443 Bacteria 241733
1312 Ga0395901_0000988 3300038443 Bacteria 30688
1313 Ga0395901_0001812 3300038443 Bacteria 22072
1314 Ga0395901_0002630 3300038443 Bacteria 18159
1315 Ga0395901_0007110 3300038443 Bacteria 11308
1316 Ga0395901_0011931 3300038443 Bacteria 8812
1317 Ga0395901_0012439 3300038443 Bacteria 8635
1318 Ga0395901_0024604 3300038443 Bacteria 6183
1319 Ga0395901_0025333 3300038443 Bacteria 6089
1320 Ga0395901_0029347 3300038443 Bacteria 5662
1321 Ga0395901_0031068 3300038443 Bacteria 5506
1322 Ga0395901_0031355 3300038443 Bacteria 5481
1323 Ga0395901_0033824 3300038443 Bacteria 5278
1324 Ga0395901_0035042 3300038443 Bacteria 5186
1325 Ga0395901_0044961 3300038443 Bacteria 4581
1326 Ga0395901_0077561 3300038443 Bacteria 3468
1327 Ga0395901_0091943 3300038443 Bacteria 3176
1328 Ga0395901_0101231 3300038443 Bacteria 3023
1329 Ga0395901_0118873 3300038443 Bacteria 2777
1330 Ga0395901_0159507 3300038443 Bacteria 2369
1331 Ga0395901_0178280 3300038443 Bacteria 2228
1332 Ga0395901_0187331 3300038443 Bacteria 2170
1333 Ga0395901_0415066 3300038443 Bacteria 1381
1334 Ga0237819_00375 3300038705 Bacteria 15767
1335 Ga0436365_0172851 3300039437 Bacteria 21668
1336 Ga0439465_0011481 3300041413 Bacteria 2780
1337 Ga0439445_0000381 3300042004 Bacteria 8921
1338 Ga0439432_029084 3300042006 Bacteria 1798
1339 Ga0439449_0007739 3300042007 Bacteria 4081
1340 Ga0439449_0017165 3300042007 Bacteria 2718
1341 Ga0450912_000687 3300042116 Bacteria 1796
1342 Ga0450917_000583 3300042120 Bacteria 2727
1343 Ga0450889_000097 3300042144 Bacteria 8333
1344 Ga0439458_0000019 3300042157 Bacteria 25805
1345 Ga0439458_0000172 3300042157 Bacteria 14580
1346 Ga0439464_0001743 3300042439 Bacteria 5225
1347 Ga0466969_0003846 3300044656 Bacteria 7971
1348 Ga0466966_0000021 3300044684 Bacteria 116714
1349 Ga0466966_0008962 3300044684 Bacteria 6629
1350 Ga0466966_0028488 3300044684 Bacteria 3638
1351 Ga0466961_0006734 3300044693 Bacteria 7312
1352 Ga0466961_0022590 3300044693 Bacteria 4047
1353 Ga0466961_0086425 3300044693 Bacteria 1982
1354 Ga0466963_0004590 3300044694 Bacteria 8041
1355 Ga0466963_0042549 3300044694 Bacteria 2983
1356 Ga0466963_0067308 3300044694 Bacteria 2403
1357 Ga0466963_0082832 3300044694 Bacteria 2175
1358 Ga0466963_0172402 3300044694 Bacteria 1508
1359 Ga0466964_0036882 3300044706 Bacteria 1962
1360 Ga0466971_0001595 3300044719 Bacteria 9571
1361 Ga0466970_0003742 3300044765 Bacteria 7438
1362 Ga0466970_0089944 3300044765 Bacteria 1666
1363 Ga0466957_0005467 3300044842 Bacteria 7129
1364 Ga0466957_0016117 3300044842 Bacteria 4368
1365 Ga0466957_0025277 3300044842 Bacteria 3519
1366 Ga0466957_0092940 3300044842 Bacteria 1892
1367 Ga0466960_0005295 3300044901 Bacteria 5100
1368 Ga0466959_0114947 3300045049 Bacteria 1917
1369 Ga0466958_0007081 3300045836 Bacteria 6140
1370 Ga0466958_0090309 3300045836 Bacteria 1895
1371 Ga0466967_0027764 3300045976 Bacteria 4712
1372 Ga0466967_0029079 3300045976 Bacteria 4621
1373 Ga0466967_0039449 3300045976 Bacteria 4060
1374 Ga0466967_0042918 3300045976 Bacteria 3912
1375 Ga0466967_0043080 3300045976 Bacteria 3906
1376 Ga0466967_0047341 3300045976 Bacteria 3748
1377 Ga0466967_0068930 3300045976 Bacteria 3160
1378 Ga0466967_0111697 3300045976 Bacteria 2512
1379 Ga0466967_0148603 3300045976 Bacteria 2188
1380 Ga0466967_0193124 3300045976 Bacteria 1925
1381 Ga0466967_0217767 3300045976 Bacteria 1813
1382 Ga0466967_0228125 3300045976 Bacteria 1772
1383 Ga0495617_070645 3300046452 Bacteria 1148
1384 Ga0495627_000494 3300046453 Bacteria 33081
1385 Ga0495627_001223 3300046453 Bacteria 16020
1386 Ga0495638_0000018 3300046460 Bacteria 389696
1387 Ga0495638_0121242 3300046460 Bacteria 1545
1388 Ga0495650_0005420 3300046471 Bacteria 8296
1389 Ga0495583_0000187 3300046506 Bacteria 104971
1390 Ga0495583_0000656 3300046506 Bacteria 45452
1391 Ga0495583_0020997 3300046506 Bacteria 3366
1392 Ga0495583_0063343 3300046506 Bacteria 1644
1393 Ga0495606_0002714 3300046507 Bacteria 19955
1394 Ga0495606_0123078 3300046507 Bacteria 1550
1395 Ga0495610_0002686 3300046512 Bacteria 14666
1396 Ga0495632_0000079 3300046519 Bacteria 100131
1397 Ga0495632_0000384 3300046519 Bacteria 42202
1398 Ga0495637_0004139 3300046520 Bacteria 7551
1399 Ga0495643_0000030 3300046522 Bacteria 260229
1400 Ga0495643_0025828 3300046522 Bacteria 3320
1401 Ga0495643_0058292 3300046522 Bacteria 2055
1402 Ga0495648_0000018 3300046524 Bacteria 282490
1403 Ga0495663_0000006 3300046525 Bacteria 306938
1404 Ga0495663_0000481 3300046525 Bacteria 14537
1405 Ga0495663_0000587 3300046525 Bacteria 12764
1406 Ga0495598_0000413 3300046537 Bacteria 7686
1407 Ga0495598_0001576 3300046537 Bacteria 4569
1408 Ga0495609_0043798 3300046538 Bacteria 2009
1409 Ga0495621_0000040 3300046539 Bacteria 25175
1410 Ga0495621_0067858 3300046539 Bacteria 1307
1411 Ga0495597_0003364 3300046542 Bacteria 9406
1412 Ga0495622_0005815 3300046557 Bacteria 5722
1413 Ga0495633_0000515 3300046558 Bacteria 38895
1414 Ga0495633_0000794 3300046558 Bacteria 28154
1415 Ga0495633_0009826 3300046558 Bacteria 5258
1416 Ga0495633_0010142 3300046558 Bacteria 5158
1417 Ga0495668_0007943 3300046616 Bacteria 6692
1418 Ga0495668_0010672 3300046616 Bacteria 5549
1419 Ga0495668_0047653 3300046616 Bacteria 2379
1420 Ga0495668_0057716 3300046616 Bacteria 2142
1421 Ga0495625_0003185 3300046660 Bacteria 16701
1422 Ga0495625_0118677 3300046660 Bacteria 1802
1423 Ga0495623_0007652 3300046679 Bacteria 7020
1424 Ga0495669_0000387 3300046684 Bacteria 21970
1425 Ga0495669_0005956 3300046684 Bacteria 5085
1426 Ga0495669_0007243 3300046684 Bacteria 4648
1427 Ga0495669_0008086 3300046684 Bacteria 4414
1428 Ga0495669_0008913 3300046684 Bacteria 4226
1429 Ga0495669_0013414 3300046684 Bacteria 3491
1430 Ga0495669_0028579 3300046684 Bacteria 2443
1431 Ga0495669_0049711 3300046684 Bacteria 1878
1432 Ga0495670_0000957 3300046691 Bacteria 13971
1433 Ga0495671_0000011 3300046692 Bacteria 365582
1434 Ga0495671_0000072 3300046692 Bacteria 97315
1435 Ga0495671_0012263 3300046692 Bacteria 4686
1436 Ga0495671_0071306 3300046692 Bacteria 1707
1437 Ga0495677_0003222 3300047445 Bacteria 6364
1438 Ga0495677_0008600 3300047445 Bacteria 3789
1439 Ga0495677_0024033 3300047445 Bacteria 2211
1440 Ga0495673_0000013 3300047469 Bacteria 612902
1441 Ga0495681_0000055 3300047470 Bacteria 104502
1442 Ga0495686_0000137 3300047472 Bacteria 148290
1443 Ga0495686_0002330 3300047472 Bacteria 18152
1444 Ga0495686_0013566 3300047472 Bacteria 5650
1445 Ga0496100_0001163 3300048903 Bacteria 12794
1446 Ga0496100_0033766 3300048903 Bacteria 3204
1447 Ga0496100_0133510 3300048903 Bacteria 1751
1448 Ga0496101_0001522 3300048904 Bacteria 13884
1449 Ga0496102_0053918 3300048905 Bacteria 3665
1450 Ga0496102_0115578 3300048905 Bacteria 2504
1451 Ga0496102_0153748 3300048905 Bacteria 2163
1452 Ga0496102_0157930 3300048905 Bacteria 2132
1453 Ga0496103_0057679 3300048906 Bacteria 2411
1454 Ga0496103_0065262 3300048906 Bacteria 2270
1455 Ga0496104_0029921 3300048907 Bacteria 5057
1456 Ga0496105_0020435 3300048908 Bacteria 5350
1457 Ga0496105_0079825 3300048908 Bacteria 2702
1458 Ga0496107_0022378 3300048910 Bacteria 4466
1459 Ga0496107_0033682 3300048910 Bacteria 3666
1460 Ga0496108_0000700 3300048911 Bacteria 26044
1461 Ga0496108_0000728 3300048911 Bacteria 25565
1462 Ga0496108_0001452 3300048911 Bacteria 18729
1463 Ga0496108_0002877 3300048911 Bacteria 13809
1464 Ga0496108_0096636 3300048911 Bacteria 2516
1465 Ga0496109_0003121 3300048912 Bacteria 13820
1466 Ga0496109_0008419 3300048912 Bacteria 8767
1467 Ga0496109_0033476 3300048912 Bacteria 4624
1468 Ga0496109_0066501 3300048912 Bacteria 3301
1469 Ga0496109_0073444 3300048912 Bacteria 3143
1470 Ga0496109_0151071 3300048912 Bacteria 2174
1471 Ga0496109_0219323 3300048912 Bacteria 1789
1472 Ga0496109_0250688 3300048912 Bacteria 1667
1473 Ga0496110_0017606 3300048913 Bacteria 5974
1474 Ga0496110_0067825 3300048913 Bacteria 3157
1475 Ga0496111_0004034 3300048914 Bacteria 9216
1476 Ga0496111_0004779 3300048914 Bacteria 8593
1477 Ga0496111_0075997 3300048914 Bacteria 2447
1478 Ga0496111_0096239 3300048914 Bacteria 2173
1479 Ga0496111_0100768 3300048914 Bacteria 2121
1480 Ga0496112_0014049 3300048915 Bacteria 7412
1481 Ga0496112_0029592 3300048915 Bacteria 5296
1482 Ga0496112_0046485 3300048915 Bacteria 4257
1483 Ga0496112_0051828 3300048915 Bacteria 4025
1484 Ga0496112_0070953 3300048915 Bacteria 3442
1485 Ga0496112_0077817 3300048915 Bacteria 3280
1486 Ga0496112_0097414 3300048915 Bacteria 2912
1487 Ga0496112_0126001 3300048915 Bacteria 2532
1488 Ga0496112_0173540 3300048915 Bacteria 2121
1489 Ga0496113_0004234 3300048916 Bacteria 8778
1490 Ga0496113_0005671 3300048916 Bacteria 7819
1491 Ga0496113_0022104 3300048916 Bacteria 4494
1492 Ga0496113_0033981 3300048916 Bacteria 3717
1493 Ga0496113_0054506 3300048916 Bacteria 2993
1494 Ga0496114_0000006 3300048917 Bacteria 472921
1495 Ga0496115_0002676 3300048918 Bacteria 12779
1496 Ga0496116_0018070 3300048919 Bacteria 5450
1497 Ga0496117_0003612 3300048920 Bacteria 17816
1498 Ga0496117_0004382 3300048920 Bacteria 15645
1499 Ga0496118_0001805 3300048921 Bacteria 30834
1500 Ga0496121_0000610 3300048924 Bacteria 66844
1501 Ga0496121_0222501 3300048924 Bacteria 1328
1502 Ga0496122_0006910 3300048925 Bacteria 12823
1503 Ga0496122_0009142 3300048925 Bacteria 10501
1504 Ga0496123_0003121 3300048926 Bacteria 18996
1505 Ga0496123_0021690 3300048926 Bacteria 4982
1506 Ga0496124_0006701 3300048927 Bacteria 12463
1507 Ga0496124_0014884 3300048927 Bacteria 7493
1508 Ga0496124_0033845 3300048927 Bacteria 4492
1509 Ga0496124_0035402 3300048927 Bacteria 4368
1510 Ga0496125_0003777 3300048928 Bacteria 18008
1511 Ga0496125_0138533 3300048928 Bacteria 1696
1512 Ga0496125_0197722 3300048928 Bacteria 1320
1513 Ga0496126_0008992 3300048929 Bacteria 10689
1514 Ga0501034_0077985 3300049571 Bacteria 3318
1515 Ga0501067_0036101 3300049583 Bacteria 2745
1516 Ga0501069_0003967 3300049585 Bacteria 7634
1517 Ga0501070_0037022 3300049586 Bacteria 4073
1518 Ga0501211_000287 3300049658 Bacteria 4613
1519 Ga0501223_000002 3300049663 Bacteria 154573
1520 Ga0501223_000112 3300049663 Bacteria 23415
1521 Ga0501223_009288 3300049663 Bacteria 1994
1522 Ga0501224_000020 3300049664 Bacteria 74346
1523 Ga0501230_008521 3300049667 Bacteria 1555
1524 Ga0501233_000277 3300049668 Bacteria 7837
1525 Ga0501235_003555 3300049669 Bacteria 3370
1526 Ga0501235_008062 3300049669 Bacteria 2296
1527 Ga0501235_008727 3300049669 Bacteria 2212
1528 Ga0501235_018552 3300049669 Bacteria 1542
1529 Ga0501249_000180 3300049679 Bacteria 19312
1530 Ga0501257_009060 3300049686 Bacteria 2243
1531 Ga0501258_000627 3300049687 Bacteria 2514
1532 Ga0501225_0000006 3300049705 Bacteria 119739
1533 Ga0501225_0000135 3300049705 Bacteria 22383
1534 Ga0501225_0000699 3300049705 Bacteria 10511
1535 Ga0501225_0004016 3300049705 Bacteria 4403
1536 Ga0501268_000889 3300049765 Bacteria 3493
1537 Ga0501268_005524 3300049765 Bacteria 1822
1538 Ga0501272_000840 3300049769 Bacteria 2797
1539 Ga0501226_000044 3300049853 Bacteria 56354
1540 nmdc:mga03683_4781_c2 3300050489 Bacteria 2499
1541 nmdc:mga00v17_6035_c1 3300050491 Bacteria 6407
1542 nmdc:mga0k408_203442_c1 3300050493 Bacteria 1182
1543 nmdc:mga06z11_260_c1 3300050494 Bacteria 20630
1544 nmdc:mga04h51_1059_c1 3300050495 Bacteria 6331
1545 nmdc:mga07m45_9469_c1 3300050496 Bacteria 5055
1546 nmdc:mga06r32_27084_c1 3300050510 Bacteria 5350
1547 nmdc:mga08y16_235020_c1 3300050511 Bacteria 1895
1548 nmdc:mga08y16_242803_c1 3300050511 Bacteria 1862
1549 nmdc:mga0n895_33781_c1 3300050512 Bacteria 4917
1550 nmdc:mga0a205_38416_c1 3300050515 Bacteria 4606
1551 Ga0495655_0012966 3300053083 Bacteria 1712
1552 Ga0500643_000430 3300053087 Bacteria 31632
1553 Ga0500643_000620 3300053087 Bacteria 24035
1554 Ga0500643_001505 3300053087 Bacteria 13338
1555 Ga0500643_004578 3300053087 Bacteria 6193
1556 Ga0500643_022780 3300053087 Bacteria 2010
1557 Ga0500646_0004153 3300053090 Bacteria 3676
1558 Ga0500647_0026423 3300053091 Bacteria 2738
1559 Ga0500651_0000548 3300053093 Bacteria 19076
1560 Ga0500572_035575 3300053111 Bacteria 1417
1561 Ga0500594_0003814 3300053118 Bacteria 3318
1562 Ga0500614_007329 3300053123 Bacteria 2325
1563 Ga0500642_0004476 3300053130 Bacteria 4379
1564 Ga0500655_000470 3300053133 Bacteria 8191
1565 Ga0500658_0000107 3300053134 Bacteria 38715
1566 Ga0500568_0000413 3300053139 Bacteria 32699
1567 Ga0500590_000301 3300053148 Bacteria 15719
1568 Ga0500604_0000038 3300053151 Bacteria 50694
1569 Ga0500616_0001124 3300053153 Bacteria 27529
1570 Ga0500622_0010167 3300053156 Bacteria 5175
1571 Ga0500624_000534 3300053157 Bacteria 10781
1572 Ga0500636_0016777 3300053177 Bacteria 4317
1573 Ga0500636_0064942 3300053177 Bacteria 2125
1574 Ga0500570_000443 3300053724 Bacteria 15910
1575 Ga0500587_006078 3300053739 Bacteria 1612
1576 Ga0590077_016813 3300059426 Bacteria 1536
1577 Ga0501082_0066749 3300060353 Bacteria 3098
1578 Ga0466962_0002682 3300061719 Bacteria 8472

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044694 Ga0466963_0172402 Ga0466963_0172402_21_1073 288
2 3300025893 Ga0207682_10024452 Ga0207682_100244524 310
3 3300032004 Ga0307414_10005184 Ga0307414_100051842 316
4 3300048928 Ga0496125_0197722 Ga0496125_0197722_296_1306 318
5 3300053083 Ga0495655_0012966 Ga0495655_0012966_635_1681 323
6 3300037466 Ga0395898_0291753 Ga0395898_0291753_26_1066 327
7 3300005336 Ga0070680_100004527 Ga0070680_1000045278 328
8 3300005563 Ga0068855_100028359 Ga0068855_1000283593 328
9 3300025917 Ga0207660_10000059 Ga0207660_1000005920 328
10 3300005530 Ga0070679_100216118 Ga0070679_1002161182 333
11 3300005547 Ga0070693_100072586 Ga0070693_1000725862 333
12 3300025907 Ga0207645_10030780 Ga0207645_100307802 333
13 3300025917 Ga0207660_10062717 Ga0207660_100627172 333
14 3300025919 Ga0207657_10035242 Ga0207657_100352423 333
15 3300025933 Ga0207706_10060755 Ga0207706_100607552 333
16 3300037418 Ga0395900_0117151 Ga0395900_0117151_1442_2683 335
17 3300037466 Ga0395898_0029806 Ga0395898_0029806_2987_4228 335
18 3300045836 Ga0466958_0007081 Ga0466958_0007081_1301_2527 335
19 3300001990 JGI24737J22298_10011579 JGI24737J22298_100115792 336
20 3300005339 Ga0070660_100007769 Ga0070660_1000077692 336
21 3300005344 Ga0070661_100026078 Ga0070661_1000260784 336
22 3300005366 Ga0070659_100080716 Ga0070659_1000807162 336
23 3300005455 Ga0070663_100049590 Ga0070663_1000495902 336
24 3300025909 Ga0207705_10002565 Ga0207705_1000256510 336
25 3300025919 Ga0207657_10002036 Ga0207657_1000203611 336
26 3300026067 Ga0207678_10005871 Ga0207678_1000587113 336
27 3300026116 Ga0207674_10007984 Ga0207674_100079842 336
28 3300037312 Ga0395899_0002341 Ga0395899_0002341_3479_4705 336
29 3300037418 Ga0395900_0005190 Ga0395900_0005190_8198_9424 336
30 3300038443 Ga0395901_0029347 Ga0395901_0029347_2437_3663 336
31 3300005840 Ga0068870_10026956 Ga0068870_100269562 337
32 3300046452 Ga0495617_070645 Ga0495617_070645_17_1132 337
33 3300048916 Ga0496113_0054506 Ga0496113_0054506_17_1117 337
34 3300005347 Ga0070668_100067246 Ga0070668_1000672462 338
35 3300005435 Ga0070714_100030786 Ga0070714_1000307862 338
36 3300005564 Ga0070664_100068767 Ga0070664_1000687673 338
37 3300005327 Ga0070658_10000782 Ga0070658_1000078224 339
38 3300005329 Ga0070683_100009091 Ga0070683_1000090912 339
39 3300005331 Ga0070670_100087282 Ga0070670_1000872822 339
40 3300005335 Ga0070666_10001807 Ga0070666_100018078 339
41 3300005339 Ga0070660_100000534 Ga0070660_10000053422 339
42 3300005344 Ga0070661_100000452 Ga0070661_10000045214 339
43 3300005344 Ga0070661_100014219 Ga0070661_1000142194 339
44 3300005355 Ga0070671_100002968 Ga0070671_1000029687 339
45 3300005366 Ga0070659_100000138 Ga0070659_10000013842 339
46 3300005455 Ga0070663_100001943 Ga0070663_10000194310 339
47 3300005455 Ga0070663_100176425 Ga0070663_1001764252 339
48 3300005456 Ga0070678_100084142 Ga0070678_1000841422 339
49 3300005457 Ga0070662_100000410 Ga0070662_1000004109 339
50 3300005457 Ga0070662_100002965 Ga0070662_1000029657 339
51 3300005535 Ga0070684_100017451 Ga0070684_1000174514 339
52 3300005539 Ga0068853_100000479 Ga0068853_10000047910 339
53 3300005547 Ga0070693_100000672 Ga0070693_10000067212 339
54 3300005548 Ga0070665_100006945 Ga0070665_1000069453 339
55 3300005563 Ga0068855_100000163 Ga0068855_10000016314 339
56 3300005564 Ga0070664_100000717 Ga0070664_10000071722 339
57 3300005564 Ga0070664_100003721 Ga0070664_1000037217 339
58 3300005614 Ga0068856_100000829 Ga0068856_10000082924 339
59 3300005616 Ga0068852_100001212 Ga0068852_10000121210 339
60 3300005618 Ga0068864_100008287 Ga0068864_1000082874 339
61 3300005841 Ga0068863_100174588 Ga0068863_1001745881 339
62 3300005842 Ga0068858_100018420 Ga0068858_1000184202 339
63 3300006358 Ga0068871_100006264 Ga0068871_1000062644 339
64 3300009174 Ga0105241_10045673 Ga0105241_100456732 339
65 3300009177 Ga0105248_10001737 Ga0105248_1000173719 339
66 3300013100 Ga0157373_10127969 Ga0157373_101279691 339
67 3300013102 Ga0157371_10000784 Ga0157371_1000078426 339
68 3300013104 Ga0157370_10003273 Ga0157370_100032736 339
69 3300014968 Ga0157379_10081005 Ga0157379_100810053 339
70 3300025321 Ga0207656_10000912 Ga0207656_100009124 339
71 3300025903 Ga0207680_10001684 Ga0207680_100016843 339
72 3300025904 Ga0207647_10005198 Ga0207647_100051989 339
73 3300025909 Ga0207705_10000260 Ga0207705_1000026022 339
74 3300025919 Ga0207657_10000031 Ga0207657_10000031132 339
75 3300025920 Ga0207649_10000394 Ga0207649_1000039417 339
76 3300025925 Ga0207650_10013470 Ga0207650_100134704 339
77 3300025925 Ga0207650_10023803 Ga0207650_100238032 339
78 3300025931 Ga0207644_10000960 Ga0207644_1000096023 339
79 3300025932 Ga0207690_10000382 Ga0207690_100003828 339
80 3300025933 Ga0207706_10000028 Ga0207706_10000028150 339
81 3300025933 Ga0207706_10025601 Ga0207706_100256014 339
82 3300025941 Ga0207711_10001375 Ga0207711_1000137523 339
83 3300025944 Ga0207661_10007677 Ga0207661_100076772 339
84 3300025945 Ga0207679_10000488 Ga0207679_100004888 339
85 3300025949 Ga0207667_10003386 Ga0207667_100033867 339
86 3300025949 Ga0207667_10165028 Ga0207667_101650282 339
87 3300025981 Ga0207640_10011717 Ga0207640_100117174 339
88 3300026035 Ga0207703_10028588 Ga0207703_100285881 339
89 3300026041 Ga0207639_10000131 Ga0207639_1000013118 339
90 3300026067 Ga0207678_10005050 Ga0207678_100050503 339
91 3300026078 Ga0207702_10000247 Ga0207702_1000024746 339
92 3300026089 Ga0207648_10245212 Ga0207648_102452122 339
93 3300026095 Ga0207676_10046019 Ga0207676_100460195 339
94 3300026121 Ga0207683_10022964 Ga0207683_100229644 339
95 3300026142 Ga0207698_10000944 Ga0207698_1000094410 339
96 3300028379 Ga0268266_10005698 Ga0268266_100056989 339
97 3300037471 Ga0395905_0078274 Ga0395905_0078274_58_1287 339
98 3300037471 Ga0395905_0094731 Ga0395905_0094731_45_1268 339
99 3300048912 Ga0496109_0219323 Ga0496109_0219323_483_1700 339
100 3300005331 Ga0070670_100006252 Ga0070670_1000062525 340
101 3300005367 Ga0070667_100254536 Ga0070667_1002545362 340
102 3300005564 Ga0070664_100018639 Ga0070664_1000186393 340
103 3300025925 Ga0207650_10231506 Ga0207650_102315061 340
104 3300025945 Ga0207679_10000876 Ga0207679_100008769 340
105 3300031824 Ga0307413_10001883 Ga0307413_100018832 340
106 3300031852 Ga0307410_10002266 Ga0307410_100022667 340
107 3300031852 Ga0307410_10008229 Ga0307410_100082292 340
108 3300031903 Ga0307407_10002416 Ga0307407_100024161 340
109 3300031995 Ga0307409_100087128 Ga0307409_1000871282 340
110 3300032126 Ga0307415_100202045 Ga0307415_1002020451 340
111 3300001979 JGI24740J21852_10015670 JGI24740J21852_100156702 341
112 3300005327 Ga0070658_10004553 Ga0070658_1000455313 341
113 3300005329 Ga0070683_100009240 Ga0070683_1000092408 341
114 3300005336 Ga0070680_100021563 Ga0070680_1000215632 341
115 3300005339 Ga0070660_100019053 Ga0070660_1000190536 341
116 3300005455 Ga0070663_100125571 Ga0070663_1001255712 341
117 3300005530 Ga0070679_100005796 Ga0070679_1000057961 341
118 3300005563 Ga0068855_100004365 Ga0068855_1000043655 341
119 3300005614 Ga0068856_100200398 Ga0068856_1002003982 341
120 3300005614 Ga0068856_100227336 Ga0068856_1002273362 341
121 3300013104 Ga0157370_10008380 Ga0157370_100083801 341
122 3300013105 Ga0157369_10082337 Ga0157369_100823373 341
123 3300025904 Ga0207647_10005186 Ga0207647_100051862 341
124 3300025909 Ga0207705_10000333 Ga0207705_1000033349 341
125 3300025917 Ga0207660_10010582 Ga0207660_100105826 341
126 3300025919 Ga0207657_10005696 Ga0207657_100056964 341
127 3300025919 Ga0207657_10075937 Ga0207657_100759372 341
128 3300025932 Ga0207690_10030137 Ga0207690_100301374 341
129 3300025944 Ga0207661_10013121 Ga0207661_100131212 341
130 3300025949 Ga0207667_10037725 Ga0207667_100377256 341
131 3300026067 Ga0207678_10002137 Ga0207678_1000213714 341
132 3300026067 Ga0207678_10084406 Ga0207678_100844065 341
133 3300037418 Ga0395900_0003179 Ga0395900_0003179_9982_11220 341
134 3300037418 Ga0395900_0063918 Ga0395900_0063918_1315_2568 341
135 3300037466 Ga0395898_0004178 Ga0395898_0004178_4602_5840 341
136 3300037471 Ga0395905_0000342 Ga0395905_0000342_10915_12138 341
137 3300037471 Ga0395905_0012125 Ga0395905_0012125_1429_2667 341
138 3300038443 Ga0395901_0007110 Ga0395901_0007110_88_1326 341
139 3300038443 Ga0395901_0415066 Ga0395901_0415066_109_1362 341
140 3300044765 Ga0466970_0089944 Ga0466970_0089944_105_1328 341
141 3300005339 Ga0070660_100012648 Ga0070660_1000126484 342
142 3300005344 Ga0070661_100135480 Ga0070661_1001354802 342
143 3300005543 Ga0070672_100073233 Ga0070672_1000732332 342
144 3300005618 Ga0068864_100000311 Ga0068864_10000031120 342
145 3300005841 Ga0068863_100066963 Ga0068863_1000669632 342
146 3300025919 Ga0207657_10015566 Ga0207657_100155664 342
147 3300025920 Ga0207649_10108811 Ga0207649_101088112 342
148 3300025924 Ga0207694_10040314 Ga0207694_100403143 342
149 3300025931 Ga0207644_10005412 Ga0207644_100054123 342
150 3300025940 Ga0207691_10038144 Ga0207691_100381442 342
151 3300025941 Ga0207711_10000055 Ga0207711_1000005589 342
152 3300026095 Ga0207676_10000937 Ga0207676_100009377 342
153 3300005355 Ga0070671_100012961 Ga0070671_1000129612 343
154 3300005435 Ga0070714_100004704 Ga0070714_1000047046 343
155 3300005459 Ga0068867_100056646 Ga0068867_1000566462 343
156 3300005578 Ga0068854_100004964 Ga0068854_1000049642 343
157 3300005618 Ga0068864_100008907 Ga0068864_1000089072 343
158 3300005841 Ga0068863_100039885 Ga0068863_1000398853 343
159 3300009551 Ga0105238_10068384 Ga0105238_100683842 343
160 3300013297 Ga0157378_10138353 Ga0157378_101383532 343
161 3300025925 Ga0207650_10043927 Ga0207650_100439272 343
162 3300025931 Ga0207644_10001995 Ga0207644_100019953 343
163 3300025941 Ga0207711_10008690 Ga0207711_100086906 343
164 3300025981 Ga0207640_10023083 Ga0207640_100230833 343
165 3300026078 Ga0207702_10086674 Ga0207702_100866743 343
166 3300026089 Ga0207648_10011277 Ga0207648_100112774 343
167 3300026095 Ga0207676_10165922 Ga0207676_101659222 343
168 3300044693 Ga0466961_0006734 Ga0466961_0006734_325_1572 343
169 3300044842 Ga0466957_0092940 Ga0466957_0092940_370_1617 343
170 3300045976 Ga0466967_0047341 Ga0466967_0047341_467_1693 343
171 3300046616 Ga0495668_0057716 Ga0495668_0057716_227_1429 343
172 3300048911 Ga0496108_0096636 Ga0496108_0096636_861_2084 343
173 3300048912 Ga0496109_0151071 Ga0496109_0151071_837_2060 343
174 3300048915 Ga0496112_0014049 Ga0496112_0014049_5510_6733 343
175 3300005435 Ga0070714_100225124 Ga0070714_1002251242 344
176 3300009098 Ga0105245_10030338 Ga0105245_100303383 344
177 3300031548 Ga0307408_100088488 Ga0307408_1000884882 344
178 3300031731 Ga0307405_10064187 Ga0307405_100641872 344
179 3300031824 Ga0307413_10050243 Ga0307413_100502432 344
180 3300031852 Ga0307410_10028004 Ga0307410_100280044 344
181 3300031901 Ga0307406_10024655 Ga0307406_100246554 344
182 3300031903 Ga0307407_10016462 Ga0307407_100164622 344
183 3300031911 Ga0307412_10069043 Ga0307412_100690432 344
184 3300031995 Ga0307409_100013807 Ga0307409_1000138075 344
185 3300032002 Ga0307416_100138879 Ga0307416_1001388792 344
186 3300041413 Ga0439465_0011481 Ga0439465_0011481_519_1745 344
187 3300044842 Ga0466957_0025277 Ga0466957_0025277_1664_2890 344
188 3300044901 Ga0466960_0005295 Ga0466960_0005295_2004_3263 344
189 3300045976 Ga0466967_0043080 Ga0466967_0043080_2227_3453 344
190 3300049663 Ga0501223_009288 Ga0501223_009288_360_1586 344
191 3300049667 Ga0501230_008521 Ga0501230_008521_263_1489 344
192 3300049669 Ga0501235_008062 Ga0501235_008062_463_1689 344
193 3300049686 Ga0501257_009060 Ga0501257_009060_679_1905 344
194 3300049687 Ga0501258_000627 Ga0501258_000627_847_2073 344
195 3300049705 Ga0501225_0004016 Ga0501225_0004016_475_1701 344
196 3300049765 Ga0501268_000889 Ga0501268_000889_1310_2536 344
197 3300049769 Ga0501272_000840 Ga0501272_000840_728_1954 344
198 3300005336 Ga0070680_100014624 Ga0070680_1000146245 345
199 3300005455 Ga0070663_100032971 Ga0070663_1000329713 345
200 3300013100 Ga0157373_10049670 Ga0157373_100496702 345
201 3300025917 Ga0207660_10000092 Ga0207660_1000009251 345
202 3300025919 Ga0207657_10007817 Ga0207657_1000781710 345
203 3300025932 Ga0207690_10013257 Ga0207690_100132576 345
204 3300001979 JGI24740J21852_10003249 JGI24740J21852_100032494 346
205 3300001989 JGI24739J22299_10017565 JGI24739J22299_100175652 346
206 3300002075 JGI24738J21930_10004401 JGI24738J21930_100044012 346
207 3300005327 Ga0070658_10028263 Ga0070658_100282633 346
208 3300005329 Ga0070683_100093309 Ga0070683_1000933092 346
209 3300005333 Ga0070677_10012509 Ga0070677_100125092 346
210 3300005335 Ga0070666_10003096 Ga0070666_100030967 346
211 3300005339 Ga0070660_100058713 Ga0070660_1000587132 346
212 3300005339 Ga0070660_100120616 Ga0070660_1001206162 346
213 3300005343 Ga0070687_100066750 Ga0070687_1000667502 346
214 3300005344 Ga0070661_100095393 Ga0070661_1000953932 346
215 3300005355 Ga0070671_100029600 Ga0070671_1000296001 346
216 3300005356 Ga0070674_100017574 Ga0070674_1000175744 346
217 3300005366 Ga0070659_100081127 Ga0070659_1000811272 346
218 3300005367 Ga0070667_100001974 Ga0070667_1000019745 346
219 3300005367 Ga0070667_100010117 Ga0070667_1000101174 346
220 3300005535 Ga0070684_100017615 Ga0070684_1000176154 346
221 3300005547 Ga0070693_100095107 Ga0070693_1000951071 346
222 3300005548 Ga0070665_100044858 Ga0070665_1000448584 346
223 3300005564 Ga0070664_100044580 Ga0070664_1000445804 346
224 3300005564 Ga0070664_100229060 Ga0070664_1002290602 346
225 3300005577 Ga0068857_100054971 Ga0068857_1000549713 346
226 3300005578 Ga0068854_100050526 Ga0068854_1000505262 346
227 3300005578 Ga0068854_100053210 Ga0068854_1000532103 346
228 3300005614 Ga0068856_100094898 Ga0068856_1000948982 346
229 3300005616 Ga0068852_100055228 Ga0068852_1000552282 346
230 3300005718 Ga0068866_10015285 Ga0068866_100152853 346
231 3300009093 Ga0105240_10348507 Ga0105240_103485072 346
232 3300009174 Ga0105241_10219380 Ga0105241_102193801 346
233 3300009177 Ga0105248_10003558 Ga0105248_1000355816 346
234 3300013100 Ga0157373_10040401 Ga0157373_100404014 346
235 3300013102 Ga0157371_10022054 Ga0157371_100220544 346
236 3300013102 Ga0157371_10133674 Ga0157371_101336742 346
237 3300013307 Ga0157372_10025215 Ga0157372_100252153 346
238 3300013307 Ga0157372_10181037 Ga0157372_101810372 346
239 3300025893 Ga0207682_10003272 Ga0207682_100032725 346
240 3300025903 Ga0207680_10034114 Ga0207680_100341142 346
241 3300025904 Ga0207647_10027096 Ga0207647_100270962 346
242 3300025907 Ga0207645_10084803 Ga0207645_100848032 346
243 3300025909 Ga0207705_10063922 Ga0207705_100639222 346
244 3300025919 Ga0207657_10004138 Ga0207657_100041384 346
245 3300025919 Ga0207657_10007120 Ga0207657_100071203 346
246 3300025920 Ga0207649_10021941 Ga0207649_100219412 346
247 3300025933 Ga0207706_10033418 Ga0207706_100334183 346
248 3300025933 Ga0207706_10037742 Ga0207706_100377423 346
249 3300025941 Ga0207711_10006300 Ga0207711_100063006 346
250 3300025942 Ga0207689_10028006 Ga0207689_100280065 346
251 3300025944 Ga0207661_10047145 Ga0207661_100471453 346
252 3300025944 Ga0207661_10227561 Ga0207661_102275611 346
253 3300025945 Ga0207679_10134726 Ga0207679_101347262 346
254 3300025960 Ga0207651_10200101 Ga0207651_102001011 346
255 3300025986 Ga0207658_10001358 Ga0207658_100013585 346
256 3300026035 Ga0207703_10074462 Ga0207703_100744623 346
257 3300026067 Ga0207678_10000354 Ga0207678_1000035416 346
258 3300026067 Ga0207678_10037178 Ga0207678_100371783 346
259 3300026078 Ga0207702_10036030 Ga0207702_100360302 346
260 3300026078 Ga0207702_10072603 Ga0207702_100726033 346
261 3300026116 Ga0207674_10004090 Ga0207674_1000409019 346
262 3300026116 Ga0207674_10006220 Ga0207674_100062209 346
263 3300026121 Ga0207683_10003374 Ga0207683_100033744 346
264 3300026142 Ga0207698_10098494 Ga0207698_100984942 346
265 3300031824 Ga0307413_10062732 Ga0307413_100627322 346
266 3300037471 Ga0395905_0195325 Ga0395905_0195325_780_1880 346
267 3300038443 Ga0395901_0159507 Ga0395901_0159507_944_2194 346
268 3300048915 Ga0496112_0173540 Ga0496112_0173540_36_1283 346
269 3300049765 Ga0501268_005524 Ga0501268_005524_343_1512 346
270 3300005614 Ga0068856_100046785 Ga0068856_1000467854 347
271 3300037312 Ga0395899_0009305 Ga0395899_0009305_1658_2893 347
272 3300037418 Ga0395900_0055440 Ga0395900_0055440_2559_3794 347
273 3300037466 Ga0395898_0002186 Ga0395898_0002186_8874_10109 347
274 3300037471 Ga0395905_0010395 Ga0395905_0010395_6217_7452 347
275 3300038443 Ga0395901_0012439 Ga0395901_0012439_1181_2416 347
276 3300045976 Ga0466967_0193124 Ga0466967_0193124_312_1565 347
277 3300048905 Ga0496102_0153748 Ga0496102_0153748_824_2047 347
278 3300049583 Ga0501067_0036101 Ga0501067_0036101_822_2045 347
279 3300005564 Ga0070664_100353361 Ga0070664_1003533611 348
280 3300031824 Ga0307413_10006729 Ga0307413_100067294 348
281 3300031852 Ga0307410_10072039 Ga0307410_100720392 348
282 3300032005 Ga0307411_10105256 Ga0307411_101052562 348
283 3300005335 Ga0070666_10045046 Ga0070666_100450462 349
284 3300025925 Ga0207650_10202525 Ga0207650_102025252 349
285 3300037068 Ga0373925_0241472 Ga0373925_0241472_14_1222 349
286 3300005327 Ga0070658_10132502 Ga0070658_101325022 350
287 3300005331 Ga0070670_100010976 Ga0070670_1000109765 350
288 3300005335 Ga0070666_10070114 Ga0070666_100701141 350
289 3300005338 Ga0068868_100040654 Ga0068868_1000406542 350
290 3300005355 Ga0070671_100081916 Ga0070671_1000819162 350
291 3300005367 Ga0070667_100023036 Ga0070667_1000230364 350
292 3300005543 Ga0070672_100002925 Ga0070672_1000029255 350
293 3300005564 Ga0070664_100040526 Ga0070664_1000405262 350
294 3300005616 Ga0068852_100216062 Ga0068852_1002160622 350
295 3300005618 Ga0068864_100030651 Ga0068864_1000306514 350
296 3300005841 Ga0068863_100118876 Ga0068863_1001188762 350
297 3300006358 Ga0068871_100009802 Ga0068871_1000098022 350
298 3300009177 Ga0105248_10027530 Ga0105248_100275302 350
299 3300013102 Ga0157371_10069443 Ga0157371_100694432 350
300 3300013296 Ga0157374_10007053 Ga0157374_100070532 350
301 3300013306 Ga0163162_10001484 Ga0163162_1000148421 350
302 3300013308 Ga0157375_10000751 Ga0157375_1000075110 350
303 3300014325 Ga0163163_10005302 Ga0163163_1000530210 350
304 3300025901 Ga0207688_10053791 Ga0207688_100537911 350
305 3300025903 Ga0207680_10001861 Ga0207680_100018616 350
306 3300025931 Ga0207644_10000541 Ga0207644_1000054125 350
307 3300025940 Ga0207691_10006787 Ga0207691_100067879 350
308 3300025941 Ga0207711_10015900 Ga0207711_100159005 350
309 3300025945 Ga0207679_10026128 Ga0207679_100261284 350
310 3300025960 Ga0207651_10001715 Ga0207651_100017155 350
311 3300026035 Ga0207703_10026110 Ga0207703_100261104 350
312 3300026088 Ga0207641_10018629 Ga0207641_100186292 350
313 3300026095 Ga0207676_10003289 Ga0207676_100032895 350
314 3300026121 Ga0207683_10036381 Ga0207683_100363812 350
315 3300045976 Ga0466967_0217767 Ga0466967_0217767_98_1333 350
316 3300048911 Ga0496108_0002877 Ga0496108_0002877_5620_6843 350
317 3300048912 Ga0496109_0003121 Ga0496109_0003121_8106_9329 350
318 3300048914 Ga0496111_0075997 Ga0496111_0075997_919_2142 350
319 3300048915 Ga0496112_0051828 Ga0496112_0051828_2065_3288 350
320 3300048916 Ga0496113_0004234 Ga0496113_0004234_1536_2759 350
321 3300050493 nmdc:mga0k408_203442_c1 nmdc:mga0k408_203442_c1_20_1165 350
322 3300005331 Ga0070670_100002057 Ga0070670_1000020576 351
323 3300005335 Ga0070666_10016385 Ga0070666_100163855 351
324 3300005347 Ga0070668_100000030 Ga0070668_10000003055 351
325 3300005353 Ga0070669_100071740 Ga0070669_1000717403 351
326 3300005355 Ga0070671_100000125 Ga0070671_10000012534 351
327 3300005367 Ga0070667_100000071 Ga0070667_10000007198 351
328 3300005617 Ga0068859_100013301 Ga0068859_1000133013 351
329 3300005841 Ga0068863_100008083 Ga0068863_10000808312 351
330 3300005842 Ga0068858_100006789 Ga0068858_10000678911 351
331 3300005843 Ga0068860_100000049 Ga0068860_100000049120 351
332 3300005844 Ga0068862_100002193 Ga0068862_10000219315 351
333 3300006931 Ga0097620_100013301 Ga0097620_1000133019 351
334 3300025903 Ga0207680_10009007 Ga0207680_100090075 351
335 3300025923 Ga0207681_10076945 Ga0207681_100769453 351
336 3300025925 Ga0207650_10004803 Ga0207650_100048035 351
337 3300025931 Ga0207644_10000804 Ga0207644_100008042 351
338 3300025933 Ga0207706_10046285 Ga0207706_100462853 351
339 3300025972 Ga0207668_10000011 Ga0207668_10000011100 351
340 3300025986 Ga0207658_10000014 Ga0207658_10000014127 351
341 3300026035 Ga0207703_10001634 Ga0207703_1000163414 351
342 3300026088 Ga0207641_10007375 Ga0207641_100073752 351
343 3300028380 Ga0268265_10002083 Ga0268265_1000208314 351
344 3300028381 Ga0268264_10000121 Ga0268264_10000121106 351
345 3300031824 Ga0307413_10011336 Ga0307413_100113361 351
346 3300031901 Ga0307406_10006201 Ga0307406_100062014 351
347 3300031903 Ga0307407_10023838 Ga0307407_100238383 351
348 3300031911 Ga0307412_10024437 Ga0307412_100244374 351
349 3300031995 Ga0307409_100044513 Ga0307409_1000445133 351
350 3300005327 Ga0070658_10072557 Ga0070658_100725573 352
351 3300005330 Ga0070690_100001926 Ga0070690_10000192612 352
352 3300005331 Ga0070670_100105952 Ga0070670_1001059522 352
353 3300005338 Ga0068868_100071727 Ga0068868_1000717273 352
354 3300005339 Ga0070660_100020862 Ga0070660_1000208622 352
355 3300005344 Ga0070661_100016661 Ga0070661_1000166613 352
356 3300005355 Ga0070671_100002744 Ga0070671_1000027442 352
357 3300005356 Ga0070674_100010449 Ga0070674_1000104494 352
358 3300005364 Ga0070673_100077858 Ga0070673_1000778583 352
359 3300005366 Ga0070659_100074363 Ga0070659_1000743632 352
360 3300005367 Ga0070667_100093656 Ga0070667_1000936562 352
361 3300005457 Ga0070662_100017032 Ga0070662_1000170324 352
362 3300005459 Ga0068867_100042556 Ga0068867_1000425562 352
363 3300005543 Ga0070672_100018137 Ga0070672_1000181374 352
364 3300005544 Ga0070686_100016826 Ga0070686_1000168263 352
365 3300005578 Ga0068854_100068462 Ga0068854_1000684623 352
366 3300005614 Ga0068856_100059917 Ga0068856_1000599172 352
367 3300005617 Ga0068859_100052253 Ga0068859_1000522534 352
368 3300005718 Ga0068866_10001658 Ga0068866_100016584 352
369 3300005834 Ga0068851_10005529 Ga0068851_100055294 352
370 3300005841 Ga0068863_100012971 Ga0068863_1000129718 352
371 3300005842 Ga0068858_100051078 Ga0068858_1000510783 352
372 3300006237 Ga0097621_100105948 Ga0097621_1001059482 352
373 3300006358 Ga0068871_100025827 Ga0068871_1000258274 352
374 3300006881 Ga0068865_100001641 Ga0068865_1000016413 352
375 3300006931 Ga0097620_100052249 Ga0097620_1000522494 352
376 3300009098 Ga0105245_10020419 Ga0105245_100204192 352
377 3300009148 Ga0105243_10067773 Ga0105243_100677733 352
378 3300009176 Ga0105242_10010689 Ga0105242_100106897 352
379 3300009177 Ga0105248_10177821 Ga0105248_101778212 352
380 3300009551 Ga0105238_10136630 Ga0105238_101366303 352
381 3300013102 Ga0157371_10040907 Ga0157371_100409072 352
382 3300013105 Ga0157369_10001571 Ga0157369_1000157117 352
383 3300013105 Ga0157369_10147134 Ga0157369_101471342 352
384 3300013296 Ga0157374_10052142 Ga0157374_100521422 352
385 3300013297 Ga0157378_10005483 Ga0157378_100054834 352
386 3300013306 Ga0163162_10145202 Ga0163162_101452023 352
387 3300013308 Ga0157375_10037868 Ga0157375_100378684 352
388 3300014325 Ga0163163_10035865 Ga0163163_100358654 352
389 3300014969 Ga0157376_10026327 Ga0157376_100263273 352
390 3300025321 Ga0207656_10056269 Ga0207656_100562692 352
391 3300025899 Ga0207642_10002708 Ga0207642_100027084 352
392 3300025903 Ga0207680_10082110 Ga0207680_100821102 352
393 3300025904 Ga0207647_10032704 Ga0207647_100327042 352
394 3300025919 Ga0207657_10030591 Ga0207657_100305912 352
395 3300025920 Ga0207649_10032277 Ga0207649_100322773 352
396 3300025924 Ga0207694_10122497 Ga0207694_101224972 352
397 3300025927 Ga0207687_10017436 Ga0207687_100174364 352
398 3300025928 Ga0207700_10018015 Ga0207700_100180154 352
399 3300025929 Ga0207664_10026604 Ga0207664_100266044 352
400 3300025931 Ga0207644_10001058 Ga0207644_1000105814 352
401 3300025932 Ga0207690_10019720 Ga0207690_100197203 352
402 3300025933 Ga0207706_10003751 Ga0207706_1000375114 352
403 3300025937 Ga0207669_10104841 Ga0207669_101048412 352
404 3300025940 Ga0207691_10000954 Ga0207691_1000095422 352
405 3300025941 Ga0207711_10003374 Ga0207711_1000337415 352
406 3300025949 Ga0207667_10130674 Ga0207667_101306743 352
407 3300025960 Ga0207651_10000289 Ga0207651_1000028914 352
408 3300025986 Ga0207658_10005082 Ga0207658_100050828 352
409 3300026023 Ga0207677_10007710 Ga0207677_100077101 352
410 3300026088 Ga0207641_10015081 Ga0207641_100150812 352
411 3300026089 Ga0207648_10005820 Ga0207648_100058209 352
412 3300026095 Ga0207676_10231988 Ga0207676_102319882 352
413 3300026121 Ga0207683_10001453 Ga0207683_1000145317 352
414 3300026142 Ga0207698_10058765 Ga0207698_100587652 352
415 3300037471 Ga0395905_0044535 Ga0395905_0044535_178_1413 352
416 3300038443 Ga0395901_0011931 Ga0395901_0011931_3533_4768 352
417 3300038443 Ga0395901_0033824 Ga0395901_0033824_351_1586 352
418 3300048903 Ga0496100_0001163 Ga0496100_0001163_7307_8548 352
419 3300048904 Ga0496101_0001522 Ga0496101_0001522_5508_6749 352
420 3300048905 Ga0496102_0157930 Ga0496102_0157930_866_2107 352
421 3300048906 Ga0496103_0057679 Ga0496103_0057679_650_1891 352
422 3300048907 Ga0496104_0029921 Ga0496104_0029921_1400_2641 352
423 3300048908 Ga0496105_0020435 Ga0496105_0020435_303_1544 352
424 3300048910 Ga0496107_0022378 Ga0496107_0022378_3174_4415 352
425 3300048911 Ga0496108_0001452 Ga0496108_0001452_8133_9374 352
426 3300048912 Ga0496109_0008419 Ga0496109_0008419_7389_8630 352
427 3300048913 Ga0496110_0017606 Ga0496110_0017606_203_1444 352
428 3300048914 Ga0496111_0004779 Ga0496111_0004779_2149_3390 352
429 3300048915 Ga0496112_0029592 Ga0496112_0029592_154_1395 352
430 3300048916 Ga0496113_0005671 Ga0496113_0005671_1805_3046 352
431 3300002067 JGI24735J21928_10002483 JGI24735J21928_100024836 353
432 3300005618 Ga0068864_100128660 Ga0068864_1001286602 353
433 3300009177 Ga0105248_10060248 Ga0105248_100602483 353
434 3300013100 Ga0157373_10140883 Ga0157373_101408831 353
435 3300031731 Ga0307405_10028554 Ga0307405_100285542 353
436 3300031852 Ga0307410_10041276 Ga0307410_100412763 353
437 3300031901 Ga0307406_10085035 Ga0307406_100850353 353
438 3300032002 Ga0307416_100054999 Ga0307416_1000549992 353
439 3300037418 Ga0395900_0006477 Ga0395900_0006477_8387_9589 353
440 3300037418 Ga0395900_0406101 Ga0395900_0406101_58_1299 353
441 3300037466 Ga0395898_0037674 Ga0395898_0037674_3271_4473 353
442 3300037471 Ga0395905_0000559 Ga0395905_0000559_42639_43841 353
443 3300037471 Ga0395905_0033266 Ga0395905_0033266_2255_3478 353
444 3300042007 Ga0439449_0007739 Ga0439449_0007739_2101_3300 353
445 3300042116 Ga0450912_000687 Ga0450912_000687_279_1478 353
446 3300044694 Ga0466963_0067308 Ga0466963_0067308_409_1650 353
447 3300045836 Ga0466958_0090309 Ga0466958_0090309_241_1482 353
448 3300045976 Ga0466967_0039449 Ga0466967_0039449_20_1237 353
449 3300046679 Ga0495623_0007652 Ga0495623_0007652_85_1335 353
450 3300005327 Ga0070658_10009160 Ga0070658_100091602 354
451 3300005329 Ga0070683_100094999 Ga0070683_1000949992 354
452 3300005330 Ga0070690_100045241 Ga0070690_1000452412 354
453 3300005335 Ga0070666_10001550 Ga0070666_1000155017 354
454 3300005336 Ga0070680_100004180 Ga0070680_1000041802 354
455 3300005338 Ga0068868_100002343 Ga0068868_10000234312 354
456 3300005339 Ga0070660_100006863 Ga0070660_1000068637 354
457 3300005341 Ga0070691_10000118 Ga0070691_1000011817 354
458 3300005344 Ga0070661_100003827 Ga0070661_10000382710 354
459 3300005355 Ga0070671_100002863 Ga0070671_1000028639 354
460 3300005364 Ga0070673_100183530 Ga0070673_1001835302 354
461 3300005366 Ga0070659_100007280 Ga0070659_1000072807 354
462 3300005367 Ga0070667_100002750 Ga0070667_1000027505 354
463 3300005434 Ga0070709_10039167 Ga0070709_100391672 354
464 3300005436 Ga0070713_100028763 Ga0070713_1000287631 354
465 3300005539 Ga0068853_100009890 Ga0068853_1000098902 354
466 3300005548 Ga0070665_100193605 Ga0070665_1001936052 354
467 3300005564 Ga0070664_100159261 Ga0070664_1001592612 354
468 3300005578 Ga0068854_100002461 Ga0068854_1000024615 354
469 3300005614 Ga0068856_100066579 Ga0068856_1000665794 354
470 3300005616 Ga0068852_100198971 Ga0068852_1001989712 354
471 3300005617 Ga0068859_100059901 Ga0068859_1000599013 354
472 3300005718 Ga0068866_10063023 Ga0068866_100630232 354
473 3300005834 Ga0068851_10013200 Ga0068851_100132002 354
474 3300005842 Ga0068858_100004720 Ga0068858_10000472016 354
475 3300006931 Ga0097620_100059901 Ga0097620_1000599014 354
476 3300009093 Ga0105240_10011419 Ga0105240_100114194 354
477 3300009177 Ga0105248_10002097 Ga0105248_1000209716 354
478 3300009545 Ga0105237_10020582 Ga0105237_100205822 354
479 3300013104 Ga0157370_10297870 Ga0157370_102978702 354
480 3300013105 Ga0157369_10266977 Ga0157369_102669772 354
481 3300013297 Ga0157378_10057063 Ga0157378_100570634 354
482 3300013308 Ga0157375_10519604 Ga0157375_105196042 354
483 3300025321 Ga0207656_10049099 Ga0207656_100490992 354
484 3300025904 Ga0207647_10000875 Ga0207647_100008755 354
485 3300025904 Ga0207647_10002329 Ga0207647_100023292 354
486 3300025906 Ga0207699_10183700 Ga0207699_101837002 354
487 3300025909 Ga0207705_10026931 Ga0207705_100269313 354
488 3300025913 Ga0207695_10092920 Ga0207695_100929204 354
489 3300025915 Ga0207693_10025441 Ga0207693_100254413 354
490 3300025917 Ga0207660_10012618 Ga0207660_100126185 354
491 3300025919 Ga0207657_10001965 Ga0207657_100019651 354
492 3300025920 Ga0207649_10003528 Ga0207649_100035289 354
493 3300025931 Ga0207644_10005104 Ga0207644_100051046 354
494 3300025933 Ga0207706_10083819 Ga0207706_100838192 354
495 3300025941 Ga0207711_10002646 Ga0207711_1000264616 354
496 3300025944 Ga0207661_10067879 Ga0207661_100678792 354
497 3300025949 Ga0207667_10013060 Ga0207667_100130609 354
498 3300025960 Ga0207651_10017630 Ga0207651_100176303 354
499 3300025981 Ga0207640_10022085 Ga0207640_100220853 354
500 3300026023 Ga0207677_10005629 Ga0207677_100056293 354
501 3300026035 Ga0207703_10002884 Ga0207703_1000288415 354
502 3300026078 Ga0207702_10196312 Ga0207702_101963122 354
503 3300026116 Ga0207674_10000638 Ga0207674_1000063825 354
504 3300028379 Ga0268266_10131688 Ga0268266_101316882 354
505 3300031995 Ga0307409_100147797 Ga0307409_1001477972 354
506 3300035170 Ga0373943_0008320 Ga0373943_0008320_1836_3071 354
507 3300035171 Ga0373946_0007376 Ga0373946_0007376_1923_3158 354
508 3300035692 Ga0373935_0048652 Ga0373935_0048652_213_1448 354
509 3300035695 Ga0373927_0081661 Ga0373927_0081661_613_1848 354
510 3300037312 Ga0395899_0000113 Ga0395899_0000113_118030_119253 354
511 3300037312 Ga0395899_0051940 Ga0395899_0051940_110_1357 354
512 3300037418 Ga0395900_0000583 Ga0395900_0000583_10603_11826 354
513 3300037418 Ga0395900_0038430 Ga0395900_0038430_1249_2496 354
514 3300037418 Ga0395900_0096984 Ga0395900_0096984_1480_2727 354
515 3300037466 Ga0395898_0001351 Ga0395898_0001351_8660_9883 354
516 3300037466 Ga0395898_0025148 Ga0395898_0025148_2565_3788 354
517 3300037471 Ga0395905_0000005 Ga0395905_0000005_241649_242872 354
518 3300037471 Ga0395905_0002977 Ga0395905_0002977_15762_16985 354
519 3300037471 Ga0395905_0062865 Ga0395905_0062865_1857_3104 354
520 3300037471 Ga0395905_0175114 Ga0395905_0175114_235_1482 354
521 3300038443 Ga0395901_0001812 Ga0395901_0001812_19061_20284 354
522 3300038443 Ga0395901_0101231 Ga0395901_0101231_1176_2423 354
523 3300038443 Ga0395901_0118873 Ga0395901_0118873_36_1259 354
524 3300038443 Ga0395901_0187331 Ga0395901_0187331_735_1982 354
525 3300048905 Ga0496102_0115578 Ga0496102_0115578_474_1727 354
526 3300005327 Ga0070658_10098386 Ga0070658_100983862 355
527 3300005344 Ga0070661_100038633 Ga0070661_1000386335 355
528 3300005366 Ga0070659_100011874 Ga0070659_1000118744 355
529 3300005366 Ga0070659_100014730 Ga0070659_1000147306 355
530 3300005444 Ga0070694_100061068 Ga0070694_1000610682 355
531 3300005457 Ga0070662_100032235 Ga0070662_1000322352 355
532 3300005545 Ga0070695_100012845 Ga0070695_1000128455 355
533 3300005546 Ga0070696_100001542 Ga0070696_1000015425 355
534 3300005564 Ga0070664_100026124 Ga0070664_1000261242 355
535 3300005577 Ga0068857_100043976 Ga0068857_1000439762 355
536 3300006237 Ga0097621_100152642 Ga0097621_1001526422 355
537 3300013100 Ga0157373_10005459 Ga0157373_100054595 355
538 3300013104 Ga0157370_10080709 Ga0157370_100807093 355
539 3300013105 Ga0157369_10102853 Ga0157369_101028533 355
540 3300025919 Ga0207657_10130568 Ga0207657_101305682 355
541 3300025920 Ga0207649_10023587 Ga0207649_100235874 355
542 3300025945 Ga0207679_10124311 Ga0207679_101243112 355
543 3300026041 Ga0207639_10034690 Ga0207639_100346904 355
544 3300026067 Ga0207678_10037074 Ga0207678_100370743 355
545 3300026078 Ga0207702_10005325 Ga0207702_1000532513 355
546 3300026116 Ga0207674_10018397 Ga0207674_100183973 355
547 3300027876 Ga0209974_10015118 Ga0209974_100151183 355
548 3300042120 Ga0450917_000583 Ga0450917_000583_159_1397 355
549 3300042144 Ga0450889_000097 Ga0450889_000097_5066_6304 355
550 3300042157 Ga0439458_0000019 Ga0439458_0000019_16884_18134 355
551 3300044694 Ga0466963_0082832 Ga0466963_0082832_50_1273 355
552 3300046537 Ga0495598_0000413 Ga0495598_0000413_1348_2604 355
553 3300046684 Ga0495669_0005956 Ga0495669_0005956_1726_2982 355
554 3300046691 Ga0495670_0000957 Ga0495670_0000957_3365_4621 355
555 3300048915 Ga0496112_0097414 Ga0496112_0097414_496_1791 355
556 3300049663 Ga0501223_000112 Ga0501223_000112_18450_19655 355
557 3300049664 Ga0501224_000020 Ga0501224_000020_69357_70562 355
558 3300049668 Ga0501233_000277 Ga0501233_000277_5129_6334 355
559 3300049669 Ga0501235_008727 Ga0501235_008727_300_1505 355
560 3300049705 Ga0501225_0000135 Ga0501225_0000135_18612_19817 355
561 3300049853 Ga0501226_000044 Ga0501226_000044_3782_4987 355
562 3300050511 nmdc:mga08y16_242803_c1 nmdc:mga08y16_242803_c1_436_1674 355
563 3300013306 Ga0163162_10192679 Ga0163162_101926791 356
564 3300025899 Ga0207642_10055655 Ga0207642_100556551 356
565 3300025937 Ga0207669_10050364 Ga0207669_100503642 356
566 3300025940 Ga0207691_10022747 Ga0207691_100227474 356
567 3300031852 Ga0307410_10001834 Ga0307410_100018347 356
568 3300031852 Ga0307410_10020142 Ga0307410_100201422 356
569 3300031852 Ga0307410_10140902 Ga0307410_101409022 356
570 3300031903 Ga0307407_10005158 Ga0307407_100051584 356
571 3300031911 Ga0307412_10025294 Ga0307412_100252943 356
572 3300031995 Ga0307409_100063306 Ga0307409_1000633062 356
573 3300032005 Ga0307411_10002272 Ga0307411_100022727 356
574 3300032005 Ga0307411_10123251 Ga0307411_101232512 356
575 3300037418 Ga0395900_0138348 Ga0395900_0138348_12_1241 356
576 3300037466 Ga0395898_0027113 Ga0395898_0027113_4497_5723 356
577 3300037471 Ga0395905_0269578 Ga0395905_0269578_31_1257 356
578 3300048917 Ga0496114_0000006 Ga0496114_0000006_283704_284972 356
579 3300005339 Ga0070660_100171710 Ga0070660_1001717101 357
580 3300005355 Ga0070671_100011686 Ga0070671_1000116864 357
581 3300005436 Ga0070713_100170411 Ga0070713_1001704111 357
582 3300005530 Ga0070679_100115823 Ga0070679_1001158232 357
583 3300005577 Ga0068857_100085587 Ga0068857_1000855872 357
584 3300009177 Ga0105248_10152983 Ga0105248_101529832 357
585 3300013104 Ga0157370_10087520 Ga0157370_100875202 357
586 3300025909 Ga0207705_10009543 Ga0207705_100095432 357
587 3300025921 Ga0207652_10074823 Ga0207652_100748232 357
588 3300025941 Ga0207711_10065132 Ga0207711_100651322 357
589 3300026067 Ga0207678_10176734 Ga0207678_101767342 357
590 3300031731 Ga0307405_10009826 Ga0307405_100098264 357
591 3300031852 Ga0307410_10012930 Ga0307410_100129304 357
592 3300031911 Ga0307412_10204240 Ga0307412_102042401 357
593 3300032005 Ga0307411_10033114 Ga0307411_100331144 357
594 3300032126 Ga0307415_100009085 Ga0307415_1000090855 357
595 3300037418 Ga0395900_0267393 Ga0395900_0267393_396_1529 357
596 3300048915 Ga0496112_0046485 Ga0496112_0046485_1592_2815 357
597 3300048915 Ga0496112_0077817 Ga0496112_0077817_147_1370 357
598 3300048916 Ga0496113_0022104 Ga0496113_0022104_1646_2869 357
599 3300002067 JGI24735J21928_10011665 JGI24735J21928_100116652 358
600 3300005327 Ga0070658_10039650 Ga0070658_100396504 358
601 3300005327 Ga0070658_10160552 Ga0070658_101605521 358
602 3300005366 Ga0070659_100089286 Ga0070659_1000892862 358
603 3300005435 Ga0070714_100395282 Ga0070714_1003952821 358
604 3300005455 Ga0070663_100061637 Ga0070663_1000616372 358
605 3300005535 Ga0070684_100046309 Ga0070684_1000463093 358
606 3300005614 Ga0068856_100075471 Ga0068856_1000754711 358
607 3300005616 Ga0068852_100001950 Ga0068852_10000195014 358
608 3300013102 Ga0157371_10014064 Ga0157371_100140644 358
609 3300013307 Ga0157372_10445933 Ga0157372_104459331 358
610 3300025904 Ga0207647_10022454 Ga0207647_100224543 358
611 3300025909 Ga0207705_10009500 Ga0207705_100095007 358
612 3300025909 Ga0207705_10051733 Ga0207705_100517332 358
613 3300025909 Ga0207705_10087607 Ga0207705_100876072 358
614 3300025921 Ga0207652_10150646 Ga0207652_101506463 358
615 3300025933 Ga0207706_10057998 Ga0207706_100579982 358
616 3300025949 Ga0207667_10077060 Ga0207667_100770602 358
617 3300026067 Ga0207678_10115894 Ga0207678_101158942 358
618 3300026116 Ga0207674_10032672 Ga0207674_100326723 358
619 3300026142 Ga0207698_10001918 Ga0207698_100019183 358
620 3300031548 Ga0307408_100034653 Ga0307408_1000346532 358
621 3300031824 Ga0307413_10075994 Ga0307413_100759943 358
622 3300032002 Ga0307416_100090546 Ga0307416_1000905462 358
623 3300032004 Ga0307414_10008582 Ga0307414_100085825 358
624 3300032005 Ga0307411_10014851 Ga0307411_100148512 358
625 3300037418 Ga0395900_0022716 Ga0395900_0022716_12_1199 358
626 3300037418 Ga0395900_0122911 Ga0395900_0122911_312_1538 358
627 3300037471 Ga0395905_0056704 Ga0395905_0056704_313_1539 358
628 3300048912 Ga0496109_0250688 Ga0496109_0250688_382_1566 358
629 3300048914 Ga0496111_0096239 Ga0496111_0096239_254_1438 358
630 3300059426 Ga0590077_016813 Ga0590077_016813_140_1339 358
631 3300005435 Ga0070714_100032704 Ga0070714_1000327042 359
632 3300005436 Ga0070713_100006844 Ga0070713_1000068444 359
633 3300006028 Ga0070717_10009374 Ga0070717_100093742 359
634 3300006880 Ga0075429_100240242 Ga0075429_1002402422 359
635 3300025929 Ga0207664_10154405 Ga0207664_101544052 359
636 3300025981 Ga0207640_10193624 Ga0207640_101936241 359
637 3300045976 Ga0466967_0029079 Ga0466967_0029079_3352_4554 359
638 3300046507 Ga0495606_0123078 Ga0495606_0123078_115_1323 359
639 3300046692 Ga0495671_0012263 Ga0495671_0012263_705_1901 359
640 3300053118 Ga0500594_0003814 Ga0500594_0003814_1475_2671 359
641 3300005548 Ga0070665_100021002 Ga0070665_1000210024 360
642 3300005564 Ga0070664_100004827 Ga0070664_10000482710 360
643 3300005577 Ga0068857_100057645 Ga0068857_1000576452 360
644 3300021388 Ga0213875_10003385 Ga0213875_100033859 360
645 3300025926 Ga0207659_10042780 Ga0207659_100427802 360
646 3300025929 Ga0207664_10212956 Ga0207664_102129562 360
647 3300026116 Ga0207674_10016401 Ga0207674_100164015 360
648 3300031852 Ga0307410_10054992 Ga0307410_100549922 360
649 3300031995 Ga0307409_100043340 Ga0307409_1000433402 360
650 3300032005 Ga0307411_10026175 Ga0307411_100261753 360
651 3300032005 Ga0307411_10063503 Ga0307411_100635033 360
652 3300037853 Ga0436364_0354297 Ga0436364_0354297_6759_7952 360
653 3300005336 Ga0070680_100028352 Ga0070680_1000283524 361
654 3300005458 Ga0070681_10104290 Ga0070681_101042903 361
655 3300005617 Ga0068859_100129835 Ga0068859_1001298353 361
656 3300005841 Ga0068863_100006708 Ga0068863_10000670811 361
657 3300005843 Ga0068860_100007356 Ga0068860_1000073569 361
658 3300005844 Ga0068862_100000085 Ga0068862_10000008581 361
659 3300009551 Ga0105238_10055862 Ga0105238_100558622 361
660 3300009553 Ga0105249_10000038 Ga0105249_10000038157 361
661 3300013102 Ga0157371_10143968 Ga0157371_101439681 361
662 3300013104 Ga0157370_10140919 Ga0157370_101409192 361
663 3300014326 Ga0157380_10013211 Ga0157380_100132113 361
664 3300014326 Ga0157380_10119667 Ga0157380_101196671 361
665 3300025904 Ga0207647_10000744 Ga0207647_1000074416 361
666 3300025917 Ga0207660_10001996 Ga0207660_1000199610 361
667 3300025933 Ga0207706_10032125 Ga0207706_100321255 361
668 3300025961 Ga0207712_10000002 Ga0207712_10000002157 361
669 3300026088 Ga0207641_10007265 Ga0207641_100072654 361
670 3300026142 Ga0207698_10003313 Ga0207698_100033133 361
671 3300028380 Ga0268265_10000104 Ga0268265_1000010467 361
672 3300028381 Ga0268264_10005614 Ga0268264_100056149 361
673 3300031824 Ga0307413_10016372 Ga0307413_100163723 361
674 3300031824 Ga0307413_10133980 Ga0307413_101339801 361
675 3300031852 Ga0307410_10053978 Ga0307410_100539782 361
676 3300031852 Ga0307410_10067089 Ga0307410_100670892 361
677 3300031911 Ga0307412_10172719 Ga0307412_101727191 361
678 3300031995 Ga0307409_100233647 Ga0307409_1002336472 361
679 3300032002 Ga0307416_100234345 Ga0307416_1002343452 361
680 3300037471 Ga0395905_0043788 Ga0395905_0043788_366_1589 361
681 3300049679 Ga0501249_000180 Ga0501249_000180_8147_9349 361
682 3300002067 JGI24735J21928_10010719 JGI24735J21928_100107191 362
683 3300005338 Ga0068868_100046864 Ga0068868_1000468643 362
684 3300005617 Ga0068859_100027722 Ga0068859_1000277227 362
685 3300005618 Ga0068864_100089377 Ga0068864_1000893772 362
686 3300005842 Ga0068858_100013651 Ga0068858_1000136513 362
687 3300006852 Ga0075433_10052827 Ga0075433_100528273 362
688 3300006931 Ga0097620_100027720 Ga0097620_1000277207 362
689 3300009093 Ga0105240_10195299 Ga0105240_101952992 362
690 3300009101 Ga0105247_10086353 Ga0105247_100863532 362
691 3300009545 Ga0105237_10027818 Ga0105237_100278184 362
692 3300009551 Ga0105238_10047795 Ga0105238_100477952 362
693 3300011119 Ga0105246_10048996 Ga0105246_100489962 362
694 3300013100 Ga0157373_10009971 Ga0157373_100099712 362
695 3300013102 Ga0157371_10049670 Ga0157371_100496703 362
696 3300013104 Ga0157370_10095079 Ga0157370_100950792 362
697 3300013307 Ga0157372_10025167 Ga0157372_100251674 362
698 3300013308 Ga0157375_10067854 Ga0157375_100678542 362
699 3300014745 Ga0157377_10004909 Ga0157377_100049095 362
700 3300025904 Ga0207647_10022826 Ga0207647_100228264 362
701 3300025913 Ga0207695_10125657 Ga0207695_101256572 362
702 3300025914 Ga0207671_10121996 Ga0207671_101219962 362
703 3300025924 Ga0207694_10002110 Ga0207694_100021104 362
704 3300025927 Ga0207687_10120019 Ga0207687_101200192 362
705 3300025942 Ga0207689_10008088 Ga0207689_1000808810 362
706 3300026035 Ga0207703_10004656 Ga0207703_100046564 362
707 3300026041 Ga0207639_10000355 Ga0207639_1000035530 362
708 3300026041 Ga0207639_10351591 Ga0207639_103515911 362
709 3300026095 Ga0207676_10136889 Ga0207676_101368892 362
710 3300028380 Ga0268265_10051956 Ga0268265_100519563 362
711 3300028381 Ga0268264_10121292 Ga0268264_101212921 362
712 3300031911 Ga0307412_10132680 Ga0307412_101326801 362
713 3300032004 Ga0307414_10003676 Ga0307414_100036763 362
714 3300032004 Ga0307414_10043203 Ga0307414_100432033 362
715 3300032126 Ga0307415_100004303 Ga0307415_1000043032 362
716 3300037418 Ga0395900_0006649 Ga0395900_0006649_5714_6955 362
717 3300037466 Ga0395898_0060116 Ga0395898_0060116_67_1308 362
718 3300037471 Ga0395905_0001508 Ga0395905_0001508_6150_7391 362
719 3300050515 nmdc:mga0a205_38416_c1 nmdc:mga0a205_38416_c1_1486_2721 362
720 3300001990 JGI24737J22298_10002336 JGI24737J22298_100023362 363
721 3300001990 JGI24737J22298_10019500 JGI24737J22298_100195001 363
722 3300005339 Ga0070660_100015485 Ga0070660_1000154854 363
723 3300005345 Ga0070692_10038875 Ga0070692_100388753 363
724 3300005539 Ga0068853_100085866 Ga0068853_1000858661 363
725 3300005543 Ga0070672_100004713 Ga0070672_1000047138 363
726 3300005563 Ga0068855_100015155 Ga0068855_1000151553 363
727 3300005577 Ga0068857_100108712 Ga0068857_1001087121 363
728 3300005614 Ga0068856_100053048 Ga0068856_1000530483 363
729 3300005616 Ga0068852_100000873 Ga0068852_1000008733 363
730 3300005843 Ga0068860_100101412 Ga0068860_1001014122 363
731 3300009093 Ga0105240_10210415 Ga0105240_102104152 363
732 3300009147 Ga0114129_10405919 Ga0114129_104059192 363
733 3300009148 Ga0105243_10091825 Ga0105243_100918252 363
734 3300009553 Ga0105249_10004370 Ga0105249_1000437012 363
735 3300025914 Ga0207671_10090708 Ga0207671_100907082 363
736 3300025919 Ga0207657_10003247 Ga0207657_100032476 363
737 3300025920 Ga0207649_10072866 Ga0207649_100728662 363
738 3300025920 Ga0207649_10089651 Ga0207649_100896512 363
739 3300025932 Ga0207690_10003285 Ga0207690_1000328510 363
740 3300025933 Ga0207706_10051673 Ga0207706_100516732 363
741 3300025949 Ga0207667_10006779 Ga0207667_100067793 363
742 3300025961 Ga0207712_10000629 Ga0207712_1000062914 363
743 3300026067 Ga0207678_10008822 Ga0207678_100088229 363
744 3300026142 Ga0207698_10000697 Ga0207698_1000069713 363
745 3300031548 Ga0307408_100018130 Ga0307408_1000181303 363
746 3300031731 Ga0307405_10002608 Ga0307405_100026086 363
747 3300031852 Ga0307410_10000790 Ga0307410_100007908 363
748 3300031901 Ga0307406_10024024 Ga0307406_100240242 363
749 3300031911 Ga0307412_10005147 Ga0307412_100051475 363
750 3300031995 Ga0307409_100052301 Ga0307409_1000523014 363
751 3300032126 Ga0307415_100013463 Ga0307415_1000134635 363
752 3300031852 Ga0307410_10065844 Ga0307410_100658442 364
753 3300046460 Ga0495638_0121242 Ga0495638_0121242_357_1532 364
754 3300005336 Ga0070680_100075002 Ga0070680_1000750021 365
755 3300005347 Ga0070668_100000014 Ga0070668_10000001452 365
756 3300005347 Ga0070668_100143435 Ga0070668_1001434351 365
757 3300005458 Ga0070681_10092039 Ga0070681_100920393 365
758 3300005563 Ga0068855_100000962 Ga0068855_1000009624 365
759 3300005614 Ga0068856_100175132 Ga0068856_1001751323 365
760 3300009093 Ga0105240_10050298 Ga0105240_100502985 365
761 3300009174 Ga0105241_10039269 Ga0105241_100392693 365
762 3300010375 Ga0105239_10047199 Ga0105239_100471994 365
763 3300025913 Ga0207695_10038671 Ga0207695_100386715 365
764 3300025949 Ga0207667_10004952 Ga0207667_1000495215 365
765 3300025972 Ga0207668_10000047 Ga0207668_1000004767 365
766 3300026142 Ga0207698_10109326 Ga0207698_101093261 365
767 3300033180 Ga0307510_10029403 Ga0307510_100294035 365
768 3300046471 Ga0495650_0005420 Ga0495650_0005420_1911_3119 365
769 3300005327 Ga0070658_10001533 Ga0070658_100015335 366
770 3300005339 Ga0070660_100013189 Ga0070660_1000131894 366
771 3300013102 Ga0157371_10050162 Ga0157371_100501622 366
772 3300025909 Ga0207705_10000577 Ga0207705_1000057713 366
773 3300025919 Ga0207657_10000088 Ga0207657_1000008877 366
774 3300037312 Ga0395899_0000230 Ga0395899_0000230_23232_24431 366
775 3300037418 Ga0395900_0000124 Ga0395900_0000124_74277_75476 366
776 3300037466 Ga0395898_0015368 Ga0395898_0015368_3335_4534 366
777 3300037466 Ga0395898_0332317 Ga0395898_0332317_113_1303 366
778 3300037471 Ga0395905_0017391 Ga0395905_0017391_1026_2225 366
779 3300038443 Ga0395901_0000031 Ga0395901_0000031_74720_75919 366
780 3300042007 Ga0439449_0017165 Ga0439449_0017165_1387_2574 366
781 3300046537 Ga0495598_0001576 Ga0495598_0001576_730_1890 366
782 3300046557 Ga0495622_0005815 Ga0495622_0005815_738_1958 366
783 3300005347 Ga0070668_100017913 Ga0070668_1000179132 367
784 3300005459 Ga0068867_100008265 Ga0068867_1000082654 367
785 3300005539 Ga0068853_100064708 Ga0068853_1000647082 367
786 3300005543 Ga0070672_100071158 Ga0070672_1000711582 367
787 3300005616 Ga0068852_100006637 Ga0068852_1000066374 367
788 3300005844 Ga0068862_100005678 Ga0068862_10000567812 367
789 3300009551 Ga0105238_10065393 Ga0105238_100653933 367
790 3300025321 Ga0207656_10000908 Ga0207656_100009085 367
791 3300025924 Ga0207694_10080747 Ga0207694_100807472 367
792 3300025981 Ga0207640_10121353 Ga0207640_101213532 367
793 3300026089 Ga0207648_10010858 Ga0207648_100108586 367
794 3300028380 Ga0268265_10001838 Ga0268265_100018388 367
795 3300031852 Ga0307410_10111135 Ga0307410_101111351 367
796 3300031901 Ga0307406_10075994 Ga0307406_100759942 367
797 3300031995 Ga0307409_100063659 Ga0307409_1000636593 367
798 3300042439 Ga0439464_0001743 Ga0439464_0001743_2420_3640 367
799 3300048912 Ga0496109_0066501 Ga0496109_0066501_1373_2596 367
800 3300005327 Ga0070658_10011486 Ga0070658_100114865 368
801 3300005327 Ga0070658_10058532 Ga0070658_100585322 368
802 3300005327 Ga0070658_10073360 Ga0070658_100733602 368
803 3300005329 Ga0070683_100019472 Ga0070683_1000194721 368
804 3300005331 Ga0070670_100021406 Ga0070670_1000214061 368
805 3300005344 Ga0070661_100004354 Ga0070661_1000043544 368
806 3300005345 Ga0070692_10020867 Ga0070692_100208673 368
807 3300005347 Ga0070668_100004094 Ga0070668_1000040942 368
808 3300005355 Ga0070671_100022393 Ga0070671_1000223934 368
809 3300005355 Ga0070671_100034749 Ga0070671_1000347492 368
810 3300005355 Ga0070671_100048750 Ga0070671_1000487501 368
811 3300005356 Ga0070674_100005730 Ga0070674_1000057301 368
812 3300005364 Ga0070673_100007510 Ga0070673_1000075104 368
813 3300005364 Ga0070673_100060329 Ga0070673_1000603293 368
814 3300005366 Ga0070659_100032502 Ga0070659_1000325021 368
815 3300005367 Ga0070667_100052123 Ga0070667_1000521233 368
816 3300005455 Ga0070663_100016124 Ga0070663_1000161243 368
817 3300005535 Ga0070684_100023512 Ga0070684_1000235125 368
818 3300005539 Ga0068853_100003482 Ga0068853_1000034827 368
819 3300005564 Ga0070664_100009847 Ga0070664_1000098475 368
820 3300005564 Ga0070664_100016182 Ga0070664_1000161824 368
821 3300005564 Ga0070664_100103703 Ga0070664_1001037032 368
822 3300005577 Ga0068857_100063078 Ga0068857_1000630782 368
823 3300005578 Ga0068854_100033398 Ga0068854_1000333982 368
824 3300005578 Ga0068854_100059901 Ga0068854_1000599011 368
825 3300005614 Ga0068856_100136283 Ga0068856_1001362832 368
826 3300005616 Ga0068852_100004387 Ga0068852_1000043874 368
827 3300005617 Ga0068859_100036265 Ga0068859_1000362652 368
828 3300005617 Ga0068859_100039692 Ga0068859_1000396926 368
829 3300005618 Ga0068864_100000557 Ga0068864_10000055723 368
830 3300005618 Ga0068864_100071293 Ga0068864_1000712933 368
831 3300005834 Ga0068851_10000728 Ga0068851_100007288 368
832 3300005841 Ga0068863_100000569 Ga0068863_10000056924 368
833 3300005841 Ga0068863_100017467 Ga0068863_1000174673 368
834 3300005842 Ga0068858_100000604 Ga0068858_10000060425 368
835 3300005842 Ga0068858_100039030 Ga0068858_1000390302 368
836 3300005843 Ga0068860_100003135 Ga0068860_1000031358 368
837 3300005844 Ga0068862_100009905 Ga0068862_1000099052 368
838 3300006042 Ga0075368_10013040 Ga0075368_100130402 368
839 3300006051 Ga0075364_10029836 Ga0075364_100298363 368
840 3300006175 Ga0070712_100024403 Ga0070712_1000244034 368
841 3300006178 Ga0075367_10000693 Ga0075367_100006934 368
842 3300006237 Ga0097621_100049829 Ga0097621_1000498292 368
843 3300006237 Ga0097621_100067298 Ga0097621_1000672982 368
844 3300006353 Ga0075370_10031464 Ga0075370_100314642 368
845 3300006358 Ga0068871_100013480 Ga0068871_1000134804 368
846 3300006931 Ga0097620_100036261 Ga0097620_1000362612 368
847 3300006931 Ga0097620_100039695 Ga0097620_1000396951 368
848 3300009094 Ga0111539_10256101 Ga0111539_102561012 368
849 3300009101 Ga0105247_10011390 Ga0105247_100113903 368
850 3300009177 Ga0105248_10000070 Ga0105248_1000007027 368
851 3300009177 Ga0105248_10019923 Ga0105248_1001992311 368
852 3300009177 Ga0105248_10026591 Ga0105248_100265913 368
853 3300009177 Ga0105248_10333120 Ga0105248_103331201 368
854 3300009551 Ga0105238_10112342 Ga0105238_101123422 368
855 3300013100 Ga0157373_10027912 Ga0157373_100279124 368
856 3300013102 Ga0157371_10102172 Ga0157371_101021722 368
857 3300013296 Ga0157374_10027077 Ga0157374_100270774 368
858 3300013296 Ga0157374_10066164 Ga0157374_100661642 368
859 3300013296 Ga0157374_10208434 Ga0157374_102084342 368
860 3300013306 Ga0163162_10073877 Ga0163162_100738772 368
861 3300013306 Ga0163162_10122828 Ga0163162_101228283 368
862 3300013308 Ga0157375_10156917 Ga0157375_101569172 368
863 3300013308 Ga0157375_10171251 Ga0157375_101712512 368
864 3300014325 Ga0163163_10022419 Ga0163163_100224194 368
865 3300014968 Ga0157379_10014941 Ga0157379_100149412 368
866 3300025321 Ga0207656_10018122 Ga0207656_100181222 368
867 3300025321 Ga0207656_10032163 Ga0207656_100321632 368
868 3300025901 Ga0207688_10018057 Ga0207688_100180573 368
869 3300025907 Ga0207645_10004643 Ga0207645_100046437 368
870 3300025909 Ga0207705_10003299 Ga0207705_100032997 368
871 3300025909 Ga0207705_10016173 Ga0207705_100161732 368
872 3300025909 Ga0207705_10080356 Ga0207705_100803562 368
873 3300025915 Ga0207693_10016769 Ga0207693_100167692 368
874 3300025919 Ga0207657_10057146 Ga0207657_100571463 368
875 3300025919 Ga0207657_10137229 Ga0207657_101372292 368
876 3300025920 Ga0207649_10002615 Ga0207649_100026158 368
877 3300025920 Ga0207649_10041003 Ga0207649_100410032 368
878 3300025931 Ga0207644_10020682 Ga0207644_100206823 368
879 3300025931 Ga0207644_10023947 Ga0207644_100239472 368
880 3300025932 Ga0207690_10010152 Ga0207690_100101525 368
881 3300025932 Ga0207690_10061894 Ga0207690_100618942 368
882 3300025941 Ga0207711_10000051 Ga0207711_10000051128 368
883 3300025941 Ga0207711_10028578 Ga0207711_100285785 368
884 3300025942 Ga0207689_10058721 Ga0207689_100587212 368
885 3300025942 Ga0207689_10071424 Ga0207689_100714242 368
886 3300025945 Ga0207679_10012241 Ga0207679_100122412 368
887 3300025949 Ga0207667_10102280 Ga0207667_101022803 368
888 3300025949 Ga0207667_10157632 Ga0207667_101576321 368
889 3300025960 Ga0207651_10036558 Ga0207651_100365583 368
890 3300025972 Ga0207668_10000417 Ga0207668_1000041720 368
891 3300025986 Ga0207658_10064785 Ga0207658_100647852 368
892 3300026035 Ga0207703_10052867 Ga0207703_100528672 368
893 3300026035 Ga0207703_10082276 Ga0207703_100822761 368
894 3300026067 Ga0207678_10002532 Ga0207678_100025327 368
895 3300026078 Ga0207702_10023692 Ga0207702_100236922 368
896 3300026088 Ga0207641_10002146 Ga0207641_1000214622 368
897 3300026089 Ga0207648_10004072 Ga0207648_1000407216 368
898 3300026095 Ga0207676_10000139 Ga0207676_1000013932 368
899 3300026116 Ga0207674_10003894 Ga0207674_100038948 368
900 3300026118 Ga0207675_100120074 Ga0207675_1001200742 368
901 3300026142 Ga0207698_10066932 Ga0207698_100669322 368
902 3300026142 Ga0207698_10101769 Ga0207698_101017692 368
903 3300026142 Ga0207698_10142196 Ga0207698_101421962 368
904 3300027866 Ga0209813_10000039 Ga0209813_1000003947 368
905 3300028379 Ga0268266_10118391 Ga0268266_101183912 368
906 3300028380 Ga0268265_10001294 Ga0268265_100012947 368
907 3300028380 Ga0268265_10290448 Ga0268265_102904481 368
908 3300028381 Ga0268264_10002102 Ga0268264_100021029 368
909 3300028381 Ga0268264_10005158 Ga0268264_100051581 368
910 3300032002 Ga0307416_100015779 Ga0307416_1000157795 368
911 3300037312 Ga0395899_0046816 Ga0395899_0046816_1102_2325 368
912 3300037418 Ga0395900_0014526 Ga0395900_0014526_5048_6271 368
913 3300037418 Ga0395900_0124118 Ga0395900_0124118_776_2035 368
914 3300037418 Ga0395900_0320034 Ga0395900_0320034_247_1470 368
915 3300037418 Ga0395900_0350382 Ga0395900_0350382_181_1404 368
916 3300037471 Ga0395905_0160586 Ga0395905_0160586_185_1408 368
917 3300037471 Ga0395905_0195906 Ga0395905_0195906_681_1883 368
918 3300038443 Ga0395901_0000988 Ga0395901_0000988_23608_24831 368
919 3300038443 Ga0395901_0025333 Ga0395901_0025333_812_2071 368
920 3300044684 Ga0466966_0028488 Ga0466966_0028488_1068_2315 368
921 3300044693 Ga0466961_0022590 Ga0466961_0022590_712_1959 368
922 3300044842 Ga0466957_0016117 Ga0466957_0016117_453_1676 368
923 3300045049 Ga0466959_0114947 Ga0466959_0114947_317_1564 368
924 3300045976 Ga0466967_0111697 Ga0466967_0111697_1040_2266 368
925 3300045976 Ga0466967_0228125 Ga0466967_0228125_418_1644 368
926 3300046453 Ga0495627_001223 Ga0495627_001223_10512_11720 368
927 3300046512 Ga0495610_0002686 Ga0495610_0002686_81_1289 368
928 3300046616 Ga0495668_0007943 Ga0495668_0007943_1366_2586 368
929 3300047470 Ga0495681_0000055 Ga0495681_0000055_19635_20843 368
930 3300047472 Ga0495686_0013566 Ga0495686_0013566_3669_4877 368
931 3300048903 Ga0496100_0033766 Ga0496100_0033766_1524_2747 368
932 3300048903 Ga0496100_0133510 Ga0496100_0133510_197_1420 368
933 3300048905 Ga0496102_0053918 Ga0496102_0053918_1688_2965 368
934 3300048906 Ga0496103_0065262 Ga0496103_0065262_456_1733 368
935 3300048908 Ga0496105_0079825 Ga0496105_0079825_409_1686 368
936 3300048910 Ga0496107_0033682 Ga0496107_0033682_78_1355 368
937 3300048911 Ga0496108_0000700 Ga0496108_0000700_21214_22452 368
938 3300048912 Ga0496109_0033476 Ga0496109_0033476_2253_3476 368
939 3300048914 Ga0496111_0004034 Ga0496111_0004034_5073_6350 368
940 3300048915 Ga0496112_0070953 Ga0496112_0070953_1528_2805 368
941 3300048916 Ga0496113_0033981 Ga0496113_0033981_941_2218 368
942 3300048918 Ga0496115_0002676 Ga0496115_0002676_8717_9940 368
943 3300050489 nmdc:mga03683_4781_c2 nmdc:mga03683_4781_c2_1113_2342 368
944 3300050491 nmdc:mga00v17_6035_c1 nmdc:mga00v17_6035_c1_1642_2871 368
945 3300050494 nmdc:mga06z11_260_c1 nmdc:mga06z11_260_c1_15673_16884 368
946 3300050495 nmdc:mga04h51_1059_c1 nmdc:mga04h51_1059_c1_3725_4936 368
947 3300050496 nmdc:mga07m45_9469_c1 nmdc:mga07m45_9469_c1_2519_3730 368
948 3300050511 nmdc:mga08y16_235020_c1 nmdc:mga08y16_235020_c1_399_1628 368
949 3300053134 Ga0500658_0000107 Ga0500658_0000107_1689_2909 368
950 3300005564 Ga0070664_100009475 Ga0070664_1000094753 369
951 3300005577 Ga0068857_100017571 Ga0068857_1000175716 369
952 3300005578 Ga0068854_100004852 Ga0068854_10000485211 369
953 3300005614 Ga0068856_100122582 Ga0068856_1001225822 369
954 3300005617 Ga0068859_100021498 Ga0068859_1000214983 369
955 3300005617 Ga0068859_100027869 Ga0068859_1000278692 369
956 3300005618 Ga0068864_100037785 Ga0068864_1000377853 369
957 3300005841 Ga0068863_100015195 Ga0068863_1000151959 369
958 3300005841 Ga0068863_100095941 Ga0068863_1000959412 369
959 3300005842 Ga0068858_100024570 Ga0068858_1000245702 369
960 3300005843 Ga0068860_100021242 Ga0068860_1000212423 369
961 3300005844 Ga0068862_100009029 Ga0068862_10000902910 369
962 3300006931 Ga0097620_100027868 Ga0097620_1000278682 369
963 3300009553 Ga0105249_10029045 Ga0105249_100290455 369
964 3300013105 Ga0157369_10194677 Ga0157369_101946772 369
965 3300014968 Ga0157379_10085012 Ga0157379_100850123 369
966 3300025907 Ga0207645_10013998 Ga0207645_100139984 369
967 3300025925 Ga0207650_10116166 Ga0207650_101161662 369
968 3300025933 Ga0207706_10134631 Ga0207706_101346312 369
969 3300025961 Ga0207712_10020582 Ga0207712_100205824 369
970 3300025981 Ga0207640_10261162 Ga0207640_102611621 369
971 3300026035 Ga0207703_10084769 Ga0207703_100847692 369
972 3300026067 Ga0207678_10009020 Ga0207678_100090203 369
973 3300026088 Ga0207641_10146054 Ga0207641_101460542 369
974 3300026095 Ga0207676_10007368 Ga0207676_1000736810 369
975 3300026116 Ga0207674_10004400 Ga0207674_1000440012 369
976 3300028380 Ga0268265_10050790 Ga0268265_100507902 369
977 3300028381 Ga0268264_10045581 Ga0268264_100455813 369
978 3300030736 Ga0316180_1129633 Ga0316180_11296332 369
979 3300030745 Ga0316182_1203927 Ga0316182_12039273 369
980 3300037312 Ga0395899_0078082 Ga0395899_0078082_184_1395 369
981 3300037418 Ga0395900_0035085 Ga0395900_0035085_3837_5048 369
982 3300037418 Ga0395900_0330854 Ga0395900_0330854_32_1258 369
983 3300037466 Ga0395898_0350627 Ga0395898_0350627_170_1396 369
984 3300038443 Ga0395901_0091943 Ga0395901_0091943_1471_2676 369
985 3300046684 Ga0495669_0049711 Ga0495669_0049711_432_1655 369
986 3300048914 Ga0496111_0100768 Ga0496111_0100768_186_1409 369
987 3300048915 Ga0496112_0126001 Ga0496112_0126001_76_1299 369
988 3300001915 JGI24741J21665_1002477 JGI24741J21665_10024772 370
989 3300001979 JGI24740J21852_10000514 JGI24740J21852_1000051410 370
990 3300001979 JGI24740J21852_10031021 JGI24740J21852_100310212 370
991 3300001989 JGI24739J22299_10003157 JGI24739J22299_100031573 370
992 3300001990 JGI24737J22298_10006220 JGI24737J22298_100062202 370
993 3300005327 Ga0070658_10014753 Ga0070658_100147535 370
994 3300005329 Ga0070683_100021549 Ga0070683_1000215493 370
995 3300005339 Ga0070660_100003370 Ga0070660_1000033709 370
996 3300005339 Ga0070660_100185696 Ga0070660_1001856962 370
997 3300005340 Ga0070689_100107485 Ga0070689_1001074852 370
998 3300005344 Ga0070661_100061142 Ga0070661_1000611422 370
999 3300005345 Ga0070692_10003924 Ga0070692_100039242 370
1000 3300005364 Ga0070673_100240837 Ga0070673_1002408372 370
1001 3300005366 Ga0070659_100002004 Ga0070659_10000200410 370
1002 3300005458 Ga0070681_10062006 Ga0070681_100620062 370
1003 3300005530 Ga0070679_100047584 Ga0070679_1000475843 370
1004 3300005539 Ga0068853_100038990 Ga0068853_1000389902 370
1005 3300005548 Ga0070665_100029703 Ga0070665_1000297032 370
1006 3300005563 Ga0068855_100262749 Ga0068855_1002627492 370
1007 3300005577 Ga0068857_100017400 Ga0068857_1000174004 370
1008 3300005578 Ga0068854_100065364 Ga0068854_1000653642 370
1009 3300005616 Ga0068852_100007117 Ga0068852_1000071173 370
1010 3300005616 Ga0068852_100090986 Ga0068852_1000909862 370
1011 3300005616 Ga0068852_100226779 Ga0068852_1002267792 370
1012 3300005617 Ga0068859_100163620 Ga0068859_1001636202 370
1013 3300005842 Ga0068858_100011411 Ga0068858_1000114114 370
1014 3300006931 Ga0097620_100163621 Ga0097620_1001636212 370
1015 3300006931 Ga0097620_100421011 Ga0097620_1004210111 370
1016 3300009093 Ga0105240_10030632 Ga0105240_100306321 370
1017 3300009174 Ga0105241_10041363 Ga0105241_100413632 370
1018 3300009177 Ga0105248_10007477 Ga0105248_100074774 370
1019 3300009551 Ga0105238_10025796 Ga0105238_100257962 370
1020 3300010375 Ga0105239_10094645 Ga0105239_100946452 370
1021 3300013102 Ga0157371_10052524 Ga0157371_100525242 370
1022 3300013105 Ga0157369_10003767 Ga0157369_100037678 370
1023 3300013105 Ga0157369_10094651 Ga0157369_100946512 370
1024 3300025229 Ga0209147_101153 Ga0209147_1011536 370
1025 3300025321 Ga0207656_10012002 Ga0207656_100120022 370
1026 3300025909 Ga0207705_10006631 Ga0207705_100066316 370
1027 3300025909 Ga0207705_10010443 Ga0207705_100104432 370
1028 3300025911 Ga0207654_10059079 Ga0207654_100590792 370
1029 3300025912 Ga0207707_10072032 Ga0207707_100720322 370
1030 3300025912 Ga0207707_10119734 Ga0207707_101197342 370
1031 3300025917 Ga0207660_10024076 Ga0207660_100240763 370
1032 3300025919 Ga0207657_10001070 Ga0207657_100010705 370
1033 3300025919 Ga0207657_10059002 Ga0207657_100590024 370
1034 3300025919 Ga0207657_10103227 Ga0207657_101032272 370
1035 3300025921 Ga0207652_10004032 Ga0207652_100040328 370
1036 3300025924 Ga0207694_10024834 Ga0207694_100248342 370
1037 3300025932 Ga0207690_10002468 Ga0207690_100024688 370
1038 3300025932 Ga0207690_10004823 Ga0207690_100048233 370
1039 3300025932 Ga0207690_10211005 Ga0207690_102110051 370
1040 3300025933 Ga0207706_10001051 Ga0207706_100010513 370
1041 3300025936 Ga0207670_10066174 Ga0207670_100661742 370
1042 3300025941 Ga0207711_10010332 Ga0207711_100103324 370
1043 3300025944 Ga0207661_10040919 Ga0207661_100409193 370
1044 3300025945 Ga0207679_10074125 Ga0207679_100741253 370
1045 3300025949 Ga0207667_10054220 Ga0207667_100542203 370
1046 3300025960 Ga0207651_10203315 Ga0207651_102033151 370
1047 3300025972 Ga0207668_10123263 Ga0207668_101232632 370
1048 3300026035 Ga0207703_10061129 Ga0207703_100611294 370
1049 3300026041 Ga0207639_10022588 Ga0207639_100225882 370
1050 3300026116 Ga0207674_10048587 Ga0207674_100485873 370
1051 3300026116 Ga0207674_10085815 Ga0207674_100858153 370
1052 3300026142 Ga0207698_10001719 Ga0207698_100017196 370
1053 3300026142 Ga0207698_10043497 Ga0207698_100434973 370
1054 3300028379 Ga0268266_10013492 Ga0268266_100134925 370
1055 3300037312 Ga0395899_0015192 Ga0395899_0015192_3535_4785 370
1056 3300037471 Ga0395905_0007754 Ga0395905_0007754_5523_6758 370
1057 3300037471 Ga0395905_0045669 Ga0395905_0045669_483_1733 370
1058 3300044694 Ga0466963_0004590 Ga0466963_0004590_460_1686 370
1059 3300045976 Ga0466967_0027764 Ga0466967_0027764_2355_3581 370
1060 3300045976 Ga0466967_0042918 Ga0466967_0042918_2097_3323 370
1061 3300045976 Ga0466967_0068930 Ga0466967_0068930_97_1347 370
1062 3300046453 Ga0495627_000494 Ga0495627_000494_14059_15285 370
1063 3300046506 Ga0495583_0063343 Ga0495583_0063343_97_1341 370
1064 3300046525 Ga0495663_0000481 Ga0495663_0000481_1435_2607 370
1065 3300046616 Ga0495668_0010672 Ga0495668_0010672_1578_2822 370
1066 3300046684 Ga0495669_0000387 Ga0495669_0000387_14848_16092 370
1067 3300046684 Ga0495669_0008086 Ga0495669_0008086_2054_3226 370
1068 3300053111 Ga0500572_035575 Ga0500572_035575_94_1320 370
1069 3300005335 Ga0070666_10063546 Ga0070666_100635462 371
1070 3300005367 Ga0070667_100183051 Ga0070667_1001830511 371
1071 3300009177 Ga0105248_10032272 Ga0105248_100322723 371
1072 3300013306 Ga0163162_10065914 Ga0163162_100659143 371
1073 3300013308 Ga0157375_10154411 Ga0157375_101544113 371
1074 3300025941 Ga0207711_10009982 Ga0207711_100099823 371
1075 3300025960 Ga0207651_10022534 Ga0207651_100225342 371
1076 3300026035 Ga0207703_10011512 Ga0207703_100115123 371
1077 3300026121 Ga0207683_10044696 Ga0207683_100446964 371
1078 3300033180 Ga0307510_10008642 Ga0307510_100086424 371
1079 3300037471 Ga0395905_0006826 Ga0395905_0006826_9317_10576 371
1080 3300037471 Ga0395905_0014919 Ga0395905_0014919_527_1765 371
1081 3300038443 Ga0395901_0044961 Ga0395901_0044961_1618_2877 371
1082 3300044693 Ga0466961_0086425 Ga0466961_0086425_383_1624 371
1083 3300046506 Ga0495583_0020997 Ga0495583_0020997_538_1734 371
1084 3300046660 Ga0495625_0003185 Ga0495625_0003185_8481_9677 371
1085 3300047445 Ga0495677_0003222 Ga0495677_0003222_4092_5288 371
1086 3300053087 Ga0500643_000620 Ga0500643_000620_20323_21519 371
1087 3300032004 Ga0307414_10145332 Ga0307414_101453322 372
1088 3300046522 Ga0495643_0025828 Ga0495643_0025828_2018_3187 372
1089 3300046538 Ga0495609_0043798 Ga0495609_0043798_149_1318 372
1090 3300053091 Ga0500647_0026423 Ga0500647_0026423_1068_2237 372
1091 3300001979 JGI24740J21852_10003133 JGI24740J21852_100031332 373
1092 3300005354 Ga0070675_100164575 Ga0070675_1001645752 373
1093 3300005366 Ga0070659_100118913 Ga0070659_1001189132 373
1094 3300005457 Ga0070662_100092811 Ga0070662_1000928112 373
1095 3300005530 Ga0070679_100439875 Ga0070679_1004398751 373
1096 3300025933 Ga0207706_10029671 Ga0207706_100296714 373
1097 3300031995 Ga0307409_100103333 Ga0307409_1001033332 373
1098 iso_pu_bacteria 2885427238 2885428897 373
1099 3300001990 JGI24737J22298_10003363 JGI24737J22298_100033633 374
1100 3300001990 JGI24737J22298_10013612 JGI24737J22298_100136122 374
1101 3300005339 Ga0070660_100093212 Ga0070660_1000932122 374
1102 3300005347 Ga0070668_100004856 Ga0070668_1000048563 374
1103 3300005353 Ga0070669_100011679 Ga0070669_1000116792 374
1104 3300005355 Ga0070671_100013661 Ga0070671_1000136613 374
1105 3300005366 Ga0070659_100003653 Ga0070659_1000036535 374
1106 3300005457 Ga0070662_100010024 Ga0070662_1000100244 374
1107 3300005577 Ga0068857_100018151 Ga0068857_1000181514 374
1108 3300005844 Ga0068862_100023574 Ga0068862_1000235744 374
1109 3300006871 Ga0075434_100024751 Ga0075434_1000247517 374
1110 3300009094 Ga0111539_10532255 Ga0111539_105322551 374
1111 3300009177 Ga0105248_10021968 Ga0105248_100219684 374
1112 3300011119 Ga0105246_10009720 Ga0105246_100097202 374
1113 3300013102 Ga0157371_10027607 Ga0157371_100276073 374
1114 3300013105 Ga0157369_10053506 Ga0157369_100535063 374
1115 3300013307 Ga0157372_10064461 Ga0157372_100644613 374
1116 3300014325 Ga0163163_10039047 Ga0163163_100390471 374
1117 3300014325 Ga0163163_10072705 Ga0163163_100727053 374
1118 3300025904 Ga0207647_10018506 Ga0207647_100185064 374
1119 3300025904 Ga0207647_10039478 Ga0207647_100394784 374
1120 3300025919 Ga0207657_10092482 Ga0207657_100924822 374
1121 3300025925 Ga0207650_10020528 Ga0207650_100205282 374
1122 3300025931 Ga0207644_10076022 Ga0207644_100760222 374
1123 3300025932 Ga0207690_10012987 Ga0207690_100129873 374
1124 3300025933 Ga0207706_10015864 Ga0207706_100158646 374
1125 3300025972 Ga0207668_10000956 Ga0207668_1000095614 374
1126 3300026088 Ga0207641_10022117 Ga0207641_100221173 374
1127 3300026116 Ga0207674_10001496 Ga0207674_1000149616 374
1128 3300028380 Ga0268265_10010726 Ga0268265_100107264 374
1129 3300037312 Ga0395899_0128974 Ga0395899_0128974_275_1525 374
1130 3300037418 Ga0395900_0003841 Ga0395900_0003841_10056_11306 374
1131 3300037418 Ga0395900_0024755 Ga0395900_0024755_1955_3205 374
1132 3300037418 Ga0395900_0061203 Ga0395900_0061203_2164_3414 374
1133 3300037466 Ga0395898_0002947 Ga0395898_0002947_8858_10108 374
1134 3300037466 Ga0395898_0138676 Ga0395898_0138676_120_1370 374
1135 3300037471 Ga0395905_0003870 Ga0395905_0003870_13956_15206 374
1136 3300037471 Ga0395905_0005166 Ga0395905_0005166_7180_8430 374
1137 3300038443 Ga0395901_0002630 Ga0395901_0002630_15922_17172 374
1138 3300038443 Ga0395901_0024604 Ga0395901_0024604_2471_3721 374
1139 3300038443 Ga0395901_0031068 Ga0395901_0031068_4091_5341 374
1140 3300038443 Ga0395901_0031355 Ga0395901_0031355_3183_4433 374
1141 3300042157 Ga0439458_0000172 Ga0439458_0000172_3705_4955 374
1142 3300046684 Ga0495669_0013414 Ga0495669_0013414_1893_3077 374
1143 3300047472 Ga0495686_0000137 Ga0495686_0000137_144933_146141 374
1144 3300048920 Ga0496117_0004382 Ga0496117_0004382_12086_13288 374
1145 3300048921 Ga0496118_0001805 Ga0496118_0001805_19777_20979 374
1146 3300048924 Ga0496121_0222501 Ga0496121_0222501_35_1237 374
1147 3300048927 Ga0496124_0033845 Ga0496124_0033845_1094_2296 374
1148 3300053087 Ga0500643_001505 Ga0500643_001505_1310_2509 374
1149 3300053087 Ga0500643_022780 Ga0500643_022780_713_1912 374
1150 3300005548 Ga0070665_100000207 Ga0070665_10000020744 375
1151 3300013308 Ga0157375_10354575 Ga0157375_103545752 375
1152 3300028379 Ga0268266_10000171 Ga0268266_1000017160 375
1153 3300038705 Ga0237819_00375 Ga0237819_00375_8796_9992 375
1154 3300048919 Ga0496116_0018070 Ga0496116_0018070_565_1815 375
1155 3300048920 Ga0496117_0003612 Ga0496117_0003612_12281_13531 375
1156 3300048927 Ga0496124_0014884 Ga0496124_0014884_532_1782 375
1157 3300050512 nmdc:mga0n895_33781_c1 nmdc:mga0n895_33781_c1_1331_2539 375
1158 3300001904 JGI24736J21556_1000687 JGI24736J21556_10006874 376
1159 3300005295 Ga0065707_10088522 Ga0065707_100885224 376
1160 3300005327 Ga0070658_10001147 Ga0070658_1000114713 376
1161 3300005327 Ga0070658_10033989 Ga0070658_100339892 376
1162 3300005328 Ga0070676_10021355 Ga0070676_100213553 376
1163 3300005339 Ga0070660_100000094 Ga0070660_10000009452 376
1164 3300005339 Ga0070660_100009551 Ga0070660_1000095512 376
1165 3300005339 Ga0070660_100062519 Ga0070660_1000625193 376
1166 3300005344 Ga0070661_100042242 Ga0070661_1000422423 376
1167 3300005345 Ga0070692_10000531 Ga0070692_100005314 376
1168 3300005353 Ga0070669_100135345 Ga0070669_1001353451 376
1169 3300005353 Ga0070669_100217527 Ga0070669_1002175272 376
1170 3300005366 Ga0070659_100012653 Ga0070659_1000126535 376
1171 3300005455 Ga0070663_100002833 Ga0070663_1000028339 376
1172 3300005455 Ga0070663_100006852 Ga0070663_1000068525 376
1173 3300005457 Ga0070662_100000513 Ga0070662_1000005138 376
1174 3300005457 Ga0070662_100026834 Ga0070662_1000268344 376
1175 3300005458 Ga0070681_10124690 Ga0070681_101246902 376
1176 3300005459 Ga0068867_100105770 Ga0068867_1001057702 376
1177 3300005530 Ga0070679_100221974 Ga0070679_1002219741 376
1178 3300005530 Ga0070679_100257478 Ga0070679_1002574782 376
1179 3300005563 Ga0068855_100000433 Ga0068855_10000043351 376
1180 3300005563 Ga0068855_100129902 Ga0068855_1001299022 376
1181 3300005564 Ga0070664_100096157 Ga0070664_1000961571 376
1182 3300005578 Ga0068854_100000364 Ga0068854_10000036417 376
1183 3300005614 Ga0068856_100061887 Ga0068856_1000618873 376
1184 3300009093 Ga0105240_10041913 Ga0105240_100419136 376
1185 3300009174 Ga0105241_10054294 Ga0105241_100542942 376
1186 3300009545 Ga0105237_10329072 Ga0105237_103290722 376
1187 3300013100 Ga0157373_10010407 Ga0157373_100104074 376
1188 3300013100 Ga0157373_10027525 Ga0157373_100275252 376
1189 3300013100 Ga0157373_10048963 Ga0157373_100489632 376
1190 3300013102 Ga0157371_10008375 Ga0157371_100083752 376
1191 3300013102 Ga0157371_10010504 Ga0157371_100105047 376
1192 3300013104 Ga0157370_10143966 Ga0157370_101439662 376
1193 3300013105 Ga0157369_10000751 Ga0157369_1000075119 376
1194 3300013105 Ga0157369_10243694 Ga0157369_102436942 376
1195 3300013296 Ga0157374_10005615 Ga0157374_100056155 376
1196 3300025904 Ga0207647_10010025 Ga0207647_100100256 376
1197 3300025904 Ga0207647_10024116 Ga0207647_100241164 376
1198 3300025904 Ga0207647_10066391 Ga0207647_100663912 376
1199 3300025907 Ga0207645_10011912 Ga0207645_100119124 376
1200 3300025909 Ga0207705_10000033 Ga0207705_1000003354 376
1201 3300025909 Ga0207705_10000082 Ga0207705_1000008288 376
1202 3300025909 Ga0207705_10026516 Ga0207705_100265162 376
1203 3300025912 Ga0207707_10093603 Ga0207707_100936032 376
1204 3300025913 Ga0207695_10003918 Ga0207695_1000391812 376
1205 3300025913 Ga0207695_10007084 Ga0207695_100070843 376
1206 3300025917 Ga0207660_10129287 Ga0207660_101292872 376
1207 3300025919 Ga0207657_10000058 Ga0207657_1000005872 376
1208 3300025919 Ga0207657_10001318 Ga0207657_1000131820 376
1209 3300025919 Ga0207657_10009829 Ga0207657_100098295 376
1210 3300025919 Ga0207657_10029188 Ga0207657_100291883 376
1211 3300025919 Ga0207657_10037304 Ga0207657_100373042 376
1212 3300025920 Ga0207649_10000848 Ga0207649_100008483 376
1213 3300025921 Ga0207652_10167850 Ga0207652_101678502 376
1214 3300025923 Ga0207681_10093205 Ga0207681_100932052 376
1215 3300025932 Ga0207690_10004981 Ga0207690_100049816 376
1216 3300025933 Ga0207706_10001436 Ga0207706_100014365 376
1217 3300025933 Ga0207706_10073406 Ga0207706_100734063 376
1218 3300025949 Ga0207667_10000114 Ga0207667_1000011468 376
1219 3300025981 Ga0207640_10000453 Ga0207640_1000045317 376
1220 3300026067 Ga0207678_10006828 Ga0207678_100068284 376
1221 3300026067 Ga0207678_10013532 Ga0207678_100135327 376
1222 3300026067 Ga0207678_10023522 Ga0207678_100235224 376
1223 3300026078 Ga0207702_10222242 Ga0207702_102222421 376
1224 3300026089 Ga0207648_10051696 Ga0207648_100516963 376
1225 3300026116 Ga0207674_10073776 Ga0207674_100737762 376
1226 3300027876 Ga0209974_10001458 Ga0209974_1000145810 376
1227 3300031852 Ga0307410_10242455 Ga0307410_102424551 376
1228 3300031901 Ga0307406_10024140 Ga0307406_100241401 376
1229 3300031901 Ga0307406_10198893 Ga0307406_101988932 376
1230 3300032004 Ga0307414_10252328 Ga0307414_102523282 376
1231 3300032005 Ga0307411_10015359 Ga0307411_100153592 376
1232 3300037312 Ga0395899_0003735 Ga0395899_0003735_10002_11201 376
1233 3300037312 Ga0395899_0021827 Ga0395899_0021827_2877_4076 376
1234 3300037312 Ga0395899_0070898 Ga0395899_0070898_1129_2328 376
1235 3300037418 Ga0395900_0089074 Ga0395900_0089074_274_1473 376
1236 3300037418 Ga0395900_0093281 Ga0395900_0093281_862_2061 376
1237 3300037418 Ga0395900_0155199 Ga0395900_0155199_762_1961 376
1238 3300037418 Ga0395900_0164484 Ga0395900_0164484_111_1310 376
1239 3300037418 Ga0395900_0214125 Ga0395900_0214125_134_1333 376
1240 3300037471 Ga0395905_0059847 Ga0395905_0059847_637_1836 376
1241 3300037471 Ga0395905_0101723 Ga0395905_0101723_1042_2241 376
1242 3300037471 Ga0395905_0110323 Ga0395905_0110323_1274_2473 376
1243 3300038443 Ga0395901_0035042 Ga0395901_0035042_2199_3398 376
1244 3300038443 Ga0395901_0077561 Ga0395901_0077561_1960_3159 376
1245 3300042006 Ga0439432_029084 Ga0439432_029084_63_1283 376
1246 3300044656 Ga0466969_0003846 Ga0466969_0003846_5382_6581 376
1247 3300044684 Ga0466966_0000021 Ga0466966_0000021_12892_14091 376
1248 3300044684 Ga0466966_0008962 Ga0466966_0008962_1391_2590 376
1249 3300044694 Ga0466963_0042549 Ga0466963_0042549_1489_2688 376
1250 3300044706 Ga0466964_0036882 Ga0466964_0036882_732_1931 376
1251 3300044719 Ga0466971_0001595 Ga0466971_0001595_7234_8433 376
1252 3300044765 Ga0466970_0003742 Ga0466970_0003742_5120_6319 376
1253 3300044842 Ga0466957_0005467 Ga0466957_0005467_1391_2590 376
1254 3300045976 Ga0466967_0148603 Ga0466967_0148603_393_1592 376
1255 3300046506 Ga0495583_0000656 Ga0495583_0000656_26473_27681 376
1256 3300046507 Ga0495606_0002714 Ga0495606_0002714_7825_9033 376
1257 3300047472 Ga0495686_0002330 Ga0495686_0002330_13859_15067 376
1258 3300048925 Ga0496122_0006910 Ga0496122_0006910_6422_7636 376
1259 3300048926 Ga0496123_0003121 Ga0496123_0003121_7062_8276 376
1260 3300053087 Ga0500643_000430 Ga0500643_000430_2746_3936 376
1261 3300061719 Ga0466962_0002682 Ga0466962_0002682_2744_3943 376
1262 3300005289 Ga0065704_10073450 Ga0065704_100734506 377
1263 3300005293 Ga0065715_10093918 Ga0065715_100939182 377
1264 3300005327 Ga0070658_10009142 Ga0070658_100091422 377
1265 3300005331 Ga0070670_100002444 Ga0070670_1000024442 377
1266 3300005331 Ga0070670_100026282 Ga0070670_1000262822 377
1267 3300005331 Ga0070670_100077416 Ga0070670_1000774161 377
1268 3300005333 Ga0070677_10019687 Ga0070677_100196872 377
1269 3300005335 Ga0070666_10012588 Ga0070666_100125883 377
1270 3300005353 Ga0070669_100005288 Ga0070669_1000052883 377
1271 3300005353 Ga0070669_100092774 Ga0070669_1000927742 377
1272 3300005354 Ga0070675_100006027 Ga0070675_1000060274 377
1273 3300005355 Ga0070671_100004366 Ga0070671_1000043664 377
1274 3300005356 Ga0070674_100018834 Ga0070674_1000188342 377
1275 3300005356 Ga0070674_100039129 Ga0070674_1000391292 377
1276 3300005364 Ga0070673_100015203 Ga0070673_1000152032 377
1277 3300005364 Ga0070673_100040478 Ga0070673_1000404783 377
1278 3300005367 Ga0070667_100011249 Ga0070667_1000112496 377
1279 3300005455 Ga0070663_100113764 Ga0070663_1001137642 377
1280 3300005457 Ga0070662_100013214 Ga0070662_1000132144 377
1281 3300005457 Ga0070662_100013967 Ga0070662_1000139674 377
1282 3300005543 Ga0070672_100002918 Ga0070672_10000291810 377
1283 3300005548 Ga0070665_100045231 Ga0070665_1000452313 377
1284 3300005564 Ga0070664_100005219 Ga0070664_1000052197 377
1285 3300005618 Ga0068864_100085435 Ga0068864_1000854352 377
1286 3300005985 Ga0081539_10026310 Ga0081539_100263103 377
1287 3300009177 Ga0105248_10019537 Ga0105248_100195374 377
1288 3300009177 Ga0105248_10446931 Ga0105248_104469311 377
1289 3300009978 Ga0105148_100289 Ga0105148_1002896 377
1290 3300013306 Ga0163162_10177166 Ga0163162_101771662 377
1291 3300014326 Ga0157380_10256620 Ga0157380_102566202 377
1292 3300017792 Ga0163161_10042729 Ga0163161_100427292 377
1293 3300025893 Ga0207682_10008944 Ga0207682_100089443 377
1294 3300025903 Ga0207680_10009702 Ga0207680_100097023 377
1295 3300025909 Ga0207705_10052820 Ga0207705_100528202 377
1296 3300025920 Ga0207649_10019851 Ga0207649_100198512 377
1297 3300025923 Ga0207681_10029297 Ga0207681_100292973 377
1298 3300025923 Ga0207681_10043401 Ga0207681_100434012 377
1299 3300025925 Ga0207650_10009574 Ga0207650_100095742 377
1300 3300025925 Ga0207650_10015917 Ga0207650_100159174 377
1301 3300025926 Ga0207659_10002600 Ga0207659_100026004 377
1302 3300025926 Ga0207659_10028462 Ga0207659_100284622 377
1303 3300025931 Ga0207644_10003712 Ga0207644_100037126 377
1304 3300025931 Ga0207644_10122427 Ga0207644_101224272 377
1305 3300025933 Ga0207706_10023100 Ga0207706_100231004 377
1306 3300025933 Ga0207706_10027955 Ga0207706_100279554 377
1307 3300025933 Ga0207706_10029636 Ga0207706_100296362 377
1308 3300025937 Ga0207669_10032241 Ga0207669_100322412 377
1309 3300025940 Ga0207691_10006076 Ga0207691_100060764 377
1310 3300025940 Ga0207691_10042720 Ga0207691_100427203 377
1311 3300025941 Ga0207711_10009269 Ga0207711_100092695 377
1312 3300025960 Ga0207651_10057592 Ga0207651_100575922 377
1313 3300025986 Ga0207658_10007781 Ga0207658_100077816 377
1314 3300026067 Ga0207678_10132924 Ga0207678_101329242 377
1315 3300031548 Ga0307408_100042046 Ga0307408_1000420462 377
1316 3300031824 Ga0307413_10009435 Ga0307413_100094354 377
1317 3300031852 Ga0307410_10011848 Ga0307410_100118481 377
1318 3300031852 Ga0307410_10028361 Ga0307410_100283614 377
1319 3300031911 Ga0307412_10013382 Ga0307412_100133825 377
1320 3300031995 Ga0307409_100017859 Ga0307409_1000178594 377
1321 3300031995 Ga0307409_100114490 Ga0307409_1001144902 377
1322 3300032002 Ga0307416_100000612 Ga0307416_1000006128 377
1323 3300032002 Ga0307416_100044427 Ga0307416_1000444273 377
1324 3300032004 Ga0307414_10002552 Ga0307414_100025522 377
1325 3300032004 Ga0307414_10016333 Ga0307414_100163334 377
1326 3300032005 Ga0307411_10046883 Ga0307411_100468832 377
1327 3300032005 Ga0307411_10078994 Ga0307411_100789942 377
1328 3300032005 Ga0307411_10129582 Ga0307411_101295822 377
1329 3300032126 Ga0307415_100010131 Ga0307415_1000101314 377
1330 3300046539 Ga0495621_0000040 Ga0495621_0000040_914_2116 377
1331 3300046684 Ga0495669_0008913 Ga0495669_0008913_727_1929 377
1332 3300047445 Ga0495677_0008600 Ga0495677_0008600_2182_3384 377
1333 3300047445 Ga0495677_0024033 Ga0495677_0024033_297_1499 377
1334 3300048912 Ga0496109_0073444 Ga0496109_0073444_913_2124 377
1335 3300048913 Ga0496110_0067825 Ga0496110_0067825_774_1985 377
1336 3300048928 Ga0496125_0138533 Ga0496125_0138533_322_1533 377
1337 3300049663 Ga0501223_000002 Ga0501223_000002_104918_106129 377
1338 3300049705 Ga0501225_0000006 Ga0501225_0000006_104736_105947 377
1339 3300049705 Ga0501225_0000699 Ga0501225_0000699_3449_4660 377
1340 3300001904 JGI24736J21556_1000727 JGI24736J21556_10007275 378
1341 3300001915 JGI24741J21665_1000569 JGI24741J21665_10005695 378
1342 3300001979 JGI24740J21852_10001407 JGI24740J21852_1000140710 378
1343 3300001979 JGI24740J21852_10001639 JGI24740J21852_100016394 378
1344 3300001989 JGI24739J22299_10000035 JGI24739J22299_1000003531 378
1345 3300001989 JGI24739J22299_10000429 JGI24739J22299_1000042914 378
1346 3300001990 JGI24737J22298_10000020 JGI24737J22298_100000204 378
1347 3300001990 JGI24737J22298_10003911 JGI24737J22298_100039113 378
1348 3300002067 JGI24735J21928_10001785 JGI24735J21928_100017852 378
1349 3300005290 Ga0065712_10111930 Ga0065712_101119302 378
1350 3300005327 Ga0070658_10030172 Ga0070658_100301722 378
1351 3300005328 Ga0070676_10005691 Ga0070676_100056914 378
1352 3300005333 Ga0070677_10036117 Ga0070677_100361172 378
1353 3300005334 Ga0068869_100000043 Ga0068869_10000004346 378
1354 3300005335 Ga0070666_10009053 Ga0070666_100090534 378
1355 3300005338 Ga0068868_100001402 Ga0068868_10000140214 378
1356 3300005339 Ga0070660_100027601 Ga0070660_1000276014 378
1357 3300005339 Ga0070660_100033373 Ga0070660_1000333733 378
1358 3300005340 Ga0070689_100077398 Ga0070689_1000773981 378
1359 3300005347 Ga0070668_100051921 Ga0070668_1000519212 378
1360 3300005353 Ga0070669_100000209 Ga0070669_10000020933 378
1361 3300005354 Ga0070675_100064636 Ga0070675_1000646363 378
1362 3300005364 Ga0070673_100005908 Ga0070673_1000059085 378
1363 3300005366 Ga0070659_100000903 Ga0070659_10000090317 378
1364 3300005366 Ga0070659_100023502 Ga0070659_1000235022 378
1365 3300005367 Ga0070667_100002316 Ga0070667_10000231614 378
1366 3300005457 Ga0070662_100000324 Ga0070662_10000032411 378
1367 3300005459 Ga0068867_100001209 Ga0068867_10000120917 378
1368 3300005466 Ga0070685_10056541 Ga0070685_100565412 378
1369 3300005543 Ga0070672_100003604 Ga0070672_10000360411 378
1370 3300005563 Ga0068855_100000780 Ga0068855_10000078028 378
1371 3300005564 Ga0070664_100012664 Ga0070664_1000126642 378
1372 3300005577 Ga0068857_100008240 Ga0068857_1000082407 378
1373 3300005577 Ga0068857_100151335 Ga0068857_1001513352 378
1374 3300005614 Ga0068856_100010860 Ga0068856_1000108605 378
1375 3300005616 Ga0068852_100000562 Ga0068852_10000056215 378
1376 3300005617 Ga0068859_100000934 Ga0068859_10000093418 378
1377 3300005618 Ga0068864_100000181 Ga0068864_10000018111 378
1378 3300005841 Ga0068863_100013287 Ga0068863_1000132879 378
1379 3300005842 Ga0068858_100004993 Ga0068858_1000049939 378
1380 3300005843 Ga0068860_100005988 Ga0068860_1000059885 378
1381 3300006237 Ga0097621_100017686 Ga0097621_1000176864 378
1382 3300006847 Ga0075431_100011561 Ga0075431_1000115612 378
1383 3300006881 Ga0068865_100040146 Ga0068865_1000401462 378
1384 3300006931 Ga0097620_100000934 Ga0097620_10000093416 378
1385 3300009098 Ga0105245_10000120 Ga0105245_1000012020 378
1386 3300009147 Ga0114129_10337894 Ga0114129_103378942 378
1387 3300009148 Ga0105243_10286067 Ga0105243_102860672 378
1388 3300009174 Ga0105241_10084562 Ga0105241_100845622 378
1389 3300009174 Ga0105241_10085666 Ga0105241_100856661 378
1390 3300009177 Ga0105248_10000256 Ga0105248_1000025621 378
1391 3300009545 Ga0105237_10013388 Ga0105237_100133885 378
1392 3300009551 Ga0105238_10065954 Ga0105238_100659544 378
1393 3300010375 Ga0105239_10131513 Ga0105239_101315132 378
1394 3300011119 Ga0105246_10001420 Ga0105246_1000142015 378
1395 3300013100 Ga0157373_10002630 Ga0157373_1000263013 378
1396 3300013102 Ga0157371_10002887 Ga0157371_1000288718 378
1397 3300013104 Ga0157370_10020698 Ga0157370_100206984 378
1398 3300013105 Ga0157369_10183756 Ga0157369_101837562 378
1399 3300013297 Ga0157378_10002232 Ga0157378_100022327 378
1400 3300013306 Ga0163162_10107380 Ga0163162_101073802 378
1401 3300013308 Ga0157375_10108245 Ga0157375_101082452 378
1402 3300025290 Ga0207673_1001556 Ga0207673_10015562 378
1403 3300025315 Ga0207697_10000260 Ga0207697_1000026016 378
1404 3300025893 Ga0207682_10057038 Ga0207682_100570381 378
1405 3300025901 Ga0207688_10000225 Ga0207688_1000022521 378
1406 3300025904 Ga0207647_10000052 Ga0207647_1000005245 378
1407 3300025904 Ga0207647_10026391 Ga0207647_100263912 378
1408 3300025907 Ga0207645_10019028 Ga0207645_100190282 378
1409 3300025919 Ga0207657_10020019 Ga0207657_100200195 378
1410 3300025919 Ga0207657_10022585 Ga0207657_100225852 378
1411 3300025920 Ga0207649_10008671 Ga0207649_100086711 378
1412 3300025925 Ga0207650_10032014 Ga0207650_100320142 378
1413 3300025926 Ga0207659_10124275 Ga0207659_101242752 378
1414 3300025927 Ga0207687_10001946 Ga0207687_100019464 378
1415 3300025933 Ga0207706_10001178 Ga0207706_1000117814 378
1416 3300025935 Ga0207709_10203590 Ga0207709_102035901 378
1417 3300025938 Ga0207704_10025132 Ga0207704_100251322 378
1418 3300025940 Ga0207691_10000114 Ga0207691_100001145 378
1419 3300025941 Ga0207711_10004639 Ga0207711_1000463914 378
1420 3300025942 Ga0207689_10000014 Ga0207689_1000001473 378
1421 3300025945 Ga0207679_10056164 Ga0207679_100561642 378
1422 3300025949 Ga0207667_10038724 Ga0207667_100387243 378
1423 3300025960 Ga0207651_10000066 Ga0207651_100000664 378
1424 3300025981 Ga0207640_10003310 Ga0207640_100033107 378
1425 3300025981 Ga0207640_10036931 Ga0207640_100369312 378
1426 3300025986 Ga0207658_10018307 Ga0207658_100183072 378
1427 3300026023 Ga0207677_10000776 Ga0207677_100007765 378
1428 3300026035 Ga0207703_10001172 Ga0207703_100011727 378
1429 3300026041 Ga0207639_10001817 Ga0207639_100018176 378
1430 3300026067 Ga0207678_10006731 Ga0207678_100067317 378
1431 3300026078 Ga0207702_10002245 Ga0207702_1000224516 378
1432 3300026089 Ga0207648_10001420 Ga0207648_1000142014 378
1433 3300026116 Ga0207674_10000244 Ga0207674_1000024421 378
1434 3300026116 Ga0207674_10063297 Ga0207674_100632973 378
1435 3300026142 Ga0207698_10011936 Ga0207698_100119365 378
1436 3300028380 Ga0268265_10037001 Ga0268265_100370012 378
1437 3300028381 Ga0268264_10008878 Ga0268264_100088785 378
1438 3300031824 Ga0307413_10000677 Ga0307413_100006777 378
1439 3300031901 Ga0307406_10080005 Ga0307406_100800052 378
1440 3300031903 Ga0307407_10002710 Ga0307407_100027104 378
1441 3300031911 Ga0307412_10020794 Ga0307412_100207942 378
1442 3300031995 Ga0307409_100187775 Ga0307409_1001877752 378
1443 3300032002 Ga0307416_100196766 Ga0307416_1001967662 378
1444 3300032004 Ga0307414_10002035 Ga0307414_100020352 378
1445 3300032005 Ga0307411_10001901 Ga0307411_100019012 378
1446 3300037312 Ga0395899_0034910 Ga0395899_0034910_1335_2591 378
1447 3300037418 Ga0395900_0056592 Ga0395900_0056592_2295_3551 378
1448 3300037418 Ga0395900_0123294 Ga0395900_0123294_1148_2398 378
1449 3300037471 Ga0395905_0054795 Ga0395905_0054795_1100_2356 378
1450 3300037471 Ga0395905_0106956 Ga0395905_0106956_1114_2364 378
1451 3300038443 Ga0395901_0178280 Ga0395901_0178280_870_2126 378
1452 3300042004 Ga0439445_0000381 Ga0439445_0000381_439_1680 378
1453 3300046460 Ga0495638_0000018 Ga0495638_0000018_111235_112449 378
1454 3300046506 Ga0495583_0000187 Ga0495583_0000187_17417_18631 378
1455 3300046519 Ga0495632_0000384 Ga0495632_0000384_39219_40433 378
1456 3300046524 Ga0495648_0000018 Ga0495648_0000018_170042_171256 378
1457 3300046525 Ga0495663_0000587 Ga0495663_0000587_9020_10228 378
1458 3300046539 Ga0495621_0067858 Ga0495621_0067858_57_1265 378
1459 3300046558 Ga0495633_0009826 Ga0495633_0009826_2087_3301 378
1460 3300046558 Ga0495633_0010142 Ga0495633_0010142_2626_3834 378
1461 3300046684 Ga0495669_0028579 Ga0495669_0028579_495_1721 378
1462 3300046692 Ga0495671_0000011 Ga0495671_0000011_175286_176500 378
1463 3300047469 Ga0495673_0000013 Ga0495673_0000013_443350_444564 378
1464 3300049658 Ga0501211_000287 Ga0501211_000287_2350_3561 378
1465 3300049669 Ga0501235_003555 Ga0501235_003555_1319_2530 378
1466 3300049669 Ga0501235_018552 Ga0501235_018552_14_1207 378
1467 3300050510 nmdc:mga06r32_27084_c1 nmdc:mga06r32_27084_c1_2496_3734 378
1468 3300009011 Ga0105251_10020072 Ga0105251_100200722 379
1469 3300017792 Ga0163161_10011142 Ga0163161_100111425 379
1470 3300025923 Ga0207681_10256732 Ga0207681_102567321 379
1471 3300032004 Ga0307414_10106041 Ga0307414_101060412 379
1472 3300048911 Ga0496108_0000728 Ga0496108_0000728_11384_12607 379
1473 3300048924 Ga0496121_0000610 Ga0496121_0000610_18609_19832 379
1474 3300048925 Ga0496122_0009142 Ga0496122_0009142_5651_6874 379
1475 3300048926 Ga0496123_0021690 Ga0496123_0021690_1036_2259 379
1476 3300048927 Ga0496124_0006701 Ga0496124_0006701_8830_10053 379
1477 3300048927 Ga0496124_0035402 Ga0496124_0035402_2302_3525 379
1478 3300048928 Ga0496125_0003777 Ga0496125_0003777_7360_8583 379
1479 3300048929 Ga0496126_0008992 Ga0496126_0008992_5730_6953 379
1480 3300026041 Ga0207639_10017663 Ga0207639_100176631 380
1481 3300046692 Ga0495671_0071306 Ga0495671_0071306_143_1348 380
1482 3300053087 Ga0500643_004578 Ga0500643_004578_50_1255 380
1483 3300053157 Ga0500624_000534 Ga0500624_000534_4677_5882 380
1484 3300053177 Ga0500636_0016777 Ga0500636_0016777_458_1663 380
1485 3300053177 Ga0500636_0064942 Ga0500636_0064942_147_1358 380
1486 3300005353 Ga0070669_100287846 Ga0070669_1002878461 381
1487 3300005544 Ga0070686_100005600 Ga0070686_1000056001 381
1488 3300009148 Ga0105243_10184287 Ga0105243_101842871 381
1489 iso_pu_bacteria 2582581305 2585261183 381
1490 3300005338 Ga0068868_100000164 Ga0068868_10000016431 382
1491 3300005339 Ga0070660_100000139 Ga0070660_10000013924 382
1492 3300005354 Ga0070675_100200711 Ga0070675_1002007112 382
1493 3300005366 Ga0070659_100000021 Ga0070659_10000002171 382
1494 3300005841 Ga0068863_100046237 Ga0068863_1000462374 382
1495 3300014969 Ga0157376_10425063 Ga0157376_104250631 382
1496 3300025907 Ga0207645_10086938 Ga0207645_100869381 382
1497 3300025919 Ga0207657_10000228 Ga0207657_1000022823 382
1498 3300025926 Ga0207659_10078622 Ga0207659_100786223 382
1499 3300025932 Ga0207690_10000030 Ga0207690_1000003073 382
1500 3300026023 Ga0207677_10000027 Ga0207677_1000002770 382
1501 3300026088 Ga0207641_10034252 Ga0207641_100342523 382
1502 3300032004 Ga0307414_10000359 Ga0307414_100003597 382
1503 3300046522 Ga0495643_0058292 Ga0495643_0058292_158_1366 382
1504 3300046542 Ga0495597_0003364 Ga0495597_0003364_1080_2288 382
1505 3300046616 Ga0495668_0047653 Ga0495668_0047653_443_1651 382
1506 3300046684 Ga0495669_0007243 Ga0495669_0007243_1614_2822 382
1507 3300049571 Ga0501034_0077985 Ga0501034_0077985_1315_2544 382
1508 3300049585 Ga0501069_0003967 Ga0501069_0003967_4886_6115 382
1509 3300049586 Ga0501070_0037022 Ga0501070_0037022_2080_3309 382
1510 3300053093 Ga0500651_0000548 Ga0500651_0000548_4783_5991 382
1511 3300053123 Ga0500614_007329 Ga0500614_007329_291_1499 382
1512 3300053130 Ga0500642_0004476 Ga0500642_0004476_2390_3598 382
1513 3300053133 Ga0500655_000470 Ga0500655_000470_2508_3716 382
1514 3300053148 Ga0500590_000301 Ga0500590_000301_1260_2468 382
1515 3300053156 Ga0500622_0010167 Ga0500622_0010167_2141_3349 382
1516 3300053724 Ga0500570_000443 Ga0500570_000443_2502_3710 382
1517 3300060353 Ga0501082_0066749 Ga0501082_0066749_236_1465 382
1518 iso_pu_bacteria 2512564014 2512643812 382
1519 iso_pu_bacteria 2808606401 2809064248 382
1520 iso_pu_bacteria 2808606404 2809080216 382
1521 iso_pu_bacteria 2808606405 2809084580 382
1522 iso_pu_bacteria 2880518877 2880522185 382
1523 3300005331 Ga0070670_100000210 Ga0070670_1000002104 383
1524 3300005331 Ga0070670_100310567 Ga0070670_1003105671 383
1525 3300005335 Ga0070666_10000089 Ga0070666_1000008932 383
1526 3300005353 Ga0070669_100000024 Ga0070669_100000024148 383
1527 3300005355 Ga0070671_100000006 Ga0070671_100000006104 383
1528 3300005544 Ga0070686_100158828 Ga0070686_1001588282 383
1529 3300005547 Ga0070693_100087802 Ga0070693_1000878022 383
1530 3300005548 Ga0070665_100054200 Ga0070665_1000542004 383
1531 3300005615 Ga0070702_100046172 Ga0070702_1000461721 383
1532 3300005616 Ga0068852_100054030 Ga0068852_1000540302 383
1533 3300005617 Ga0068859_100000256 Ga0068859_10000025638 383
1534 3300005617 Ga0068859_100011472 Ga0068859_1000114726 383
1535 3300005618 Ga0068864_100001437 Ga0068864_10000143717 383
1536 3300005719 Ga0068861_100000799 Ga0068861_1000007993 383
1537 3300005719 Ga0068861_100048671 Ga0068861_1000486713 383
1538 3300005841 Ga0068863_100000719 Ga0068863_1000007197 383
1539 3300005843 Ga0068860_100043630 Ga0068860_1000436302 383
1540 3300005844 Ga0068862_100000310 Ga0068862_10000031033 383
1541 3300006931 Ga0097620_100000256 Ga0097620_10000025638 383
1542 3300006931 Ga0097620_100011472 Ga0097620_1000114725 383
1543 3300009101 Ga0105247_10000644 Ga0105247_1000064418 383
1544 3300009177 Ga0105248_10039049 Ga0105248_100390495 383
1545 3300009553 Ga0105249_10002324 Ga0105249_1000232413 383
1546 3300013306 Ga0163162_10035573 Ga0163162_100355734 383
1547 3300014325 Ga0163163_10048817 Ga0163163_100488172 383
1548 3300014968 Ga0157379_10027131 Ga0157379_100271314 383
1549 3300020070 Ga0206356_10594826 Ga0206356_105948262 383
1550 3300025315 Ga0207697_10000419 Ga0207697_1000041917 383
1551 3300025903 Ga0207680_10000517 Ga0207680_1000051721 383
1552 3300025923 Ga0207681_10000004 Ga0207681_10000004322 383
1553 3300025925 Ga0207650_10007330 Ga0207650_100073302 383
1554 3300025931 Ga0207644_10000009 Ga0207644_10000009146 383
1555 3300025941 Ga0207711_10186726 Ga0207711_101867262 383
1556 3300025961 Ga0207712_10011297 Ga0207712_100112975 383
1557 3300025972 Ga0207668_10002597 Ga0207668_100025977 383
1558 3300025986 Ga0207658_10003250 Ga0207658_1000325013 383
1559 3300026035 Ga0207703_10001946 Ga0207703_1000194613 383
1560 3300026088 Ga0207641_10002944 Ga0207641_1000294416 383
1561 3300026095 Ga0207676_10000532 Ga0207676_1000053230 383
1562 3300026118 Ga0207675_100000740 Ga0207675_10000074021 383
1563 3300026118 Ga0207675_100196416 Ga0207675_1001964162 383
1564 3300028380 Ga0268265_10001269 Ga0268265_100012692 383
1565 3300028381 Ga0268264_10000069 Ga0268264_10000069100 383
1566 3300039437 Ga0436365_0172851 Ga0436365_0172851_6869_8080 383
1567 iso_pu_bacteria 2643221560 2643821003 383
1568 iso_pu_bacteria 2919709256 2919712163 383
1569 3300053090 Ga0500646_0004153 Ga0500646_0004153_1157_2365 384
1570 3300053139 Ga0500568_0000413 Ga0500568_0000413_29006_30217 384
1571 3300053151 Ga0500604_0000038 Ga0500604_0000038_21609_22820 384
1572 3300053153 Ga0500616_0001124 Ga0500616_0001124_14984_16192 384
1573 iso_pu_bacteria 2775507255 2778124945 384
1574 3300005843 Ga0068860_100038262 Ga0068860_1000382623 385
1575 3300046519 Ga0495632_0000079 Ga0495632_0000079_37807_39015 385
1576 3300046520 Ga0495637_0004139 Ga0495637_0004139_4177_5385 385
1577 3300046522 Ga0495643_0000030 Ga0495643_0000030_226476_227684 385
1578 3300046525 Ga0495663_0000006 Ga0495663_0000006_267924_269132 385
1579 3300046558 Ga0495633_0000515 Ga0495633_0000515_36141_37349 385
1580 3300046558 Ga0495633_0000794 Ga0495633_0000794_4862_6070 385
1581 3300046660 Ga0495625_0118677 Ga0495625_0118677_330_1538 385
1582 3300046692 Ga0495671_0000072 Ga0495671_0000072_63562_64770 385
1583 3300005548 Ga0070665_100000521 Ga0070665_1000005219 386
1584 3300021388 Ga0213875_10000101 Ga0213875_1000010150 386
1585 3300028379 Ga0268266_10002001 Ga0268266_1000200110 386
1586 3300037853 Ga0436364_0188471 Ga0436364_0188471_3497_4717 386
1587 3300053739 Ga0500587_006078 Ga0500587_006078_108_1325 386
1588 3300000549 LJQas_1002319 LJQas_10023192 390

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03739

LptF_LptG

Lipopolysaccharide export system permease LptF/LptG

31

361

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s8g-assembly1.cif.gz_F cryo-em structure of lptb2fgc in complex with amp-pnp 0.766 4 155
7efo-assembly1.cif.gz_F lptb2fg-lps from klebsiella pneumoniae in nanodiscs 0.7621 4 142
6gym-assembly1.cif.gz_V structure of a yeast closed complex with distorted dna (ccdist) 0.7508 180 236
7efo-assembly1.cif.gz_G lptb2fg-lps from klebsiella pneumoniae in nanodiscs 0.7329 4 139
6mi8-assembly1.cif.gz_F cryo-em structure of vanadate-trapped e.coli lptb2fgc 0.7233 6 141
ID Description Score Start End Superfamily
af_Q5GRG2_26_552_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.6005 264 293 3.40.50.1820
af_P32774_58_118_2.30.18.10 Mainly Beta;Roll;TATA box binding Protein, subunit D; domain 2;Transcription factor IIA (TFIIA), beta-barrel domain 0.5591 186 236 2.30.18.10
af_Q8ILA7_22_101_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.5043 137 234 2.30.30.100
af_Q6YZ03_33_177_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.5019 255 328 1.20.140.40
5gmke00 Mainly Beta;Roll;SH3 type barrels.; 0.4948 177 233 2.30.30.100
ID Description Score Start End GO Terms
AF-A0A3C1W1Q8-F1-model_v4 deleted 0.9444 3 138
AF-A0A662D042-F1-model_v4 LPS export ABC transporter permease LptF 0.9393 5 152 GO:0015920
GO:0043190
AF-A0A3B0TF76-F1-model_v4 LptF/LptG family permease 0.9373 1 121 GO:0015920
GO:0043190
AF-A0A522AD52-F1-model_v4 LptF/LptG family permease 0.9354 1 141 GO:0015920
GO:0043190
AF-A0A3C1WIC5-F1-model_v4 YjgP/YjgQ family permease 0.9241 3 124 GO:0015920
GO:0043190

Feature Viewer

pLDDT pTM Quality
75.03 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map