F494944

General Info

Members Datasets Scaffolds Average Seq Length
1592 684 1400 531

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10015199|Ga0265314_100151994
Length 574
Sequence MRRRRFVRKNTGKSYRYANGRIVGILGTRLAELAPLGGCKVMTTSASKPTLWVPGDWNAFFGFGTNILVNMLVLTGLLRFVLKMPDAIVFGRILPALGMMMCLSTFYYAYLAYSLAKKTGRDDVCALPSGVSVPHMFIVTFVIMLPIALKTNDPVKGWEAGLVWVFFQSFILMIGGFVAPYIRKITPRAALLGTLAGVSITFISMRPALEMFMTPVIGLTCFAIIMVSWFGGVKYPKGIPAGLVAIAVGVVIAWGSNLFGLHVGDMSGAKVAAAFSNFGFSVPLPAVGHVFSGFEFLGVILVTAIPYGIYDLVEAMDNVESAEAAGDHYPTTRVLTADGVVSLIGCLMGNPFINAVYIGHPGWKSMGGRIGYSAATGVMVILLSWFGLISLLLAVIPVVAISPILLYIGMLIGAQAFQSTPKEHAPAIALALTPHLAAWATVLITGALGAAGMMYPAVHAPEFIGKMAQQGVLFHGIEVMGGGSILTGLVLGAIGVCVIDRNFVKASAFALAGAVLTYFGFMHGEAVGIGGGFGVTPSVALAYAMVAAFLYALARMPASVEASAPLEAKIAPAE

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
9 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
10 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
11 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
12 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
13 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
14 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
15 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
16 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
17 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
18 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
19 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
20 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
21 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
22 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
23 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
24 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
25 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
26 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
27 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
28 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
29 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
30 2791355199
31 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
32 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
33 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
34 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
35 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
36 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
37 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
38 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
39 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
40 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
41 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
42 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
43 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
44 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
45 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
46 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
47 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
48 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
49 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
50 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
51 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
52 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
53 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
54 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
55 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
56 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
57 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
58 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
59 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
60 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
61 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
62 2842694124 Methylopila sp. R-72369 Isolate Unclassified
63 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
64 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
65 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
66 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
67 2851182111 Bosea sp. Tri-44 Isolate Nodule
68 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
69 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
70 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
71 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
72 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
73 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
74 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
75 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
76 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
77 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
78 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
79 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
80 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
81 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
82 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
83 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
84 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
85 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
86 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
87 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
88 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
89 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
90 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
91 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
92 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
93 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
94 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
95 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
96 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
97 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
98 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
99 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
100 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
101 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
102 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
103 2922368715
104 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
105 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
106 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
107 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
108 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
109 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
110 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
111 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
112 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
113 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
114 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
115 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
116 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
117 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
118 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
119 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
120 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
121 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
122 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
123 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
124 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
125 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
126 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
127 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
128 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
129 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
130 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
131 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
132 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
133 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
134 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
135 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
136 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
137 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
138 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
139 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
140 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
141 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
142 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
143 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
144 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
145 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
146 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
147 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
148 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
149 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
150 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
151 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
152 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
153 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
154 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
155 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
156 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
157 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
158 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
159 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
160 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
161 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
162 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
163 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
164 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
165 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
166 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
167 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
168 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
169 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
170 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
171 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
172 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
173 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
174 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
175 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
176 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
177 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
178 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
179 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
180 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
181 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
182 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
183 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
184 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
185 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
186 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
187 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
188 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
189 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
190 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
191 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
192 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
193 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
194 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
195 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
196 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
197 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
198 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
199 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
200 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
201 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
202 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
203 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
204 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
205 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
206 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
207 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
208 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
209 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
210 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
211 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
212 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
213 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
214 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
215 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
216 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
217 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
218 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
219 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
220 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
221 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
222 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
223 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
224 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
225 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
226 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
227 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
228 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
229 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
230 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
231 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
232 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
233 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
234 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
235 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
236 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
237 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
238 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
239 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
240 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
241 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
242 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
243 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
244 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
245 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
246 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
247 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
248 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
249 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
250 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
251 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
252 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
253 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
254 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
255 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
256 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
257 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
258 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
259 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
260 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
261 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
262 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
263 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
264 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
265 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
266 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
267 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
268 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
269 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
270 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
271 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
272 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
273 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
274 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
275 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
276 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
277 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
278 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
279 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
280 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
281 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
282 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
283 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
284 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
285 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
286 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
287 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
288 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
289 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
290 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
291 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
292 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
293 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
294 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
295 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
296 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
297 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
298 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
299 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
300 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
301 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
302 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
303 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
304 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
305 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
306 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
307 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
308 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
309 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
310 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
311 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
312 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
313 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
314 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
315 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
316 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
317 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
318 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
319 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
320 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
321 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
322 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
323 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
378 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
385 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
386 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
387 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
388 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
389 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
391 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
392 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
393 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
394 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
395 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
396 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
397 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
398 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
399 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
400 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
401 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
402 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
403 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
404 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
406 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
407 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
408 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
409 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
410 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
411 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
412 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
413 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
414 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
415 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
416 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
417 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
418 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
419 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
420 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
421 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
422 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
423 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
424 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
425 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
426 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
427 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
428 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
429 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
430 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
431 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
432 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
433 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
434 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
435 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
436 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
437 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
438 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
439 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
440 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
441 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
442 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
443 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
444 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
445 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
446 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
447 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
448 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
449 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
450 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
451 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
452 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
453 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
454 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
455 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
456 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
457 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
458 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
459 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
460 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
461 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
462 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
463 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
464 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
465 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
466 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
467 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
468 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
469 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
470 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
471 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
472 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
473 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
474 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
475 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
476 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
477 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
478 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
479 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
480 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
481 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
482 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
483 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
484 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
485 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
486 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
487 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
488 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
489 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
490 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
491 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
492 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
493 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
494 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
495 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
496 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
497 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
498 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
499 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
500 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
501 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
502 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
503 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
504 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
505 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
506 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
507 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
508 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
509 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
510 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
511 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
512 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
513 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
514 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
515 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
516 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
517 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
518 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
519 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
520 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
521 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
522 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
523 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
524 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
525 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
526 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
527 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
528 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
529 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
530 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
531 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
532 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
533 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
534 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
535 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
536 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
537 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
538 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
539 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
540 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
541 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
542 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
543 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
544 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
545 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
546 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
547 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
548 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
549 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
550 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
551 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
552 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
553 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
554 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
555 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
556 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
557 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
558 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
559 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
560 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
561 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
562 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
563 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
564 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
565 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
566 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
567 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
568 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
569 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
570 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
571 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
572 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
573 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
574 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
575 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
576 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
577 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
578 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
579 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
580 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
581 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
582 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
583 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
584 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
585 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
586 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
587 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
588 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
589 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
590 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
591 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
592 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
593 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
594 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
595 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
596 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
597 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
598 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
599 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
600 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
601 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
602 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
603 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
604 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
605 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
606 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
607 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
608 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
609 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
610 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
611 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
612 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
613 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
614 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
615 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
616 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
617 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
618 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
619 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
620 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
621 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
622 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
623 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
624 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
625 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
626 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
627 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
628 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
629 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
630 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
631 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
632 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
633 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
634 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
635 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
636 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
637 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
638 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
639 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
640 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
641 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
642 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
643 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
644 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
645 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
646 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
647 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
648 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
649 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
650 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
651 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
652 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
653 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
654 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
655 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
656 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
657 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
658 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
659 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
660 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
661 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
662 641522639 Methylobacterium sp. 4-46 Isolate Nodule
663 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
664 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
665 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
666 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
667 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
668 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
669 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
670 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
671 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
672 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
673 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
674 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
675 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
676 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
677 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
678 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
679 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
680 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
681 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
682 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
683 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
684 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.92
Metatranscriptomes 0.06
Isolates 12.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.49
Nodule 8.61
Rhizoplane 4.71
Rhizosphere 67.96
Stem 0
Stem Tuber 0
Unclassified 8.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000003 3300001904 Bacteria 60801
2 JGI24741J21665_1004125 3300001915 Bacteria 3290
3 JGI24740J21852_10000141 3300001979 Bacteria 27562
4 JGI24739J22299_10003411 3300001989 Bacteria 6063
5 JGI24739J22299_10008663 3300001989 Bacteria 3796
6 JGI24737J22298_10000271 3300001990 Bacteria 17105
7 JGI24743J22301_10000006 3300001991 Bacteria 22489
8 JGI24750J21931_1000961 3300002070 Bacteria 3836
9 JGI24738J21930_10000901 3300002075 Bacteria 8533
10 JGI24749J21850_1000081 3300002076 Bacteria 17395
11 JGI24751J29686_10000128 3300002459 Bacteria 38241
12 JGI24751J29686_10000557 3300002459 Bacteria 10192
13 JGI24751J29686_10006798 3300002459 Bacteria 2332
14 JGI25159J45721_1004900 3300002987 Bacteria 4304
15 JGI25406J46586_10000471 3300003203 Bacteria 18790
16 JGI25406J46586_10009867 3300003203 Bacteria 4265
17 JGI25153J46596_10000317 3300003215 Bacteria 35509
18 JGI25153J46596_10002852 3300003215 Bacteria 9818
19 JGI25153J46596_10004006 3300003215 Bacteria 8043
20 JGI25153J46596_10013376 3300003215 Bacteria 3468
21 rootH1_10002054 3300003316 Bacteria 7111
22 rootH1_10002054 3300003323 Bacteria 118550
23 rootH1_10030737 3300003323 Bacteria 34575
24 JGI25160J50197_1007102 3300003354 Bacteria 4422
25 JGI25404J52841_10010314 3300003659 Bacteria 2010
26 Ga0055542_1005518 3300003762 Bacteria 2845
27 Ga0055526_1000447 3300003771 Bacteria 32803
28 Ga0055531_10009524 3300003794 Bacteria 4957
29 Ga0065165_1000641 3300005262 Bacteria 50686
30 Ga0065165_1000747 3300005262 Bacteria 44635
31 Ga0065165_1010604 3300005262 Bacteria 3956
32 Ga0065712_10025524 3300005290 Bacteria 1762
33 Ga0065707_10081846 3300005295 Bacteria 34057
34 Ga0065707_10084154 3300005295 Bacteria 7602
35 Ga0065707_10124715 3300005295 Bacteria 2038
36 Ga0070658_10005612 3300005327 Bacteria 10174
37 Ga0070658_10030065 3300005327 Bacteria 4365
38 Ga0070683_100074629 3300005329 Bacteria 3167
39 Ga0070690_100031826 3300005330 Bacteria 3289
40 Ga0070670_100000282 3300005331 Bacteria 44780
41 Ga0070670_100000302 3300005331 Bacteria 42495
42 Ga0070670_100008482 3300005331 Bacteria 8765
43 Ga0070670_100016572 3300005331 Bacteria 6325
44 Ga0070670_100106820 3300005331 Bacteria 2412
45 Ga0070677_10019275 3300005333 Bacteria 2468
46 Ga0068869_100001294 3300005334 Bacteria 14814
47 Ga0070666_10000098 3300005335 Bacteria 59878
48 Ga0070666_10050526 3300005335 Bacteria 2796
49 Ga0070680_100006002 3300005336 Bacteria 9216
50 Ga0070682_100003941 3300005337 Bacteria 8240
51 Ga0070682_100004003 3300005337 Bacteria 8189
52 Ga0070682_100044241 3300005337 Bacteria 2756
53 Ga0068868_100001290 3300005338 Bacteria 17256
54 Ga0068868_100004970 3300005338 Bacteria 9337
55 Ga0068868_100032633 3300005338 Bacteria 4008
56 Ga0070689_100000003 3300005340 Bacteria 579260
57 Ga0070689_100003777 3300005340 Bacteria 10142
58 Ga0070689_100024687 3300005340 Bacteria 4509
59 Ga0070689_100031683 3300005340 Bacteria 4019
60 Ga0070689_100070032 3300005340 Bacteria 2737
61 Ga0070689_100117882 3300005340 Bacteria 2118
62 Ga0070661_100005157 3300005344 Bacteria 8992
63 Ga0070668_100000300 3300005347 Bacteria 32482
64 Ga0070668_100000702 3300005347 Bacteria 22873
65 Ga0070668_100002551 3300005347 Bacteria 13404
66 Ga0070668_100003954 3300005347 Bacteria 10958
67 Ga0070668_100008213 3300005347 Bacteria 7752
68 Ga0070668_100023571 3300005347 Bacteria 4656
69 Ga0070668_100081988 3300005347 Bacteria 2529
70 Ga0070669_100000029 3300005353 Bacteria 163005
71 Ga0070669_100000243 3300005353 Bacteria 45185
72 Ga0070669_100000962 3300005353 Bacteria 21044
73 Ga0070675_100001026 3300005354 Bacteria 20075
74 Ga0070675_100057929 3300005354 Bacteria 3194
75 Ga0070671_100000016 3300005355 Bacteria 156166
76 Ga0070671_100000185 3300005355 Bacteria 41669
77 Ga0070671_100000398 3300005355 Bacteria 29948
78 Ga0070671_100001904 3300005355 Bacteria 15964
79 Ga0070671_100001960 3300005355 Bacteria 15778
80 Ga0070671_100116174 3300005355 Bacteria 2250
81 Ga0070671_100118523 3300005355 Bacteria 2227
82 Ga0070671_100178932 3300005355 Bacteria 1795
83 Ga0070674_100010930 3300005356 Bacteria 5506
84 Ga0070674_100033968 3300005356 Bacteria 3401
85 Ga0070673_100000314 3300005364 Bacteria 25487
86 Ga0070673_100000679 3300005364 Bacteria 18764
87 Ga0070673_100011417 3300005364 Bacteria 6059
88 Ga0070673_100018372 3300005364 Bacteria 4992
89 Ga0070688_100013390 3300005365 Bacteria 4623
90 Ga0070688_100025596 3300005365 Bacteria 3495
91 Ga0070688_100032741 3300005365 Bacteria 3138
92 Ga0070688_100073945 3300005365 Bacteria 2187
93 Ga0070667_100000019 3300005367 Bacteria 224710
94 Ga0070667_100000060 3300005367 Bacteria 145801
95 Ga0070667_100000387 3300005367 Bacteria 47707
96 Ga0070667_100000881 3300005367 Bacteria 27716
97 Ga0070667_100004769 3300005367 Bacteria 11358
98 Ga0070667_100007142 3300005367 Bacteria 9283
99 Ga0070667_100020729 3300005367 Bacteria 5459
100 Ga0070667_100021473 3300005367 Bacteria 5360
101 Ga0070667_100043409 3300005367 Bacteria 3773
102 Ga0070667_100065659 3300005367 Bacteria 3081
103 Ga0070709_10002197 3300005434 Bacteria 10578
104 Ga0070709_10009537 3300005434 Bacteria 5356
105 Ga0070714_100002801 3300005435 Bacteria 12865
106 Ga0070714_100033885 3300005435 Bacteria 4274
107 Ga0070714_100166027 3300005435 Bacteria 2001
108 Ga0070714_100191273 3300005435 Bacteria 1868
109 Ga0070713_100007044 3300005436 Bacteria 7854
110 Ga0070713_100007472 3300005436 Bacteria 7674
111 Ga0070713_100023480 3300005436 Bacteria 4786
112 Ga0070713_100029458 3300005436 Bacteria 4349
113 Ga0070713_100095835 3300005436 Bacteria 2560
114 Ga0070713_100119994 3300005436 Bacteria 2305
115 Ga0070710_10033066 3300005437 Bacteria 2806
116 Ga0070701_10003498 3300005438 Bacteria 6228
117 Ga0070711_100003772 3300005439 Bacteria 8886
118 Ga0070711_100006265 3300005439 Bacteria 7167
119 Ga0070711_100012735 3300005439 Bacteria 5264
120 Ga0070700_100029752 3300005441 Bacteria 3258
121 Ga0070663_100007115 3300005455 Bacteria 6789
122 Ga0070663_100074836 3300005455 Bacteria 2473
123 Ga0070678_100017215 3300005456 Bacteria 4647
124 Ga0070678_100024704 3300005456 Bacteria 4028
125 Ga0070678_100042026 3300005456 Bacteria 3246
126 Ga0070678_100069299 3300005456 Bacteria 2633
127 Ga0070662_100000370 3300005457 Bacteria 26837
128 Ga0070681_10048858 3300005458 Bacteria 4226
129 Ga0068867_100000865 3300005459 Bacteria 20441
130 Ga0068867_100025407 3300005459 Bacteria 4250
131 Ga0068867_100123124 3300005459 Bacteria 2006
132 Ga0070685_10000048 3300005466 Bacteria 72576
133 Ga0070685_10036955 3300005466 Bacteria 2763
134 Ga0070706_100002539 3300005467 Bacteria 18347
135 Ga0070706_100074355 3300005467 Bacteria 3145
136 Ga0070707_100018724 3300005468 Bacteria 6518
137 Ga0070707_100058714 3300005468 Bacteria 3689
138 Ga0070707_100115885 3300005468 Bacteria 2601
139 Ga0070698_100006949 3300005471 Bacteria 12252
140 Ga0070698_100016070 3300005471 Bacteria 7902
141 Ga0070698_100213584 3300005471 Bacteria 1863
142 Ga0070699_100005556 3300005518 Bacteria 11054
143 Ga0070699_100030551 3300005518 Bacteria 4651
144 Ga0070699_100117393 3300005518 Unclassified 2338
145 Ga0070679_100028198 3300005530 Bacteria 5534
146 Ga0070684_100009421 3300005535 Bacteria 7689
147 Ga0070684_100085007 3300005535 Bacteria 2806
148 Ga0070697_100038189 3300005536 Bacteria 3879
149 Ga0070697_100056218 3300005536 Bacteria 3201
150 Ga0070697_100058461 3300005536 Bacteria 3138
151 Ga0068853_100001192 3300005539 Bacteria 18528
152 Ga0068853_100005048 3300005539 Bacteria 10298
153 Ga0068853_100008986 3300005539 Bacteria 8048
154 Ga0068853_100011526 3300005539 Bacteria 7187
155 Ga0070672_100009235 3300005543 Bacteria 6789
156 Ga0070672_100027081 3300005543 Bacteria 4274
157 Ga0070686_100005830 3300005544 Bacteria 6827
158 Ga0070665_100000507 3300005548 Bacteria 55834
159 Ga0070665_100000758 3300005548 Bacteria 42702
160 Ga0070665_100001151 3300005548 Bacteria 32520
161 Ga0070665_100004291 3300005548 Bacteria 14986
162 Ga0070665_100014726 3300005548 Bacteria 7846
163 Ga0070665_100036542 3300005548 Bacteria 4940
164 Ga0070665_100044258 3300005548 Bacteria 4471
165 Ga0068855_100000192 3300005563 Bacteria 79087
166 Ga0068855_100002197 3300005563 Bacteria 24123
167 Ga0068855_100007625 3300005563 Bacteria 13086
168 Ga0068855_100070333 3300005563 Bacteria 4071
169 Ga0068855_100119725 3300005563 Bacteria 3014
170 Ga0070664_100003613 3300005564 Bacteria 12460
171 Ga0070664_100092724 3300005564 Bacteria 2616
172 Ga0068857_100010298 3300005577 Bacteria 8124
173 Ga0068857_100066482 3300005577 Bacteria 3207
174 Ga0068857_100095759 3300005577 Bacteria 2660
175 Ga0068857_100197455 3300005577 Bacteria 1833
176 Ga0068854_100003709 3300005578 Bacteria 9553
177 Ga0068854_100011592 3300005578 Bacteria 5747
178 Ga0068854_100046172 3300005578 Bacteria 3100
179 Ga0068856_100005399 3300005614 Bacteria 12602
180 Ga0068856_100027049 3300005614 Bacteria 5596
181 Ga0068856_100029183 3300005614 Bacteria 5388
182 Ga0068856_100074519 3300005614 Bacteria 3360
183 Ga0070702_100002985 3300005615 Bacteria 7477
184 Ga0068852_100006452 3300005616 Bacteria 8474
185 Ga0068852_100039558 3300005616 Bacteria 3971
186 Ga0068859_100000234 3300005617 Bacteria 54759
187 Ga0068859_100002952 3300005617 Bacteria 17252
188 Ga0068859_100006298 3300005617 Bacteria 12035
189 Ga0068859_100008985 3300005617 Bacteria 10092
190 Ga0068859_100015278 3300005617 Bacteria 7710
191 Ga0068859_100019239 3300005617 Bacteria 6860
192 Ga0068859_100029751 3300005617 Bacteria 5480
193 Ga0068859_100032021 3300005617 Bacteria 5282
194 Ga0068859_100044417 3300005617 Bacteria 4464
195 Ga0068859_100047291 3300005617 Bacteria 4322
196 Ga0068859_100143786 3300005617 Bacteria 2459
197 Ga0068864_100000119 3300005618 Bacteria 77606
198 Ga0068864_100000289 3300005618 Bacteria 44780
199 Ga0068864_100000491 3300005618 Bacteria 34223
200 Ga0068864_100002845 3300005618 Bacteria 14295
201 Ga0068864_100016415 3300005618 Bacteria 6165
202 Ga0068864_100018783 3300005618 Bacteria 5778
203 Ga0068864_100052272 3300005618 Bacteria 3521
204 Ga0068864_100080946 3300005618 Bacteria 2846
205 Ga0068864_100081382 3300005618 Bacteria 2839
206 Ga0068861_100006818 3300005719 Bacteria 7799
207 Ga0068861_100010355 3300005719 Bacteria 6469
208 Ga0068861_100042615 3300005719 Bacteria 3403
209 Ga0068851_10008653 3300005834 Bacteria 4711
210 Ga0068851_10056742 3300005834 Bacteria 1998
211 Ga0068863_100000045 3300005841 Bacteria 147269
212 Ga0068863_100000182 3300005841 Bacteria 67022
213 Ga0068863_100004096 3300005841 Bacteria 14401
214 Ga0068863_100011468 3300005841 Bacteria 8570
215 Ga0068863_100048364 3300005841 Bacteria 4033
216 Ga0068863_100072031 3300005841 Bacteria 3270
217 Ga0068858_100000138 3300005842 Bacteria 77033
218 Ga0068858_100002443 3300005842 Bacteria 18778
219 Ga0068858_100002570 3300005842 Bacteria 18284
220 Ga0068858_100002969 3300005842 Bacteria 17031
221 Ga0068858_100003323 3300005842 Bacteria 16008
222 Ga0068858_100003875 3300005842 Bacteria 14781
223 Ga0068858_100023028 3300005842 Bacteria 5809
224 Ga0068858_100038967 3300005842 Bacteria 4408
225 Ga0068858_100080443 3300005842 Bacteria 3028
226 Ga0068860_100000032 3300005843 Bacteria 251624
227 Ga0068860_100000042 3300005843 Bacteria 227404
228 Ga0068860_100000101 3300005843 Bacteria 142856
229 Ga0068860_100000119 3300005843 Bacteria 127040
230 Ga0068860_100000167 3300005843 Bacteria 108234
231 Ga0068860_100000875 3300005843 Bacteria 33443
232 Ga0068860_100001922 3300005843 Bacteria 22001
233 Ga0068860_100003716 3300005843 Bacteria 15690
234 Ga0068860_100004785 3300005843 Bacteria 13791
235 Ga0068860_100014117 3300005843 Bacteria 7834
236 Ga0068860_100014572 3300005843 Bacteria 7692
237 Ga0068860_100015206 3300005843 Bacteria 7518
238 Ga0068860_100023935 3300005843 Bacteria 5902
239 Ga0068860_100026183 3300005843 Bacteria 5625
240 Ga0068860_100075068 3300005843 Bacteria 3216
241 Ga0068862_100000073 3300005844 Bacteria 119632
242 Ga0068862_100000074 3300005844 Bacteria 118036
243 Ga0068862_100003179 3300005844 Bacteria 14239
244 Ga0068862_100003402 3300005844 Bacteria 13720
245 Ga0068862_100004039 3300005844 Bacteria 12439
246 Ga0068862_100026916 3300005844 Bacteria 4837
247 Ga0068862_100056981 3300005844 Bacteria 3349
248 Ga0068862_100083157 3300005844 Bacteria 2780
249 Ga0081455_10000015 3300005937 Bacteria 189655
250 Ga0081455_10001999 3300005937 Bacteria 24349
251 Ga0081455_10002788 3300005937 Bacteria 20571
252 Ga0081455_10008730 3300005937 Bacteria 10495
253 Ga0081455_10011336 3300005937 Bacteria 8963
254 Ga0081455_10053851 3300005937 Bacteria 3435
255 Ga0081540_1000483 3300005983 Bacteria 39033
256 Ga0081540_1003649 3300005983 Bacteria 12076
257 Ga0081540_1006453 3300005983 Bacteria 8538
258 Ga0081540_1027883 3300005983 Bacteria 3188
259 Ga0081540_1028930 3300005983 Bacteria 3099
260 Ga0081540_1030478 3300005983 Bacteria 2987
261 Ga0081540_1033317 3300005983 Bacteria 2800
262 Ga0081539_10000048 3300005985 Bacteria 272906
263 Ga0081539_10000118 3300005985 Bacteria 184562
264 Ga0081539_10000220 3300005985 Bacteria 133834
265 Ga0081539_10005165 3300005985 Bacteria 13578
266 Ga0070717_10001656 3300006028 Bacteria 15473
267 Ga0070717_10008544 3300006028 Bacteria 7647
268 Ga0070717_10035686 3300006028 Bacteria 4027
269 Ga0070717_10131083 3300006028 Bacteria 2156
270 Ga0070717_10140851 3300006028 Bacteria 2080
271 Ga0075365_10025507 3300006038 Bacteria 3743
272 Ga0075365_10041229 3300006038 Bacteria 3015
273 Ga0075365_10067876 3300006038 Bacteria 2395
274 Ga0075365_10070297 3300006038 Bacteria 2354
275 Ga0075368_10000162 3300006042 Bacteria 18059
276 Ga0075368_10013943 3300006042 Bacteria 2959
277 Ga0075368_10016963 3300006042 Bacteria 2719
278 Ga0075363_100000226 3300006048 Bacteria 15721
279 Ga0075363_100002722 3300006048 Bacteria 7315
280 Ga0075364_10021089 3300006051 Bacteria 4104
281 Ga0070715_10001127 3300006163 Bacteria 7613
282 Ga0070715_10019430 3300006163 Bacteria 2606
283 Ga0070715_10037981 3300006163 Bacteria 1997
284 Ga0070716_100006731 3300006173 Bacteria 5629
285 Ga0070716_100007202 3300006173 Bacteria 5469
286 Ga0070716_100019006 3300006173 Bacteria 3588
287 Ga0070716_100031176 3300006173 Bacteria 2898
288 Ga0075362_10000015 3300006177 Bacteria 84026
289 Ga0075362_10001505 3300006177 Bacteria 7495
290 Ga0075362_10009394 3300006177 Bacteria 3782
291 Ga0075367_10016941 3300006178 Bacteria 3989
292 Ga0075367_10027414 3300006178 Bacteria 3241
293 Ga0075369_10000089 3300006186 Bacteria 24511
294 Ga0075369_10004561 3300006186 Bacteria 5131
295 Ga0075369_10018978 3300006186 Bacteria 2804
296 Ga0075369_10026585 3300006186 Bacteria 2413
297 Ga0075366_10000072 3300006195 Bacteria 39088
298 Ga0097621_100002597 3300006237 Bacteria 12377
299 Ga0097621_100108212 3300006237 Bacteria 2346
300 Ga0075370_10000082 3300006353 Bacteria 28896
301 Ga0075370_10001199 3300006353 Bacteria 10934
302 Ga0075370_10021876 3300006353 Bacteria 3506
303 Ga0075370_10098227 3300006353 Bacteria 1693
304 Ga0068871_100004107 3300006358 Bacteria 10069
305 Ga0068871_100040734 3300006358 Bacteria 3721
306 Ga0068871_100055688 3300006358 Bacteria 3211
307 Ga0075428_100087762 3300006844 Bacteria 3393
308 Ga0075430_100000066 3300006846 Bacteria 56729
309 Ga0075433_10002626 3300006852 Bacteria 13713
310 Ga0075434_100006092 3300006871 Bacteria 11036
311 Ga0075434_100129165 3300006871 Bacteria 2545
312 Ga0068865_100003223 3300006881 Bacteria 9777
313 Ga0068865_100007553 3300006881 Bacteria 6692
314 Ga0068865_100070136 3300006881 Bacteria 2482
315 Ga0097620_100000234 3300006931 Bacteria 54759
316 Ga0097620_100002952 3300006931 Bacteria 17252
317 Ga0097620_100006299 3300006931 Bacteria 12035
318 Ga0097620_100008985 3300006931 Bacteria 10092
319 Ga0097620_100015278 3300006931 Bacteria 7710
320 Ga0097620_100019239 3300006931 Bacteria 6860
321 Ga0097620_100029750 3300006931 Bacteria 5480
322 Ga0097620_100032022 3300006931 Bacteria 5282
323 Ga0097620_100044417 3300006931 Bacteria 4464
324 Ga0097620_100047297 3300006931 Bacteria 4322
325 Ga0097620_100143785 3300006931 Bacteria 2459
326 Ga0097620_100192051 3300006931 Bacteria 2126
327 Ga0075435_100006360 3300007076 Bacteria 8349
328 Ga0075435_100014544 3300007076 Bacteria 5887
329 Ga0075435_100021990 3300007076 Bacteria 4916
330 Ga0099794_10019822 3300007265 Bacteria 3036
331 Ga0099794_10035438 3300007265 Bacteria 2355
332 Ga0099794_10054279 3300007265 Bacteria 1934
333 Ga0099795_10000439 3300007788 Bacteria 7640
334 Ga0099795_10003692 3300007788 Bacteria 3833
335 Ga0099795_10009280 3300007788 Bacteria 2847
336 Ga0105251_10000989 3300009011 Bacteria 24948
337 Ga0105240_10000053 3300009093 Bacteria 225578
338 Ga0105240_10000535 3300009093 Bacteria 70216
339 Ga0105240_10004238 3300009093 Bacteria 21930
340 Ga0105240_10004473 3300009093 Bacteria 21293
341 Ga0105240_10024203 3300009093 Bacteria 8013
342 Ga0105240_10097372 3300009093 Bacteria 3585
343 Ga0105240_10114939 3300009093 Bacteria 3250
344 Ga0111539_10041562 3300009094 Bacteria 5526
345 Ga0111539_10043837 3300009094 Bacteria 5362
346 Ga0111539_10053062 3300009094 Bacteria 4826
347 Ga0111539_10079286 3300009094 Bacteria 3863
348 Ga0111539_10144080 3300009094 Bacteria 2789
349 Ga0111539_10281037 3300009094 Bacteria 1937
350 Ga0105245_10007663 3300009098 Bacteria 9455
351 Ga0105245_10032182 3300009098 Bacteria 4643
352 Ga0105247_10004758 3300009101 Bacteria 8639
353 Ga0105247_10004980 3300009101 Bacteria 8441
354 Ga0105247_10027718 3300009101 Bacteria 3426
355 Ga0105247_10066045 3300009101 Bacteria 2251
356 Ga0105247_10072346 3300009101 Bacteria 2158
357 Ga0114129_10046183 3300009147 Bacteria 6122
358 Ga0114129_10420069 3300009147 Bacteria 1759
359 Ga0105243_10092413 3300009148 Bacteria 2495
360 Ga0105243_10143483 3300009148 Bacteria 2040
361 Ga0105241_10032799 3300009174 Bacteria 3897
362 Ga0105241_10046041 3300009174 Bacteria 3312
363 Ga0105241_10090950 3300009174 Bacteria 2407
364 Ga0105242_10016950 3300009176 Bacteria 5670
365 Ga0105248_10000493 3300009177 Bacteria 44891
366 Ga0105248_10002280 3300009177 Bacteria 21247
367 Ga0105248_10006264 3300009177 Bacteria 13045
368 Ga0105248_10009662 3300009177 Bacteria 10627
369 Ga0105248_10019871 3300009177 Bacteria 7439
370 Ga0105248_10034363 3300009177 Bacteria 5669
371 Ga0105248_10037389 3300009177 Bacteria 5431
372 Ga0105248_10075191 3300009177 Bacteria 3796
373 Ga0105248_10265288 3300009177 Bacteria 1933
374 Ga0105237_10000523 3300009545 Bacteria 54108
375 Ga0105237_10000940 3300009545 Bacteria 39141
376 Ga0105237_10008112 3300009545 Bacteria 11409
377 Ga0105237_10008601 3300009545 Bacteria 11040
378 Ga0105237_10048817 3300009545 Bacteria 4255
379 Ga0105237_10067881 3300009545 Bacteria 3559
380 Ga0105237_10106046 3300009545 Bacteria 2802
381 Ga0105237_10125072 3300009545 Bacteria 2566
382 Ga0105238_10003007 3300009551 Bacteria 16839
383 Ga0105238_10027647 3300009551 Bacteria 5781
384 Ga0105238_10077462 3300009551 Bacteria 3316
385 Ga0105249_10000167 3300009553 Bacteria 77350
386 Ga0105249_10002340 3300009553 Bacteria 16464
387 Ga0105249_10045509 3300009553 Bacteria 3992
388 Ga0105249_10068040 3300009553 Bacteria 3283
389 Ga0105249_10078257 3300009553 Bacteria 3068
390 Ga0105249_10099150 3300009553 Bacteria 2738
391 Ga0099796_10000306 3300010159 Bacteria 7768
392 Ga0099796_10007159 3300010159 Bacteria 2904
393 Ga0105239_10021238 3300010375 Bacteria 7158
394 Ga0105239_10046277 3300010375 Bacteria 4768
395 Ga0105239_10195070 3300010375 Bacteria 2268
396 Ga0157370_10009206 3300013104 Bacteria 10587
397 Ga0157369_10139654 3300013105 Bacteria 2564
398 Ga0157374_10036932 3300013296 Bacteria 4478
399 Ga0157374_10139391 3300013296 Bacteria 2353
400 Ga0157378_10023381 3300013297 Bacteria 5439
401 Ga0157378_10037039 3300013297 Bacteria 4319
402 Ga0157378_10165201 3300013297 Bacteria 2073
403 Ga0163162_10016774 3300013306 Bacteria 7160
404 Ga0163162_10043667 3300013306 Bacteria 4488
405 Ga0163162_10139244 3300013306 Bacteria 2539
406 Ga0163162_10188099 3300013306 Bacteria 2192
407 Ga0163162_10288388 3300013306 Bacteria 1773
408 Ga0157375_10019930 3300013308 Bacteria 6115
409 Ga0163163_10000160 3300014325 Bacteria 70273
410 Ga0163163_10002766 3300014325 Bacteria 14808
411 Ga0163163_10032153 3300014325 Bacteria 5068
412 Ga0163163_10032475 3300014325 Bacteria 5041
413 Ga0163163_10050619 3300014325 Bacteria 4091
414 Ga0163163_10070525 3300014325 Bacteria 3480
415 Ga0157380_10000347 3300014326 Bacteria 27741
416 Ga0157380_10236974 3300014326 Bacteria 1643
417 Ga0157379_10000171 3300014968 Bacteria 48687
418 Ga0157379_10006700 3300014968 Bacteria 9949
419 Ga0157379_10029114 3300014968 Bacteria 4912
420 Ga0157376_10039904 3300014969 Bacteria 3833
421 Ga0157376_10115038 3300014969 Bacteria 2374
422 Ga0163161_10083594 3300017792 Bacteria 2353
423 Ga0214544_1000001 3300021320 Bacteria 783667
424 Ga0214542_1001925 3300021321 Bacteria 42950
425 Ga0214545_1000003 3300021324 Bacteria 720274
426 Ga0214543_1000002 3300021327 Bacteria 712733
427 Ga0213872_10005329 3300021361 Bacteria 6639
428 Ga0213872_10035346 3300021361 Bacteria 2285
429 Ga0213876_10000789 3300021384 Bacteria 21526
430 Ga0213876_10025680 3300021384 Bacteria 3107
431 Ga0213875_10000009 3300021388 Bacteria 451129
432 Ga0209563_100325 3300025230 Bacteria 18742
433 Ga0209677_102346 3300025253 Bacteria 7251
434 Ga0209148_1000812 3300025254 Bacteria 22632
435 Ga0209233_1002110 3300025261 Bacteria 7499
436 Ga0209233_1006415 3300025261 Bacteria 3794
437 Ga0209233_1008168 3300025261 Bacteria 3259
438 Ga0209455_1001400 3300025272 Bacteria 10947
439 Ga0209130_1000648 3300025284 Bacteria 32278
440 Ga0209564_1000031 3300025295 Bacteria 494703
441 Ga0209758_1000011 3300025297 Bacteria 1049685
442 Ga0209758_1000120 3300025297 Bacteria 192212
443 Ga0209758_1001027 3300025297 Bacteria 36658
444 Ga0209758_1001848 3300025297 Bacteria 23245
445 Ga0209758_1005026 3300025297 Bacteria 10533
446 Ga0209758_1008838 3300025297 Bacteria 6412
447 Ga0209758_1018545 3300025297 Bacteria 3402
448 Ga0209050_1001613 3300025298 Bacteria 23201
449 Ga0209256_1000128 3300025299 Bacteria 163833
450 Ga0207426_1000328 3300025302 Bacteria 90659
451 Ga0207426_1000458 3300025302 Bacteria 64019
452 Ga0207426_1006703 3300025302 Bacteria 4942
453 Ga0209257_1001101 3300025304 Bacteria 35153
454 Ga0209257_1011618 3300025304 Bacteria 4210
455 Ga0207697_10000473 3300025315 Bacteria 22696
456 Ga0207697_10021382 3300025315 Bacteria 2648
457 Ga0207697_10044170 3300025315 Bacteria 1833
458 Ga0207656_10001845 3300025321 Bacteria 7036
459 Ga0207713_1001270 3300025735 Bacteria 20805
460 Ga0207682_10001361 3300025893 Bacteria 11279
461 Ga0207692_10015414 3300025898 Bacteria 3363
462 Ga0207642_10022875 3300025899 Bacteria 2487
463 Ga0207710_10003075 3300025900 Bacteria 7494
464 Ga0207710_10019832 3300025900 Bacteria 2871
465 Ga0207688_10000290 3300025901 Bacteria 22926
466 Ga0207680_10000399 3300025903 Bacteria 20706
467 Ga0207680_10023292 3300025903 Bacteria 3379
468 Ga0207680_10032857 3300025903 Bacteria 2954
469 Ga0207647_10000885 3300025904 Bacteria 23242
470 Ga0207699_10001610 3300025906 Bacteria 10719
471 Ga0207699_10034270 3300025906 Bacteria 2878
472 Ga0207645_10009970 3300025907 Bacteria 6544
473 Ga0207645_10033658 3300025907 Bacteria 3293
474 Ga0207643_10003975 3300025908 Bacteria 7960
475 Ga0207705_10001805 3300025909 Bacteria 16883
476 Ga0207705_10042106 3300025909 Bacteria 3279
477 Ga0207684_10001107 3300025910 Bacteria 30151
478 Ga0207684_10007765 3300025910 Bacteria 9606
479 Ga0207684_10027597 3300025910 Bacteria 4836
480 Ga0207654_10005029 3300025911 Bacteria 6679
481 Ga0207654_10046562 3300025911 Bacteria 2474
482 Ga0207707_10000886 3300025912 Bacteria 29266
483 Ga0207707_10029159 3300025912 Bacteria 4824
484 Ga0207707_10042235 3300025912 Bacteria 3980
485 Ga0207695_10000163 3300025913 Bacteria 197030
486 Ga0207695_10000590 3300025913 Bacteria 73193
487 Ga0207695_10005277 3300025913 Bacteria 17223
488 Ga0207695_10005898 3300025913 Bacteria 16065
489 Ga0207695_10013483 3300025913 Bacteria 9746
490 Ga0207695_10045323 3300025913 Bacteria 4669
491 Ga0207695_10062664 3300025913 Bacteria 3838
492 Ga0207695_10085964 3300025913 Bacteria 3173
493 Ga0207671_10001251 3300025914 Bacteria 29946
494 Ga0207671_10004455 3300025914 Bacteria 13386
495 Ga0207671_10004663 3300025914 Bacteria 12971
496 Ga0207671_10019133 3300025914 Bacteria 5242
497 Ga0207671_10114674 3300025914 Bacteria 2054
498 Ga0207663_10007530 3300025916 Bacteria 5651
499 Ga0207660_10017407 3300025917 Bacteria 4774
500 Ga0207660_10037977 3300025917 Bacteria 3359
501 Ga0207657_10007886 3300025919 Bacteria 10862
502 Ga0207652_10013425 3300025921 Bacteria 6630
503 Ga0207652_10126863 3300025921 Bacteria 2273
504 Ga0207646_10023526 3300025922 Bacteria 5658
505 Ga0207646_10036804 3300025922 Bacteria 4416
506 Ga0207681_10000023 3300025923 Bacteria 229753
507 Ga0207681_10000040 3300025923 Bacteria 147547
508 Ga0207681_10000344 3300025923 Bacteria 33392
509 Ga0207681_10051971 3300025923 Bacteria 2777
510 Ga0207694_10001025 3300025924 Bacteria 24369
511 Ga0207694_10020560 3300025924 Bacteria 4996
512 Ga0207694_10081682 3300025924 Bacteria 2539
513 Ga0207650_10000013 3300025925 Bacteria 409471
514 Ga0207650_10000029 3300025925 Bacteria 236660
515 Ga0207650_10000074 3300025925 Bacteria 134837
516 Ga0207650_10010335 3300025925 Bacteria 6399
517 Ga0207650_10016614 3300025925 Bacteria 5145
518 Ga0207650_10030519 3300025925 Bacteria 3884
519 Ga0207650_10039320 3300025925 Bacteria 3457
520 Ga0207650_10130277 3300025925 Bacteria 1968
521 Ga0207659_10000322 3300025926 Bacteria 28877
522 Ga0207659_10013870 3300025926 Bacteria 5180
523 Ga0207687_10010698 3300025927 Bacteria 5991
524 Ga0207687_10025359 3300025927 Bacteria 3967
525 Ga0207700_10019379 3300025928 Bacteria 4593
526 Ga0207700_10030830 3300025928 Bacteria 3803
527 Ga0207700_10031621 3300025928 Bacteria 3763
528 Ga0207700_10081122 3300025928 Bacteria 2532
529 Ga0207664_10007788 3300025929 Bacteria 7438
530 Ga0207664_10168176 3300025929 Bacteria 1874
531 Ga0207644_10000023 3300025931 Bacteria 156180
532 Ga0207644_10000329 3300025931 Bacteria 30793
533 Ga0207644_10000454 3300025931 Bacteria 26457
534 Ga0207644_10000721 3300025931 Bacteria 20946
535 Ga0207644_10000742 3300025931 Bacteria 20667
536 Ga0207644_10001329 3300025931 Bacteria 15860
537 Ga0207644_10001691 3300025931 Bacteria 14224
538 Ga0207706_10001157 3300025933 Bacteria 26820
539 Ga0207706_10026179 3300025933 Bacteria 5221
540 Ga0207706_10031423 3300025933 Bacteria 4730
541 Ga0207670_10000006 3300025936 Bacteria 401723
542 Ga0207670_10001660 3300025936 Bacteria 11621
543 Ga0207670_10026740 3300025936 Bacteria 3640
544 Ga0207670_10028242 3300025936 Bacteria 3559
545 Ga0207670_10103780 3300025936 Bacteria 2035
546 Ga0207669_10009904 3300025937 Bacteria 4563
547 Ga0207669_10072821 3300025937 Bacteria 2165
548 Ga0207704_10002304 3300025938 Bacteria 8576
549 Ga0207665_10000994 3300025939 Bacteria 19134
550 Ga0207665_10012034 3300025939 Bacteria 5679
551 Ga0207691_10001236 3300025940 Bacteria 25481
552 Ga0207691_10013025 3300025940 Bacteria 7963
553 Ga0207691_10014041 3300025940 Bacteria 7642
554 Ga0207691_10020585 3300025940 Bacteria 6238
555 Ga0207691_10047249 3300025940 Bacteria 3950
556 Ga0207711_10000541 3300025941 Bacteria 38660
557 Ga0207711_10001307 3300025941 Bacteria 23557
558 Ga0207711_10003436 3300025941 Bacteria 13701
559 Ga0207711_10005730 3300025941 Bacteria 10483
560 Ga0207711_10010435 3300025941 Bacteria 7711
561 Ga0207711_10024631 3300025941 Bacteria 5046
562 Ga0207711_10122038 3300025941 Bacteria 2327
563 Ga0207689_10000988 3300025942 Bacteria 27253
564 Ga0207689_10025964 3300025942 Bacteria 4905
565 Ga0207689_10059341 3300025942 Bacteria 3147
566 Ga0207661_10019630 3300025944 Bacteria 5043
567 Ga0207661_10127179 3300025944 Bacteria 2177
568 Ga0207679_10012972 3300025945 Bacteria 5453
569 Ga0207667_10000173 3300025949 Bacteria 95378
570 Ga0207667_10002524 3300025949 Bacteria 22795
571 Ga0207667_10011668 3300025949 Bacteria 10195
572 Ga0207667_10017111 3300025949 Bacteria 8173
573 Ga0207667_10050503 3300025949 Bacteria 4388
574 Ga0207651_10012387 3300025960 Bacteria 4825
575 Ga0207651_10018851 3300025960 Bacteria 4119
576 Ga0207651_10058353 3300025960 Bacteria 2667
577 Ga0207651_10111560 3300025960 Bacteria 2054
578 Ga0207712_10000049 3300025961 Bacteria 160026
579 Ga0207712_10001178 3300025961 Bacteria 18107
580 Ga0207712_10011824 3300025961 Bacteria 5566
581 Ga0207712_10045890 3300025961 Bacteria 3027
582 Ga0207712_10084911 3300025961 Bacteria 2315
583 Ga0207712_10119256 3300025961 Bacteria 1993
584 Ga0207712_10130621 3300025961 Bacteria 1914
585 Ga0207668_10000001 3300025972 Bacteria 266091
586 Ga0207668_10000093 3300025972 Bacteria 64280
587 Ga0207668_10000565 3300025972 Bacteria 23257
588 Ga0207668_10002375 3300025972 Bacteria 10997
589 Ga0207668_10006644 3300025972 Bacteria 6840
590 Ga0207668_10015911 3300025972 Bacteria 4683
591 Ga0207668_10016988 3300025972 Bacteria 4552
592 Ga0207640_10013731 3300025981 Bacteria 4648
593 Ga0207658_10000002 3300025986 Bacteria 1364188
594 Ga0207658_10000005 3300025986 Bacteria 408341
595 Ga0207658_10000266 3300025986 Bacteria 55102
596 Ga0207658_10001288 3300025986 Bacteria 19833
597 Ga0207658_10004400 3300025986 Bacteria 9798
598 Ga0207658_10008836 3300025986 Bacteria 6836
599 Ga0207658_10013896 3300025986 Bacteria 5509
600 Ga0207658_10029979 3300025986 Bacteria 3848
601 Ga0207677_10009636 3300026023 Bacteria 5438
602 Ga0207677_10030833 3300026023 Bacteria 3428
603 Ga0207677_10032216 3300026023 Bacteria 3367
604 Ga0207703_10000778 3300026035 Bacteria 31401
605 Ga0207703_10000817 3300026035 Bacteria 30675
606 Ga0207703_10003066 3300026035 Bacteria 14131
607 Ga0207703_10003952 3300026035 Bacteria 12287
608 Ga0207703_10005822 3300026035 Bacteria 9873
609 Ga0207703_10006496 3300026035 Bacteria 9334
610 Ga0207703_10016737 3300026035 Bacteria 5720
611 Ga0207639_10001095 3300026041 Bacteria 18432
612 Ga0207639_10002001 3300026041 Bacteria 13739
613 Ga0207639_10006875 3300026041 Bacteria 7748
614 Ga0207639_10013567 3300026041 Bacteria 5708
615 Ga0207678_10003737 3300026067 Bacteria 13694
616 Ga0207678_10009474 3300026067 Bacteria 8566
617 Ga0207678_10012506 3300026067 Bacteria 7454
618 Ga0207678_10014197 3300026067 Bacteria 7003
619 Ga0207708_10003262 3300026075 Bacteria 11955
620 Ga0207708_10010903 3300026075 Bacteria 6761
621 Ga0207702_10014770 3300026078 Bacteria 6477
622 Ga0207702_10024292 3300026078 Bacteria 5028
623 Ga0207641_10000011 3300026088 Bacteria 384362
624 Ga0207641_10000102 3300026088 Bacteria 122366
625 Ga0207641_10000207 3300026088 Bacteria 77525
626 Ga0207641_10001148 3300026088 Bacteria 26600
627 Ga0207641_10002051 3300026088 Bacteria 19163
628 Ga0207641_10006748 3300026088 Bacteria 9617
629 Ga0207641_10009357 3300026088 Bacteria 8081
630 Ga0207641_10011322 3300026088 Bacteria 7321
631 Ga0207648_10003222 3300026089 Bacteria 17183
632 Ga0207648_10006548 3300026089 Bacteria 11564
633 Ga0207648_10010265 3300026089 Bacteria 8892
634 Ga0207648_10085897 3300026089 Bacteria 2744
635 Ga0207648_10101649 3300026089 Bacteria 2519
636 Ga0207676_10000010 3300026095 Bacteria 519402
637 Ga0207676_10000059 3300026095 Bacteria 119553
638 Ga0207676_10000674 3300026095 Bacteria 27320
639 Ga0207676_10000765 3300026095 Bacteria 25128
640 Ga0207676_10002078 3300026095 Bacteria 14534
641 Ga0207676_10024857 3300026095 Bacteria 4438
642 Ga0207676_10031252 3300026095 Bacteria 4004
643 Ga0207676_10068626 3300026095 Bacteria 2836
644 Ga0207674_10004839 3300026116 Bacteria 16124
645 Ga0207674_10033659 3300026116 Bacteria 5364
646 Ga0207674_10066837 3300026116 Bacteria 3620
647 Ga0207674_10105081 3300026116 Bacteria 2802
648 Ga0207674_10151754 3300026116 Bacteria 2274
649 Ga0207674_10167142 3300026116 Bacteria 2154
650 Ga0207675_100000667 3300026118 Bacteria 33777
651 Ga0207675_100003638 3300026118 Bacteria 15027
652 Ga0207675_100010160 3300026118 Bacteria 8823
653 Ga0207675_100024107 3300026118 Bacteria 5657
654 Ga0207675_100026655 3300026118 Bacteria 5380
655 Ga0207675_100026697 3300026118 Bacteria 5374
656 Ga0207675_100053902 3300026118 Bacteria 3752
657 Ga0207675_100146824 3300026118 Bacteria 2243
658 Ga0207683_10015557 3300026121 Bacteria 6478
659 Ga0207683_10038522 3300026121 Bacteria 4167
660 Ga0207683_10040799 3300026121 Bacteria 4052
661 Ga0207683_10044126 3300026121 Bacteria 3897
662 Ga0207698_10009467 3300026142 Bacteria 6215
663 Ga0207698_10036023 3300026142 Bacteria 3627
664 Ga0207698_10087592 3300026142 Bacteria 2537
665 Ga0209389_1000043 3300027296 Bacteria 123224
666 Ga0209589_1000047 3300027357 Bacteria 118659
667 Ga0209489_100075 3300027361 Bacteria 136991
668 Ga0209813_10000286 3300027866 Bacteria 14129
669 Ga0209813_10001620 3300027866 Bacteria 5067
670 Ga0207428_10013649 3300027907 Bacteria 7087
671 Ga0207428_10020735 3300027907 Bacteria 5575
672 Ga0207428_10061807 3300027907 Bacteria 2963
673 Ga0268266_10000289 3300028379 Bacteria 82515
674 Ga0268266_10000616 3300028379 Bacteria 48562
675 Ga0268266_10001288 3300028379 Bacteria 30547
676 Ga0268266_10006154 3300028379 Bacteria 11038
677 Ga0268266_10009379 3300028379 Bacteria 8622
678 Ga0268266_10021656 3300028379 Bacteria 5477
679 Ga0268266_10044436 3300028379 Bacteria 3797
680 Ga0268266_10053622 3300028379 Bacteria 3465
681 Ga0268266_10239470 3300028379 Bacteria 1674
682 Ga0268265_10000018 3300028380 Bacteria 285651
683 Ga0268265_10000098 3300028380 Bacteria 110108
684 Ga0268265_10000113 3300028380 Bacteria 101546
685 Ga0268265_10001685 3300028380 Bacteria 18014
686 Ga0268265_10004032 3300028380 Bacteria 10339
687 Ga0268265_10029151 3300028380 Bacteria 3959
688 Ga0268265_10107530 3300028380 Bacteria 2268
689 Ga0268264_10000001 3300028381 Bacteria 1221000
690 Ga0268264_10000016 3300028381 Bacteria 502537
691 Ga0268264_10000030 3300028381 Bacteria 418542
692 Ga0268264_10000045 3300028381 Bacteria 364764
693 Ga0268264_10000068 3300028381 Bacteria 275708
694 Ga0268264_10000128 3300028381 Bacteria 183164
695 Ga0268264_10000141 3300028381 Bacteria 170966
696 Ga0268264_10000672 3300028381 Bacteria 39982
697 Ga0268264_10000828 3300028381 Bacteria 33168
698 Ga0268264_10003137 3300028381 Bacteria 14329
699 Ga0268264_10123908 3300028381 Bacteria 2281
700 Ga0265326_10007004 3300028558 Bacteria 3474
701 Ga0265319_1000212 3300028563 Bacteria 43934
702 Ga0265319_1003155 3300028563 Bacteria 8684
703 Ga0265319_1004330 3300028563 Bacteria 7048
704 Ga0265334_10000218 3300028573 Bacteria 33090
705 Ga0265334_10002358 3300028573 Bacteria 8890
706 Ga0265334_10012354 3300028573 Bacteria 3590
707 Ga0265334_10015220 3300028573 Bacteria 3199
708 Ga0265318_10000012 3300028577 Bacteria 218292
709 Ga0265318_10000236 3300028577 Bacteria 48002
710 Ga0265318_10000302 3300028577 Bacteria 39987
711 Ga0265318_10005337 3300028577 Bacteria 6045
712 Ga0265318_10008041 3300028577 Bacteria 4721
713 Ga0265318_10008342 3300028577 Bacteria 4619
714 Ga0265318_10026127 3300028577 Bacteria 2301
715 Ga0265323_10000434 3300028653 Bacteria 23913
716 Ga0265323_10010258 3300028653 Bacteria 3802
717 Ga0265322_10008928 3300028654 Bacteria 2915
718 Ga0265336_10000649 3300028666 Bacteria 18964
719 Ga0265336_10003752 3300028666 Bacteria 5876
720 Ga0307517_10000279 3300028786 Bacteria 88025
721 Ga0307515_10000131 3300028794 Bacteria 178919
722 Ga0307515_10018110 3300028794 Bacteria 12780
723 Ga0307515_10105023 3300028794 Bacteria 3367
724 Ga0307515_10140827 3300028794 Bacteria 2588
725 Ga0265338_10000280 3300028800 Bacteria 91942
726 Ga0265338_10001103 3300028800 Bacteria 44947
727 Ga0265338_10004109 3300028800 Bacteria 19938
728 Ga0265338_10017545 3300028800 Bacteria 7710
729 Ga0265338_10028156 3300028800 Bacteria 5613
730 Ga0265338_10060329 3300028800 Bacteria 3334
731 Ga0265324_10000040 3300029957 Bacteria 116473
732 Ga0265324_10000174 3300029957 Bacteria 50027
733 Ga0265324_10000316 3300029957 Bacteria 35472
734 Ga0265324_10010442 3300029957 Bacteria 3579
735 Ga0307511_10054250 3300030521 Bacteria 3163
736 Ga0265760_10002753 3300031090 Bacteria 5144
737 Ga0265330_10000009 3300031235 Bacteria 190785
738 Ga0265330_10000072 3300031235 Bacteria 87680
739 Ga0265330_10000354 3300031235 Bacteria 32334
740 Ga0265330_10017581 3300031235 Bacteria 3290
741 Ga0265330_10037183 3300031235 Bacteria 2168
742 Ga0265332_10000194 3300031238 Bacteria 49527
743 Ga0265332_10002865 3300031238 Bacteria 8529
744 Ga0265332_10003878 3300031238 Bacteria 7142
745 Ga0265332_10005012 3300031238 Bacteria 6154
746 Ga0265332_10020287 3300031238 Bacteria 2934
747 Ga0265328_10001090 3300031239 Bacteria 12455
748 Ga0265328_10003523 3300031239 Bacteria 6902
749 Ga0265328_10009579 3300031239 Bacteria 3939
750 Ga0265328_10024805 3300031239 Bacteria 2262
751 Ga0265320_10000003 3300031240 Bacteria 410153
752 Ga0265320_10000038 3300031240 Bacteria 135648
753 Ga0265320_10002099 3300031240 Bacteria 14024
754 Ga0265320_10002226 3300031240 Bacteria 13596
755 Ga0265320_10009072 3300031240 Bacteria 6032
756 Ga0265320_10015075 3300031240 Bacteria 4377
757 Ga0265320_10018943 3300031240 Bacteria 3775
758 Ga0265325_10008489 3300031241 Bacteria 6058
759 Ga0265325_10016566 3300031241 Bacteria 4118
760 Ga0265329_10000104 3300031242 Bacteria 40556
761 Ga0265329_10000491 3300031242 Bacteria 20514
762 Ga0265329_10000631 3300031242 Bacteria 17989
763 Ga0265329_10005454 3300031242 Bacteria 5139
764 Ga0265329_10007780 3300031242 Bacteria 4114
765 Ga0265329_10010898 3300031242 Bacteria 3324
766 Ga0265329_10032021 3300031242 Bacteria 1705
767 Ga0265340_10000256 3300031247 Bacteria 27740
768 Ga0265340_10003153 3300031247 Bacteria 9350
769 Ga0265340_10005099 3300031247 Bacteria 7310
770 Ga0265340_10005148 3300031247 Bacteria 7271
771 Ga0265340_10005200 3300031247 Bacteria 7228
772 Ga0265340_10009402 3300031247 Bacteria 5248
773 Ga0265340_10012494 3300031247 Bacteria 4483
774 Ga0265340_10014618 3300031247 Bacteria 4095
775 Ga0265339_10000188 3300031249 Bacteria 52215
776 Ga0265339_10000900 3300031249 Bacteria 22829
777 Ga0265339_10001668 3300031249 Bacteria 16396
778 Ga0265339_10004146 3300031249 Bacteria 9978
779 Ga0265339_10004932 3300031249 Bacteria 8991
780 Ga0265339_10010237 3300031249 Bacteria 5836
781 Ga0265339_10010417 3300031249 Bacteria 5776
782 Ga0265339_10016164 3300031249 Bacteria 4455
783 Ga0265331_10000098 3300031250 Bacteria 119302
784 Ga0265331_10000421 3300031250 Bacteria 42955
785 Ga0265331_10000862 3300031250 Bacteria 24653
786 Ga0265331_10002331 3300031250 Bacteria 12915
787 Ga0265331_10002513 3300031250 Bacteria 12372
788 Ga0265331_10010509 3300031250 Bacteria 5119
789 Ga0265331_10016119 3300031250 Bacteria 3930
790 Ga0265331_10034447 3300031250 Bacteria 2498
791 Ga0265327_10000044 3300031251 Bacteria 284808
792 Ga0265327_10000149 3300031251 Bacteria 150385
793 Ga0265316_10000930 3300031344 Bacteria 31824
794 Ga0265316_10000951 3300031344 Bacteria 31569
795 Ga0265316_10001076 3300031344 Bacteria 29533
796 Ga0265316_10009307 3300031344 Bacteria 9050
797 Ga0265316_10012949 3300031344 Bacteria 7444
798 Ga0265316_10026947 3300031344 Bacteria 4770
799 Ga0265316_10031732 3300031344 Bacteria 4317
800 Ga0265316_10041019 3300031344 Bacteria 3708
801 Ga0307513_10088845 3300031456 Bacteria 3157
802 Ga0307513_10111515 3300031456 Bacteria 2728
803 Ga0307513_10115328 3300031456 Bacteria 2669
804 Ga0307509_10025035 3300031507 Bacteria 6671
805 Ga0307408_100000062 3300031548 Bacteria 127855
806 Ga0265313_10000171 3300031595 Bacteria 68612
807 Ga0265313_10000311 3300031595 Bacteria 52824
808 Ga0265313_10000640 3300031595 Bacteria 36071
809 Ga0265313_10000856 3300031595 Bacteria 30671
810 Ga0265313_10009850 3300031595 Bacteria 6149
811 Ga0265313_10010550 3300031595 Bacteria 5826
812 Ga0265313_10012826 3300031595 Bacteria 5085
813 Ga0265313_10014710 3300031595 Bacteria 4606
814 Ga0265313_10018307 3300031595 Bacteria 3938
815 Ga0265313_10044992 3300031595 Bacteria 2151
816 Ga0307508_10001411 3300031616 Bacteria 27053
817 Ga0307508_10005665 3300031616 Bacteria 11840
818 Ga0265314_10000001 3300031711 Bacteria 3792860
819 Ga0265314_10000017 3300031711 Bacteria 340498
820 Ga0265314_10000041 3300031711 Bacteria 218376
821 Ga0265314_10000114 3300031711 Bacteria 124126
822 Ga0265314_10000182 3300031711 Bacteria 92772
823 Ga0265314_10001782 3300031711 Bacteria 23250
824 Ga0265314_10003018 3300031711 Bacteria 16635
825 Ga0265314_10009657 3300031711 Bacteria 8125
826 Ga0265314_10010362 3300031711 Bacteria 7782
827 Ga0265314_10011314 3300031711 Bacteria 7377
828 Ga0265314_10013584 3300031711 Bacteria 6570
829 Ga0265314_10015199 3300031711 Bacteria 6114
830 Ga0265314_10018978 3300031711 Bacteria 5336
831 Ga0265314_10020268 3300031711 Bacteria 5135
832 Ga0265314_10024792 3300031711 Bacteria 4539
833 Ga0265314_10027793 3300031711 Bacteria 4229
834 Ga0265314_10043964 3300031711 Bacteria 3170
835 Ga0265342_10000043 3300031712 Bacteria 137642
836 Ga0265342_10000268 3300031712 Bacteria 58391
837 Ga0265342_10000287 3300031712 Bacteria 57222
838 Ga0265342_10000707 3300031712 Bacteria 34634
839 Ga0265342_10001279 3300031712 Bacteria 23688
840 Ga0265342_10003914 3300031712 Bacteria 11958
841 Ga0265342_10004024 3300031712 Bacteria 11738
842 Ga0265342_10040517 3300031712 Bacteria 2825
843 Ga0265342_10050569 3300031712 Bacteria 2482
844 Ga0265342_10072741 3300031712 Bacteria 2001
845 Ga0307516_10000011 3300031730 Bacteria 224428
846 Ga0307516_10000789 3300031730 Bacteria 43316
847 Ga0307516_10024291 3300031730 Bacteria 6192
848 Ga0307516_10033324 3300031730 Bacteria 5182
849 Ga0307410_10000016 3300031852 Bacteria 72757
850 Ga0307407_10003156 3300031903 Bacteria 6674
851 Ga0307412_10026701 3300031911 Bacteria 3592
852 Ga0307412_10062602 3300031911 Bacteria 2506
853 Ga0307409_100000034 3300031995 Bacteria 48281
854 Ga0307416_100000012 3300032002 Bacteria 296814
855 Ga0307411_10002080 3300032005 Bacteria 8618
856 Ga0307415_100090042 3300032126 Bacteria 2218
857 Ga0307510_10097116 3300033180 Bacteria 2758
858 Ga0373930_0000113 3300034816 Bacteria 8643
859 Ga0373950_0000029 3300034818 Bacteria 165216
860 Ga0373950_0000031 3300034818 Bacteria 162196
861 Ga0373938_0003894 3300034957 Bacteria 2468
862 Ga0373928_0000305 3300035084 Bacteria 9764
863 Ga0373934_0003030 3300035086 Bacteria 6135
864 Ga0373934_0010197 3300035086 Bacteria 3527
865 Ga0373934_0031037 3300035086 Bacteria 2091
866 Ga0373944_0000080 3300035089 Bacteria 16528
867 Ga0373932_0000001 3300035112 Bacteria 1459067
868 Ga0373936_0032142 3300035113 Bacteria 2075
869 Ga0373945_0008060 3300035116 Bacteria 3422
870 Ga0373945_0019037 3300035116 Bacteria 2341
871 Ga0373954_0000084 3300035118 Bacteria 33354
872 Ga0373956_0000384 3300035119 Bacteria 18025
873 Ga0373956_0048116 3300035119 Bacteria 1909
874 Ga0373957_0008762 3300035120 Bacteria 3293
875 Ga0373943_0014882 3300035170 Bacteria 3530
876 Ga0373943_0025979 3300035170 Bacteria 2740
877 Ga0373943_0038440 3300035170 Bacteria 2301
878 Ga0373943_0040553 3300035170 Bacteria 2248
879 Ga0373946_0013817 3300035171 Bacteria 3039
880 Ga0373955_0001982 3300035172 Bacteria 8821
881 Ga0373955_0009166 3300035172 Bacteria 4626
882 Ga0373955_0016122 3300035172 Bacteria 3673
883 Ga0373955_0046149 3300035172 Bacteria 2354
884 Ga0373961_0005234 3300035241 Bacteria 3120
885 Ga0373962_0000013 3300035242 Bacteria 49373
886 Ga0373924_0029572 3300035410 Bacteria 2191
887 Ga0373931_0000002 3300035691 Bacteria 599830
888 Ga0373931_0001597 3300035691 Bacteria 9796
889 Ga0373931_0003800 3300035691 Bacteria 6831
890 Ga0373931_0008056 3300035691 Bacteria 4986
891 Ga0373931_0066644 3300035691 Bacteria 1954
892 Ga0373935_0000244 3300035692 Bacteria 26819
893 Ga0373935_0094939 3300035692 Bacteria 1958
894 Ga0373927_0010602 3300035695 Bacteria 6142
895 Ga0373927_0011775 3300035695 Bacteria 5824
896 Ga0373927_0016320 3300035695 Bacteria 4901
897 Ga0373927_0029296 3300035695 Bacteria 3587
898 Ga0373933_0000576 3300035724 Bacteria 23018
899 Ga0373933_0002444 3300035724 Bacteria 10470
900 Ga0373933_0003599 3300035724 Bacteria 8600
901 Ga0373933_0018992 3300035724 Bacteria 3874
902 Ga0373947_0002144 3300035725 Bacteria 11991
903 Ga0373947_0016812 3300035725 Bacteria 4203
904 Ga0373937_0000995 3300036401 Bacteria 24075
905 Ga0373937_0001469 3300036401 Bacteria 19735
906 Ga0373937_0001753 3300036401 Bacteria 18252
907 Ga0373937_0004952 3300036401 Bacteria 11323
908 Ga0373937_0016403 3300036401 Bacteria 6579
909 Ga0373937_0046678 3300036401 Bacteria 3961
910 Ga0373937_0088807 3300036401 Bacteria 2862
911 Ga0373925_0001674 3300037068 Bacteria 18651
912 Ga0373925_0002323 3300037068 Bacteria 15297
913 Ga0373925_0015046 3300037068 Bacteria 5594
914 Ga0373925_0055603 3300037068 Bacteria 2963
915 Ga0395905_0000250 3300037471 Bacteria 80488
916 Ga0436364_0413488 3300037853 Bacteria 83589
917 Ga0436364_0719430 3300037853 Bacteria 2006
918 Ga0436365_0042250 3300039437 Bacteria 60076
919 Ga0436365_0104564 3300039437 Bacteria 3407
920 Ga0436365_0564112 3300039437 Bacteria 7504
921 Ga0436365_0845153 3300039437 Bacteria 8729
922 Ga0436365_0881693 3300039437 Bacteria 4323
923 Ga0436365_1236739 3300039437 Bacteria 30341
924 Ga0436360_0247830 3300039438 Bacteria 20307
925 Ga0436360_0484380 3300039438 Bacteria 2544
926 Ga0436360_1063097 3300039438 Bacteria 1668
927 Ga0436361_0108686 3300039447 Bacteria 4031
928 Ga0436361_0217304 3300039447 Bacteria 2727
929 Ga0436361_0446852 3300039447 Bacteria 2036
930 Ga0436361_0575778 3300039447 Bacteria 4567
931 Ga0436361_0611093 3300039447 Bacteria 29254
932 Ga0436361_0612836 3300039447 Bacteria 1828
933 Ga0436361_0958358 3300039447 Bacteria 3411
934 Ga0436363_1355831 3300039450 Bacteria 7359
935 Ga0451791_1455622 3300041451 Bacteria 2059
936 Ga0451807_1505972 3300041486 Bacteria 3952
937 Ga0451849_0319247 3300041505 Bacteria 6280
938 Ga0451853_0598287 3300041512 Bacteria 10480
939 Ga0450923_007746 3300042125 Bacteria 1828
940 Ga0466972_0000079 3300044658 Bacteria 90348
941 Ga0466972_0001061 3300044658 Bacteria 13191
942 Ga0466965_0059686 3300044683 Bacteria 1904
943 Ga0466966_0000191 3300044684 Bacteria 40906
944 Ga0466961_0000005 3300044693 Bacteria 173105
945 Ga0466963_0070364 3300044694 Bacteria 2353
946 Ga0453684_0325867 3300044712 Bacteria 1738
947 Ga0466971_0000119 3300044719 Bacteria 28517
948 Ga0466968_0007887 3300044735 Bacteria 4063
949 Ga0466957_0013977 3300044842 Bacteria 4668
950 Ga0466960_0015116 3300044901 Bacteria 3323
951 Ga0466959_0003302 3300045049 Bacteria 10526
952 Ga0451576_0067703 3300045051 Bacteria 3717
953 Ga0451576_0113605 3300045051 Bacteria 2819
954 Ga0466967_0038848 3300045976 Bacteria 4086
955 Ga0466967_0179592 3300045976 Bacteria 1996
956 Ga0495592_0010499 3300046454 Bacteria 6984
957 Ga0495603_0000370 3300046455 Bacteria 24383
958 Ga0495603_0040388 3300046455 Bacteria 2793
959 Ga0495629_0001947 3300046459 Bacteria 16090
960 Ga0495629_0006802 3300046459 Bacteria 8455
961 Ga0495629_0111724 3300046459 Bacteria 1905
962 Ga0495638_0089584 3300046460 Bacteria 1855
963 Ga0495651_0001194 3300046462 Bacteria 20074
964 Ga0495651_0015545 3300046462 Bacteria 5889
965 Ga0495651_0027951 3300046462 Bacteria 4396
966 Ga0495653_0000561 3300046463 Bacteria 28449
967 Ga0495653_0102510 3300046463 Bacteria 2071
968 Ga0495580_0000435 3300046472 Bacteria 34468
969 Ga0495580_0109327 3300046472 Bacteria 1919
970 Ga0495582_0000051 3300046473 Bacteria 59010
971 Ga0495582_0041625 3300046473 Bacteria 2531
972 Ga0495639_0000010 3300046475 Bacteria 93685
973 Ga0495639_0010168 3300046475 Bacteria 4047
974 Ga0495662_0000097 3300046476 Bacteria 31889
975 Ga0495662_0045247 3300046476 Bacteria 2125
976 Ga0495664_0035009 3300046477 Bacteria 2955
977 Ga0495664_0035191 3300046477 Bacteria 2948
978 Ga0495664_0036563 3300046477 Bacteria 2895
979 Ga0495664_0074586 3300046477 Bacteria 2030
980 Ga0495594_0001553 3300046499 Bacteria 11928
981 Ga0495583_0032548 3300046506 Bacteria 2516
982 Ga0495606_0000265 3300046507 Bacteria 92526
983 Ga0495608_0026124 3300046511 Bacteria 3983
984 Ga0495608_0026417 3300046511 Bacteria 3958
985 Ga0495628_0056667 3300046516 Bacteria 3084
986 Ga0495628_0084694 3300046516 Bacteria 2460
987 Ga0495630_0000173 3300046517 Bacteria 50167
988 Ga0495630_0010293 3300046517 Bacteria 6748
989 Ga0495630_0019164 3300046517 Bacteria 5028
990 Ga0495630_0040664 3300046517 Bacteria 3475
991 Ga0495632_0013474 3300046519 Bacteria 4666
992 Ga0495637_0023505 3300046520 Bacteria 2800
993 Ga0495643_0000852 3300046522 Bacteria 32898
994 Ga0495643_0006134 3300046522 Bacteria 7986
995 Ga0495648_0002889 3300046524 Bacteria 15455
996 Ga0495663_0010022 3300046525 Bacteria 2630
997 Ga0495652_0003743 3300046529 Bacteria 14879
998 Ga0495652_0005002 3300046529 Bacteria 12557
999 Ga0495652_0007836 3300046529 Bacteria 9808
1000 Ga0495652_0044462 3300046529 Bacteria 3824
1001 Ga0495652_0044898 3300046529 Bacteria 3803
1002 Ga0495654_0005844 3300046530 Bacteria 7081
1003 Ga0495665_0000005 3300046531 Bacteria 86491
1004 Ga0495640_0000301 3300046533 Bacteria 33996
1005 Ga0495640_0008933 3300046533 Bacteria 7826
1006 Ga0495640_0031720 3300046533 Bacteria 3769
1007 Ga0495640_0066899 3300046533 Bacteria 2422
1008 Ga0495587_0000608 3300046536 Bacteria 24349
1009 Ga0495587_0019048 3300046536 Bacteria 4252
1010 Ga0495597_0000634 3300046542 Bacteria 28662
1011 Ga0495645_0010535 3300046543 Bacteria 6485
1012 Ga0495645_0043804 3300046543 Bacteria 3265
1013 Ga0495622_0003164 3300046557 Bacteria 7794
1014 Ga0495622_0004381 3300046557 Bacteria 6572
1015 Ga0495622_0011078 3300046557 Bacteria 4162
1016 Ga0495622_0025083 3300046557 Bacteria 2785
1017 Ga0495667_0010607 3300046559 Bacteria 6233
1018 Ga0495667_0031389 3300046559 Bacteria 3567
1019 Ga0495656_0001420 3300046615 Bacteria 7836
1020 Ga0495668_0003522 3300046616 Bacteria 11660
1021 Ga0495668_0040899 3300046616 Bacteria 2584
1022 Ga0495634_0000878 3300046642 Bacteria 28888
1023 Ga0495634_0001496 3300046642 Bacteria 20684
1024 Ga0495634_0067650 3300046642 Bacteria 2362
1025 Ga0495634_0082617 3300046642 Bacteria 2098
1026 Ga0495625_0046431 3300046660 Bacteria 3135
1027 Ga0495625_0101638 3300046660 Bacteria 1974
1028 Ga0495635_0000259 3300046663 Bacteria 33960
1029 Ga0495635_0001844 3300046663 Bacteria 14340
1030 Ga0495635_0004612 3300046663 Bacteria 9560
1031 Ga0495635_0092383 3300046663 Bacteria 2069
1032 Ga0495657_0011319 3300046675 Bacteria 6675
1033 Ga0495657_0011893 3300046675 Bacteria 6485
1034 Ga0495657_0019856 3300046675 Bacteria 4843
1035 Ga0495599_0003115 3300046678 Bacteria 9661
1036 Ga0495623_0002010 3300046679 Bacteria 13656
1037 Ga0495623_0007161 3300046679 Bacteria 7243
1038 Ga0495646_0015040 3300046680 Bacteria 4915
1039 Ga0495646_0033661 3300046680 Bacteria 3186
1040 Ga0495658_0050687 3300046683 Bacteria 2349
1041 Ga0495613_0001985 3300046689 Bacteria 15542
1042 Ga0495613_0002444 3300046689 Bacteria 14016
1043 Ga0495613_0004516 3300046689 Bacteria 10436
1044 Ga0495613_0030462 3300046689 Bacteria 4008
1045 Ga0495613_0056067 3300046689 Bacteria 2894
1046 Ga0495613_0065381 3300046689 Bacteria 2658
1047 Ga0495613_0076425 3300046689 Bacteria 2437
1048 Ga0495624_0000094 3300046690 Bacteria 59911
1049 Ga0495624_0009667 3300046690 Bacteria 6677
1050 Ga0495670_0010707 3300046691 Bacteria 4507
1051 Ga0495670_0017241 3300046691 Bacteria 3554
1052 Ga0495649_0004358 3300046694 Bacteria 9269
1053 Ga0495649_0036990 3300046694 Bacteria 2681
1054 Ga0495600_0001094 3300046809 Bacteria 14750
1055 Ga0495600_0001399 3300046809 Bacteria 13307
1056 Ga0495600_0006454 3300046809 Bacteria 7142
1057 Ga0495600_0007977 3300046809 Bacteria 6486
1058 Ga0495581_0000810 3300047315 Bacteria 16618
1059 Ga0495581_0036014 3300047315 Bacteria 2863
1060 Ga0495581_0039280 3300047315 Bacteria 2740
1061 Ga0495581_0050468 3300047315 Bacteria 2403
1062 Ga0495604_0003631 3300047317 Bacteria 12306
1063 Ga0495604_0005082 3300047317 Bacteria 10416
1064 Ga0495604_0006658 3300047317 Bacteria 9154
1065 Ga0495604_0055520 3300047317 Bacteria 3052
1066 Ga0495674_0000955 3300047319 Bacteria 27621
1067 Ga0495674_0001687 3300047319 Bacteria 21689
1068 Ga0495674_0006393 3300047319 Bacteria 11295
1069 Ga0495674_0010503 3300047319 Bacteria 8763
1070 Ga0495674_0014488 3300047319 Bacteria 7379
1071 Ga0495674_0067571 3300047319 Bacteria 3096
1072 Ga0495676_0083113 3300047321 Bacteria 2421
1073 Ga0495680_0000539 3300047322 Bacteria 42513
1074 Ga0495680_0002965 3300047322 Bacteria 16974
1075 Ga0495680_0038000 3300047322 Bacteria 3851
1076 Ga0495687_002007 3300047443 Bacteria 17252
1077 Ga0495687_002640 3300047443 Bacteria 14021
1078 Ga0495675_0008558 3300047444 Bacteria 6342
1079 Ga0495675_0011659 3300047444 Bacteria 5519
1080 Ga0495675_0061202 3300047444 Bacteria 2385
1081 Ga0495675_0066824 3300047444 Bacteria 2272
1082 Ga0495684_0000266 3300047471 Bacteria 41618
1083 Ga0495684_0000777 3300047471 Bacteria 25850
1084 Ga0495684_0002819 3300047471 Bacteria 13707
1085 Ga0495684_0005641 3300047471 Bacteria 9751
1086 Ga0495684_0056485 3300047471 Bacteria 2993
1087 Ga0495684_0127518 3300047471 Bacteria 1913
1088 Ga0495593_0002656 3300047673 Bacteria 10746
1089 Ga0495602_0001871 3300048088 Bacteria 21055
1090 Ga0495602_0012527 3300048088 Bacteria 8709
1091 Ga0496100_0041917 3300048903 Bacteria 2921
1092 Ga0496100_0049080 3300048903 Bacteria 2727
1093 Ga0496100_0084153 3300048903 Bacteria 2156
1094 Ga0496101_0110773 3300048904 Bacteria 2066
1095 Ga0496101_0136165 3300048904 Bacteria 1869
1096 Ga0496102_0018812 3300048905 Bacteria 6076
1097 Ga0496102_0096574 3300048905 Bacteria 2740
1098 Ga0496102_0109610 3300048905 Bacteria 2573
1099 Ga0496102_0133002 3300048905 Bacteria 2329
1100 Ga0496102_0136501 3300048905 Bacteria 2298
1101 Ga0496102_0142432 3300048905 Bacteria 2248
1102 Ga0496103_0012210 3300048906 Bacteria 5100
1103 Ga0496103_0012379 3300048906 Bacteria 5059
1104 Ga0496103_0039593 3300048906 Bacteria 2897
1105 Ga0496104_0000631 3300048907 Bacteria 30188
1106 Ga0496104_0003007 3300048907 Bacteria 14514
1107 Ga0496104_0031837 3300048907 Bacteria 4907
1108 Ga0496104_0044499 3300048907 Bacteria 4171
1109 Ga0496104_0071264 3300048907 Bacteria 3304
1110 Ga0496104_0082259 3300048907 Bacteria 3070
1111 Ga0496104_0151797 3300048907 Bacteria 2223
1112 Ga0496105_0002656 3300048908 Bacteria 13019
1113 Ga0496105_0027040 3300048908 Bacteria 4682
1114 Ga0496105_0034147 3300048908 Bacteria 4182
1115 Ga0496105_0038381 3300048908 Bacteria 3945
1116 Ga0496105_0048946 3300048908 Bacteria 3489
1117 Ga0496106_0006585 3300048909 Bacteria 8601
1118 Ga0496106_0014414 3300048909 Bacteria 5840
1119 Ga0496108_0000401 3300048911 Bacteria 35822
1120 Ga0496108_0026218 3300048911 Bacteria 4806
1121 Ga0496108_0049073 3300048911 Bacteria 3530
1122 Ga0496109_0006972 3300048912 Bacteria 9537
1123 Ga0496109_0008941 3300048912 Bacteria 8533
1124 Ga0496109_0011092 3300048912 Bacteria 7726
1125 Ga0496109_0040813 3300048912 Bacteria 4203
1126 Ga0496109_0070516 3300048912 Bacteria 3207
1127 Ga0496109_0128691 3300048912 Bacteria 2362
1128 Ga0496109_0170958 3300048912 Bacteria 2039
1129 Ga0496110_0003071 3300048913 Bacteria 12658
1130 Ga0496110_0003215 3300048913 Bacteria 12440
1131 Ga0496110_0092088 3300048913 Bacteria 2712
1132 Ga0496110_0092134 3300048913 Bacteria 2711
1133 Ga0496110_0100818 3300048913 Bacteria 2588
1134 Ga0496110_0114993 3300048913 Bacteria 2421
1135 Ga0496110_0120056 3300048913 Bacteria 2368
1136 Ga0496111_0006918 3300048914 Bacteria 7403
1137 Ga0496111_0032125 3300048914 Bacteria 3742
1138 Ga0496111_0044181 3300048914 Bacteria 3202
1139 Ga0496111_0044978 3300048914 Bacteria 3175
1140 Ga0496111_0081028 3300048914 Bacteria 2369
1141 Ga0496111_0101648 3300048914 Bacteria 2112
1142 Ga0496112_0000019 3300048915 Bacteria 185531
1143 Ga0496112_0006000 3300048915 Bacteria 10602
1144 Ga0496112_0010357 3300048915 Bacteria 8455
1145 Ga0496112_0072708 3300048915 Bacteria 3399
1146 Ga0496112_0108981 3300048915 Bacteria 2740
1147 Ga0496113_0000120 3300048916 Bacteria 33811
1148 Ga0496113_0002345 3300048916 Bacteria 10957
1149 Ga0496113_0007321 3300048916 Bacteria 7086
1150 Ga0496113_0032298 3300048916 Bacteria 3805
1151 Ga0496113_0072022 3300048916 Bacteria 2629
1152 Ga0496114_0001911 3300048917 Bacteria 15861
1153 Ga0496114_0003558 3300048917 Bacteria 11964
1154 Ga0496114_0009131 3300048917 Bacteria 7861
1155 Ga0496114_0049882 3300048917 Bacteria 3483
1156 Ga0496114_0119094 3300048917 Bacteria 2269
1157 Ga0496114_0133596 3300048917 Bacteria 2145
1158 Ga0496114_0144437 3300048917 Bacteria 2062
1159 Ga0496115_0014571 3300048918 Bacteria 5952
1160 Ga0496115_0019418 3300048918 Bacteria 5229
1161 Ga0496115_0065605 3300048918 Bacteria 2932
1162 Ga0496116_0004642 3300048919 Bacteria 13010
1163 Ga0496116_0017333 3300048919 Bacteria 5593
1164 Ga0496117_0028571 3300048920 Bacteria 4316
1165 Ga0496117_0029077 3300048920 Bacteria 4267
1166 Ga0496117_0057840 3300048920 Bacteria 2689
1167 Ga0496118_0004973 3300048921 Bacteria 15376
1168 Ga0496118_0008432 3300048921 Bacteria 10656
1169 Ga0496118_0010334 3300048921 Bacteria 9254
1170 Ga0496118_0018408 3300048921 Bacteria 6305
1171 Ga0496118_0035458 3300048921 Bacteria 4050
1172 Ga0496119_0000597 3300048922 Bacteria 48924
1173 Ga0496119_0012249 3300048922 Bacteria 6991
1174 Ga0496119_0029020 3300048922 Bacteria 3762
1175 Ga0496119_0053880 3300048922 Bacteria 2453
1176 Ga0496120_0040547 3300048923 Bacteria 2735
1177 Ga0496121_0000089 3300048924 Bacteria 219007
1178 Ga0496121_0000627 3300048924 Bacteria 65883
1179 Ga0496121_0002110 3300048924 Bacteria 31261
1180 Ga0496121_0002541 3300048924 Bacteria 27654
1181 Ga0496121_0005680 3300048924 Bacteria 15870
1182 Ga0496121_0009971 3300048924 Bacteria 10803
1183 Ga0496121_0010787 3300048924 Bacteria 10240
1184 Ga0496122_0001337 3300048925 Bacteria 40284
1185 Ga0496122_0068513 3300048925 Bacteria 2547
1186 Ga0496123_0001933 3300048926 Bacteria 27009
1187 Ga0496123_0014430 3300048926 Bacteria 6550
1188 Ga0496124_0004464 3300048927 Bacteria 16323
1189 Ga0496124_0135883 3300048927 Bacteria 1947
1190 Ga0496124_0150981 3300048927 Bacteria 1822
1191 Ga0496125_0000048 3300048928 Bacteria 290651
1192 Ga0496125_0008939 3300048928 Bacteria 10399
1193 Ga0496125_0051025 3300048928 Bacteria 3416
1194 Ga0496125_0061560 3300048928 Bacteria 3009
1195 Ga0496126_0001629 3300048929 Bacteria 33942
1196 Ga0496126_0002122 3300048929 Bacteria 27701
1197 Ga0496126_0005869 3300048929 Bacteria 13853
1198 Ga0496126_0035854 3300048929 Bacteria 4643
1199 Ga0496126_0052410 3300048929 Bacteria 3708
1200 Ga0496126_0058324 3300048929 Bacteria 3480
1201 Ga0496126_0070800 3300048929 Bacteria 3106
1202 Ga0496126_0102048 3300048929 Bacteria 2508
1203 Ga0496126_0104168 3300048929 Bacteria 2479
1204 Ga0501292_000003 3300049515 Bacteria 161908
1205 Ga0501294_000016 3300049517 Bacteria 18550
1206 Ga0501031_0004751 3300049568 Bacteria 8822
1207 Ga0501033_0000083 3300049570 Bacteria 89452
1208 Ga0501034_0000019 3300049571 Bacteria 282405
1209 Ga0501034_0114472 3300049571 Bacteria 2685
1210 Ga0501036_0011075 3300049572 Bacteria 7458
1211 Ga0501036_0023857 3300049572 Bacteria 5155
1212 Ga0501037_0000083 3300049573 Bacteria 86322
1213 Ga0501039_0157282 3300049575 Bacteria 1786
1214 Ga0501040_0062497 3300049576 Bacteria 2562
1215 Ga0501043_0000195 3300049579 Bacteria 55394
1216 Ga0501043_0001626 3300049579 Bacteria 19542
1217 Ga0501043_0032309 3300049579 Bacteria 4115
1218 Ga0501046_0001737 3300049580 Bacteria 20771
1219 Ga0501047_0000007 3300049581 Bacteria 443240
1220 Ga0501047_0001199 3300049581 Bacteria 25679
1221 Ga0501047_0001255 3300049581 Bacteria 25105
1222 Ga0501048_0000943 3300049582 Bacteria 21492
1223 Ga0501067_0000087 3300049583 Bacteria 53713
1224 Ga0501067_0006889 3300049583 Bacteria 6306
1225 Ga0501067_0010606 3300049583 Bacteria 5099
1226 Ga0501067_0023980 3300049583 Bacteria 3383
1227 Ga0501068_0000120 3300049584 Bacteria 34509
1228 Ga0501068_0002120 3300049584 Bacteria 10584
1229 Ga0501068_0006369 3300049584 Bacteria 6505
1230 Ga0501070_0000083 3300049586 Bacteria 80820
1231 Ga0501070_0000884 3300049586 Bacteria 27205
1232 Ga0501070_0002364 3300049586 Bacteria 16541
1233 Ga0501071_0084639 3300049587 Bacteria 2325
1234 Ga0501072_0000008 3300049588 Bacteria 216818
1235 Ga0501072_0000026 3300049588 Bacteria 140606
1236 Ga0501072_0045773 3300049588 Bacteria 3441
1237 Ga0501073_0000273 3300049589 Bacteria 34201
1238 Ga0501073_0000740 3300049589 Bacteria 23114
1239 Ga0501073_0001487 3300049589 Bacteria 17375
1240 Ga0501073_0016789 3300049589 Bacteria 5303
1241 Ga0501073_0018397 3300049589 Bacteria 5049
1242 Ga0501073_0055969 3300049589 Bacteria 2759
1243 Ga0501073_0073838 3300049589 Bacteria 2374
1244 Ga0501074_0002872 3300049590 Bacteria 12069
1245 Ga0501074_0031011 3300049590 Bacteria 3873
1246 Ga0501222_000150 3300049662 Bacteria 14309
1247 Ga0501223_000241 3300049663 Bacteria 13964
1248 Ga0501259_001070 3300049688 Bacteria 4572
1249 Ga0501261_000007 3300049690 Bacteria 60773
1250 Ga0501079_0000166 3300049741 Bacteria 36526
1251 Ga0501079_0011888 3300049741 Bacteria 6642
1252 Ga0501080_0004571 3300049742 Bacteria 12338
1253 Ga0501080_0005109 3300049742 Bacteria 11689
1254 Ga0501080_0014877 3300049742 Bacteria 7164
1255 Ga0501080_0028749 3300049742 Bacteria 5175
1256 Ga0501080_0043578 3300049742 Bacteria 4178
1257 Ga0501083_0003843 3300049744 Bacteria 10546
1258 Ga0501083_0023744 3300049744 Bacteria 4252
1259 Ga0501083_0045137 3300049744 Bacteria 2981
1260 Ga0501083_0065733 3300049744 Bacteria 2416
1261 Ga0501279_000009 3300049775 Bacteria 117146
1262 Ga0501280_000022 3300049776 Bacteria 51958
1263 Ga0501281_00089 3300049777 Bacteria 10755
1264 Ga0501282_000069 3300049778 Bacteria 12604
1265 Ga0501035_0000001 3300049822 Bacteria 1037138
1266 Ga0501044_0000159 3300049823 Bacteria 83639
1267 Ga0501044_0022678 3300049823 Bacteria 6685
1268 Ga0501044_0225016 3300049823 Bacteria 1826
1269 nmdc:mga03683_233_c1 3300050489 Bacteria 17402
1270 nmdc:mga03683_3_c1 3300050489 Bacteria 285872
1271 nmdc:mga03n38_1577_c1 3300050490 Bacteria 6628
1272 nmdc:mga00v17_14448_c1 3300050491 Bacteria 4406
1273 nmdc:mga00v17_15664_c1 3300050491 Bacteria 4259
1274 nmdc:mga00v17_21920_c1 3300050491 Bacteria 3680
1275 nmdc:mga0yw44_108142_c1 3300050492 Bacteria 1779
1276 nmdc:mga0yw44_19556_c1 3300050492 Bacteria 3737
1277 nmdc:mga0yw44_55460_c1 3300050492 Bacteria 2411
1278 nmdc:mga0k408_26576_c1 3300050493 Bacteria 3282
1279 nmdc:mga0k408_2_c1 3300050493 Bacteria 395671
1280 nmdc:mga0k408_81667_c1 3300050493 Bacteria 1893
1281 nmdc:mga06z11_13397_c1 3300050494 Bacteria 3600
1282 nmdc:mga06z11_1483_c1 3300050494 Bacteria 8709
1283 nmdc:mga06z11_16446_c1 3300050494 Bacteria 3333
1284 nmdc:mga04h51_77_c1 3300050495 Bacteria 31782
1285 nmdc:mga07m45_163_c1 3300050496 Bacteria 26703
1286 nmdc:mga07m45_22_c1 3300050496 Bacteria 117399
1287 nmdc:mga07m45_6319_c1 3300050496 Bacteria 4931
1288 nmdc:mga05p37_25169_c1 3300050507 Bacteria 7238
1289 nmdc:mga0qj67_235_c1 3300050509 Bacteria 37732
1290 nmdc:mga08y16_108426_c1 3300050511 Bacteria 2891
1291 nmdc:mga08y16_12581_c1 3300050511 Bacteria 8903
1292 nmdc:mga08y16_29163_c1 3300050511 Bacteria 5815
1293 nmdc:mga08y16_40831_c1 3300050511 Bacteria 4861
1294 nmdc:mga08y16_87533_c1 3300050511 Bacteria 3246
1295 nmdc:mga0n895_38751_c1 3300050512 Bacteria 4619
1296 nmdc:mga0n895_7400_c1 3300050512 Bacteria 9421
1297 nmdc:mga0rr50_37882_c1 3300050513 Bacteria 3484
1298 nmdc:mga0a205_8462_c1 3300050515 Bacteria 9363
1299 nmdc:mga0sz30_162_c1 3300050516 Bacteria 24511
1300 nmdc:mga0sz30_2049_c1 3300050516 Bacteria 5539
1301 Ga0495601_0014613 3300053077 Bacteria 4733
1302 Ga0495612_0004149 3300053078 Bacteria 6003
1303 Ga0500610_0039973 3300053079 Bacteria 2423
1304 Ga0500635_0000045 3300053080 Bacteria 87314
1305 Ga0495595_0000250 3300053084 Bacteria 21281
1306 Ga0495595_0008027 3300053084 Bacteria 4325
1307 Ga0495619_0002268 3300053085 Bacteria 12701
1308 Ga0495619_0024706 3300053085 Bacteria 3855
1309 Ga0495619_0038523 3300053085 Bacteria 3118
1310 Ga0495619_0082652 3300053085 Bacteria 2165
1311 Ga0500643_000150 3300053087 Bacteria 71016
1312 Ga0500643_000544 3300053087 Bacteria 26284
1313 Ga0500643_010091 3300053087 Bacteria 3546
1314 Ga0500644_0000897 3300053088 Bacteria 9589
1315 Ga0500651_0001180 3300053093 Bacteria 12952
1316 Ga0500651_0006247 3300053093 Bacteria 6856
1317 Ga0500566_0000011 3300053094 Bacteria 118644
1318 Ga0500566_0000144 3300053094 Bacteria 36317
1319 Ga0500566_0000412 3300053094 Bacteria 23818
1320 Ga0500641_0008960 3300053096 Bacteria 3586
1321 Ga0500641_0042066 3300053096 Bacteria 1850
1322 Ga0500650_0065374 3300053098 Bacteria 1699
1323 Ga0500554_003790 3300053102 Bacteria 3130
1324 Ga0500556_0000306 3300053104 Bacteria 37363
1325 Ga0500556_0000879 3300053104 Bacteria 16883
1326 Ga0500557_000025 3300053105 Bacteria 84884
1327 Ga0500569_000575 3300053109 Bacteria 6187
1328 Ga0500569_001093 3300053109 Bacteria 4957
1329 Ga0500572_000065 3300053111 Bacteria 32713
1330 Ga0500572_001006 3300053111 Bacteria 8512
1331 Ga0500592_000056 3300053116 Bacteria 31914
1332 Ga0500592_002419 3300053116 Bacteria 3011
1333 Ga0500595_000006 3300053119 Bacteria 300857
1334 Ga0500595_000364 3300053119 Bacteria 29229
1335 Ga0500595_003806 3300053119 Bacteria 6938
1336 Ga0500595_007204 3300053119 Bacteria 4634
1337 Ga0500595_008317 3300053119 Bacteria 4246
1338 Ga0500607_000006 3300053121 Bacteria 136863
1339 Ga0500607_000573 3300053121 Bacteria 35378
1340 Ga0500608_005329 3300053122 Bacteria 5097
1341 Ga0500614_002633 3300053123 Bacteria 3974
1342 Ga0500642_0000017 3300053130 Bacteria 167670
1343 Ga0500642_0000127 3300053130 Bacteria 34341
1344 Ga0500642_0021316 3300053130 Bacteria 2564
1345 Ga0500652_000168 3300053131 Bacteria 25261
1346 Ga0500652_000454 3300053131 Bacteria 14537
1347 Ga0500655_000017 3300053133 Bacteria 46539
1348 Ga0500559_0001342 3300053136 Bacteria 14123
1349 Ga0500559_0001551 3300053136 Bacteria 12857
1350 Ga0500559_0001798 3300053136 Bacteria 11758
1351 Ga0500559_0023050 3300053136 Bacteria 2642
1352 Ga0500568_0003553 3300053139 Bacteria 8628
1353 Ga0500568_0038550 3300053139 Bacteria 1934
1354 Ga0500577_0000563 3300053142 Bacteria 9566
1355 Ga0500590_004244 3300053148 Bacteria 6737
1356 Ga0500603_000269 3300053150 Bacteria 13789
1357 Ga0500603_000319 3300053150 Bacteria 12617
1358 Ga0500604_0004004 3300053151 Bacteria 3933
1359 Ga0500616_0000001 3300053153 Bacteria 1986011
1360 Ga0500616_0000118 3300053153 Bacteria 143496
1361 Ga0500616_0006394 3300053153 Bacteria 7723
1362 Ga0500616_0007796 3300053153 Bacteria 6750
1363 Ga0500622_0000315 3300053156 Bacteria 49087
1364 Ga0500622_0003396 3300053156 Bacteria 10710
1365 Ga0500624_000184 3300053157 Bacteria 24693
1366 Ga0500627_0001052 3300053158 Bacteria 7519
1367 Ga0500627_0006100 3300053158 Bacteria 4072
1368 Ga0500630_000832 3300053159 Bacteria 14267
1369 Ga0500634_0043227 3300053161 Bacteria 2443
1370 Ga0500638_000081 3300053162 Bacteria 17034
1371 Ga0500639_000079 3300053163 Bacteria 45631
1372 Ga0500636_0000041 3300053177 Bacteria 69687
1373 Ga0500636_0000720 3300053177 Bacteria 17792
1374 Ga0500636_0000970 3300053177 Bacteria 15430
1375 Ga0500636_0002589 3300053177 Bacteria 10039
1376 Ga0500636_0007376 3300053177 Bacteria 6359
1377 Ga0500636_0011668 3300053177 Bacteria 5143
1378 Ga0500636_0042972 3300053177 Bacteria 2670
1379 Ga0500636_0070189 3300053177 Bacteria 2033
1380 Ga0500637_0001657 3300053178 Bacteria 9584
1381 Ga0500637_0002424 3300053178 Bacteria 8296
1382 Ga0500570_026039 3300053724 Bacteria 3210
1383 Ga0500576_001460 3300053725 Bacteria 7974
1384 Ga0500625_002974 3300053729 Bacteria 6540
1385 Ga0500625_009276 3300053729 Bacteria 4382
1386 Ga0500645_000106 3300053730 Bacteria 67066
1387 Ga0500645_006021 3300053730 Bacteria 4378
1388 Ga0500645_006831 3300053730 Bacteria 4033
1389 Ga0500645_009789 3300053730 Bacteria 3206
1390 Ga0500596_000987 3300053735 Bacteria 5689
1391 Ga0500596_002181 3300053735 Bacteria 3879
1392 Ga0500601_000306 3300053737 Bacteria 9164
1393 Ga0501084_0000005 3300054114 Bacteria 237244
1394 Ga0501084_0000021 3300054114 Bacteria 146118
1395 Ga0500661_001337 3300055283 Bacteria 4597
1396 Ga0501082_0000171 3300060353 Bacteria 56020
1397 Ga0501082_0000615 3300060353 Bacteria 31401
1398 Ga0501082_0002259 3300060353 Bacteria 16870
1399 Ga0501082_0045105 3300060353 Bacteria 3802
1400 Ga0466962_0000006 3300061719 Bacteria 168917

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014326 Ga0157380_10236974 Ga0157380_102369741 418
2 3300027907 Ga0207428_10061807 Ga0207428_100618072 443
3 3300045976 Ga0466967_0038848 Ga0466967_0038848_21_1442 452
4 3300025925 Ga0207650_10130277 Ga0207650_101302772 453
5 3300049744 Ga0501083_0065733 Ga0501083_0065733_895_2406 455
6 3300047319 Ga0495674_0067571 Ga0495674_0067571_1642_3075 457
7 3300035113 Ga0373936_0032142 Ga0373936_0032142_661_2058 460
8 3300047471 Ga0495684_0127518 Ga0495684_0127518_17_1477 462
9 3300049590 Ga0501074_0031011 Ga0501074_0031011_2434_3849 462
10 3300049744 Ga0501083_0003843 Ga0501083_0003843_12_1427 462
11 3300048903 Ga0496100_0084153 Ga0496100_0084153_728_2140 463
12 3300035172 Ga0373955_0046149 Ga0373955_0046149_14_1519 465
13 3300044658 Ga0466972_0001061 Ga0466972_0001061_9372_11021 467
14 3300044735 Ga0466968_0007887 Ga0466968_0007887_131_1780 467
15 3300048905 Ga0496102_0136501 Ga0496102_0136501_363_2021 467
16 3300028563 Ga0265319_1004330 Ga0265319_10043305 468
17 3300048914 Ga0496111_0101648 Ga0496111_0101648_12_1472 468
18 3300025304 Ga0209257_1011618 Ga0209257_10116183 469
19 3300025315 Ga0207697_10044170 Ga0207697_100441702 469
20 3300053087 Ga0500643_000150 Ga0500643_000150_59538_61187 469
21 3300053153 Ga0500616_0000001 Ga0500616_0000001_391951_393459 469
22 iso_pu_bacteria 8019619141 8019620031 469
23 3300005436 Ga0070713_100007472 Ga0070713_1000074723 470
24 3300006028 Ga0070717_10131083 Ga0070717_101310832 470
25 3300005616 Ga0068852_100039558 Ga0068852_1000395582 471
26 3300006038 Ga0075365_10025507 Ga0075365_100255072 473
27 3300007788 Ga0099795_10009280 Ga0099795_100092802 473
28 3300050492 nmdc:mga0yw44_19556_c1 nmdc:mga0yw44_19556_c1_1401_2990 473
29 3300005983 Ga0081540_1030478 Ga0081540_10304783 474
30 3300039447 Ga0436361_0612836 Ga0436361_0612836_102_1655 477
31 3300028577 Ga0265318_10026127 Ga0265318_100261272 480
32 3300046680 Ga0495646_0033661 Ga0495646_0033661_1371_3017 480
33 3300026121 Ga0207683_10015557 Ga0207683_100155572 481
34 iso_pu_bacteria 8019638758 8019646828 481
35 3300048927 Ga0496124_0150981 Ga0496124_0150981_173_1744 482
36 3300049571 Ga0501034_0114472 Ga0501034_0114472_825_2486 482
37 3300003215 JGI25153J46596_10013376 JGI25153J46596_100133762 483
38 3300009094 Ga0111539_10043837 Ga0111539_100438372 483
39 3300025230 Ga0209563_100325 Ga0209563_1003257 483
40 3300025253 Ga0209677_102346 Ga0209677_1023463 483
41 3300025297 Ga0209758_1008838 Ga0209758_10088386 483
42 3300050511 nmdc:mga08y16_29163_c1 nmdc:mga08y16_29163_c1_2206_3798 483
43 3300053094 Ga0500566_0000412 Ga0500566_0000412_17880_19532 483
44 3300005262 Ga0065165_1000747 Ga0065165_100074712 484
45 3300025261 Ga0209233_1002110 Ga0209233_10021104 484
46 3300048908 Ga0496105_0038381 Ga0496105_0038381_1418_3085 484
47 3300005937 Ga0081455_10001999 Ga0081455_100019992 486
48 3300049576 Ga0501040_0062497 Ga0501040_0062497_38_1570 486
49 3300037471 Ga0395905_0000250 Ga0395905_0000250_20350_21945 488
50 3300009093 Ga0105240_10004238 Ga0105240_1000423811 489
51 3300009545 Ga0105237_10000940 Ga0105237_100009402 489
52 3300025913 Ga0207695_10005277 Ga0207695_1000527710 489
53 3300025914 Ga0207671_10001251 Ga0207671_100012515 489
54 3300026116 Ga0207674_10167142 Ga0207674_101671421 489
55 3300031240 Ga0265320_10015075 Ga0265320_100150751 489
56 3300031595 Ga0265313_10009850 Ga0265313_100098505 489
57 3300031712 Ga0265342_10072741 Ga0265342_100727412 489
58 3300046463 Ga0495653_0102510 Ga0495653_0102510_150_1751 489
59 3300046516 Ga0495628_0056667 Ga0495628_0056667_674_2275 489
60 3300046517 Ga0495630_0000173 Ga0495630_0000173_31396_32997 489
61 3300046690 Ga0495624_0009667 Ga0495624_0009667_3282_4883 489
62 3300047471 Ga0495684_0000266 Ga0495684_0000266_16505_18106 489
63 3300025936 Ga0207670_10026740 Ga0207670_100267402 490
64 3300028573 Ga0265334_10015220 Ga0265334_100152202 490
65 3300048913 Ga0496110_0114993 Ga0496110_0114993_917_2410 490
66 3300031344 Ga0265316_10026947 Ga0265316_100269471 491
67 3300031456 Ga0307513_10111515 Ga0307513_101115151 491
68 3300048904 Ga0496101_0136165 Ga0496101_0136165_22_1587 491
69 3300005455 Ga0070663_100074836 Ga0070663_1000748362 492
70 3300007076 Ga0075435_100006360 Ga0075435_1000063607 492
71 3300028794 Ga0307515_10105023 Ga0307515_101050232 492
72 3300046455 Ga0495603_0040388 Ga0495603_0040388_1234_2733 492
73 3300046691 Ga0495670_0017241 Ga0495670_0017241_225_1868 492
74 3300048923 Ga0496120_0040547 Ga0496120_0040547_191_1834 492
75 3300048924 Ga0496121_0009971 Ga0496121_0009971_5924_7567 492
76 3300048926 Ga0496123_0014430 Ga0496123_0014430_4701_6344 492
77 3300053093 Ga0500651_0006247 Ga0500651_0006247_3293_4936 492
78 3300053096 Ga0500641_0008960 Ga0500641_0008960_15_1658 492
79 3300053104 Ga0500556_0000306 Ga0500556_0000306_14497_16140 492
80 3300053109 Ga0500569_000575 Ga0500569_000575_2226_3869 492
81 3300053116 Ga0500592_002419 Ga0500592_002419_891_2534 492
82 3300053130 Ga0500642_0000017 Ga0500642_0000017_146055_147698 492
83 3300053139 Ga0500568_0003553 Ga0500568_0003553_2939_4582 492
84 3300053151 Ga0500604_0004004 Ga0500604_0004004_1943_3586 492
85 3300053156 Ga0500622_0003396 Ga0500622_0003396_3222_4865 492
86 3300005614 Ga0068856_100029183 Ga0068856_1000291837 493
87 3300005843 Ga0068860_100075068 Ga0068860_1000750681 493
88 3300026067 Ga0207678_10003737 Ga0207678_100037372 493
89 3300053153 Ga0500616_0000118 Ga0500616_0000118_136028_137671 493
90 3300048907 Ga0496104_0000631 Ga0496104_0000631_22805_24394 494
91 3300048913 Ga0496110_0003215 Ga0496110_0003215_864_2453 494
92 3300048915 Ga0496112_0010357 Ga0496112_0010357_5151_6740 494
93 3300048916 Ga0496113_0072022 Ga0496113_0072022_580_2169 494
94 3300053105 Ga0500557_000025 Ga0500557_000025_317_1969 494
95 3300053177 Ga0500636_0000720 Ga0500636_0000720_8912_10528 494
96 3300053178 Ga0500637_0001657 Ga0500637_0001657_748_2328 494
97 3300053729 Ga0500625_002974 Ga0500625_002974_383_2035 494
98 3300053729 Ga0500625_009276 Ga0500625_009276_270_1850 494
99 3300005340 Ga0070689_100031683 Ga0070689_1000316832 495
100 3300005356 Ga0070674_100010930 Ga0070674_1000109303 495
101 3300005365 Ga0070688_100032741 Ga0070688_1000327411 495
102 3300005456 Ga0070678_100017215 Ga0070678_1000172155 495
103 3300005543 Ga0070672_100009235 Ga0070672_1000092354 495
104 3300005548 Ga0070665_100004291 Ga0070665_10000429111 495
105 3300005983 Ga0081540_1000483 Ga0081540_100048333 495
106 3300025936 Ga0207670_10001660 Ga0207670_1000166010 495
107 3300025940 Ga0207691_10020585 Ga0207691_100205854 495
108 3300028379 Ga0268266_10021656 Ga0268266_100216565 495
109 3300049584 Ga0501068_0002120 Ga0501068_0002120_4990_6573 495
110 3300049589 Ga0501073_0001487 Ga0501073_0001487_2522_4180 495
111 3300049742 Ga0501080_0014877 Ga0501080_0014877_386_1969 495
112 3300003762 Ga0055542_1005518 Ga0055542_10055182 496
113 3300007265 Ga0099794_10035438 Ga0099794_100354382 496
114 3300009094 Ga0111539_10041562 Ga0111539_100415624 496
115 3300025254 Ga0209148_1000812 Ga0209148_10008127 496
116 3300025261 Ga0209233_1008168 Ga0209233_10081682 496
117 3300025272 Ga0209455_1001400 Ga0209455_10014007 496
118 3300048917 Ga0496114_0009131 Ga0496114_0009131_5669_7252 496
119 3300050511 nmdc:mga08y16_108426_c1 nmdc:mga08y16_108426_c1_1098_2699 496
120 3300053730 Ga0500645_000106 Ga0500645_000106_23601_25199 496
121 3300039447 Ga0436361_0958358 Ga0436361_0958358_222_1811 497
122 3300053088 Ga0500644_0000897 Ga0500644_0000897_4930_6528 497
123 3300053131 Ga0500652_000454 Ga0500652_000454_1193_2836 497
124 3300005364 Ga0070673_100000314 Ga0070673_10000031418 498
125 3300005719 Ga0068861_100006818 Ga0068861_1000068184 498
126 3300021384 Ga0213876_10000789 Ga0213876_100007893 498
127 3300026118 Ga0207675_100010160 Ga0207675_1000101605 498
128 3300039437 Ga0436365_0042250 Ga0436365_0042250_48416_50005 498
129 3300005548 Ga0070665_100014726 Ga0070665_1000147268 499
130 3300014325 Ga0163163_10070525 Ga0163163_100705254 499
131 3300048903 Ga0496100_0041917 Ga0496100_0041917_462_2069 499
132 3300048905 Ga0496102_0109610 Ga0496102_0109610_719_2326 499
133 3300048907 Ga0496104_0071264 Ga0496104_0071264_451_2058 499
134 3300048908 Ga0496105_0034147 Ga0496105_0034147_248_1855 499
135 3300048911 Ga0496108_0049073 Ga0496108_0049073_398_2005 499
136 3300048912 Ga0496109_0006972 Ga0496109_0006972_4969_6576 499
137 3300048913 Ga0496110_0003071 Ga0496110_0003071_7902_9509 499
138 3300048914 Ga0496111_0032125 Ga0496111_0032125_330_1937 499
139 3300048918 Ga0496115_0065605 Ga0496115_0065605_271_1878 499
140 3300050493 nmdc:mga0k408_26576_c1 nmdc:mga0k408_26576_c1_1572_3167 499
141 3300005337 Ga0070682_100044241 Ga0070682_1000442412 500
142 3300005355 Ga0070671_100178932 Ga0070671_1001789321 500
143 3300005455 Ga0070663_100007115 Ga0070663_1000071154 500
144 3300005563 Ga0068855_100119725 Ga0068855_1001197252 500
145 3300005841 Ga0068863_100048364 Ga0068863_1000483642 500
146 3300005937 Ga0081455_10002788 Ga0081455_100027884 500
147 3300005985 Ga0081539_10005165 Ga0081539_100051654 500
148 3300006163 Ga0070715_10037981 Ga0070715_100379811 500
149 3300006852 Ga0075433_10002626 Ga0075433_100026263 500
150 3300006871 Ga0075434_100129165 Ga0075434_1001291652 500
151 3300007076 Ga0075435_100021990 Ga0075435_1000219904 500
152 3300009094 Ga0111539_10144080 Ga0111539_101440802 500
153 3300009098 Ga0105245_10032182 Ga0105245_100321822 500
154 3300009101 Ga0105247_10072346 Ga0105247_100723462 500
155 3300009147 Ga0114129_10046183 Ga0114129_100461835 500
156 3300009174 Ga0105241_10046041 Ga0105241_100460412 500
157 3300009177 Ga0105248_10002280 Ga0105248_100022807 500
158 3300013297 Ga0157378_10165201 Ga0157378_101652012 500
159 3300013308 Ga0157375_10019930 Ga0157375_100199305 500
160 3300025917 Ga0207660_10037977 Ga0207660_100379775 500
161 3300025926 Ga0207659_10013870 Ga0207659_100138702 500
162 3300025942 Ga0207689_10000988 Ga0207689_1000098816 500
163 3300025949 Ga0207667_10050503 Ga0207667_100505033 500
164 3300026041 Ga0207639_10006875 Ga0207639_100068753 500
165 3300026067 Ga0207678_10009474 Ga0207678_100094742 500
166 3300026089 Ga0207648_10010265 Ga0207648_100102655 500
167 3300031250 Ga0265331_10000862 Ga0265331_100008626 500
168 3300031251 Ga0265327_10000149 Ga0265327_10000149132 500
169 3300039438 Ga0436360_0247830 Ga0436360_0247830_17071_18675 500
170 3300049572 Ga0501036_0011075 Ga0501036_0011075_4755_6335 500
171 3300049823 Ga0501044_0225016 Ga0501044_0225016_82_1662 500
172 3300050512 nmdc:mga0n895_7400_c1 nmdc:mga0n895_7400_c1_7299_8888 500
173 3300050515 nmdc:mga0a205_8462_c1 nmdc:mga0a205_8462_c1_939_2528 500
174 3300053119 Ga0500595_000006 Ga0500595_000006_110641_112239 500
175 3300060353 Ga0501082_0045105 Ga0501082_0045105_1650_3230 500
176 iso_pu_bacteria 2824714736 2824722858 500
177 3300013306 Ga0163162_10188099 Ga0163162_101880992 501
178 3300026118 Ga0207675_100026655 Ga0207675_1000266554 501
179 3300031711 Ga0265314_10001782 Ga0265314_1000178219 501
180 3300035172 Ga0373955_0009166 Ga0373955_0009166_2641_4230 501
181 3300035410 Ga0373924_0029572 Ga0373924_0029572_221_1807 501
182 3300036401 Ga0373937_0001753 Ga0373937_0001753_3083_4669 501
183 3300039438 Ga0436360_1063097 Ga0436360_1063097_15_1610 501
184 3300048912 Ga0496109_0170958 Ga0496109_0170958_277_1884 501
185 3300005330 Ga0070690_100031826 Ga0070690_1000318262 502
186 3300005844 Ga0068862_100056981 Ga0068862_1000569813 502
187 3300006881 Ga0068865_100007553 Ga0068865_1000075533 502
188 3300010375 Ga0105239_10195070 Ga0105239_101950701 502
189 3300025261 Ga0209233_1006415 Ga0209233_10064152 502
190 3300025938 Ga0207704_10002304 Ga0207704_100023046 502
191 3300025972 Ga0207668_10006644 Ga0207668_100066445 502
192 3300026075 Ga0207708_10003262 Ga0207708_1000326212 502
193 3300039437 Ga0436365_0564112 Ga0436365_0564112_2199_3797 502
194 3300046462 Ga0495651_0015545 Ga0495651_0015545_2562_4211 502
195 3300046477 Ga0495664_0035191 Ga0495664_0035191_104_1753 502
196 3300046511 Ga0495608_0026417 Ga0495608_0026417_159_1808 502
197 3300046529 Ga0495652_0007836 Ga0495652_0007836_2457_4106 502
198 3300046533 Ga0495640_0031720 Ga0495640_0031720_1902_3551 502
199 3300046543 Ga0495645_0010535 Ga0495645_0010535_1421_3070 502
200 3300046559 Ga0495667_0031389 Ga0495667_0031389_1249_2898 502
201 3300046679 Ga0495623_0007161 Ga0495623_0007161_5527_7176 502
202 3300046689 Ga0495613_0030462 Ga0495613_0030462_1770_3419 502
203 3300046809 Ga0495600_0001399 Ga0495600_0001399_9296_10945 502
204 3300047317 Ga0495604_0005082 Ga0495604_0005082_3150_4799 502
205 3300047319 Ga0495674_0014488 Ga0495674_0014488_3341_4990 502
206 3300047322 Ga0495680_0002965 Ga0495680_0002965_2379_4028 502
207 3300047444 Ga0495675_0061202 Ga0495675_0061202_98_1747 502
208 3300047471 Ga0495684_0056485 Ga0495684_0056485_1170_2819 502
209 3300048088 Ga0495602_0012527 Ga0495602_0012527_5003_6652 502
210 3300053130 Ga0500642_0000127 Ga0500642_0000127_25362_27014 502
211 3300053737 Ga0500601_000306 Ga0500601_000306_6433_8082 502
212 3300005337 Ga0070682_100004003 Ga0070682_1000040038 503
213 3300005843 Ga0068860_100014117 Ga0068860_1000141176 503
214 3300005983 Ga0081540_1028930 Ga0081540_10289303 503
215 3300009174 Ga0105241_10032799 Ga0105241_100327993 503
216 3300021361 Ga0213872_10035346 Ga0213872_100353462 503
217 3300028666 Ga0265336_10003752 Ga0265336_100037522 503
218 3300031238 Ga0265332_10020287 Ga0265332_100202872 503
219 3300031240 Ga0265320_10002226 Ga0265320_100022265 503
220 3300031251 Ga0265327_10000044 Ga0265327_10000044127 503
221 3300031711 Ga0265314_10020268 Ga0265314_100202686 503
222 3300031712 Ga0265342_10000043 Ga0265342_1000004362 503
223 3300032005 Ga0307411_10002080 Ga0307411_100020808 503
224 3300035170 Ga0373943_0040553 Ga0373943_0040553_604_2232 503
225 3300039438 Ga0436360_0484380 Ga0436360_0484380_816_2399 503
226 3300046529 Ga0495652_0044898 Ga0495652_0044898_162_1802 503
227 3300046557 Ga0495622_0011078 Ga0495622_0011078_19_1659 503
228 3300046663 Ga0495635_0004612 Ga0495635_0004612_7586_9226 503
229 3300046675 Ga0495657_0011893 Ga0495657_0011893_4567_6207 503
230 3300046809 Ga0495600_0006454 Ga0495600_0006454_2353_3993 503
231 3300047317 Ga0495604_0055520 Ga0495604_0055520_85_1725 503
232 3300048907 Ga0496104_0082259 Ga0496104_0082259_1364_3004 503
233 3300048922 Ga0496119_0053880 Ga0496119_0053880_35_1675 503
234 3300048928 Ga0496125_0061560 Ga0496125_0061560_431_2071 503
235 3300048929 Ga0496126_0052410 Ga0496126_0052410_1879_3519 503
236 3300049575 Ga0501039_0157282 Ga0501039_0157282_24_1679 503
237 3300003323 rootH1_10002054 rootH1_1000205437 504
238 3300005436 Ga0070713_100023480 Ga0070713_1000234804 504
239 3300006028 Ga0070717_10035686 Ga0070717_100356863 504
240 3300025302 Ga0207426_1000328 Ga0207426_100032810 504
241 3300028577 Ga0265318_10008342 Ga0265318_100083424 504
242 3300028794 Ga0307515_10000131 Ga0307515_1000013129 504
243 3300028800 Ga0265338_10004109 Ga0265338_100041096 504
244 3300031235 Ga0265330_10017581 Ga0265330_100175811 504
245 3300031240 Ga0265320_10018943 Ga0265320_100189434 504
246 3300031242 Ga0265329_10007780 Ga0265329_100077802 504
247 3300031247 Ga0265340_10014618 Ga0265340_100146183 504
248 3300031249 Ga0265339_10010237 Ga0265339_100102377 504
249 3300031250 Ga0265331_10010509 Ga0265331_100105093 504
250 3300031456 Ga0307513_10115328 Ga0307513_101153282 504
251 3300031595 Ga0265313_10010550 Ga0265313_100105504 504
252 3300031711 Ga0265314_10027793 Ga0265314_100277932 504
253 3300031712 Ga0265342_10050569 Ga0265342_100505692 504
254 3300035119 Ga0373956_0048116 Ga0373956_0048116_142_1719 504
255 3300035692 Ga0373935_0094939 Ga0373935_0094939_15_1565 504
256 3300035724 Ga0373933_0018992 Ga0373933_0018992_311_1888 504
257 3300036401 Ga0373937_0046678 Ga0373937_0046678_104_1681 504
258 3300044658 Ga0466972_0000079 Ga0466972_0000079_62229_63881 504
259 3300046522 Ga0495643_0000852 Ga0495643_0000852_13380_14993 504
260 3300049742 Ga0501080_0004571 Ga0501080_0004571_7642_9240 504
261 3300005617 Ga0068859_100047291 Ga0068859_1000472912 505
262 3300005618 Ga0068864_100080946 Ga0068864_1000809463 505
263 3300005937 Ga0081455_10000015 Ga0081455_10000015179 505
264 3300006931 Ga0097620_100047297 Ga0097620_1000472974 505
265 3300021388 Ga0213875_10000009 Ga0213875_10000009373 505
266 3300026095 Ga0207676_10024857 Ga0207676_100248575 505
267 3300026116 Ga0207674_10033659 Ga0207674_100336594 505
268 3300028786 Ga0307517_10000279 Ga0307517_1000027980 505
269 3300037853 Ga0436364_0413488 Ga0436364_0413488_24330_25919 505
270 3300048907 Ga0496104_0044499 Ga0496104_0044499_265_1851 505
271 3300048917 Ga0496114_0119094 Ga0496114_0119094_641_2227 505
272 3300049587 Ga0501071_0084639 Ga0501071_0084639_603_2183 505
273 3300001991 JGI24743J22301_10000006 JGI24743J22301_1000000621 506
274 3300010375 Ga0105239_10021238 Ga0105239_100212386 506
275 3300026118 Ga0207675_100026697 Ga0207675_1000266975 506
276 3300028563 Ga0265319_1000212 Ga0265319_10002128 506
277 3300028577 Ga0265318_10000302 Ga0265318_1000030219 506
278 3300028794 Ga0307515_10140827 Ga0307515_101408272 506
279 3300031235 Ga0265330_10000072 Ga0265330_1000007234 506
280 3300031238 Ga0265332_10000194 Ga0265332_1000019419 506
281 3300031239 Ga0265328_10003523 Ga0265328_100035236 506
282 3300031240 Ga0265320_10000038 Ga0265320_1000003878 506
283 3300031242 Ga0265329_10000104 Ga0265329_1000010418 506
284 3300031249 Ga0265339_10010417 Ga0265339_100104175 506
285 3300031250 Ga0265331_10000421 Ga0265331_1000042115 506
286 3300031344 Ga0265316_10000930 Ga0265316_1000093019 506
287 3300031595 Ga0265313_10000311 Ga0265313_1000031127 506
288 3300031711 Ga0265314_10000114 Ga0265314_1000011478 506
289 3300031712 Ga0265342_10000268 Ga0265342_1000026819 506
290 3300031730 Ga0307516_10000011 Ga0307516_10000011172 506
291 3300044683 Ga0466965_0059686 Ga0466965_0059686_52_1635 506
292 3300044719 Ga0466971_0000119 Ga0466971_0000119_16616_18199 506
293 3300044842 Ga0466957_0013977 Ga0466957_0013977_1266_2849 506
294 3300049573 Ga0501037_0000083 Ga0501037_0000083_11954_13537 506
295 3300049579 Ga0501043_0032309 Ga0501043_0032309_1151_2752 506
296 3300049581 Ga0501047_0001199 Ga0501047_0001199_9184_10785 506
297 3300049583 Ga0501067_0006889 Ga0501067_0006889_2016_3617 506
298 3300049584 Ga0501068_0000120 Ga0501068_0000120_5261_6862 506
299 3300049588 Ga0501072_0000008 Ga0501072_0000008_205572_207173 506
300 3300049589 Ga0501073_0073838 Ga0501073_0073838_282_1883 506
301 3300049741 Ga0501079_0011888 Ga0501079_0011888_4266_5867 506
302 3300049742 Ga0501080_0005109 Ga0501080_0005109_4367_5968 506
303 3300049744 Ga0501083_0023744 Ga0501083_0023744_590_2191 506
304 3300049823 Ga0501044_0000159 Ga0501044_0000159_81444_83027 506
305 3300053177 Ga0500636_0070189 Ga0500636_0070189_223_1794 506
306 3300054114 Ga0501084_0000005 Ga0501084_0000005_35507_37108 506
307 3300060353 Ga0501082_0000171 Ga0501082_0000171_24273_25874 506
308 3300061719 Ga0466962_0000006 Ga0466962_0000006_19867_21450 506
309 3300003323 rootH1_10030737 rootH1_1003073710 507
310 3300005338 Ga0068868_100001290 Ga0068868_10000129016 507
311 3300005340 Ga0070689_100024687 Ga0070689_1000246872 507
312 3300005354 Ga0070675_100001026 Ga0070675_10000102617 507
313 3300005364 Ga0070673_100000679 Ga0070673_1000006792 507
314 3300005367 Ga0070667_100021473 Ga0070667_1000214733 507
315 3300005456 Ga0070678_100024704 Ga0070678_1000247043 507
316 3300005459 Ga0068867_100123124 Ga0068867_1001231241 507
317 3300005617 Ga0068859_100032021 Ga0068859_1000320214 507
318 3300005842 Ga0068858_100002570 Ga0068858_1000025702 507
319 3300006173 Ga0070716_100019006 Ga0070716_1000190063 507
320 3300006358 Ga0068871_100055688 Ga0068871_1000556883 507
321 3300006931 Ga0097620_100032022 Ga0097620_1000320223 507
322 3300009545 Ga0105237_10106046 Ga0105237_101060462 507
323 3300009553 Ga0105249_10078257 Ga0105249_100782573 507
324 3300013296 Ga0157374_10036932 Ga0157374_100369323 507
325 3300014325 Ga0163163_10050619 Ga0163163_100506193 507
326 3300014968 Ga0157379_10029114 Ga0157379_100291144 507
327 3300025926 Ga0207659_10000322 Ga0207659_1000032225 507
328 3300025933 Ga0207706_10031423 Ga0207706_100314233 507
329 3300025941 Ga0207711_10005730 Ga0207711_100057303 507
330 3300025960 Ga0207651_10012387 Ga0207651_100123872 507
331 3300026023 Ga0207677_10009636 Ga0207677_100096365 507
332 3300026121 Ga0207683_10040799 Ga0207683_100407993 507
333 3300028577 Ga0265318_10008041 Ga0265318_100080413 507
334 3300028800 Ga0265338_10001103 Ga0265338_100011036 507
335 3300031239 Ga0265328_10009579 Ga0265328_100095792 507
336 3300031240 Ga0265320_10002099 Ga0265320_1000209910 507
337 3300031247 Ga0265340_10005200 Ga0265340_100052003 507
338 3300031249 Ga0265339_10016164 Ga0265339_100161644 507
339 3300031344 Ga0265316_10000951 Ga0265316_100009519 507
340 3300031595 Ga0265313_10014710 Ga0265313_100147103 507
341 3300031711 Ga0265314_10024792 Ga0265314_100247922 507
342 3300031712 Ga0265342_10001279 Ga0265342_1000127911 507
343 3300034957 Ga0373938_0003894 Ga0373938_0003894_572_2155 507
344 3300035241 Ga0373961_0005234 Ga0373961_0005234_752_2335 507
345 3300035691 Ga0373931_0003800 Ga0373931_0003800_3945_5528 507
346 3300039447 Ga0436361_0575778 Ga0436361_0575778_2352_3953 507
347 3300039450 Ga0436363_1355831 Ga0436363_1355831_807_2408 507
348 3300049568 Ga0501031_0004751 Ga0501031_0004751_6869_8452 507
349 3300049570 Ga0501033_0000083 Ga0501033_0000083_72384_73967 507
350 3300049579 Ga0501043_0001626 Ga0501043_0001626_14225_15808 507
351 3300049581 Ga0501047_0001255 Ga0501047_0001255_9389_10972 507
352 3300049586 Ga0501070_0000884 Ga0501070_0000884_20624_22207 507
353 3300049822 Ga0501035_0000001 Ga0501035_0000001_467072_468655 507
354 3300050516 nmdc:mga0sz30_2049_c1 nmdc:mga0sz30_2049_c1_619_2211 507
355 3300053094 Ga0500566_0000144 Ga0500566_0000144_612_2258 507
356 3300003215 JGI25153J46596_10004006 JGI25153J46596_100040064 508
357 3300005340 Ga0070689_100070032 Ga0070689_1000700322 508
358 3300005563 Ga0068855_100007625 Ga0068855_10000762512 508
359 3300005614 Ga0068856_100005399 Ga0068856_1000053995 508
360 3300005616 Ga0068852_100006452 Ga0068852_1000064522 508
361 3300005617 Ga0068859_100143786 Ga0068859_1001437862 508
362 3300006042 Ga0075368_10016963 Ga0075368_100169631 508
363 3300006846 Ga0075430_100000066 Ga0075430_10000006630 508
364 3300006931 Ga0097620_100143785 Ga0097620_1001437852 508
365 3300013306 Ga0163162_10288388 Ga0163162_102883881 508
366 3300025297 Ga0209758_1001848 Ga0209758_100184821 508
367 3300025302 Ga0207426_1000458 Ga0207426_10004588 508
368 3300025907 Ga0207645_10009970 Ga0207645_100099703 508
369 3300025913 Ga0207695_10000163 Ga0207695_1000016315 508
370 3300025914 Ga0207671_10004663 Ga0207671_100046632 508
371 3300025940 Ga0207691_10013025 Ga0207691_100130252 508
372 3300025949 Ga0207667_10017111 Ga0207667_100171112 508
373 3300026023 Ga0207677_10032216 Ga0207677_100322162 508
374 3300026078 Ga0207702_10014770 Ga0207702_100147704 508
375 3300026089 Ga0207648_10006548 Ga0207648_1000654811 508
376 3300044684 Ga0466966_0000191 Ga0466966_0000191_25105_26778 508
377 3300044693 Ga0466961_0000005 Ga0466961_0000005_65131_66804 508
378 3300044712 Ga0453684_0325867 Ga0453684_0325867_56_1666 508
379 3300045049 Ga0466959_0003302 Ga0466959_0003302_1799_3472 508
380 3300049583 Ga0501067_0023980 Ga0501067_0023980_1269_2870 508
381 3300050509 nmdc:mga0qj67_235_c1 nmdc:mga0qj67_235_c1_3855_5453 508
382 3300005290 Ga0065712_10025524 Ga0065712_100255241 509
383 3300005331 Ga0070670_100000302 Ga0070670_10000030231 509
384 3300005355 Ga0070671_100000185 Ga0070671_10000018526 509
385 3300005365 Ga0070688_100013390 Ga0070688_1000133904 509
386 3300005367 Ga0070667_100000060 Ga0070667_10000006061 509
387 3300005456 Ga0070678_100069299 Ga0070678_1000692991 509
388 3300005466 Ga0070685_10000048 Ga0070685_1000004860 509
389 3300005548 Ga0070665_100036542 Ga0070665_1000365422 509
390 3300005564 Ga0070664_100092724 Ga0070664_1000927242 509
391 3300005617 Ga0068859_100029751 Ga0068859_1000297516 509
392 3300005618 Ga0068864_100000119 Ga0068864_10000011962 509
393 3300005843 Ga0068860_100000875 Ga0068860_1000008754 509
394 3300005843 Ga0068860_100001922 Ga0068860_1000019224 509
395 3300005844 Ga0068862_100003179 Ga0068862_1000031793 509
396 3300006844 Ga0075428_100087762 Ga0075428_1000877622 509
397 3300006931 Ga0097620_100029750 Ga0097620_1000297502 509
398 3300009101 Ga0105247_10027718 Ga0105247_100277183 509
399 3300009177 Ga0105248_10037389 Ga0105248_100373894 509
400 3300009177 Ga0105248_10075191 Ga0105248_100751914 509
401 3300009545 Ga0105237_10008601 Ga0105237_100086013 509
402 3300009553 Ga0105249_10045509 Ga0105249_100455094 509
403 3300014325 Ga0163163_10000160 Ga0163163_1000016029 509
404 3300021320 Ga0214544_1000001 Ga0214544_1000001543 509
405 3300021321 Ga0214542_1001925 Ga0214542_100192530 509
406 3300021324 Ga0214545_1000003 Ga0214545_1000003219 509
407 3300021327 Ga0214543_1000002 Ga0214543_1000002547 509
408 3300025893 Ga0207682_10001361 Ga0207682_100013615 509
409 3300025903 Ga0207680_10023292 Ga0207680_100232922 509
410 3300025925 Ga0207650_10000013 Ga0207650_1000001398 509
411 3300025931 Ga0207644_10000742 Ga0207644_100007427 509
412 3300025941 Ga0207711_10003436 Ga0207711_1000343614 509
413 3300025961 Ga0207712_10119256 Ga0207712_101192562 509
414 3300025986 Ga0207658_10000005 Ga0207658_1000000599 509
415 3300026095 Ga0207676_10000010 Ga0207676_10000010196 509
416 3300026121 Ga0207683_10044126 Ga0207683_100441261 509
417 3300027296 Ga0209389_1000043 Ga0209389_100004321 509
418 3300027357 Ga0209589_1000047 Ga0209589_100004790 509
419 3300027361 Ga0209489_100075 Ga0209489_100075122 509
420 3300028379 Ga0268266_10009379 Ga0268266_1000937910 509
421 3300028380 Ga0268265_10001685 Ga0268265_100016859 509
422 3300028381 Ga0268264_10000016 Ga0268264_1000001659 509
423 3300028381 Ga0268264_10000672 Ga0268264_1000067231 509
424 3300028794 Ga0307515_10018110 Ga0307515_1001811010 509
425 3300031548 Ga0307408_100000062 Ga0307408_10000006295 509
426 3300031911 Ga0307412_10062602 Ga0307412_100626022 509
427 3300032002 Ga0307416_100000012 Ga0307416_100000012250 509
428 3300047443 Ga0495687_002640 Ga0495687_002640_12114_13715 509
429 3300048927 Ga0496124_0135883 Ga0496124_0135883_231_1802 509
430 3300048928 Ga0496125_0000048 Ga0496125_0000048_216564_218189 509
431 3300005295 Ga0065707_10084154 Ga0065707_100841545 510
432 3300005329 Ga0070683_100074629 Ga0070683_1000746292 510
433 3300005334 Ga0068869_100001294 Ga0068869_10000129410 510
434 3300005338 Ga0068868_100032633 Ga0068868_1000326332 510
435 3300005355 Ga0070671_100116174 Ga0070671_1001161742 510
436 3300005459 Ga0068867_100000865 Ga0068867_1000008656 510
437 3300005535 Ga0070684_100085007 Ga0070684_1000850072 510
438 3300006237 Ga0097621_100002597 Ga0097621_1000025975 510
439 3300006358 Ga0068871_100004107 Ga0068871_1000041076 510
440 3300006881 Ga0068865_100003223 Ga0068865_1000032236 510
441 3300009098 Ga0105245_10007663 Ga0105245_100076634 510
442 3300025912 Ga0207707_10000886 Ga0207707_1000088626 510
443 3300025912 Ga0207707_10042235 Ga0207707_100422353 510
444 3300025927 Ga0207687_10025359 Ga0207687_100253593 510
445 3300025942 Ga0207689_10059341 Ga0207689_100593412 510
446 3300025944 Ga0207661_10019630 Ga0207661_100196305 510
447 3300025944 Ga0207661_10127179 Ga0207661_101271792 510
448 3300026023 Ga0207677_10030833 Ga0207677_100308332 510
449 3300026089 Ga0207648_10003222 Ga0207648_100032228 510
450 3300035086 Ga0373934_0031037 Ga0373934_0031037_135_1787 510
451 3300036401 Ga0373937_0016403 Ga0373937_0016403_3946_5598 510
452 3300037068 Ga0373925_0055603 Ga0373925_0055603_64_1716 510
453 3300046459 Ga0495629_0111724 Ga0495629_0111724_150_1802 510
454 3300046472 Ga0495580_0109327 Ga0495580_0109327_161_1813 510
455 3300046473 Ga0495582_0041625 Ga0495582_0041625_210_1862 510
456 3300046475 Ga0495639_0010168 Ga0495639_0010168_181_1833 510
457 3300046477 Ga0495664_0035009 Ga0495664_0035009_817_2469 510
458 3300046517 Ga0495630_0019164 Ga0495630_0019164_2066_3718 510
459 3300046533 Ga0495640_0066899 Ga0495640_0066899_254_1906 510
460 3300046642 Ga0495634_0067650 Ga0495634_0067650_638_2290 510
461 3300047471 Ga0495684_0005641 Ga0495684_0005641_5916_7568 510
462 3300048922 Ga0496119_0000597 Ga0496119_0000597_32715_34337 510
463 3300048922 Ga0496119_0012249 Ga0496119_0012249_3239_4825 510
464 3300048925 Ga0496122_0001337 Ga0496122_0001337_3584_5206 510
465 3300048926 Ga0496123_0001933 Ga0496123_0001933_21752_23374 510
466 3300053104 Ga0500556_0000879 Ga0500556_0000879_3714_5336 510
467 3300053122 Ga0500608_005329 Ga0500608_005329_1599_3242 510
468 3300053136 Ga0500559_0001551 Ga0500559_0001551_1907_3550 510
469 3300053177 Ga0500636_0002589 Ga0500636_0002589_1903_3546 510
470 3300053730 Ga0500645_006021 Ga0500645_006021_1227_2849 510
471 3300005337 Ga0070682_100003941 Ga0070682_1000039417 511
472 3300005340 Ga0070689_100117882 Ga0070689_1001178822 511
473 3300005365 Ga0070688_100073945 Ga0070688_1000739452 511
474 3300005467 Ga0070706_100074355 Ga0070706_1000743552 511
475 3300005468 Ga0070707_100115885 Ga0070707_1001158852 511
476 3300005471 Ga0070698_100016070 Ga0070698_1000160706 511
477 3300005518 Ga0070699_100117393 Ga0070699_1001173932 511
478 3300005536 Ga0070697_100056218 Ga0070697_1000562183 511
479 3300005536 Ga0070697_100058461 Ga0070697_1000584612 511
480 3300009094 Ga0111539_10281037 Ga0111539_102810371 511
481 3300025910 Ga0207684_10001107 Ga0207684_1000110731 511
482 3300025936 Ga0207670_10103780 Ga0207670_101037801 511
483 3300025960 Ga0207651_10111560 Ga0207651_101115601 511
484 3300025961 Ga0207712_10084911 Ga0207712_100849111 511
485 3300026035 Ga0207703_10000817 Ga0207703_100008175 511
486 3300028379 Ga0268266_10239470 Ga0268266_102394701 511
487 3300028380 Ga0268265_10107530 Ga0268265_101075302 511
488 3300031247 Ga0265340_10005148 Ga0265340_100051483 511
489 3300031249 Ga0265339_10001668 Ga0265339_100016688 511
490 3300031249 Ga0265339_10004146 Ga0265339_100041464 511
491 3300031344 Ga0265316_10009307 Ga0265316_100093076 511
492 3300031595 Ga0265313_10044992 Ga0265313_100449923 511
493 3300031711 Ga0265314_10000001 Ga0265314_100000011649 511
494 3300031711 Ga0265314_10010362 Ga0265314_100103626 511
495 3300046477 Ga0495664_0074586 Ga0495664_0074586_282_1877 511
496 3300046557 Ga0495622_0003164 Ga0495622_0003164_5869_7476 511
497 3300046689 Ga0495613_0002444 Ga0495613_0002444_2921_4516 511
498 3300048915 Ga0496112_0072708 Ga0496112_0072708_467_2026 511
499 3300050491 nmdc:mga00v17_14448_c1 nmdc:mga00v17_14448_c1_2645_4225 511
500 3300053177 Ga0500636_0000041 Ga0500636_0000041_30543_32198 511
501 iso_pu_bacteria 2738541276 2738714707 511
502 iso_pu_bacteria 2894772417 2894774530 511
503 iso_pu_bacteria 2929199973 2929201529 511
504 iso_pu_bacteria 8055909800 8055916129 511
505 3300005617 Ga0068859_100044417 Ga0068859_1000444173 512
506 3300006931 Ga0097620_100044417 Ga0097620_1000444173 512
507 3300009545 Ga0105237_10008112 Ga0105237_100081123 512
508 3300013296 Ga0157374_10139391 Ga0157374_101393912 512
509 3300025909 Ga0207705_10001805 Ga0207705_1000180513 512
510 3300028379 Ga0268266_10044436 Ga0268266_100444362 512
511 3300028800 Ga0265338_10028156 Ga0265338_100281562 512
512 3300029957 Ga0265324_10000316 Ga0265324_1000031614 512
513 3300034816 Ga0373930_0000113 Ga0373930_0000113_6350_7930 512
514 3300035084 Ga0373928_0000305 Ga0373928_0000305_857_2437 512
515 3300035089 Ga0373944_0000080 Ga0373944_0000080_789_2369 512
516 3300035112 Ga0373932_0000001 Ga0373932_0000001_1270266_1271846 512
517 3300035170 Ga0373943_0025979 Ga0373943_0025979_795_2426 512
518 3300035242 Ga0373962_0000013 Ga0373962_0000013_142_1722 512
519 3300035691 Ga0373931_0000002 Ga0373931_0000002_223552_225132 512
520 3300035695 Ga0373927_0010602 Ga0373927_0010602_3383_4963 512
521 3300035725 Ga0373947_0016812 Ga0373947_0016812_2027_3658 512
522 3300037068 Ga0373925_0002323 Ga0373925_0002323_7421_9001 512
523 3300044694 Ga0466963_0070364 Ga0466963_0070364_115_1755 512
524 3300046529 Ga0495652_0044462 Ga0495652_0044462_579_2147 512
525 3300048917 Ga0496114_0003558 Ga0496114_0003558_8300_9895 512
526 3300048924 Ga0496121_0005680 Ga0496121_0005680_3267_4919 512
527 3300002459 JGI24751J29686_10006798 JGI24751J29686_100067982 513
528 3300005331 Ga0070670_100008482 Ga0070670_1000084828 513
529 3300005331 Ga0070670_100016572 Ga0070670_1000165723 513
530 3300005347 Ga0070668_100000300 Ga0070668_10000030014 513
531 3300005355 Ga0070671_100001904 Ga0070671_10000190417 513
532 3300005367 Ga0070667_100000019 Ga0070667_100000019116 513
533 3300005618 Ga0068864_100018783 Ga0068864_1000187835 513
534 3300005842 Ga0068858_100000138 Ga0068858_10000013883 513
535 3300005843 Ga0068860_100000042 Ga0068860_10000004265 513
536 3300005937 Ga0081455_10053851 Ga0081455_100538511 513
537 3300006051 Ga0075364_10021089 Ga0075364_100210893 513
538 3300006177 Ga0075362_10009394 Ga0075362_100093945 513
539 3300006178 Ga0075367_10016941 Ga0075367_100169413 513
540 3300006186 Ga0075369_10018978 Ga0075369_100189782 513
541 3300006353 Ga0075370_10001199 Ga0075370_1000119911 513
542 3300006353 Ga0075370_10098227 Ga0075370_100982271 513
543 3300025925 Ga0207650_10010335 Ga0207650_100103353 513
544 3300025925 Ga0207650_10030519 Ga0207650_100305195 513
545 3300025931 Ga0207644_10000721 Ga0207644_1000072113 513
546 3300025937 Ga0207669_10072821 Ga0207669_100728211 513
547 3300025972 Ga0207668_10000565 Ga0207668_100005653 513
548 3300025986 Ga0207658_10000002 Ga0207658_10000002144 513
549 3300026035 Ga0207703_10016737 Ga0207703_100167375 513
550 3300026088 Ga0207641_10000207 Ga0207641_1000020758 513
551 3300026095 Ga0207676_10068626 Ga0207676_100686263 513
552 3300028381 Ga0268264_10000001 Ga0268264_10000001469 513
553 3300031616 Ga0307508_10005665 Ga0307508_100056656 513
554 3300031711 Ga0265314_10015199 Ga0265314_100151994 513
555 3300031852 Ga0307410_10000016 Ga0307410_1000001649 513
556 3300031903 Ga0307407_10003156 Ga0307407_100031562 513
557 3300031995 Ga0307409_100000034 Ga0307409_10000003429 513
558 3300036401 Ga0373937_0088807 Ga0373937_0088807_729_2318 513
559 3300044901 Ga0466960_0015116 Ga0466960_0015116_1232_2818 513
560 3300046689 Ga0495613_0076425 Ga0495613_0076425_138_1733 513
561 3300048905 Ga0496102_0133002 Ga0496102_0133002_460_2055 513
562 3300048907 Ga0496104_0003007 Ga0496104_0003007_10107_11702 513
563 3300048908 Ga0496105_0002656 Ga0496105_0002656_2610_4205 513
564 3300048911 Ga0496108_0000401 Ga0496108_0000401_32162_33757 513
565 3300048912 Ga0496109_0008941 Ga0496109_0008941_6067_7662 513
566 3300048913 Ga0496110_0092134 Ga0496110_0092134_436_2031 513
567 3300048915 Ga0496112_0006000 Ga0496112_0006000_5881_7476 513
568 3300048916 Ga0496113_0000120 Ga0496113_0000120_29278_30873 513
569 3300049579 Ga0501043_0000195 Ga0501043_0000195_28241_29824 513
570 3300050491 nmdc:mga00v17_15664_c1 nmdc:mga00v17_15664_c1_94_1674 513
571 3300050493 nmdc:mga0k408_81667_c1 nmdc:mga0k408_81667_c1_187_1767 513
572 3300050494 nmdc:mga06z11_16446_c1 nmdc:mga06z11_16446_c1_1590_3170 513
573 3300050507 nmdc:mga05p37_25169_c1 nmdc:mga05p37_25169_c1_2896_4491 513
574 iso_pu_bacteria 2841911363 2841917045 513
575 iso_pu_bacteria 2841917233 2841922666 513
576 3300003203 JGI25406J46586_10009867 JGI25406J46586_100098673 514
577 3300005335 Ga0070666_10050526 Ga0070666_100505263 514
578 3300005467 Ga0070706_100002539 Ga0070706_10000253911 514
579 3300005577 Ga0068857_100095759 Ga0068857_1000957591 514
580 3300005578 Ga0068854_100011592 Ga0068854_1000115923 514
581 3300005937 Ga0081455_10011336 Ga0081455_100113367 514
582 3300005985 Ga0081539_10000118 Ga0081539_1000011824 514
583 3300006042 Ga0075368_10013943 Ga0075368_100139432 514
584 3300006353 Ga0075370_10021876 Ga0075370_100218762 514
585 3300009093 Ga0105240_10000053 Ga0105240_10000053149 514
586 3300009148 Ga0105243_10092413 Ga0105243_100924132 514
587 3300009545 Ga0105237_10067881 Ga0105237_100678812 514
588 3300025298 Ga0209050_1001613 Ga0209050_100161314 514
589 3300025910 Ga0207684_10007765 Ga0207684_100077653 514
590 3300025913 Ga0207695_10000590 Ga0207695_1000059015 514
591 3300025914 Ga0207671_10019133 Ga0207671_100191332 514
592 3300025933 Ga0207706_10026179 Ga0207706_100261792 514
593 3300025981 Ga0207640_10013731 Ga0207640_100137314 514
594 3300026116 Ga0207674_10105081 Ga0207674_101050811 514
595 3300027866 Ga0209813_10001620 Ga0209813_100016203 514
596 3300029957 Ga0265324_10010442 Ga0265324_100104425 514
597 3300031241 Ga0265325_10016566 Ga0265325_100165664 514
598 3300046519 Ga0495632_0013474 Ga0495632_0013474_573_2186 514
599 3300046694 Ga0495649_0004358 Ga0495649_0004358_4062_5675 514
600 3300047443 Ga0495687_002007 Ga0495687_002007_6375_7988 514
601 3300050494 nmdc:mga06z11_13397_c1 nmdc:mga06z11_13397_c1_438_2039 514
602 3300050496 nmdc:mga07m45_6319_c1 nmdc:mga07m45_6319_c1_2320_3933 514
603 iso_pu_bacteria 2786546517 2787436468 514
604 iso_pu_bacteria 8001522603 8001525916 514
605 3300005356 Ga0070674_100033968 Ga0070674_1000339682 515
606 3300005543 Ga0070672_100027081 Ga0070672_1000270813 515
607 3300009093 Ga0105240_10000535 Ga0105240_1000053554 515
608 3300025913 Ga0207695_10005898 Ga0207695_1000589821 515
609 3300025931 Ga0207644_10000454 Ga0207644_1000045414 515
610 3300028577 Ga0265318_10000012 Ga0265318_10000012172 515
611 3300031090 Ga0265760_10002753 Ga0265760_100027536 515
612 3300031235 Ga0265330_10000009 Ga0265330_10000009116 515
613 3300031238 Ga0265332_10002865 Ga0265332_100028657 515
614 3300031239 Ga0265328_10024805 Ga0265328_100248052 515
615 3300031240 Ga0265320_10000003 Ga0265320_10000003334 515
616 3300031242 Ga0265329_10005454 Ga0265329_100054542 515
617 3300031249 Ga0265339_10000900 Ga0265339_1000090019 515
618 3300031250 Ga0265331_10000098 Ga0265331_100000989 515
619 3300031344 Ga0265316_10031732 Ga0265316_100317322 515
620 3300031595 Ga0265313_10000171 Ga0265313_1000017119 515
621 3300031595 Ga0265313_10000640 Ga0265313_100006404 515
622 3300031711 Ga0265314_10000041 Ga0265314_10000041171 515
623 3300031711 Ga0265314_10018978 Ga0265314_100189784 515
624 3300053142 Ga0500577_0000563 Ga0500577_0000563_237_1862 515
625 3300053177 Ga0500636_0042972 Ga0500636_0042972_890_2551 515
626 iso_pu_bacteria 2545555834 2545676798 515
627 iso_pu_bacteria 2775506901 2776266367 515
628 iso_pu_bacteria 641522639 641642871 515
629 3300003659 JGI25404J52841_10010314 JGI25404J52841_100103142 516
630 3300005563 Ga0068855_100000192 Ga0068855_10000019234 516
631 3300005983 Ga0081540_1027883 Ga0081540_10278832 516
632 3300006028 Ga0070717_10140851 Ga0070717_101408512 516
633 3300006038 Ga0075365_10070297 Ga0075365_100702972 516
634 3300006048 Ga0075363_100002722 Ga0075363_1000027224 516
635 3300007076 Ga0075435_100014544 Ga0075435_1000145442 516
636 3300009553 Ga0105249_10068040 Ga0105249_100680402 516
637 3300025906 Ga0207699_10034270 Ga0207699_100342702 516
638 3300025940 Ga0207691_10047249 Ga0207691_100472493 516
639 3300025949 Ga0207667_10000173 Ga0207667_1000017321 516
640 3300026089 Ga0207648_10085897 Ga0207648_100858972 516
641 3300026118 Ga0207675_100024107 Ga0207675_1000241072 516
642 3300027907 Ga0207428_10020735 Ga0207428_100207354 516
643 3300028558 Ga0265326_10007004 Ga0265326_100070043 516
644 3300028577 Ga0265318_10005337 Ga0265318_100053375 516
645 3300028800 Ga0265338_10060329 Ga0265338_100603296 516
646 3300030521 Ga0307511_10054250 Ga0307511_100542502 516
647 3300031235 Ga0265330_10037183 Ga0265330_100371832 516
648 3300031238 Ga0265332_10003878 Ga0265332_100038785 516
649 3300031242 Ga0265329_10032021 Ga0265329_100320211 516
650 3300031250 Ga0265331_10002331 Ga0265331_100023314 516
651 3300031507 Ga0307509_10025035 Ga0307509_100250352 516
652 3300031711 Ga0265314_10003018 Ga0265314_1000301816 516
653 3300031730 Ga0307516_10000789 Ga0307516_1000078914 516
654 3300037853 Ga0436364_0719430 Ga0436364_0719430_14_1594 516
655 3300039447 Ga0436361_0108686 Ga0436361_0108686_2048_3706 516
656 3300048907 Ga0496104_0151797 Ga0496104_0151797_58_1695 516
657 3300048908 Ga0496105_0048946 Ga0496105_0048946_1608_3245 516
658 3300050490 nmdc:mga03n38_1577_c1 nmdc:mga03n38_1577_c1_3627_5198 516
659 3300050511 nmdc:mga08y16_12581_c1 nmdc:mga08y16_12581_c1_5439_7040 516
660 3300050513 nmdc:mga0rr50_37882_c1 nmdc:mga0rr50_37882_c1_716_2305 516
661 3300053098 Ga0500650_0065374 Ga0500650_0065374_44_1657 516
662 3300053119 Ga0500595_007204 Ga0500595_007204_540_2129 516
663 3300053131 Ga0500652_000168 Ga0500652_000168_17974_19563 516
664 3300053177 Ga0500636_0011668 Ga0500636_0011668_1554_3143 516
665 iso_pu_bacteria 2643221547 2643757718 516
666 iso_pu_bacteria 2824644064 2824651763 516
667 iso_pu_bacteria 2842694124 2842697031 516
668 3300005354 Ga0070675_100057929 Ga0070675_1000579294 517
669 3300005364 Ga0070673_100011417 Ga0070673_1000114176 517
670 3300005471 Ga0070698_100213584 Ga0070698_1002135841 517
671 3300005563 Ga0068855_100002197 Ga0068855_10000219716 517
672 3300005614 Ga0068856_100027049 Ga0068856_1000270493 517
673 3300005618 Ga0068864_100052272 Ga0068864_1000522723 517
674 3300005842 Ga0068858_100038967 Ga0068858_1000389672 517
675 3300005843 Ga0068860_100003716 Ga0068860_10000371610 517
676 3300009093 Ga0105240_10024203 Ga0105240_100242037 517
677 3300009094 Ga0111539_10079286 Ga0111539_100792862 517
678 3300009177 Ga0105248_10006264 Ga0105248_100062642 517
679 3300014325 Ga0163163_10032475 Ga0163163_100324754 517
680 3300014968 Ga0157379_10006700 Ga0157379_100067002 517
681 3300025913 Ga0207695_10062664 Ga0207695_100626643 517
682 3300025941 Ga0207711_10122038 Ga0207711_101220382 517
683 3300025949 Ga0207667_10011668 Ga0207667_1001166810 517
684 3300025960 Ga0207651_10018851 Ga0207651_100188514 517
685 3300027907 Ga0207428_10013649 Ga0207428_100136494 517
686 3300028381 Ga0268264_10123908 Ga0268264_101239081 517
687 3300028573 Ga0265334_10000218 Ga0265334_100002182 517
688 3300031241 Ga0265325_10008489 Ga0265325_100084893 517
689 3300031242 Ga0265329_10000631 Ga0265329_1000063111 517
690 3300031247 Ga0265340_10012494 Ga0265340_100124943 517
691 3300031456 Ga0307513_10088845 Ga0307513_100888451 517
692 3300031595 Ga0265313_10000856 Ga0265313_100008566 517
693 3300031711 Ga0265314_10000182 Ga0265314_1000018227 517
694 3300035691 Ga0373931_0001597 Ga0373931_0001597_6351_7934 517
695 3300045051 Ga0451576_0067703 Ga0451576_0067703_1949_3532 517
696 3300048903 Ga0496100_0049080 Ga0496100_0049080_289_1872 517
697 3300048905 Ga0496102_0142432 Ga0496102_0142432_617_2200 517
698 3300048906 Ga0496103_0039593 Ga0496103_0039593_598_2181 517
699 3300048912 Ga0496109_0128691 Ga0496109_0128691_476_2059 517
700 3300048914 Ga0496111_0044978 Ga0496111_0044978_785_2368 517
701 3300048917 Ga0496114_0133596 Ga0496114_0133596_474_2075 517
702 3300050492 nmdc:mga0yw44_108142_c1 nmdc:mga0yw44_108142_c1_90_1664 517
703 3300050511 nmdc:mga08y16_87533_c1 nmdc:mga08y16_87533_c1_1162_2772 517
704 iso_pu_bacteria 2851182111 2851183752 517
705 3300003215 JGI25153J46596_10002852 JGI25153J46596_100028527 518
706 3300003354 JGI25160J50197_1007102 JGI25160J50197_10071022 518
707 3300003794 Ga0055531_10009524 Ga0055531_100095244 518
708 3300005262 Ga0065165_1010604 Ga0065165_10106045 518
709 3300009093 Ga0105240_10004473 Ga0105240_1000447312 518
710 3300009093 Ga0105240_10097372 Ga0105240_100973723 518
711 3300009545 Ga0105237_10000523 Ga0105237_1000052315 518
712 3300009545 Ga0105237_10125072 Ga0105237_101250722 518
713 3300010159 Ga0099796_10007159 Ga0099796_100071592 518
714 3300021361 Ga0213872_10005329 Ga0213872_100053295 518
715 3300025297 Ga0209758_1000011 Ga0209758_1000011540 518
716 3300025302 Ga0207426_1006703 Ga0207426_10067036 518
717 3300025304 Ga0209257_1001101 Ga0209257_10011016 518
718 3300025913 Ga0207695_10045323 Ga0207695_100453233 518
719 3300025913 Ga0207695_10085964 Ga0207695_100859643 518
720 3300025914 Ga0207671_10114674 Ga0207671_101146741 518
721 3300025924 Ga0207694_10081682 Ga0207694_100816822 518
722 3300025940 Ga0207691_10001236 Ga0207691_100012365 518
723 3300028379 Ga0268266_10001288 Ga0268266_1000128823 518
724 3300028573 Ga0265334_10012354 Ga0265334_100123543 518
725 3300028577 Ga0265318_10000236 Ga0265318_1000023614 518
726 3300029957 Ga0265324_10000040 Ga0265324_1000004080 518
727 3300031235 Ga0265330_10000354 Ga0265330_1000035417 518
728 3300031239 Ga0265328_10001090 Ga0265328_100010902 518
729 3300031240 Ga0265320_10009072 Ga0265320_100090723 518
730 3300031242 Ga0265329_10000491 Ga0265329_1000049112 518
731 3300031242 Ga0265329_10010898 Ga0265329_100108982 518
732 3300031250 Ga0265331_10002513 Ga0265331_100025139 518
733 3300031344 Ga0265316_10001076 Ga0265316_1000107618 518
734 3300031344 Ga0265316_10041019 Ga0265316_100410191 518
735 3300031711 Ga0265314_10009657 Ga0265314_100096571 518
736 3300031712 Ga0265342_10000707 Ga0265342_100007077 518
737 3300035116 Ga0373945_0019037 Ga0373945_0019037_623_2206 518
738 3300035120 Ga0373957_0008762 Ga0373957_0008762_1339_2922 518
739 3300039437 Ga0436365_0881693 Ga0436365_0881693_2006_3589 518
740 3300039447 Ga0436361_0217304 Ga0436361_0217304_707_2287 518
741 3300039447 Ga0436361_0446852 Ga0436361_0446852_186_1766 518
742 3300039447 Ga0436361_0611093 Ga0436361_0611093_3065_4645 518
743 3300045051 Ga0451576_0113605 Ga0451576_0113605_32_1636 518
744 3300045976 Ga0466967_0179592 Ga0466967_0179592_159_1793 518
745 3300046477 Ga0495664_0036563 Ga0495664_0036563_749_2422 518
746 3300046517 Ga0495630_0010293 Ga0495630_0010293_3510_5126 518
747 3300046615 Ga0495656_0001420 Ga0495656_0001420_1477_3072 518
748 3300046642 Ga0495634_0001496 Ga0495634_0001496_3700_5316 518
749 3300046691 Ga0495670_0010707 Ga0495670_0010707_2429_4087 518
750 3300047319 Ga0495674_0006393 Ga0495674_0006393_4716_6332 518
751 3300048915 Ga0496112_0108981 Ga0496112_0108981_569_2155 518
752 iso_pu_bacteria 2829745981 2829746945 518
753 3300002987 JGI25159J45721_1004900 JGI25159J45721_10049003 519
754 3300003771 Ga0055526_1000447 Ga0055526_10004472 519
755 3300005262 Ga0065165_1000641 Ga0065165_100064129 519
756 3300005333 Ga0070677_10019275 Ga0070677_100192751 519
757 3300005355 Ga0070671_100118523 Ga0070671_1001185231 519
758 3300005365 Ga0070688_100025596 Ga0070688_1000255962 519
759 3300005459 Ga0068867_100025407 Ga0068867_1000254073 519
760 3300005468 Ga0070707_100018724 Ga0070707_1000187242 519
761 3300005471 Ga0070698_100006949 Ga0070698_1000069497 519
762 3300005518 Ga0070699_100030551 Ga0070699_1000305514 519
763 3300005536 Ga0070697_100038189 Ga0070697_1000381892 519
764 3300005983 Ga0081540_1003649 Ga0081540_100364911 519
765 3300006038 Ga0075365_10067876 Ga0075365_100678761 519
766 3300006173 Ga0070716_100007202 Ga0070716_1000072025 519
767 3300006173 Ga0070716_100031176 Ga0070716_1000311762 519
768 3300009094 Ga0111539_10053062 Ga0111539_100530626 519
769 3300025284 Ga0209130_1000648 Ga0209130_10006489 519
770 3300025295 Ga0209564_1000031 Ga0209564_1000031238 519
771 3300025299 Ga0209256_1000128 Ga0209256_100012897 519
772 3300025899 Ga0207642_10022875 Ga0207642_100228752 519
773 3300025936 Ga0207670_10028242 Ga0207670_100282422 519
774 3300025939 Ga0207665_10000994 Ga0207665_100009945 519
775 3300025941 Ga0207711_10010435 Ga0207711_100104355 519
776 3300026121 Ga0207683_10038522 Ga0207683_100385222 519
777 3300028653 Ga0265323_10010258 Ga0265323_100102582 519
778 3300028800 Ga0265338_10017545 Ga0265338_100175453 519
779 3300029957 Ga0265324_10000174 Ga0265324_1000017418 519
780 3300031238 Ga0265332_10005012 Ga0265332_100050121 519
781 3300031247 Ga0265340_10000256 Ga0265340_100002564 519
782 3300031247 Ga0265340_10003153 Ga0265340_100031534 519
783 3300031247 Ga0265340_10005099 Ga0265340_100050996 519
784 3300031249 Ga0265339_10000188 Ga0265339_1000018821 519
785 3300031250 Ga0265331_10016119 Ga0265331_100161192 519
786 3300031344 Ga0265316_10012949 Ga0265316_100129492 519
787 3300031595 Ga0265313_10012826 Ga0265313_100128261 519
788 3300031595 Ga0265313_10018307 Ga0265313_100183072 519
789 3300031711 Ga0265314_10000017 Ga0265314_1000001730 519
790 3300031711 Ga0265314_10013584 Ga0265314_100135842 519
791 3300031711 Ga0265314_10043964 Ga0265314_100439642 519
792 3300031712 Ga0265342_10000287 Ga0265342_1000028726 519
793 3300031712 Ga0265342_10003914 Ga0265342_100039145 519
794 3300031712 Ga0265342_10004024 Ga0265342_100040245 519
795 3300031712 Ga0265342_10040517 Ga0265342_100405171 519
796 3300041451 Ga0451791_1455622 Ga0451791_1455622_84_1676 519
797 3300041486 Ga0451807_1505972 Ga0451807_1505972_2245_3837 519
798 3300048917 Ga0496114_0144437 Ga0496114_0144437_212_1843 519
799 3300048924 Ga0496121_0002110 Ga0496121_0002110_27950_29548 519
800 3300048929 Ga0496126_0058324 Ga0496126_0058324_584_2182 519
801 3300049584 Ga0501068_0006369 Ga0501068_0006369_722_2350 519
802 3300050492 nmdc:mga0yw44_55460_c1 nmdc:mga0yw44_55460_c1_742_2325 519
803 3300050511 nmdc:mga08y16_40831_c1 nmdc:mga08y16_40831_c1_3146_4738 519
804 3300053079 Ga0500610_0039973 Ga0500610_0039973_220_1803 519
805 3300053153 Ga0500616_0007796 Ga0500616_0007796_4726_6330 519
806 3300053177 Ga0500636_0000970 Ga0500636_0000970_8533_10143 519
807 iso_pu_bacteria 2929615660 2929621258 519
808 iso_pu_bacteria 2929624759 2929625911 519
809 iso_pu_bacteria 2933577622 2933582873 519
810 iso_pu_bacteria 8055742211 8055744881 519
811 3300005340 Ga0070689_100000003 Ga0070689_100000003136 520
812 3300005937 Ga0081455_10008730 Ga0081455_100087306 520
813 3300005983 Ga0081540_1033317 Ga0081540_10333172 520
814 3300005985 Ga0081539_10000220 Ga0081539_100002206 520
815 3300007788 Ga0099795_10000439 Ga0099795_100004395 520
816 3300009177 Ga0105248_10265288 Ga0105248_102652881 520
817 3300010159 Ga0099796_10000306 Ga0099796_100003065 520
818 3300025936 Ga0207670_10000006 Ga0207670_10000006136 520
819 3300036401 Ga0373937_0001469 Ga0373937_0001469_11592_13181 520
820 3300039437 Ga0436365_0104564 Ga0436365_0104564_719_2359 520
821 3300041505 Ga0451849_0319247 Ga0451849_0319247_1447_3093 520
822 3300041512 Ga0451853_0598287 Ga0451853_0598287_3932_5578 520
823 iso_pu_bacteria 2511231028 2511398970 520
824 iso_pu_bacteria 2513237101 2513693776 520
825 iso_pu_bacteria 2513237104 2513721529 520
826 iso_pu_bacteria 2791355199 2793077835 520
827 iso_pu_bacteria 2824704595 2824711119 520
828 iso_pu_bacteria 2824753945 2824760446 520
829 iso_pu_bacteria 2824763712 2824766565 520
830 iso_pu_bacteria 2842698319 2842702894 520
831 iso_pu_bacteria 2844315083 2844320220 520
832 iso_pu_bacteria 2874604998 2874611643 520
833 iso_pu_bacteria 2874628541 2874630108 520
834 iso_pu_bacteria 2876808645 2876813551 520
835 iso_pu_bacteria 2879110137 2879117508 520
836 iso_pu_bacteria 2889033259 2889037755 520
837 iso_pu_bacteria 2903727486 2903731190 520
838 iso_pu_bacteria 2904711408 2904711737 520
839 iso_pu_bacteria 2906602504 2906610043 520
840 iso_pu_bacteria 2906626472 2906629214 520
841 iso_pu_bacteria 2922361189 2922361697 520
842 iso_pu_bacteria 2935769743 2935776452 520
843 iso_pu_bacteria 2935785616 2935792323 520
844 iso_pu_bacteria 2935793552 2935800502 520
845 iso_pu_bacteria 2935959822 2935962913 520
846 iso_pu_bacteria 3005710791 3005716007 520
847 iso_pu_bacteria 8006964411 8006966813 520
848 iso_pu_bacteria 8006984368 8006984683 520
849 iso_pu_bacteria 8006994254 8006994676 520
850 iso_pu_bacteria 8016583857 8016594608 520
851 3300005435 Ga0070714_100166027 Ga0070714_1001660271 521
852 3300005535 Ga0070684_100009421 Ga0070684_1000094214 521
853 3300049571 Ga0501034_0000019 Ga0501034_0000019_211376_213004 521
854 3300049572 Ga0501036_0023857 Ga0501036_0023857_2163_3791 521
855 3300049580 Ga0501046_0001737 Ga0501046_0001737_5009_6637 521
856 3300049581 Ga0501047_0000007 Ga0501047_0000007_229981_231609 521
857 3300049582 Ga0501048_0000943 Ga0501048_0000943_6842_8470 521
858 3300049583 Ga0501067_0010606 Ga0501067_0010606_17_1621 521
859 3300049586 Ga0501070_0002364 Ga0501070_0002364_4501_6129 521
860 3300049588 Ga0501072_0000026 Ga0501072_0000026_68897_70525 521
861 3300049588 Ga0501072_0045773 Ga0501072_0045773_1583_3211 521
862 3300049589 Ga0501073_0016789 Ga0501073_0016789_1803_3431 521
863 3300049741 Ga0501079_0000166 Ga0501079_0000166_13689_15317 521
864 3300049742 Ga0501080_0028749 Ga0501080_0028749_1745_3373 521
865 3300049744 Ga0501083_0045137 Ga0501083_0045137_204_1832 521
866 3300049823 Ga0501044_0022678 Ga0501044_0022678_3150_4775 521
867 3300053153 Ga0500616_0006394 Ga0500616_0006394_95_1687 521
868 3300054114 Ga0501084_0000021 Ga0501084_0000021_32826_34454 521
869 3300060353 Ga0501082_0002259 Ga0501082_0002259_5137_6765 521
870 iso_pu_bacteria 2507262055 2507507455 521
871 iso_pu_bacteria 2508501009 2508541569 521
872 iso_pu_bacteria 2508501042 2508692888 521
873 iso_pu_bacteria 2513237092 2513621664 521
874 iso_pu_bacteria 2513237094 2513636912 521
875 iso_pu_bacteria 2513237095 2513651143 521
876 iso_pu_bacteria 2513237102 2513700653 521
877 iso_pu_bacteria 2513237139 2513878363 521
878 iso_pu_bacteria 2513237161 2514011707 521
879 iso_pu_bacteria 2515154112 2515626278 521
880 iso_pu_bacteria 2517093001 2517107845 521
881 iso_pu_bacteria 2528768022 2528852881 521
882 iso_pu_bacteria 2602042107 2603858146 521
883 iso_pu_bacteria 2617270735 2617352713 521
884 iso_pu_bacteria 2617270741 2617372944 521
885 iso_pu_bacteria 2791355196 2793061087 521
886 iso_pu_bacteria 2802429603 2805920586 521
887 iso_pu_bacteria 2816332527 2818236777 521
888 iso_pu_bacteria 2824617872 2824622030 521
889 iso_pu_bacteria 2824626560 2824629294 521
890 iso_pu_bacteria 2824635225 2824639173 521
891 iso_pu_bacteria 2824661429 2824664040 521
892 iso_pu_bacteria 2824671348 2824675210 521
893 iso_pu_bacteria 2824679649 2824681567 521
894 iso_pu_bacteria 2824687955 2824690042 521
895 iso_pu_bacteria 2824696289 2824701155 521
896 iso_pu_bacteria 2824723954 2824731756 521
897 iso_pu_bacteria 2824732956 2824735652 521
898 iso_pu_bacteria 2824746037 2824752150 521
899 iso_pu_bacteria 2824773399 2824776685 521
900 iso_pu_bacteria 2838122688 2838127365 521
901 iso_pu_bacteria 2841941048 2841946384 521
902 iso_pu_bacteria 2841949485 2841957103 521
903 iso_pu_bacteria 2841957949 2841965623 521
904 iso_pu_bacteria 2841966195 2841972894 521
905 iso_pu_bacteria 2841974524 2841978434 521
906 iso_pu_bacteria 2841983080 2841987464 521
907 iso_pu_bacteria 2842038055 2842040860 521
908 iso_pu_bacteria 2842045827 2842046195 521
909 iso_pu_bacteria 2847939898 2847947967 521
910 iso_pu_bacteria 2849076700 2849078185 521
911 iso_pu_bacteria 2857524615 2857527535 521
912 iso_pu_bacteria 2874590934 2874598571 521
913 iso_pu_bacteria 2874612657 2874616759 521
914 iso_pu_bacteria 2874620515 2874628294 521
915 iso_pu_bacteria 2874645413 2874652024 521
916 iso_pu_bacteria 2876761206 2876768299 521
917 iso_pu_bacteria 2876771140 2876778609 521
918 iso_pu_bacteria 2876818435 2876823414 521
919 iso_pu_bacteria 2879074833 2879082402 521
920 iso_pu_bacteria 2879099564 2879107938 521
921 iso_pu_bacteria 2879127579 2879131817 521
922 iso_pu_bacteria 2879142872 2879150153 521
923 iso_pu_bacteria 2881364244 2881370119 521
924 iso_pu_bacteria 2881665667 2881670119 521
925 iso_pu_bacteria 2885366525 2885370184 521
926 iso_pu_bacteria 2885409591 2885414380 521
927 iso_pu_bacteria 2888378607 2888385700 521
928 iso_pu_bacteria 2888388044 2888392572 521
929 iso_pu_bacteria 2893066018 2893067029 521
930 iso_pu_bacteria 2904666416 2904674087 521
931 iso_pu_bacteria 2908775508 2908781393 521
932 iso_pu_bacteria 2919073203 2919073384 521
933 iso_pu_bacteria 2922368715 2922375948 521
934 iso_pu_bacteria 2922393267 2922396852 521
935 iso_pu_bacteria 2932784394 2932785205 521
936 iso_pu_bacteria 2932801729 2932808754 521
937 iso_pu_bacteria 2932809354 2932810238 521
938 iso_pu_bacteria 2932818245 2932821810 521
939 iso_pu_bacteria 2932828146 2932829041 521
940 iso_pu_bacteria 2935608549 2935610041 521
941 iso_pu_bacteria 2935616580 2935619539 521
942 iso_pu_bacteria 2935638405 2935638519 521
943 iso_pu_bacteria 2935648319 2935656349 521
944 iso_pu_bacteria 2935656913 2935660095 521
945 iso_pu_bacteria 2935665750 2935666629 521
946 iso_pu_bacteria 2935675223 2935682182 521
947 iso_pu_bacteria 2935684952 2935691164 521
948 iso_pu_bacteria 2935694250 2935694412 521
949 iso_pu_bacteria 2935703347 2935703525 521
950 iso_pu_bacteria 2935713505 2935718545 521
951 iso_pu_bacteria 2935722832 2935727475 521
952 iso_pu_bacteria 2935732158 2935736178 521
953 iso_pu_bacteria 2935741537 2935745558 521
954 iso_pu_bacteria 2935750917 2935755939 521
955 iso_pu_bacteria 2935760218 2935760797 521
956 iso_pu_bacteria 2935801545 2935801662 521
957 iso_pu_bacteria 2935810662 2935814927 521
958 iso_pu_bacteria 2935819856 2935823201 521
959 iso_pu_bacteria 2935827899 2935828013 521
960 iso_pu_bacteria 2935837841 2935842218 521
961 iso_pu_bacteria 2935847175 2935848783 521
962 iso_pu_bacteria 2935855204 2935858145 521
963 iso_pu_bacteria 2935864058 2935868050 521
964 iso_pu_bacteria 2935873716 2935873927 521
965 iso_pu_bacteria 2935883170 2935885683 521
966 iso_pu_bacteria 2935908558 2935909415 521
967 iso_pu_bacteria 2935916978 2935917137 521
968 iso_pu_bacteria 2935926038 2935926896 521
969 iso_pu_bacteria 2935934488 2935937260 521
970 iso_pu_bacteria 2935942939 2935944437 521
971 iso_pu_bacteria 2935951376 2935952874 521
972 iso_pu_bacteria 2935967501 2935969714 521
973 iso_pu_bacteria 2935975950 2935976325 521
974 iso_pu_bacteria 2935984226 2935991834 521
975 iso_pu_bacteria 2935992306 2935993149 521
976 iso_pu_bacteria 2936002035 2936003086 521
977 iso_pu_bacteria 2936011229 2936014511 521
978 iso_pu_bacteria 2936019824 2936027822 521
979 iso_pu_bacteria 2936028420 2936031292 521
980 iso_pu_bacteria 2936037263 2936040430 521
981 iso_pu_bacteria 2936046547 2936049617 521
982 iso_pu_bacteria 2936055302 2936061167 521
983 iso_pu_bacteria 2940556831 2940562086 521
984 iso_pu_bacteria 2941538514 2941542267 521
985 iso_pu_bacteria 3005483717 3005488452 521
986 iso_pu_bacteria 3005506211 3005508226 521
987 iso_pu_bacteria 3005587118 3005588275 521
988 iso_pu_bacteria 3005594810 3005600533 521
989 iso_pu_bacteria 3005718088 3005723356 521
990 iso_pu_bacteria 8006926726 8006928641 521
991 iso_pu_bacteria 8016511872 8016520419 521
992 iso_pu_bacteria 8016630954 8016638941 521
993 iso_pu_bacteria 8017057580 8017065155 521
994 iso_pu_bacteria 8019586578 8019592319 521
995 iso_pu_bacteria 8019608314 8019609407 521
996 iso_pu_bacteria 8019629233 8019633075 521
997 iso_pu_bacteria 8019648815 8019649602 521
998 iso_pu_bacteria 8019668869 8019670516 521
999 iso_pu_bacteria 8019687851 8019691292 521
1000 iso_pu_bacteria 8056967851 8056974847 521
1001 3300002070 JGI24750J21931_1000961 JGI24750J21931_10009612 522
1002 3300005327 Ga0070658_10030065 Ga0070658_100300653 522
1003 3300005336 Ga0070680_100006002 Ga0070680_1000060025 522
1004 3300005338 Ga0068868_100004970 Ga0068868_1000049704 522
1005 3300005340 Ga0070689_100003777 Ga0070689_1000037775 522
1006 3300005347 Ga0070668_100002551 Ga0070668_1000025513 522
1007 3300005355 Ga0070671_100001960 Ga0070671_1000019606 522
1008 3300005364 Ga0070673_100018372 Ga0070673_1000183723 522
1009 3300005367 Ga0070667_100043409 Ga0070667_1000434092 522
1010 3300005367 Ga0070667_100065659 Ga0070667_1000656592 522
1011 3300005438 Ga0070701_10003498 Ga0070701_100034983 522
1012 3300005441 Ga0070700_100029752 Ga0070700_1000297522 522
1013 3300005530 Ga0070679_100028198 Ga0070679_1000281983 522
1014 3300005539 Ga0068853_100005048 Ga0068853_1000050482 522
1015 3300005544 Ga0070686_100005830 Ga0070686_1000058303 522
1016 3300005548 Ga0070665_100044258 Ga0070665_1000442582 522
1017 3300005563 Ga0068855_100070333 Ga0068855_1000703333 522
1018 3300005578 Ga0068854_100046172 Ga0068854_1000461722 522
1019 3300005615 Ga0070702_100002985 Ga0070702_1000029852 522
1020 3300005617 Ga0068859_100000234 Ga0068859_10000023416 522
1021 3300005617 Ga0068859_100015278 Ga0068859_1000152783 522
1022 3300005618 Ga0068864_100016415 Ga0068864_1000164154 522
1023 3300005841 Ga0068863_100011468 Ga0068863_1000114686 522
1024 3300005842 Ga0068858_100002969 Ga0068858_10000296912 522
1025 3300005843 Ga0068860_100023935 Ga0068860_1000239355 522
1026 3300005843 Ga0068860_100026183 Ga0068860_1000261832 522
1027 3300006358 Ga0068871_100040734 Ga0068871_1000407342 522
1028 3300006931 Ga0097620_100000234 Ga0097620_10000023416 522
1029 3300006931 Ga0097620_100015278 Ga0097620_1000152784 522
1030 3300007265 Ga0099794_10054279 Ga0099794_100542792 522
1031 3300007788 Ga0099795_10003692 Ga0099795_100036921 522
1032 3300009176 Ga0105242_10016950 Ga0105242_100169503 522
1033 3300009551 Ga0105238_10003007 Ga0105238_100030073 522
1034 3300013306 Ga0163162_10016774 Ga0163162_100167743 522
1035 3300014325 Ga0163163_10002766 Ga0163163_1000276610 522
1036 3300014325 Ga0163163_10032153 Ga0163163_100321534 522
1037 3300014968 Ga0157379_10000171 Ga0157379_1000017121 522
1038 3300014969 Ga0157376_10039904 Ga0157376_100399043 522
1039 3300025900 Ga0207710_10019832 Ga0207710_100198322 522
1040 3300025901 Ga0207688_10000290 Ga0207688_1000029017 522
1041 3300025907 Ga0207645_10033658 Ga0207645_100336582 522
1042 3300025908 Ga0207643_10003975 Ga0207643_100039755 522
1043 3300025909 Ga0207705_10042106 Ga0207705_100421063 522
1044 3300025917 Ga0207660_10017407 Ga0207660_100174073 522
1045 3300025921 Ga0207652_10013425 Ga0207652_100134255 522
1046 3300025921 Ga0207652_10126863 Ga0207652_101268632 522
1047 3300025923 Ga0207681_10051971 Ga0207681_100519712 522
1048 3300025924 Ga0207694_10020560 Ga0207694_100205602 522
1049 3300025925 Ga0207650_10039320 Ga0207650_100393203 522
1050 3300025927 Ga0207687_10010698 Ga0207687_100106984 522
1051 3300025931 Ga0207644_10001329 Ga0207644_100013299 522
1052 3300025937 Ga0207669_10009904 Ga0207669_100099042 522
1053 3300025942 Ga0207689_10025964 Ga0207689_100259643 522
1054 3300025960 Ga0207651_10058353 Ga0207651_100583532 522
1055 3300025986 Ga0207658_10029979 Ga0207658_100299792 522
1056 3300026035 Ga0207703_10003952 Ga0207703_100039522 522
1057 3300026075 Ga0207708_10010903 Ga0207708_100109035 522
1058 3300026088 Ga0207641_10009357 Ga0207641_100093578 522
1059 3300028379 Ga0268266_10053622 Ga0268266_100536222 522
1060 3300031249 Ga0265339_10004932 Ga0265339_100049324 522
1061 3300031730 Ga0307516_10033324 Ga0307516_100333243 522
1062 3300035116 Ga0373945_0008060 Ga0373945_0008060_556_2208 522
1063 3300035171 Ga0373946_0013817 Ga0373946_0013817_1259_2911 522
1064 3300035172 Ga0373955_0016122 Ga0373955_0016122_737_2389 522
1065 3300035691 Ga0373931_0008056 Ga0373931_0008056_278_1870 522
1066 3300035692 Ga0373935_0000244 Ga0373935_0000244_7308_8960 522
1067 3300035695 Ga0373927_0029296 Ga0373927_0029296_1245_2837 522
1068 3300035725 Ga0373947_0002144 Ga0373947_0002144_4475_6127 522
1069 3300036401 Ga0373937_0004952 Ga0373937_0004952_3030_4682 522
1070 3300037068 Ga0373925_0001674 Ga0373925_0001674_3588_5240 522
1071 3300037068 Ga0373925_0015046 Ga0373925_0015046_1111_2757 522
1072 3300042125 Ga0450923_007746 Ga0450923_007746_143_1789 522
1073 3300046455 Ga0495603_0000370 Ga0495603_0000370_2384_4036 522
1074 3300046472 Ga0495580_0000435 Ga0495580_0000435_28365_30017 522
1075 3300046473 Ga0495582_0000051 Ga0495582_0000051_22146_23798 522
1076 3300046475 Ga0495639_0000010 Ga0495639_0000010_76639_78291 522
1077 3300046476 Ga0495662_0000097 Ga0495662_0000097_28099_29751 522
1078 3300046499 Ga0495594_0001553 Ga0495594_0001553_4030_5682 522
1079 3300046531 Ga0495665_0000005 Ga0495665_0000005_63766_65418 522
1080 3300046533 Ga0495640_0000301 Ga0495640_0000301_16923_18575 522
1081 3300046663 Ga0495635_0000259 Ga0495635_0000259_10239_11891 522
1082 3300046663 Ga0495635_0092383 Ga0495635_0092383_154_1806 522
1083 3300046689 Ga0495613_0001985 Ga0495613_0001985_10466_12118 522
1084 3300046690 Ga0495624_0000094 Ga0495624_0000094_41396_43048 522
1085 3300047315 Ga0495581_0000810 Ga0495581_0000810_8970_10622 522
1086 3300047319 Ga0495674_0000955 Ga0495674_0000955_17138_18790 522
1087 3300047444 Ga0495675_0066824 Ga0495675_0066824_189_1841 522
1088 3300048904 Ga0496101_0110773 Ga0496101_0110773_433_2040 522
1089 3300048909 Ga0496106_0006585 Ga0496106_0006585_2742_4331 522
1090 3300048911 Ga0496108_0026218 Ga0496108_0026218_2429_4018 522
1091 3300048912 Ga0496109_0011092 Ga0496109_0011092_4069_5658 522
1092 3300048915 Ga0496112_0000019 Ga0496112_0000019_77440_79092 522
1093 3300048916 Ga0496113_0007321 Ga0496113_0007321_4191_5780 522
1094 3300048917 Ga0496114_0001911 Ga0496114_0001911_2001_3608 522
1095 3300048918 Ga0496115_0014571 Ga0496115_0014571_669_2276 522
1096 3300048918 Ga0496115_0019418 Ga0496115_0019418_917_2506 522
1097 3300048929 Ga0496126_0102048 Ga0496126_0102048_670_2322 522
1098 3300049589 Ga0501073_0018397 Ga0501073_0018397_3243_4913 522
1099 3300050512 nmdc:mga0n895_38751_c1 nmdc:mga0n895_38751_c1_2198_3790 522
1100 3300053077 Ga0495601_0014613 Ga0495601_0014613_1690_3339 522
1101 3300053085 Ga0495619_0038523 Ga0495619_0038523_879_2528 522
1102 iso_pu_bacteria 2513237098 2513674091 522
1103 iso_pu_bacteria 2513237141 2513892568 522
1104 iso_pu_bacteria 2524023210 2524465547 522
1105 iso_pu_bacteria 2721755755 2723843443 522
1106 iso_pu_bacteria 2903768456 2903770714 522
1107 iso_pu_bacteria 2922386360 2922387042 522
1108 iso_pu_bacteria 2932794094 2932799657 522
1109 iso_pu_bacteria 8056673599 8056680856 522
1110 3300005347 Ga0070668_100003954 Ga0070668_10000395410 523
1111 3300005353 Ga0070669_100000962 Ga0070669_1000009622 523
1112 3300005367 Ga0070667_100020729 Ga0070667_1000207293 523
1113 3300005434 Ga0070709_10002197 Ga0070709_100021972 523
1114 3300005435 Ga0070714_100002801 Ga0070714_1000028016 523
1115 3300005435 Ga0070714_100191273 Ga0070714_1001912731 523
1116 3300005437 Ga0070710_10033066 Ga0070710_100330661 523
1117 3300005439 Ga0070711_100003772 Ga0070711_1000037727 523
1118 3300005439 Ga0070711_100006265 Ga0070711_1000062652 523
1119 3300005439 Ga0070711_100012735 Ga0070711_1000127354 523
1120 3300005458 Ga0070681_10048858 Ga0070681_100488583 523
1121 3300005539 Ga0068853_100001192 Ga0068853_10000119210 523
1122 3300005548 Ga0070665_100000507 Ga0070665_10000050721 523
1123 3300005577 Ga0068857_100066482 Ga0068857_1000664823 523
1124 3300005834 Ga0068851_10056742 Ga0068851_100567422 523
1125 3300005843 Ga0068860_100000101 Ga0068860_1000001014 523
1126 3300005843 Ga0068860_100014572 Ga0068860_1000145726 523
1127 3300005844 Ga0068862_100083157 Ga0068862_1000831573 523
1128 3300006163 Ga0070715_10001127 Ga0070715_100011272 523
1129 3300006186 Ga0075369_10026585 Ga0075369_100265852 523
1130 3300009011 Ga0105251_10000989 Ga0105251_100009893 523
1131 3300009101 Ga0105247_10066045 Ga0105247_100660452 523
1132 3300014969 Ga0157376_10115038 Ga0157376_101150382 523
1133 3300025297 Ga0209758_1001027 Ga0209758_100102723 523
1134 3300025315 Ga0207697_10021382 Ga0207697_100213823 523
1135 3300025735 Ga0207713_1001270 Ga0207713_100127018 523
1136 3300025906 Ga0207699_10001610 Ga0207699_100016102 523
1137 3300025912 Ga0207707_10029159 Ga0207707_100291596 523
1138 3300025923 Ga0207681_10000344 Ga0207681_1000034412 523
1139 3300025928 Ga0207700_10030830 Ga0207700_100308302 523
1140 3300025929 Ga0207664_10007788 Ga0207664_100077886 523
1141 3300025939 Ga0207665_10012034 Ga0207665_100120342 523
1142 3300025972 Ga0207668_10002375 Ga0207668_100023753 523
1143 3300025986 Ga0207658_10008836 Ga0207658_100088363 523
1144 3300026041 Ga0207639_10001095 Ga0207639_100010958 523
1145 3300026067 Ga0207678_10014197 Ga0207678_100141975 523
1146 3300026088 Ga0207641_10002051 Ga0207641_1000205112 523
1147 3300026116 Ga0207674_10004839 Ga0207674_100048396 523
1148 3300026116 Ga0207674_10151754 Ga0207674_101517542 523
1149 3300026142 Ga0207698_10036023 Ga0207698_100360233 523
1150 3300028379 Ga0268266_10000616 Ga0268266_100006167 523
1151 3300028381 Ga0268264_10000030 Ga0268264_10000030224 523
1152 3300028381 Ga0268264_10003137 Ga0268264_100031377 523
1153 3300028563 Ga0265319_1003155 Ga0265319_10031552 523
1154 3300028573 Ga0265334_10002358 Ga0265334_100023587 523
1155 3300028653 Ga0265323_10000434 Ga0265323_1000043416 523
1156 3300028654 Ga0265322_10008928 Ga0265322_100089283 523
1157 3300028666 Ga0265336_10000649 Ga0265336_100006499 523
1158 3300028800 Ga0265338_10000280 Ga0265338_1000028042 523
1159 3300031250 Ga0265331_10034447 Ga0265331_100344472 523
1160 3300031616 Ga0307508_10001411 Ga0307508_1000141115 523
1161 3300031711 Ga0265314_10011314 Ga0265314_100113143 523
1162 3300035695 Ga0373927_0011775 Ga0373927_0011775_3910_5508 523
1163 3300035724 Ga0373933_0003599 Ga0373933_0003599_6774_8372 523
1164 3300036401 Ga0373937_0000995 Ga0373937_0000995_12179_13777 523
1165 3300039437 Ga0436365_1236739 Ga0436365_1236739_28361_30010 523
1166 3300046454 Ga0495592_0010499 Ga0495592_0010499_337_1935 523
1167 3300046459 Ga0495629_0001947 Ga0495629_0001947_1157_2755 523
1168 3300046462 Ga0495651_0001194 Ga0495651_0001194_12712_14310 523
1169 3300046463 Ga0495653_0000561 Ga0495653_0000561_13905_15503 523
1170 3300046516 Ga0495628_0084694 Ga0495628_0084694_221_1819 523
1171 3300046517 Ga0495630_0040664 Ga0495630_0040664_508_2106 523
1172 3300046524 Ga0495648_0002889 Ga0495648_0002889_5895_7520 523
1173 3300046529 Ga0495652_0005002 Ga0495652_0005002_3073_4671 523
1174 3300046536 Ga0495587_0000608 Ga0495587_0000608_20202_21800 523
1175 3300046642 Ga0495634_0000878 Ga0495634_0000878_8885_10483 523
1176 3300046675 Ga0495657_0019856 Ga0495657_0019856_1856_3454 523
1177 3300046679 Ga0495623_0002010 Ga0495623_0002010_6833_8431 523
1178 3300046680 Ga0495646_0015040 Ga0495646_0015040_448_2046 523
1179 3300046683 Ga0495658_0050687 Ga0495658_0050687_619_2217 523
1180 3300046689 Ga0495613_0056067 Ga0495613_0056067_861_2459 523
1181 3300046689 Ga0495613_0065381 Ga0495613_0065381_152_1825 523
1182 3300046809 Ga0495600_0001094 Ga0495600_0001094_4544_6142 523
1183 3300047315 Ga0495581_0050468 Ga0495581_0050468_652_2250 523
1184 3300047317 Ga0495604_0003631 Ga0495604_0003631_4931_6529 523
1185 3300047319 Ga0495674_0001687 Ga0495674_0001687_4701_6299 523
1186 3300047322 Ga0495680_0000539 Ga0495680_0000539_4223_5821 523
1187 3300047444 Ga0495675_0011659 Ga0495675_0011659_1167_2765 523
1188 3300047471 Ga0495684_0002819 Ga0495684_0002819_3817_5415 523
1189 3300048905 Ga0496102_0018812 Ga0496102_0018812_1348_3003 523
1190 3300048906 Ga0496103_0012379 Ga0496103_0012379_2019_3602 523
1191 3300048912 Ga0496109_0070516 Ga0496109_0070516_1386_3041 523
1192 3300048913 Ga0496110_0100818 Ga0496110_0100818_425_2080 523
1193 3300048916 Ga0496113_0032298 Ga0496113_0032298_1393_3048 523
1194 3300048919 Ga0496116_0004642 Ga0496116_0004642_9292_10938 523
1195 3300048919 Ga0496116_0017333 Ga0496116_0017333_2152_3735 523
1196 3300048920 Ga0496117_0028571 Ga0496117_0028571_1398_3044 523
1197 3300048921 Ga0496118_0008432 Ga0496118_0008432_5870_7453 523
1198 3300048921 Ga0496118_0018408 Ga0496118_0018408_919_2565 523
1199 3300048922 Ga0496119_0029020 Ga0496119_0029020_718_2301 523
1200 3300048924 Ga0496121_0010787 Ga0496121_0010787_3300_4883 523
1201 3300049589 Ga0501073_0000273 Ga0501073_0000273_22436_24058 523
1202 3300053078 Ga0495612_0004149 Ga0495612_0004149_1093_2691 523
1203 3300053084 Ga0495595_0000250 Ga0495595_0000250_9982_11580 523
1204 3300053085 Ga0495619_0002268 Ga0495619_0002268_5009_6607 523
1205 3300053093 Ga0500651_0001180 Ga0500651_0001180_10818_12470 523
1206 3300053119 Ga0500595_008317 Ga0500595_008317_1266_2918 523
1207 3300053139 Ga0500568_0038550 Ga0500568_0038550_132_1784 523
1208 iso_pu_bacteria 2919450847 2919451966 523
1209 iso_pu_bacteria 8001845381 8001849946 523
1210 3300003203 JGI25406J46586_10000471 JGI25406J46586_100004715 524
1211 3300003215 JGI25153J46596_10000317 JGI25153J46596_100003174 524
1212 3300005331 Ga0070670_100106820 Ga0070670_1001068202 524
1213 3300005347 Ga0070668_100023571 Ga0070668_1000235713 524
1214 3300005347 Ga0070668_100081988 Ga0070668_1000819882 524
1215 3300005434 Ga0070709_10009537 Ga0070709_100095374 524
1216 3300005435 Ga0070714_100033885 Ga0070714_1000338854 524
1217 3300005436 Ga0070713_100007044 Ga0070713_1000070445 524
1218 3300005436 Ga0070713_100029458 Ga0070713_1000294584 524
1219 3300005436 Ga0070713_100119994 Ga0070713_1001199942 524
1220 3300005456 Ga0070678_100042026 Ga0070678_1000420262 524
1221 3300005466 Ga0070685_10036955 Ga0070685_100369552 524
1222 3300005468 Ga0070707_100058714 Ga0070707_1000587142 524
1223 3300005518 Ga0070699_100005556 Ga0070699_1000055562 524
1224 3300005983 Ga0081540_1006453 Ga0081540_10064536 524
1225 3300005985 Ga0081539_10000048 Ga0081539_1000004818 524
1226 3300006028 Ga0070717_10001656 Ga0070717_100016568 524
1227 3300006038 Ga0075365_10041229 Ga0075365_100412292 524
1228 3300006163 Ga0070715_10019430 Ga0070715_100194301 524
1229 3300006173 Ga0070716_100006731 Ga0070716_1000067311 524
1230 3300006237 Ga0097621_100108212 Ga0097621_1001082122 524
1231 3300006871 Ga0075434_100006092 Ga0075434_1000060924 524
1232 3300006881 Ga0068865_100070136 Ga0068865_1000701362 524
1233 3300007265 Ga0099794_10019822 Ga0099794_100198223 524
1234 3300009147 Ga0114129_10420069 Ga0114129_104200691 524
1235 3300009148 Ga0105243_10143483 Ga0105243_101434831 524
1236 3300009174 Ga0105241_10090950 Ga0105241_100909502 524
1237 3300009551 Ga0105238_10027647 Ga0105238_100276472 524
1238 3300009553 Ga0105249_10099150 Ga0105249_100991502 524
1239 3300013297 Ga0157378_10037039 Ga0157378_100370392 524
1240 3300025297 Ga0209758_1000120 Ga0209758_100012042 524
1241 3300025297 Ga0209758_1005026 Ga0209758_10050262 524
1242 3300025297 Ga0209758_1018545 Ga0209758_10185452 524
1243 3300025898 Ga0207692_10015414 Ga0207692_100154142 524
1244 3300025910 Ga0207684_10027597 Ga0207684_100275974 524
1245 3300025911 Ga0207654_10046562 Ga0207654_100465622 524
1246 3300025916 Ga0207663_10007530 Ga0207663_100075303 524
1247 3300025922 Ga0207646_10023526 Ga0207646_100235262 524
1248 3300025922 Ga0207646_10036804 Ga0207646_100368043 524
1249 3300025928 Ga0207700_10019379 Ga0207700_100193792 524
1250 3300025928 Ga0207700_10031621 Ga0207700_100316212 524
1251 3300025928 Ga0207700_10081122 Ga0207700_100811222 524
1252 3300025929 Ga0207664_10168176 Ga0207664_101681761 524
1253 3300025940 Ga0207691_10014041 Ga0207691_100140415 524
1254 3300025961 Ga0207712_10130621 Ga0207712_101306211 524
1255 3300026067 Ga0207678_10012506 Ga0207678_100125066 524
1256 3300026089 Ga0207648_10101649 Ga0207648_101016492 524
1257 3300026118 Ga0207675_100146824 Ga0207675_1001468242 524
1258 3300031247 Ga0265340_10009402 Ga0265340_100094024 524
1259 3300032126 Ga0307415_100090042 Ga0307415_1000900421 524
1260 3300033180 Ga0307510_10097116 Ga0307510_100971162 524
1261 3300034818 Ga0373950_0000031 Ga0373950_0000031_71104_72729 524
1262 3300035086 Ga0373934_0003030 Ga0373934_0003030_1961_3619 524
1263 3300035086 Ga0373934_0010197 Ga0373934_0010197_1893_3512 524
1264 3300035118 Ga0373954_0000084 Ga0373954_0000084_11237_12895 524
1265 3300035119 Ga0373956_0000384 Ga0373956_0000384_5697_7355 524
1266 3300035170 Ga0373943_0014882 Ga0373943_0014882_1551_3209 524
1267 3300035170 Ga0373943_0038440 Ga0373943_0038440_82_1677 524
1268 3300035172 Ga0373955_0001982 Ga0373955_0001982_2278_3936 524
1269 3300035691 Ga0373931_0066644 Ga0373931_0066644_116_1777 524
1270 3300035695 Ga0373927_0016320 Ga0373927_0016320_1194_2789 524
1271 3300035724 Ga0373933_0000576 Ga0373933_0000576_3758_5377 524
1272 3300035724 Ga0373933_0002444 Ga0373933_0002444_2919_4577 524
1273 3300046459 Ga0495629_0006802 Ga0495629_0006802_5052_6710 524
1274 3300046460 Ga0495638_0089584 Ga0495638_0089584_17_1675 524
1275 3300046462 Ga0495651_0027951 Ga0495651_0027951_1203_2861 524
1276 3300046476 Ga0495662_0045247 Ga0495662_0045247_237_1895 524
1277 3300046507 Ga0495606_0000265 Ga0495606_0000265_8363_10021 524
1278 3300046511 Ga0495608_0026124 Ga0495608_0026124_1664_3322 524
1279 3300046525 Ga0495663_0010022 Ga0495663_0010022_555_2213 524
1280 3300046529 Ga0495652_0003743 Ga0495652_0003743_1664_3322 524
1281 3300046533 Ga0495640_0008933 Ga0495640_0008933_927_2585 524
1282 3300046536 Ga0495587_0019048 Ga0495587_0019048_662_2320 524
1283 3300046543 Ga0495645_0043804 Ga0495645_0043804_1192_2850 524
1284 3300046559 Ga0495667_0010607 Ga0495667_0010607_1746_3404 524
1285 3300046642 Ga0495634_0082617 Ga0495634_0082617_120_1778 524
1286 3300046663 Ga0495635_0001844 Ga0495635_0001844_4725_6383 524
1287 3300046675 Ga0495657_0011319 Ga0495657_0011319_2060_3718 524
1288 3300046678 Ga0495599_0003115 Ga0495599_0003115_3655_5313 524
1289 3300046689 Ga0495613_0004516 Ga0495613_0004516_1084_2742 524
1290 3300046809 Ga0495600_0007977 Ga0495600_0007977_1999_3657 524
1291 3300047315 Ga0495581_0036014 Ga0495581_0036014_699_2363 524
1292 3300047317 Ga0495604_0006658 Ga0495604_0006658_4578_6236 524
1293 3300047319 Ga0495674_0010503 Ga0495674_0010503_271_1929 524
1294 3300047321 Ga0495676_0083113 Ga0495676_0083113_68_1726 524
1295 3300047322 Ga0495680_0038000 Ga0495680_0038000_254_1912 524
1296 3300047444 Ga0495675_0008558 Ga0495675_0008558_1467_3125 524
1297 3300047471 Ga0495684_0000777 Ga0495684_0000777_22541_24199 524
1298 3300047673 Ga0495593_0002656 Ga0495593_0002656_4311_5969 524
1299 3300048088 Ga0495602_0001871 Ga0495602_0001871_3277_4935 524
1300 3300048906 Ga0496103_0012210 Ga0496103_0012210_2769_4364 524
1301 3300048913 Ga0496110_0092088 Ga0496110_0092088_628_2289 524
1302 3300048913 Ga0496110_0120056 Ga0496110_0120056_38_1699 524
1303 3300048914 Ga0496111_0006918 Ga0496111_0006918_824_2485 524
1304 3300048914 Ga0496111_0081028 Ga0496111_0081028_107_1702 524
1305 3300048917 Ga0496114_0049882 Ga0496114_0049882_1569_3179 524
1306 3300048920 Ga0496117_0057840 Ga0496117_0057840_682_2343 524
1307 3300048925 Ga0496122_0068513 Ga0496122_0068513_132_1790 524
1308 3300048929 Ga0496126_0001629 Ga0496126_0001629_28742_30403 524
1309 3300048929 Ga0496126_0035854 Ga0496126_0035854_2317_3975 524
1310 3300049586 Ga0501070_0000083 Ga0501070_0000083_3374_4984 524
1311 3300049589 Ga0501073_0055969 Ga0501073_0055969_881_2491 524
1312 3300049742 Ga0501080_0043578 Ga0501080_0043578_2026_3636 524
1313 3300050489 nmdc:mga03683_3_c1 nmdc:mga03683_3_c1_256173_257759 524
1314 3300050493 nmdc:mga0k408_2_c1 nmdc:mga0k408_2_c1_292988_294574 524
1315 3300050516 nmdc:mga0sz30_162_c1 nmdc:mga0sz30_162_c1_2244_3830 524
1316 3300053084 Ga0495595_0008027 Ga0495595_0008027_1697_3307 524
1317 3300053085 Ga0495619_0024706 Ga0495619_0024706_662_2320 524
1318 3300053085 Ga0495619_0082652 Ga0495619_0082652_350_2008 524
1319 3300053094 Ga0500566_0000011 Ga0500566_0000011_65345_67003 524
1320 3300053102 Ga0500554_003790 Ga0500554_003790_1293_2951 524
1321 3300053111 Ga0500572_000065 Ga0500572_000065_3415_5073 524
1322 3300053111 Ga0500572_001006 Ga0500572_001006_6446_8104 524
1323 3300053119 Ga0500595_000364 Ga0500595_000364_7708_9366 524
1324 3300053136 Ga0500559_0001342 Ga0500559_0001342_6413_8071 524
1325 3300053136 Ga0500559_0001798 Ga0500559_0001798_8847_10505 524
1326 3300053150 Ga0500603_000269 Ga0500603_000269_5271_6929 524
1327 3300053150 Ga0500603_000319 Ga0500603_000319_2454_4112 524
1328 3300053159 Ga0500630_000832 Ga0500630_000832_9396_11054 524
1329 3300053161 Ga0500634_0043227 Ga0500634_0043227_736_2394 524
1330 3300053162 Ga0500638_000081 Ga0500638_000081_209_1867 524
1331 3300053163 Ga0500639_000079 Ga0500639_000079_7559_9217 524
1332 3300053178 Ga0500637_0002424 Ga0500637_0002424_5703_7361 524
1333 3300053725 Ga0500576_001460 Ga0500576_001460_396_2054 524
1334 3300053735 Ga0500596_000987 Ga0500596_000987_3541_5199 524
1335 3300055283 Ga0500661_001337 Ga0500661_001337_757_2415 524
1336 3300060353 Ga0501082_0000615 Ga0501082_0000615_9162_10772 524
1337 3300005436 Ga0070713_100095835 Ga0070713_1000958352 525
1338 3300006028 Ga0070717_10008544 Ga0070717_100085444 525
1339 3300006931 Ga0097620_100192051 Ga0097620_1001920512 525
1340 3300031730 Ga0307516_10024291 Ga0307516_100242912 525
1341 3300034818 Ga0373950_0000029 Ga0373950_0000029_144462_146087 525
1342 3300046557 Ga0495622_0025083 Ga0495622_0025083_640_2310 525
1343 3300048921 Ga0496118_0035458 Ga0496118_0035458_209_1879 525
1344 3300048924 Ga0496121_0000089 Ga0496121_0000089_3058_4728 525
1345 3300048927 Ga0496124_0004464 Ga0496124_0004464_696_2366 525
1346 3300048929 Ga0496126_0002122 Ga0496126_0002122_3278_4948 525
1347 3300049583 Ga0501067_0000087 Ga0501067_0000087_37931_39556 525
1348 3300049589 Ga0501073_0000740 Ga0501073_0000740_9363_10988 525
1349 3300053121 Ga0500607_000573 Ga0500607_000573_33139_34734 525
1350 iso_pu_bacteria 2582581305 2585262654 525
1351 3300002076 JGI24749J21850_1000081 JGI24749J21850_10000812 526
1352 3300002459 JGI24751J29686_10000128 JGI24751J29686_1000012830 526
1353 3300005295 Ga0065707_10124715 Ga0065707_101247152 526
1354 3300005331 Ga0070670_100000282 Ga0070670_10000028214 526
1355 3300005347 Ga0070668_100000702 Ga0070668_10000070224 526
1356 3300005347 Ga0070668_100008213 Ga0070668_1000082137 526
1357 3300005353 Ga0070669_100000243 Ga0070669_10000024322 526
1358 3300005367 Ga0070667_100000387 Ga0070667_10000038714 526
1359 3300005367 Ga0070667_100000881 Ga0070667_10000088113 526
1360 3300005548 Ga0070665_100001151 Ga0070665_10000115125 526
1361 3300005617 Ga0068859_100008985 Ga0068859_1000089855 526
1362 3300005618 Ga0068864_100000289 Ga0068864_10000028914 526
1363 3300005618 Ga0068864_100000491 Ga0068864_10000049125 526
1364 3300005719 Ga0068861_100010355 Ga0068861_1000103554 526
1365 3300005841 Ga0068863_100004096 Ga0068863_1000040963 526
1366 3300005842 Ga0068858_100023028 Ga0068858_1000230287 526
1367 3300005843 Ga0068860_100000167 Ga0068860_10000016756 526
1368 3300005844 Ga0068862_100000073 Ga0068862_10000007328 526
1369 3300005844 Ga0068862_100003402 Ga0068862_1000034029 526
1370 3300006048 Ga0075363_100000226 Ga0075363_10000022618 526
1371 3300006177 Ga0075362_10000015 Ga0075362_1000001532 526
1372 3300006186 Ga0075369_10000089 Ga0075369_100000894 526
1373 3300006195 Ga0075366_10000072 Ga0075366_1000007232 526
1374 3300006931 Ga0097620_100008985 Ga0097620_1000089855 526
1375 3300009177 Ga0105248_10000493 Ga0105248_1000049328 526
1376 3300009553 Ga0105249_10002340 Ga0105249_100023408 526
1377 3300010375 Ga0105239_10046277 Ga0105239_100462773 526
1378 3300013306 Ga0163162_10043667 Ga0163162_100436673 526
1379 3300014326 Ga0157380_10000347 Ga0157380_1000034713 526
1380 3300017792 Ga0163161_10083594 Ga0163161_100835941 526
1381 3300025903 Ga0207680_10032857 Ga0207680_100328573 526
1382 3300025923 Ga0207681_10000023 Ga0207681_10000023147 526
1383 3300025925 Ga0207650_10000029 Ga0207650_10000029155 526
1384 3300025925 Ga0207650_10000074 Ga0207650_1000007457 526
1385 3300025941 Ga0207711_10000541 Ga0207711_1000054110 526
1386 3300025961 Ga0207712_10001178 Ga0207712_100011788 526
1387 3300025972 Ga0207668_10000093 Ga0207668_1000009355 526
1388 3300025972 Ga0207668_10015911 Ga0207668_100159113 526
1389 3300025986 Ga0207658_10000266 Ga0207658_1000026643 526
1390 3300025986 Ga0207658_10001288 Ga0207658_100012889 526
1391 3300026035 Ga0207703_10005822 Ga0207703_1000582210 526
1392 3300026088 Ga0207641_10006748 Ga0207641_100067481 526
1393 3300026095 Ga0207676_10000059 Ga0207676_1000005976 526
1394 3300026095 Ga0207676_10000674 Ga0207676_1000067423 526
1395 3300026118 Ga0207675_100003638 Ga0207675_1000036386 526
1396 3300028379 Ga0268266_10006154 Ga0268266_100061543 526
1397 3300028380 Ga0268265_10000018 Ga0268265_1000001830 526
1398 3300028380 Ga0268265_10004032 Ga0268265_1000403211 526
1399 3300028381 Ga0268264_10000068 Ga0268264_1000006871 526
1400 3300046557 Ga0495622_0004381 Ga0495622_0004381_237_1874 526
1401 3300046694 Ga0495649_0036990 Ga0495649_0036990_176_1762 526
1402 3300049590 Ga0501074_0002872 Ga0501074_0002872_9148_10782 526
1403 3300050491 nmdc:mga00v17_21920_c1 nmdc:mga00v17_21920_c1_1698_3290 526
1404 3300053080 Ga0500635_0000045 Ga0500635_0000045_9035_10672 526
1405 3300053116 Ga0500592_000056 Ga0500592_000056_22151_23737 526
1406 3300053119 Ga0500595_003806 Ga0500595_003806_1074_2711 526
1407 3300053123 Ga0500614_002633 Ga0500614_002633_1739_3376 526
1408 3300053136 Ga0500559_0023050 Ga0500559_0023050_315_1952 526
1409 3300053158 Ga0500627_0001052 Ga0500627_0001052_2394_3980 526
1410 3300053735 Ga0500596_002181 Ga0500596_002181_1756_3393 526
1411 3300005367 Ga0070667_100004769 Ga0070667_1000047692 527
1412 3300005367 Ga0070667_100007142 Ga0070667_1000071423 527
1413 3300005548 Ga0070665_100000758 Ga0070665_1000007587 527
1414 3300005841 Ga0068863_100000045 Ga0068863_100000045149 527
1415 3300005841 Ga0068863_100000182 Ga0068863_10000018264 527
1416 3300005842 Ga0068858_100002443 Ga0068858_1000024438 527
1417 3300005842 Ga0068858_100080443 Ga0068858_1000804432 527
1418 3300005843 Ga0068860_100000119 Ga0068860_10000011974 527
1419 3300009177 Ga0105248_10034363 Ga0105248_100343632 527
1420 3300025941 Ga0207711_10001307 Ga0207711_100013072 527
1421 3300025961 Ga0207712_10045890 Ga0207712_100458903 527
1422 3300025972 Ga0207668_10000001 Ga0207668_10000001133 527
1423 3300025986 Ga0207658_10004400 Ga0207658_1000440010 527
1424 3300026035 Ga0207703_10000778 Ga0207703_1000077821 527
1425 3300026035 Ga0207703_10006496 Ga0207703_100064963 527
1426 3300026088 Ga0207641_10000011 Ga0207641_1000001114 527
1427 3300026088 Ga0207641_10000102 Ga0207641_100001027 527
1428 3300026095 Ga0207676_10002078 Ga0207676_1000207814 527
1429 3300028379 Ga0268266_10000289 Ga0268266_1000028952 527
1430 3300028381 Ga0268264_10000128 Ga0268264_10000128116 527
1431 3300046506 Ga0495583_0032548 Ga0495583_0032548_700_2322 527
1432 3300046522 Ga0495643_0006134 Ga0495643_0006134_3431_5053 527
1433 3300046542 Ga0495597_0000634 Ga0495597_0000634_6272_7894 527
1434 3300047315 Ga0495581_0039280 Ga0495581_0039280_146_1780 527
1435 3300048905 Ga0496102_0096574 Ga0496102_0096574_1041_2663 527
1436 3300048907 Ga0496104_0031837 Ga0496104_0031837_2911_4506 527
1437 3300048908 Ga0496105_0027040 Ga0496105_0027040_197_1792 527
1438 3300048920 Ga0496117_0029077 Ga0496117_0029077_2204_3799 527
1439 3300048921 Ga0496118_0004973 Ga0496118_0004973_5160_6782 527
1440 3300048921 Ga0496118_0010334 Ga0496118_0010334_7022_8617 527
1441 3300048924 Ga0496121_0000627 Ga0496121_0000627_26838_28460 527
1442 3300048924 Ga0496121_0002541 Ga0496121_0002541_20953_22548 527
1443 3300053087 Ga0500643_010091 Ga0500643_010091_1218_2816 527
1444 3300053109 Ga0500569_001093 Ga0500569_001093_1001_2623 527
1445 3300053157 Ga0500624_000184 Ga0500624_000184_19181_20779 527
1446 3300053177 Ga0500636_0007376 Ga0500636_0007376_1392_2990 527
1447 3300005335 Ga0070666_10000098 Ga0070666_1000009839 528
1448 3300005353 Ga0070669_100000029 Ga0070669_100000029114 528
1449 3300005355 Ga0070671_100000016 Ga0070671_10000001644 528
1450 3300005617 Ga0068859_100006298 Ga0068859_1000062986 528
1451 3300005618 Ga0068864_100002845 Ga0068864_1000028458 528
1452 3300005842 Ga0068858_100003323 Ga0068858_1000033239 528
1453 3300005844 Ga0068862_100004039 Ga0068862_1000040396 528
1454 3300005844 Ga0068862_100026916 Ga0068862_1000269163 528
1455 3300006042 Ga0075368_10000162 Ga0075368_100001629 528
1456 3300006177 Ga0075362_10001505 Ga0075362_100015054 528
1457 3300006178 Ga0075367_10027414 Ga0075367_100274143 528
1458 3300006186 Ga0075369_10004561 Ga0075369_100045615 528
1459 3300006931 Ga0097620_100006299 Ga0097620_1000062995 528
1460 3300009101 Ga0105247_10004980 Ga0105247_100049805 528
1461 3300009177 Ga0105248_10009662 Ga0105248_100096623 528
1462 3300021384 Ga0213876_10025680 Ga0213876_100256802 528
1463 3300025315 Ga0207697_10000473 Ga0207697_100004738 528
1464 3300025900 Ga0207710_10003075 Ga0207710_100030756 528
1465 3300025903 Ga0207680_10000399 Ga0207680_100003995 528
1466 3300025923 Ga0207681_10000040 Ga0207681_10000040112 528
1467 3300025925 Ga0207650_10016614 Ga0207650_100166145 528
1468 3300025931 Ga0207644_10000023 Ga0207644_1000002344 528
1469 3300025961 Ga0207712_10011824 Ga0207712_100118245 528
1470 3300025972 Ga0207668_10016988 Ga0207668_100169883 528
1471 3300025986 Ga0207658_10013896 Ga0207658_100138962 528
1472 3300026088 Ga0207641_10011322 Ga0207641_100113223 528
1473 3300026095 Ga0207676_10000765 Ga0207676_100007658 528
1474 3300026118 Ga0207675_100000667 Ga0207675_10000066710 528
1475 3300027866 Ga0209813_10000286 Ga0209813_100002865 528
1476 3300028380 Ga0268265_10000098 Ga0268265_1000009829 528
1477 3300028380 Ga0268265_10029151 Ga0268265_100291514 528
1478 3300028381 Ga0268264_10000141 Ga0268264_1000014168 528
1479 3300039437 Ga0436365_0845153 Ga0436365_0845153_2050_3669 528
1480 3300050489 nmdc:mga03683_233_c1 nmdc:mga03683_233_c1_10463_12064 528
1481 3300050494 nmdc:mga06z11_1483_c1 nmdc:mga06z11_1483_c1_4777_6378 528
1482 3300050495 nmdc:mga04h51_77_c1 nmdc:mga04h51_77_c1_19968_21569 528
1483 3300050496 nmdc:mga07m45_22_c1 nmdc:mga07m45_22_c1_76932_78533 528
1484 3300053121 Ga0500607_000006 Ga0500607_000006_25963_27579 528
1485 3300053730 Ga0500645_006831 Ga0500645_006831_156_1772 528
1486 3300053730 Ga0500645_009789 Ga0500645_009789_1202_2803 528
1487 3300006353 Ga0075370_10000082 Ga0075370_100000827 529
1488 3300025931 Ga0207644_10001691 Ga0207644_1000169110 529
1489 3300046520 Ga0495637_0023505 Ga0495637_0023505_352_1950 529
1490 3300046616 Ga0495668_0003522 Ga0495668_0003522_662_2263 529
1491 3300046660 Ga0495625_0046431 Ga0495625_0046431_968_2569 529
1492 3300046660 Ga0495625_0101638 Ga0495625_0101638_149_1747 529
1493 3300048928 Ga0496125_0008939 Ga0496125_0008939_4146_5747 529
1494 3300048928 Ga0496125_0051025 Ga0496125_0051025_663_2267 529
1495 3300048929 Ga0496126_0070800 Ga0496126_0070800_94_1698 529
1496 3300048929 Ga0496126_0104168 Ga0496126_0104168_683_2287 529
1497 3300050496 nmdc:mga07m45_163_c1 nmdc:mga07m45_163_c1_18383_19984 529
1498 3300053096 Ga0500641_0042066 Ga0500641_0042066_101_1699 529
1499 3300053130 Ga0500642_0021316 Ga0500642_0021316_861_2459 529
1500 3300053133 Ga0500655_000017 Ga0500655_000017_17148_18746 529
1501 3300053148 Ga0500590_004244 Ga0500590_004244_1414_3012 529
1502 3300053156 Ga0500622_0000315 Ga0500622_0000315_7135_8736 529
1503 3300053724 Ga0500570_026039 Ga0500570_026039_828_2426 529
1504 3300001904 JGI24736J21556_1000003 JGI24736J21556_100000334 530
1505 3300001915 JGI24741J21665_1004125 JGI24741J21665_10041253 530
1506 3300001979 JGI24740J21852_10000141 JGI24740J21852_1000014124 530
1507 3300001989 JGI24739J22299_10003411 JGI24739J22299_100034116 530
1508 3300001989 JGI24739J22299_10008663 JGI24739J22299_100086632 530
1509 3300001990 JGI24737J22298_10000271 JGI24737J22298_100002717 530
1510 3300002075 JGI24738J21930_10000901 JGI24738J21930_100009017 530
1511 3300002459 JGI24751J29686_10000557 JGI24751J29686_100005575 530
1512 3300005295 Ga0065707_10081846 Ga0065707_1008184623 530
1513 3300005327 Ga0070658_10005612 Ga0070658_1000561210 530
1514 3300005344 Ga0070661_100005157 Ga0070661_1000051577 530
1515 3300005355 Ga0070671_100000398 Ga0070671_10000039825 530
1516 3300005457 Ga0070662_100000370 Ga0070662_1000003706 530
1517 3300005539 Ga0068853_100008986 Ga0068853_1000089868 530
1518 3300005539 Ga0068853_100011526 Ga0068853_1000115266 530
1519 3300005564 Ga0070664_100003613 Ga0070664_1000036135 530
1520 3300005577 Ga0068857_100010298 Ga0068857_1000102985 530
1521 3300005577 Ga0068857_100197455 Ga0068857_1001974552 530
1522 3300005578 Ga0068854_100003709 Ga0068854_1000037095 530
1523 3300005614 Ga0068856_100074519 Ga0068856_1000745192 530
1524 3300005617 Ga0068859_100002952 Ga0068859_10000295210 530
1525 3300005617 Ga0068859_100019239 Ga0068859_1000192395 530
1526 3300005618 Ga0068864_100081382 Ga0068864_1000813823 530
1527 3300005719 Ga0068861_100042615 Ga0068861_1000426153 530
1528 3300005834 Ga0068851_10008653 Ga0068851_100086533 530
1529 3300005841 Ga0068863_100072031 Ga0068863_1000720312 530
1530 3300005842 Ga0068858_100003875 Ga0068858_1000038757 530
1531 3300005843 Ga0068860_100000032 Ga0068860_100000032169 530
1532 3300005843 Ga0068860_100004785 Ga0068860_10000478516 530
1533 3300005843 Ga0068860_100015206 Ga0068860_1000152065 530
1534 3300005844 Ga0068862_100000074 Ga0068862_10000007442 530
1535 3300006931 Ga0097620_100002952 Ga0097620_10000295210 530
1536 3300006931 Ga0097620_100019239 Ga0097620_1000192395 530
1537 3300009093 Ga0105240_10114939 Ga0105240_101149392 530
1538 3300009101 Ga0105247_10004758 Ga0105247_1000475811 530
1539 3300009177 Ga0105248_10019871 Ga0105248_100198714 530
1540 3300009545 Ga0105237_10048817 Ga0105237_100488174 530
1541 3300009551 Ga0105238_10077462 Ga0105238_100774622 530
1542 3300009553 Ga0105249_10000167 Ga0105249_1000016753 530
1543 3300013104 Ga0157370_10009206 Ga0157370_100092063 530
1544 3300013105 Ga0157369_10139654 Ga0157369_101396541 530
1545 3300013297 Ga0157378_10023381 Ga0157378_100233814 530
1546 3300013306 Ga0163162_10139244 Ga0163162_101392442 530
1547 3300025321 Ga0207656_10001845 Ga0207656_100018454 530
1548 3300025904 Ga0207647_10000885 Ga0207647_1000088522 530
1549 3300025911 Ga0207654_10005029 Ga0207654_100050293 530
1550 3300025913 Ga0207695_10013483 Ga0207695_100134837 530
1551 3300025914 Ga0207671_10004455 Ga0207671_100044559 530
1552 3300025919 Ga0207657_10007886 Ga0207657_100078863 530
1553 3300025924 Ga0207694_10001025 Ga0207694_1000102521 530
1554 3300025931 Ga0207644_10000329 Ga0207644_100003295 530
1555 3300025933 Ga0207706_10001157 Ga0207706_100011576 530
1556 3300025941 Ga0207711_10024631 Ga0207711_100246314 530
1557 3300025945 Ga0207679_10012972 Ga0207679_100129722 530
1558 3300025949 Ga0207667_10002524 Ga0207667_1000252422 530
1559 3300025961 Ga0207712_10000049 Ga0207712_1000004975 530
1560 3300026035 Ga0207703_10003066 Ga0207703_100030666 530
1561 3300026041 Ga0207639_10002001 Ga0207639_100020015 530
1562 3300026041 Ga0207639_10013567 Ga0207639_100135675 530
1563 3300026078 Ga0207702_10024292 Ga0207702_100242921 530
1564 3300026088 Ga0207641_10001148 Ga0207641_1000114817 530
1565 3300026095 Ga0207676_10031252 Ga0207676_100312523 530
1566 3300026116 Ga0207674_10066837 Ga0207674_100668373 530
1567 3300026118 Ga0207675_100053902 Ga0207675_1000539022 530
1568 3300026142 Ga0207698_10009467 Ga0207698_100094675 530
1569 3300026142 Ga0207698_10087592 Ga0207698_100875922 530
1570 3300028380 Ga0268265_10000113 Ga0268265_1000011357 530
1571 3300028381 Ga0268264_10000045 Ga0268264_10000045184 530
1572 3300028381 Ga0268264_10000828 Ga0268264_1000082827 530
1573 3300031911 Ga0307412_10026701 Ga0307412_100267012 530
1574 3300046530 Ga0495654_0005844 Ga0495654_0005844_3839_5440 530
1575 3300046616 Ga0495668_0040899 Ga0495668_0040899_884_2485 530
1576 3300048909 Ga0496106_0014414 Ga0496106_0014414_1246_2862 530
1577 3300048912 Ga0496109_0040813 Ga0496109_0040813_1231_2847 530
1578 3300048914 Ga0496111_0044181 Ga0496111_0044181_315_1931 530
1579 3300048916 Ga0496113_0002345 Ga0496113_0002345_5947_7563 530
1580 3300048929 Ga0496126_0005869 Ga0496126_0005869_5020_6636 530
1581 3300049515 Ga0501292_000003 Ga0501292_000003_46624_48222 530
1582 3300049517 Ga0501294_000016 Ga0501294_000016_15953_17551 530
1583 3300049662 Ga0501222_000150 Ga0501222_000150_7866_9464 530
1584 3300049663 Ga0501223_000241 Ga0501223_000241_6269_7867 530
1585 3300049688 Ga0501259_001070 Ga0501259_001070_2849_4447 530
1586 3300049690 Ga0501261_000007 Ga0501261_000007_56661_58259 530
1587 3300049775 Ga0501279_000009 Ga0501279_000009_17496_19094 530
1588 3300049776 Ga0501280_000022 Ga0501280_000022_30778_32376 530
1589 3300049777 Ga0501281_00089 Ga0501281_00089_2474_4072 530
1590 3300049778 Ga0501282_000069 Ga0501282_000069_974_2572 530
1591 3300053087 Ga0500643_000544 Ga0500643_000544_15458_17059 530
1592 3300053158 Ga0500627_0006100 Ga0500627_0006100_1726_3327 530

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ki1-assembly2.cif.gz_B the transmembrane domain of a cyanobacterium bicarbonate transporter bica 0.6889 18 408
7v73-assembly1.cif.gz_A thermostabilized human prestin in complex with chloride 0.6809 9 458
7v75-assembly1.cif.gz_A thermostabilized human prestin in complex with salicylate 0.672 9 458
5iof-assembly1.cif.gz_A structure of the transmembrane domain of the transporter slc26dg 0.6693 16 462
5da0-assembly1.cif.gz_A structure of the the slc26 transporter slc26dg in complex with a nanobody 0.6693 16 462
ID Description Score Start End Superfamily
af_P76103_4_381_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7156 12 454 1.20.1740.10
af_P76103_4_381_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7056 12 454 1.20.1740.10
af_Q57772_21_432_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6877 20 505 1.20.1740.10
af_Q57772_21_432_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6802 20 505 1.20.1740.10
af_Q6ZIE6_46_504_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.5761 27 469 1.20.1730.10
ID Description Score Start End GO Terms
AF-A0A3C0NTC5-F1-model_v4 Regulator 0.9881 7 390 GO:0016020
AF-A0A3C0NTC5-F1-model_v4 Regulator 0.9856 7 390 GO:0016020
AF-A0A7V9BX27-F1-model_v4 Regulator 0.9766 3 515 GO:0016020
AF-A0A1Z4BWK6-F1-model_v4 Regulator 0.9724 8 530 GO:0016020
AF-A0A7V9BX27-F1-model_v4 Regulator 0.9709 3 515 GO:0016020

Feature Viewer

pLDDT pTM Quality
88.09 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map