F494944
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1592 | 684 | 1400 | 531 |
Family's Representative Sequence
| Representative Sequence | 3300031711|Ga0265314_10015199|Ga0265314_100151994 |
| Length | 574 |
| Sequence | MRRRRFVRKNTGKSYRYANGRIVGILGTRLAELAPLGGCKVMTTSASKPTLWVPGDWNAFFGFGTNILVNMLVLTGLLRFVLKMPDAIVFGRILPALGMMMCLSTFYYAYLAYSLAKKTGRDDVCALPSGVSVPHMFIVTFVIMLPIALKTNDPVKGWEAGLVWVFFQSFILMIGGFVAPYIRKITPRAALLGTLAGVSITFISMRPALEMFMTPVIGLTCFAIIMVSWFGGVKYPKGIPAGLVAIAVGVVIAWGSNLFGLHVGDMSGAKVAAAFSNFGFSVPLPAVGHVFSGFEFLGVILVTAIPYGIYDLVEAMDNVESAEAAGDHYPTTRVLTADGVVSLIGCLMGNPFINAVYIGHPGWKSMGGRIGYSAATGVMVILLSWFGLISLLLAVIPVVAISPILLYIGMLIGAQAFQSTPKEHAPAIALALTPHLAAWATVLITGALGAAGMMYPAVHAPEFIGKMAQQGVLFHGIEVMGGGSILTGLVLGAIGVCVIDRNFVKASAFALAGAVLTYFGFMHGEAVGIGGGFGVTPSVALAYAMVAAFLYALARMPASVEASAPLEAKIAPAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 9 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 10 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 11 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 12 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 13 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 14 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 15 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 16 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 17 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 18 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 19 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 20 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 21 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 22 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 23 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 24 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 25 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 26 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 27 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 28 | 2786546517 | Verrucomicrobia bacterium LW23 | Isolate | Rhizoplane |
| 29 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 30 | 2791355199 | |||
| 31 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 32 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 33 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 34 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 35 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 36 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 37 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 38 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 39 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 40 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 41 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 42 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 43 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 44 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 45 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 46 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 47 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 48 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 49 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 50 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 51 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 52 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 53 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 54 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 55 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 56 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 57 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 58 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 59 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 60 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 61 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 62 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 63 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 64 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 65 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 66 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 67 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 68 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 69 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 70 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 71 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 72 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 73 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 74 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 75 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 76 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 77 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 78 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 79 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 80 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 81 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 82 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 83 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 84 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 85 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 86 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 87 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 88 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 89 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 90 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 91 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 92 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 93 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 94 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 95 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 96 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 97 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 98 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 99 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 100 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 101 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 102 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 103 | 2922368715 | |||
| 104 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 105 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 106 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 107 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 108 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 109 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 110 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 111 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 112 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 113 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 114 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 115 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 116 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 117 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 118 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 119 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 120 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 121 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 122 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 123 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 124 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 125 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 126 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 127 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 128 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 129 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 130 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 131 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 132 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 133 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 134 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 135 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 136 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 137 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 138 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 139 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 140 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 141 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 142 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 143 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 144 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 145 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 146 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 147 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 148 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 149 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 150 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 151 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 152 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 153 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 154 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 155 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 156 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 157 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 158 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 159 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 160 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 161 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 162 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 163 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 164 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 165 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 166 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 167 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 168 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 169 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 170 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 171 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 172 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 173 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 174 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 175 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 176 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 177 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 178 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 179 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 180 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 181 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 182 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 183 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 184 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 185 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 186 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 187 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 188 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 189 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 190 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 191 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 192 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 193 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 195 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 196 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 198 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 199 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 201 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 202 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 203 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 204 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 212 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 214 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 216 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 217 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 218 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 220 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 224 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 225 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 226 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 227 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 228 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 229 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 230 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 231 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 232 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 233 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 234 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 235 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 236 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 237 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 238 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 239 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 240 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 241 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 242 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 243 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 244 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 245 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 246 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 247 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 248 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 249 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 250 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 251 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 252 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 253 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 254 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 255 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 256 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 257 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 258 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 259 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 260 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 261 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 262 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 263 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 264 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 265 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 266 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 268 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 269 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 270 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 271 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 272 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 273 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 274 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 276 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 277 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 278 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 279 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 280 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 282 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 283 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 285 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 286 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 287 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 288 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 289 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 290 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 291 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 292 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 293 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 294 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 295 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 296 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 297 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 298 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 299 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 300 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 301 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 302 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 303 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 304 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 305 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 306 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 307 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 308 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 309 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 310 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 311 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 312 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 313 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 314 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 315 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 316 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 317 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 318 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 319 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 320 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 321 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 322 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 323 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 385 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 386 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 387 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 388 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 389 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 393 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 394 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 395 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 396 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 397 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 398 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 399 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 400 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 401 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 402 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 403 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 404 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 406 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 407 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 408 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 409 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 410 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 411 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 412 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 413 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 414 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 415 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 416 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 417 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 418 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 419 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 420 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 421 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 422 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 423 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 424 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 425 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 426 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 427 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 428 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 429 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 430 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 431 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 432 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 433 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 434 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 435 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 436 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 437 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 438 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 439 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 440 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 441 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 442 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 443 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 444 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 445 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 446 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 447 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 448 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 449 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 450 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 451 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 452 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 453 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 454 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 455 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 456 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 457 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 458 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 459 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 460 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 461 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 462 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 463 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 464 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 465 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 466 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 467 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 468 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 469 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 470 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 471 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 472 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 473 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 474 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 475 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 476 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 477 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 478 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 479 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 480 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 481 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 538 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 539 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 540 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 541 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 542 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 543 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 544 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 545 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 546 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 547 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 548 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 549 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 550 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 551 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 552 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 553 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 554 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 555 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 556 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 557 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 558 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 559 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 560 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 561 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 562 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 563 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 564 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 565 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 566 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 567 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 568 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 569 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 570 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 571 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 572 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 573 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 574 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 575 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 576 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 577 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 578 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 579 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 580 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 581 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 582 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 583 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 584 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 585 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 586 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 587 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 588 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 589 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 590 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 591 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 592 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 593 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 594 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 595 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 596 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 597 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 598 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 599 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 600 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 601 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 602 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 603 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 604 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 605 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 606 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 607 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 608 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 609 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 610 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 611 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 614 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 615 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 618 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 619 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 620 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 621 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 622 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 623 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 624 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 625 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 626 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 627 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 628 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 629 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 630 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 631 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 632 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 633 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 634 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 635 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 636 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 637 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 638 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 639 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 640 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 641 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 642 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 643 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 644 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 645 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 646 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 647 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 648 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 649 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 650 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 651 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 652 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 653 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 654 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 655 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 656 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 657 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 658 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 659 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 660 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 661 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 662 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 663 | 8001522603 | Methylomicrobium sp. RS1 | Isolate | Unclassified |
| 664 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 665 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 666 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 667 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 668 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 669 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 670 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 671 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 672 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 673 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 674 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 675 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 676 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 677 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 678 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 679 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 680 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 681 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 682 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 683 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 684 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.92 |
| Metatranscriptomes | 0.06 |
| Isolates | 12.01 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.49 |
| Nodule | 8.61 |
| Rhizoplane | 4.71 |
| Rhizosphere | 67.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000003 | 3300001904 | Bacteria | 60801 |
| 2 | JGI24741J21665_1004125 | 3300001915 | Bacteria | 3290 |
| 3 | JGI24740J21852_10000141 | 3300001979 | Bacteria | 27562 |
| 4 | JGI24739J22299_10003411 | 3300001989 | Bacteria | 6063 |
| 5 | JGI24739J22299_10008663 | 3300001989 | Bacteria | 3796 |
| 6 | JGI24737J22298_10000271 | 3300001990 | Bacteria | 17105 |
| 7 | JGI24743J22301_10000006 | 3300001991 | Bacteria | 22489 |
| 8 | JGI24750J21931_1000961 | 3300002070 | Bacteria | 3836 |
| 9 | JGI24738J21930_10000901 | 3300002075 | Bacteria | 8533 |
| 10 | JGI24749J21850_1000081 | 3300002076 | Bacteria | 17395 |
| 11 | JGI24751J29686_10000128 | 3300002459 | Bacteria | 38241 |
| 12 | JGI24751J29686_10000557 | 3300002459 | Bacteria | 10192 |
| 13 | JGI24751J29686_10006798 | 3300002459 | Bacteria | 2332 |
| 14 | JGI25159J45721_1004900 | 3300002987 | Bacteria | 4304 |
| 15 | JGI25406J46586_10000471 | 3300003203 | Bacteria | 18790 |
| 16 | JGI25406J46586_10009867 | 3300003203 | Bacteria | 4265 |
| 17 | JGI25153J46596_10000317 | 3300003215 | Bacteria | 35509 |
| 18 | JGI25153J46596_10002852 | 3300003215 | Bacteria | 9818 |
| 19 | JGI25153J46596_10004006 | 3300003215 | Bacteria | 8043 |
| 20 | JGI25153J46596_10013376 | 3300003215 | Bacteria | 3468 |
| 21 | rootH1_10002054 | 3300003316 | Bacteria | 7111 |
| 22 | rootH1_10002054 | 3300003323 | Bacteria | 118550 |
| 23 | rootH1_10030737 | 3300003323 | Bacteria | 34575 |
| 24 | JGI25160J50197_1007102 | 3300003354 | Bacteria | 4422 |
| 25 | JGI25404J52841_10010314 | 3300003659 | Bacteria | 2010 |
| 26 | Ga0055542_1005518 | 3300003762 | Bacteria | 2845 |
| 27 | Ga0055526_1000447 | 3300003771 | Bacteria | 32803 |
| 28 | Ga0055531_10009524 | 3300003794 | Bacteria | 4957 |
| 29 | Ga0065165_1000641 | 3300005262 | Bacteria | 50686 |
| 30 | Ga0065165_1000747 | 3300005262 | Bacteria | 44635 |
| 31 | Ga0065165_1010604 | 3300005262 | Bacteria | 3956 |
| 32 | Ga0065712_10025524 | 3300005290 | Bacteria | 1762 |
| 33 | Ga0065707_10081846 | 3300005295 | Bacteria | 34057 |
| 34 | Ga0065707_10084154 | 3300005295 | Bacteria | 7602 |
| 35 | Ga0065707_10124715 | 3300005295 | Bacteria | 2038 |
| 36 | Ga0070658_10005612 | 3300005327 | Bacteria | 10174 |
| 37 | Ga0070658_10030065 | 3300005327 | Bacteria | 4365 |
| 38 | Ga0070683_100074629 | 3300005329 | Bacteria | 3167 |
| 39 | Ga0070690_100031826 | 3300005330 | Bacteria | 3289 |
| 40 | Ga0070670_100000282 | 3300005331 | Bacteria | 44780 |
| 41 | Ga0070670_100000302 | 3300005331 | Bacteria | 42495 |
| 42 | Ga0070670_100008482 | 3300005331 | Bacteria | 8765 |
| 43 | Ga0070670_100016572 | 3300005331 | Bacteria | 6325 |
| 44 | Ga0070670_100106820 | 3300005331 | Bacteria | 2412 |
| 45 | Ga0070677_10019275 | 3300005333 | Bacteria | 2468 |
| 46 | Ga0068869_100001294 | 3300005334 | Bacteria | 14814 |
| 47 | Ga0070666_10000098 | 3300005335 | Bacteria | 59878 |
| 48 | Ga0070666_10050526 | 3300005335 | Bacteria | 2796 |
| 49 | Ga0070680_100006002 | 3300005336 | Bacteria | 9216 |
| 50 | Ga0070682_100003941 | 3300005337 | Bacteria | 8240 |
| 51 | Ga0070682_100004003 | 3300005337 | Bacteria | 8189 |
| 52 | Ga0070682_100044241 | 3300005337 | Bacteria | 2756 |
| 53 | Ga0068868_100001290 | 3300005338 | Bacteria | 17256 |
| 54 | Ga0068868_100004970 | 3300005338 | Bacteria | 9337 |
| 55 | Ga0068868_100032633 | 3300005338 | Bacteria | 4008 |
| 56 | Ga0070689_100000003 | 3300005340 | Bacteria | 579260 |
| 57 | Ga0070689_100003777 | 3300005340 | Bacteria | 10142 |
| 58 | Ga0070689_100024687 | 3300005340 | Bacteria | 4509 |
| 59 | Ga0070689_100031683 | 3300005340 | Bacteria | 4019 |
| 60 | Ga0070689_100070032 | 3300005340 | Bacteria | 2737 |
| 61 | Ga0070689_100117882 | 3300005340 | Bacteria | 2118 |
| 62 | Ga0070661_100005157 | 3300005344 | Bacteria | 8992 |
| 63 | Ga0070668_100000300 | 3300005347 | Bacteria | 32482 |
| 64 | Ga0070668_100000702 | 3300005347 | Bacteria | 22873 |
| 65 | Ga0070668_100002551 | 3300005347 | Bacteria | 13404 |
| 66 | Ga0070668_100003954 | 3300005347 | Bacteria | 10958 |
| 67 | Ga0070668_100008213 | 3300005347 | Bacteria | 7752 |
| 68 | Ga0070668_100023571 | 3300005347 | Bacteria | 4656 |
| 69 | Ga0070668_100081988 | 3300005347 | Bacteria | 2529 |
| 70 | Ga0070669_100000029 | 3300005353 | Bacteria | 163005 |
| 71 | Ga0070669_100000243 | 3300005353 | Bacteria | 45185 |
| 72 | Ga0070669_100000962 | 3300005353 | Bacteria | 21044 |
| 73 | Ga0070675_100001026 | 3300005354 | Bacteria | 20075 |
| 74 | Ga0070675_100057929 | 3300005354 | Bacteria | 3194 |
| 75 | Ga0070671_100000016 | 3300005355 | Bacteria | 156166 |
| 76 | Ga0070671_100000185 | 3300005355 | Bacteria | 41669 |
| 77 | Ga0070671_100000398 | 3300005355 | Bacteria | 29948 |
| 78 | Ga0070671_100001904 | 3300005355 | Bacteria | 15964 |
| 79 | Ga0070671_100001960 | 3300005355 | Bacteria | 15778 |
| 80 | Ga0070671_100116174 | 3300005355 | Bacteria | 2250 |
| 81 | Ga0070671_100118523 | 3300005355 | Bacteria | 2227 |
| 82 | Ga0070671_100178932 | 3300005355 | Bacteria | 1795 |
| 83 | Ga0070674_100010930 | 3300005356 | Bacteria | 5506 |
| 84 | Ga0070674_100033968 | 3300005356 | Bacteria | 3401 |
| 85 | Ga0070673_100000314 | 3300005364 | Bacteria | 25487 |
| 86 | Ga0070673_100000679 | 3300005364 | Bacteria | 18764 |
| 87 | Ga0070673_100011417 | 3300005364 | Bacteria | 6059 |
| 88 | Ga0070673_100018372 | 3300005364 | Bacteria | 4992 |
| 89 | Ga0070688_100013390 | 3300005365 | Bacteria | 4623 |
| 90 | Ga0070688_100025596 | 3300005365 | Bacteria | 3495 |
| 91 | Ga0070688_100032741 | 3300005365 | Bacteria | 3138 |
| 92 | Ga0070688_100073945 | 3300005365 | Bacteria | 2187 |
| 93 | Ga0070667_100000019 | 3300005367 | Bacteria | 224710 |
| 94 | Ga0070667_100000060 | 3300005367 | Bacteria | 145801 |
| 95 | Ga0070667_100000387 | 3300005367 | Bacteria | 47707 |
| 96 | Ga0070667_100000881 | 3300005367 | Bacteria | 27716 |
| 97 | Ga0070667_100004769 | 3300005367 | Bacteria | 11358 |
| 98 | Ga0070667_100007142 | 3300005367 | Bacteria | 9283 |
| 99 | Ga0070667_100020729 | 3300005367 | Bacteria | 5459 |
| 100 | Ga0070667_100021473 | 3300005367 | Bacteria | 5360 |
| 101 | Ga0070667_100043409 | 3300005367 | Bacteria | 3773 |
| 102 | Ga0070667_100065659 | 3300005367 | Bacteria | 3081 |
| 103 | Ga0070709_10002197 | 3300005434 | Bacteria | 10578 |
| 104 | Ga0070709_10009537 | 3300005434 | Bacteria | 5356 |
| 105 | Ga0070714_100002801 | 3300005435 | Bacteria | 12865 |
| 106 | Ga0070714_100033885 | 3300005435 | Bacteria | 4274 |
| 107 | Ga0070714_100166027 | 3300005435 | Bacteria | 2001 |
| 108 | Ga0070714_100191273 | 3300005435 | Bacteria | 1868 |
| 109 | Ga0070713_100007044 | 3300005436 | Bacteria | 7854 |
| 110 | Ga0070713_100007472 | 3300005436 | Bacteria | 7674 |
| 111 | Ga0070713_100023480 | 3300005436 | Bacteria | 4786 |
| 112 | Ga0070713_100029458 | 3300005436 | Bacteria | 4349 |
| 113 | Ga0070713_100095835 | 3300005436 | Bacteria | 2560 |
| 114 | Ga0070713_100119994 | 3300005436 | Bacteria | 2305 |
| 115 | Ga0070710_10033066 | 3300005437 | Bacteria | 2806 |
| 116 | Ga0070701_10003498 | 3300005438 | Bacteria | 6228 |
| 117 | Ga0070711_100003772 | 3300005439 | Bacteria | 8886 |
| 118 | Ga0070711_100006265 | 3300005439 | Bacteria | 7167 |
| 119 | Ga0070711_100012735 | 3300005439 | Bacteria | 5264 |
| 120 | Ga0070700_100029752 | 3300005441 | Bacteria | 3258 |
| 121 | Ga0070663_100007115 | 3300005455 | Bacteria | 6789 |
| 122 | Ga0070663_100074836 | 3300005455 | Bacteria | 2473 |
| 123 | Ga0070678_100017215 | 3300005456 | Bacteria | 4647 |
| 124 | Ga0070678_100024704 | 3300005456 | Bacteria | 4028 |
| 125 | Ga0070678_100042026 | 3300005456 | Bacteria | 3246 |
| 126 | Ga0070678_100069299 | 3300005456 | Bacteria | 2633 |
| 127 | Ga0070662_100000370 | 3300005457 | Bacteria | 26837 |
| 128 | Ga0070681_10048858 | 3300005458 | Bacteria | 4226 |
| 129 | Ga0068867_100000865 | 3300005459 | Bacteria | 20441 |
| 130 | Ga0068867_100025407 | 3300005459 | Bacteria | 4250 |
| 131 | Ga0068867_100123124 | 3300005459 | Bacteria | 2006 |
| 132 | Ga0070685_10000048 | 3300005466 | Bacteria | 72576 |
| 133 | Ga0070685_10036955 | 3300005466 | Bacteria | 2763 |
| 134 | Ga0070706_100002539 | 3300005467 | Bacteria | 18347 |
| 135 | Ga0070706_100074355 | 3300005467 | Bacteria | 3145 |
| 136 | Ga0070707_100018724 | 3300005468 | Bacteria | 6518 |
| 137 | Ga0070707_100058714 | 3300005468 | Bacteria | 3689 |
| 138 | Ga0070707_100115885 | 3300005468 | Bacteria | 2601 |
| 139 | Ga0070698_100006949 | 3300005471 | Bacteria | 12252 |
| 140 | Ga0070698_100016070 | 3300005471 | Bacteria | 7902 |
| 141 | Ga0070698_100213584 | 3300005471 | Bacteria | 1863 |
| 142 | Ga0070699_100005556 | 3300005518 | Bacteria | 11054 |
| 143 | Ga0070699_100030551 | 3300005518 | Bacteria | 4651 |
| 144 | Ga0070699_100117393 | 3300005518 | Unclassified | 2338 |
| 145 | Ga0070679_100028198 | 3300005530 | Bacteria | 5534 |
| 146 | Ga0070684_100009421 | 3300005535 | Bacteria | 7689 |
| 147 | Ga0070684_100085007 | 3300005535 | Bacteria | 2806 |
| 148 | Ga0070697_100038189 | 3300005536 | Bacteria | 3879 |
| 149 | Ga0070697_100056218 | 3300005536 | Bacteria | 3201 |
| 150 | Ga0070697_100058461 | 3300005536 | Bacteria | 3138 |
| 151 | Ga0068853_100001192 | 3300005539 | Bacteria | 18528 |
| 152 | Ga0068853_100005048 | 3300005539 | Bacteria | 10298 |
| 153 | Ga0068853_100008986 | 3300005539 | Bacteria | 8048 |
| 154 | Ga0068853_100011526 | 3300005539 | Bacteria | 7187 |
| 155 | Ga0070672_100009235 | 3300005543 | Bacteria | 6789 |
| 156 | Ga0070672_100027081 | 3300005543 | Bacteria | 4274 |
| 157 | Ga0070686_100005830 | 3300005544 | Bacteria | 6827 |
| 158 | Ga0070665_100000507 | 3300005548 | Bacteria | 55834 |
| 159 | Ga0070665_100000758 | 3300005548 | Bacteria | 42702 |
| 160 | Ga0070665_100001151 | 3300005548 | Bacteria | 32520 |
| 161 | Ga0070665_100004291 | 3300005548 | Bacteria | 14986 |
| 162 | Ga0070665_100014726 | 3300005548 | Bacteria | 7846 |
| 163 | Ga0070665_100036542 | 3300005548 | Bacteria | 4940 |
| 164 | Ga0070665_100044258 | 3300005548 | Bacteria | 4471 |
| 165 | Ga0068855_100000192 | 3300005563 | Bacteria | 79087 |
| 166 | Ga0068855_100002197 | 3300005563 | Bacteria | 24123 |
| 167 | Ga0068855_100007625 | 3300005563 | Bacteria | 13086 |
| 168 | Ga0068855_100070333 | 3300005563 | Bacteria | 4071 |
| 169 | Ga0068855_100119725 | 3300005563 | Bacteria | 3014 |
| 170 | Ga0070664_100003613 | 3300005564 | Bacteria | 12460 |
| 171 | Ga0070664_100092724 | 3300005564 | Bacteria | 2616 |
| 172 | Ga0068857_100010298 | 3300005577 | Bacteria | 8124 |
| 173 | Ga0068857_100066482 | 3300005577 | Bacteria | 3207 |
| 174 | Ga0068857_100095759 | 3300005577 | Bacteria | 2660 |
| 175 | Ga0068857_100197455 | 3300005577 | Bacteria | 1833 |
| 176 | Ga0068854_100003709 | 3300005578 | Bacteria | 9553 |
| 177 | Ga0068854_100011592 | 3300005578 | Bacteria | 5747 |
| 178 | Ga0068854_100046172 | 3300005578 | Bacteria | 3100 |
| 179 | Ga0068856_100005399 | 3300005614 | Bacteria | 12602 |
| 180 | Ga0068856_100027049 | 3300005614 | Bacteria | 5596 |
| 181 | Ga0068856_100029183 | 3300005614 | Bacteria | 5388 |
| 182 | Ga0068856_100074519 | 3300005614 | Bacteria | 3360 |
| 183 | Ga0070702_100002985 | 3300005615 | Bacteria | 7477 |
| 184 | Ga0068852_100006452 | 3300005616 | Bacteria | 8474 |
| 185 | Ga0068852_100039558 | 3300005616 | Bacteria | 3971 |
| 186 | Ga0068859_100000234 | 3300005617 | Bacteria | 54759 |
| 187 | Ga0068859_100002952 | 3300005617 | Bacteria | 17252 |
| 188 | Ga0068859_100006298 | 3300005617 | Bacteria | 12035 |
| 189 | Ga0068859_100008985 | 3300005617 | Bacteria | 10092 |
| 190 | Ga0068859_100015278 | 3300005617 | Bacteria | 7710 |
| 191 | Ga0068859_100019239 | 3300005617 | Bacteria | 6860 |
| 192 | Ga0068859_100029751 | 3300005617 | Bacteria | 5480 |
| 193 | Ga0068859_100032021 | 3300005617 | Bacteria | 5282 |
| 194 | Ga0068859_100044417 | 3300005617 | Bacteria | 4464 |
| 195 | Ga0068859_100047291 | 3300005617 | Bacteria | 4322 |
| 196 | Ga0068859_100143786 | 3300005617 | Bacteria | 2459 |
| 197 | Ga0068864_100000119 | 3300005618 | Bacteria | 77606 |
| 198 | Ga0068864_100000289 | 3300005618 | Bacteria | 44780 |
| 199 | Ga0068864_100000491 | 3300005618 | Bacteria | 34223 |
| 200 | Ga0068864_100002845 | 3300005618 | Bacteria | 14295 |
| 201 | Ga0068864_100016415 | 3300005618 | Bacteria | 6165 |
| 202 | Ga0068864_100018783 | 3300005618 | Bacteria | 5778 |
| 203 | Ga0068864_100052272 | 3300005618 | Bacteria | 3521 |
| 204 | Ga0068864_100080946 | 3300005618 | Bacteria | 2846 |
| 205 | Ga0068864_100081382 | 3300005618 | Bacteria | 2839 |
| 206 | Ga0068861_100006818 | 3300005719 | Bacteria | 7799 |
| 207 | Ga0068861_100010355 | 3300005719 | Bacteria | 6469 |
| 208 | Ga0068861_100042615 | 3300005719 | Bacteria | 3403 |
| 209 | Ga0068851_10008653 | 3300005834 | Bacteria | 4711 |
| 210 | Ga0068851_10056742 | 3300005834 | Bacteria | 1998 |
| 211 | Ga0068863_100000045 | 3300005841 | Bacteria | 147269 |
| 212 | Ga0068863_100000182 | 3300005841 | Bacteria | 67022 |
| 213 | Ga0068863_100004096 | 3300005841 | Bacteria | 14401 |
| 214 | Ga0068863_100011468 | 3300005841 | Bacteria | 8570 |
| 215 | Ga0068863_100048364 | 3300005841 | Bacteria | 4033 |
| 216 | Ga0068863_100072031 | 3300005841 | Bacteria | 3270 |
| 217 | Ga0068858_100000138 | 3300005842 | Bacteria | 77033 |
| 218 | Ga0068858_100002443 | 3300005842 | Bacteria | 18778 |
| 219 | Ga0068858_100002570 | 3300005842 | Bacteria | 18284 |
| 220 | Ga0068858_100002969 | 3300005842 | Bacteria | 17031 |
| 221 | Ga0068858_100003323 | 3300005842 | Bacteria | 16008 |
| 222 | Ga0068858_100003875 | 3300005842 | Bacteria | 14781 |
| 223 | Ga0068858_100023028 | 3300005842 | Bacteria | 5809 |
| 224 | Ga0068858_100038967 | 3300005842 | Bacteria | 4408 |
| 225 | Ga0068858_100080443 | 3300005842 | Bacteria | 3028 |
| 226 | Ga0068860_100000032 | 3300005843 | Bacteria | 251624 |
| 227 | Ga0068860_100000042 | 3300005843 | Bacteria | 227404 |
| 228 | Ga0068860_100000101 | 3300005843 | Bacteria | 142856 |
| 229 | Ga0068860_100000119 | 3300005843 | Bacteria | 127040 |
| 230 | Ga0068860_100000167 | 3300005843 | Bacteria | 108234 |
| 231 | Ga0068860_100000875 | 3300005843 | Bacteria | 33443 |
| 232 | Ga0068860_100001922 | 3300005843 | Bacteria | 22001 |
| 233 | Ga0068860_100003716 | 3300005843 | Bacteria | 15690 |
| 234 | Ga0068860_100004785 | 3300005843 | Bacteria | 13791 |
| 235 | Ga0068860_100014117 | 3300005843 | Bacteria | 7834 |
| 236 | Ga0068860_100014572 | 3300005843 | Bacteria | 7692 |
| 237 | Ga0068860_100015206 | 3300005843 | Bacteria | 7518 |
| 238 | Ga0068860_100023935 | 3300005843 | Bacteria | 5902 |
| 239 | Ga0068860_100026183 | 3300005843 | Bacteria | 5625 |
| 240 | Ga0068860_100075068 | 3300005843 | Bacteria | 3216 |
| 241 | Ga0068862_100000073 | 3300005844 | Bacteria | 119632 |
| 242 | Ga0068862_100000074 | 3300005844 | Bacteria | 118036 |
| 243 | Ga0068862_100003179 | 3300005844 | Bacteria | 14239 |
| 244 | Ga0068862_100003402 | 3300005844 | Bacteria | 13720 |
| 245 | Ga0068862_100004039 | 3300005844 | Bacteria | 12439 |
| 246 | Ga0068862_100026916 | 3300005844 | Bacteria | 4837 |
| 247 | Ga0068862_100056981 | 3300005844 | Bacteria | 3349 |
| 248 | Ga0068862_100083157 | 3300005844 | Bacteria | 2780 |
| 249 | Ga0081455_10000015 | 3300005937 | Bacteria | 189655 |
| 250 | Ga0081455_10001999 | 3300005937 | Bacteria | 24349 |
| 251 | Ga0081455_10002788 | 3300005937 | Bacteria | 20571 |
| 252 | Ga0081455_10008730 | 3300005937 | Bacteria | 10495 |
| 253 | Ga0081455_10011336 | 3300005937 | Bacteria | 8963 |
| 254 | Ga0081455_10053851 | 3300005937 | Bacteria | 3435 |
| 255 | Ga0081540_1000483 | 3300005983 | Bacteria | 39033 |
| 256 | Ga0081540_1003649 | 3300005983 | Bacteria | 12076 |
| 257 | Ga0081540_1006453 | 3300005983 | Bacteria | 8538 |
| 258 | Ga0081540_1027883 | 3300005983 | Bacteria | 3188 |
| 259 | Ga0081540_1028930 | 3300005983 | Bacteria | 3099 |
| 260 | Ga0081540_1030478 | 3300005983 | Bacteria | 2987 |
| 261 | Ga0081540_1033317 | 3300005983 | Bacteria | 2800 |
| 262 | Ga0081539_10000048 | 3300005985 | Bacteria | 272906 |
| 263 | Ga0081539_10000118 | 3300005985 | Bacteria | 184562 |
| 264 | Ga0081539_10000220 | 3300005985 | Bacteria | 133834 |
| 265 | Ga0081539_10005165 | 3300005985 | Bacteria | 13578 |
| 266 | Ga0070717_10001656 | 3300006028 | Bacteria | 15473 |
| 267 | Ga0070717_10008544 | 3300006028 | Bacteria | 7647 |
| 268 | Ga0070717_10035686 | 3300006028 | Bacteria | 4027 |
| 269 | Ga0070717_10131083 | 3300006028 | Bacteria | 2156 |
| 270 | Ga0070717_10140851 | 3300006028 | Bacteria | 2080 |
| 271 | Ga0075365_10025507 | 3300006038 | Bacteria | 3743 |
| 272 | Ga0075365_10041229 | 3300006038 | Bacteria | 3015 |
| 273 | Ga0075365_10067876 | 3300006038 | Bacteria | 2395 |
| 274 | Ga0075365_10070297 | 3300006038 | Bacteria | 2354 |
| 275 | Ga0075368_10000162 | 3300006042 | Bacteria | 18059 |
| 276 | Ga0075368_10013943 | 3300006042 | Bacteria | 2959 |
| 277 | Ga0075368_10016963 | 3300006042 | Bacteria | 2719 |
| 278 | Ga0075363_100000226 | 3300006048 | Bacteria | 15721 |
| 279 | Ga0075363_100002722 | 3300006048 | Bacteria | 7315 |
| 280 | Ga0075364_10021089 | 3300006051 | Bacteria | 4104 |
| 281 | Ga0070715_10001127 | 3300006163 | Bacteria | 7613 |
| 282 | Ga0070715_10019430 | 3300006163 | Bacteria | 2606 |
| 283 | Ga0070715_10037981 | 3300006163 | Bacteria | 1997 |
| 284 | Ga0070716_100006731 | 3300006173 | Bacteria | 5629 |
| 285 | Ga0070716_100007202 | 3300006173 | Bacteria | 5469 |
| 286 | Ga0070716_100019006 | 3300006173 | Bacteria | 3588 |
| 287 | Ga0070716_100031176 | 3300006173 | Bacteria | 2898 |
| 288 | Ga0075362_10000015 | 3300006177 | Bacteria | 84026 |
| 289 | Ga0075362_10001505 | 3300006177 | Bacteria | 7495 |
| 290 | Ga0075362_10009394 | 3300006177 | Bacteria | 3782 |
| 291 | Ga0075367_10016941 | 3300006178 | Bacteria | 3989 |
| 292 | Ga0075367_10027414 | 3300006178 | Bacteria | 3241 |
| 293 | Ga0075369_10000089 | 3300006186 | Bacteria | 24511 |
| 294 | Ga0075369_10004561 | 3300006186 | Bacteria | 5131 |
| 295 | Ga0075369_10018978 | 3300006186 | Bacteria | 2804 |
| 296 | Ga0075369_10026585 | 3300006186 | Bacteria | 2413 |
| 297 | Ga0075366_10000072 | 3300006195 | Bacteria | 39088 |
| 298 | Ga0097621_100002597 | 3300006237 | Bacteria | 12377 |
| 299 | Ga0097621_100108212 | 3300006237 | Bacteria | 2346 |
| 300 | Ga0075370_10000082 | 3300006353 | Bacteria | 28896 |
| 301 | Ga0075370_10001199 | 3300006353 | Bacteria | 10934 |
| 302 | Ga0075370_10021876 | 3300006353 | Bacteria | 3506 |
| 303 | Ga0075370_10098227 | 3300006353 | Bacteria | 1693 |
| 304 | Ga0068871_100004107 | 3300006358 | Bacteria | 10069 |
| 305 | Ga0068871_100040734 | 3300006358 | Bacteria | 3721 |
| 306 | Ga0068871_100055688 | 3300006358 | Bacteria | 3211 |
| 307 | Ga0075428_100087762 | 3300006844 | Bacteria | 3393 |
| 308 | Ga0075430_100000066 | 3300006846 | Bacteria | 56729 |
| 309 | Ga0075433_10002626 | 3300006852 | Bacteria | 13713 |
| 310 | Ga0075434_100006092 | 3300006871 | Bacteria | 11036 |
| 311 | Ga0075434_100129165 | 3300006871 | Bacteria | 2545 |
| 312 | Ga0068865_100003223 | 3300006881 | Bacteria | 9777 |
| 313 | Ga0068865_100007553 | 3300006881 | Bacteria | 6692 |
| 314 | Ga0068865_100070136 | 3300006881 | Bacteria | 2482 |
| 315 | Ga0097620_100000234 | 3300006931 | Bacteria | 54759 |
| 316 | Ga0097620_100002952 | 3300006931 | Bacteria | 17252 |
| 317 | Ga0097620_100006299 | 3300006931 | Bacteria | 12035 |
| 318 | Ga0097620_100008985 | 3300006931 | Bacteria | 10092 |
| 319 | Ga0097620_100015278 | 3300006931 | Bacteria | 7710 |
| 320 | Ga0097620_100019239 | 3300006931 | Bacteria | 6860 |
| 321 | Ga0097620_100029750 | 3300006931 | Bacteria | 5480 |
| 322 | Ga0097620_100032022 | 3300006931 | Bacteria | 5282 |
| 323 | Ga0097620_100044417 | 3300006931 | Bacteria | 4464 |
| 324 | Ga0097620_100047297 | 3300006931 | Bacteria | 4322 |
| 325 | Ga0097620_100143785 | 3300006931 | Bacteria | 2459 |
| 326 | Ga0097620_100192051 | 3300006931 | Bacteria | 2126 |
| 327 | Ga0075435_100006360 | 3300007076 | Bacteria | 8349 |
| 328 | Ga0075435_100014544 | 3300007076 | Bacteria | 5887 |
| 329 | Ga0075435_100021990 | 3300007076 | Bacteria | 4916 |
| 330 | Ga0099794_10019822 | 3300007265 | Bacteria | 3036 |
| 331 | Ga0099794_10035438 | 3300007265 | Bacteria | 2355 |
| 332 | Ga0099794_10054279 | 3300007265 | Bacteria | 1934 |
| 333 | Ga0099795_10000439 | 3300007788 | Bacteria | 7640 |
| 334 | Ga0099795_10003692 | 3300007788 | Bacteria | 3833 |
| 335 | Ga0099795_10009280 | 3300007788 | Bacteria | 2847 |
| 336 | Ga0105251_10000989 | 3300009011 | Bacteria | 24948 |
| 337 | Ga0105240_10000053 | 3300009093 | Bacteria | 225578 |
| 338 | Ga0105240_10000535 | 3300009093 | Bacteria | 70216 |
| 339 | Ga0105240_10004238 | 3300009093 | Bacteria | 21930 |
| 340 | Ga0105240_10004473 | 3300009093 | Bacteria | 21293 |
| 341 | Ga0105240_10024203 | 3300009093 | Bacteria | 8013 |
| 342 | Ga0105240_10097372 | 3300009093 | Bacteria | 3585 |
| 343 | Ga0105240_10114939 | 3300009093 | Bacteria | 3250 |
| 344 | Ga0111539_10041562 | 3300009094 | Bacteria | 5526 |
| 345 | Ga0111539_10043837 | 3300009094 | Bacteria | 5362 |
| 346 | Ga0111539_10053062 | 3300009094 | Bacteria | 4826 |
| 347 | Ga0111539_10079286 | 3300009094 | Bacteria | 3863 |
| 348 | Ga0111539_10144080 | 3300009094 | Bacteria | 2789 |
| 349 | Ga0111539_10281037 | 3300009094 | Bacteria | 1937 |
| 350 | Ga0105245_10007663 | 3300009098 | Bacteria | 9455 |
| 351 | Ga0105245_10032182 | 3300009098 | Bacteria | 4643 |
| 352 | Ga0105247_10004758 | 3300009101 | Bacteria | 8639 |
| 353 | Ga0105247_10004980 | 3300009101 | Bacteria | 8441 |
| 354 | Ga0105247_10027718 | 3300009101 | Bacteria | 3426 |
| 355 | Ga0105247_10066045 | 3300009101 | Bacteria | 2251 |
| 356 | Ga0105247_10072346 | 3300009101 | Bacteria | 2158 |
| 357 | Ga0114129_10046183 | 3300009147 | Bacteria | 6122 |
| 358 | Ga0114129_10420069 | 3300009147 | Bacteria | 1759 |
| 359 | Ga0105243_10092413 | 3300009148 | Bacteria | 2495 |
| 360 | Ga0105243_10143483 | 3300009148 | Bacteria | 2040 |
| 361 | Ga0105241_10032799 | 3300009174 | Bacteria | 3897 |
| 362 | Ga0105241_10046041 | 3300009174 | Bacteria | 3312 |
| 363 | Ga0105241_10090950 | 3300009174 | Bacteria | 2407 |
| 364 | Ga0105242_10016950 | 3300009176 | Bacteria | 5670 |
| 365 | Ga0105248_10000493 | 3300009177 | Bacteria | 44891 |
| 366 | Ga0105248_10002280 | 3300009177 | Bacteria | 21247 |
| 367 | Ga0105248_10006264 | 3300009177 | Bacteria | 13045 |
| 368 | Ga0105248_10009662 | 3300009177 | Bacteria | 10627 |
| 369 | Ga0105248_10019871 | 3300009177 | Bacteria | 7439 |
| 370 | Ga0105248_10034363 | 3300009177 | Bacteria | 5669 |
| 371 | Ga0105248_10037389 | 3300009177 | Bacteria | 5431 |
| 372 | Ga0105248_10075191 | 3300009177 | Bacteria | 3796 |
| 373 | Ga0105248_10265288 | 3300009177 | Bacteria | 1933 |
| 374 | Ga0105237_10000523 | 3300009545 | Bacteria | 54108 |
| 375 | Ga0105237_10000940 | 3300009545 | Bacteria | 39141 |
| 376 | Ga0105237_10008112 | 3300009545 | Bacteria | 11409 |
| 377 | Ga0105237_10008601 | 3300009545 | Bacteria | 11040 |
| 378 | Ga0105237_10048817 | 3300009545 | Bacteria | 4255 |
| 379 | Ga0105237_10067881 | 3300009545 | Bacteria | 3559 |
| 380 | Ga0105237_10106046 | 3300009545 | Bacteria | 2802 |
| 381 | Ga0105237_10125072 | 3300009545 | Bacteria | 2566 |
| 382 | Ga0105238_10003007 | 3300009551 | Bacteria | 16839 |
| 383 | Ga0105238_10027647 | 3300009551 | Bacteria | 5781 |
| 384 | Ga0105238_10077462 | 3300009551 | Bacteria | 3316 |
| 385 | Ga0105249_10000167 | 3300009553 | Bacteria | 77350 |
| 386 | Ga0105249_10002340 | 3300009553 | Bacteria | 16464 |
| 387 | Ga0105249_10045509 | 3300009553 | Bacteria | 3992 |
| 388 | Ga0105249_10068040 | 3300009553 | Bacteria | 3283 |
| 389 | Ga0105249_10078257 | 3300009553 | Bacteria | 3068 |
| 390 | Ga0105249_10099150 | 3300009553 | Bacteria | 2738 |
| 391 | Ga0099796_10000306 | 3300010159 | Bacteria | 7768 |
| 392 | Ga0099796_10007159 | 3300010159 | Bacteria | 2904 |
| 393 | Ga0105239_10021238 | 3300010375 | Bacteria | 7158 |
| 394 | Ga0105239_10046277 | 3300010375 | Bacteria | 4768 |
| 395 | Ga0105239_10195070 | 3300010375 | Bacteria | 2268 |
| 396 | Ga0157370_10009206 | 3300013104 | Bacteria | 10587 |
| 397 | Ga0157369_10139654 | 3300013105 | Bacteria | 2564 |
| 398 | Ga0157374_10036932 | 3300013296 | Bacteria | 4478 |
| 399 | Ga0157374_10139391 | 3300013296 | Bacteria | 2353 |
| 400 | Ga0157378_10023381 | 3300013297 | Bacteria | 5439 |
| 401 | Ga0157378_10037039 | 3300013297 | Bacteria | 4319 |
| 402 | Ga0157378_10165201 | 3300013297 | Bacteria | 2073 |
| 403 | Ga0163162_10016774 | 3300013306 | Bacteria | 7160 |
| 404 | Ga0163162_10043667 | 3300013306 | Bacteria | 4488 |
| 405 | Ga0163162_10139244 | 3300013306 | Bacteria | 2539 |
| 406 | Ga0163162_10188099 | 3300013306 | Bacteria | 2192 |
| 407 | Ga0163162_10288388 | 3300013306 | Bacteria | 1773 |
| 408 | Ga0157375_10019930 | 3300013308 | Bacteria | 6115 |
| 409 | Ga0163163_10000160 | 3300014325 | Bacteria | 70273 |
| 410 | Ga0163163_10002766 | 3300014325 | Bacteria | 14808 |
| 411 | Ga0163163_10032153 | 3300014325 | Bacteria | 5068 |
| 412 | Ga0163163_10032475 | 3300014325 | Bacteria | 5041 |
| 413 | Ga0163163_10050619 | 3300014325 | Bacteria | 4091 |
| 414 | Ga0163163_10070525 | 3300014325 | Bacteria | 3480 |
| 415 | Ga0157380_10000347 | 3300014326 | Bacteria | 27741 |
| 416 | Ga0157380_10236974 | 3300014326 | Bacteria | 1643 |
| 417 | Ga0157379_10000171 | 3300014968 | Bacteria | 48687 |
| 418 | Ga0157379_10006700 | 3300014968 | Bacteria | 9949 |
| 419 | Ga0157379_10029114 | 3300014968 | Bacteria | 4912 |
| 420 | Ga0157376_10039904 | 3300014969 | Bacteria | 3833 |
| 421 | Ga0157376_10115038 | 3300014969 | Bacteria | 2374 |
| 422 | Ga0163161_10083594 | 3300017792 | Bacteria | 2353 |
| 423 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 424 | Ga0214542_1001925 | 3300021321 | Bacteria | 42950 |
| 425 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 426 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 427 | Ga0213872_10005329 | 3300021361 | Bacteria | 6639 |
| 428 | Ga0213872_10035346 | 3300021361 | Bacteria | 2285 |
| 429 | Ga0213876_10000789 | 3300021384 | Bacteria | 21526 |
| 430 | Ga0213876_10025680 | 3300021384 | Bacteria | 3107 |
| 431 | Ga0213875_10000009 | 3300021388 | Bacteria | 451129 |
| 432 | Ga0209563_100325 | 3300025230 | Bacteria | 18742 |
| 433 | Ga0209677_102346 | 3300025253 | Bacteria | 7251 |
| 434 | Ga0209148_1000812 | 3300025254 | Bacteria | 22632 |
| 435 | Ga0209233_1002110 | 3300025261 | Bacteria | 7499 |
| 436 | Ga0209233_1006415 | 3300025261 | Bacteria | 3794 |
| 437 | Ga0209233_1008168 | 3300025261 | Bacteria | 3259 |
| 438 | Ga0209455_1001400 | 3300025272 | Bacteria | 10947 |
| 439 | Ga0209130_1000648 | 3300025284 | Bacteria | 32278 |
| 440 | Ga0209564_1000031 | 3300025295 | Bacteria | 494703 |
| 441 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 442 | Ga0209758_1000120 | 3300025297 | Bacteria | 192212 |
| 443 | Ga0209758_1001027 | 3300025297 | Bacteria | 36658 |
| 444 | Ga0209758_1001848 | 3300025297 | Bacteria | 23245 |
| 445 | Ga0209758_1005026 | 3300025297 | Bacteria | 10533 |
| 446 | Ga0209758_1008838 | 3300025297 | Bacteria | 6412 |
| 447 | Ga0209758_1018545 | 3300025297 | Bacteria | 3402 |
| 448 | Ga0209050_1001613 | 3300025298 | Bacteria | 23201 |
| 449 | Ga0209256_1000128 | 3300025299 | Bacteria | 163833 |
| 450 | Ga0207426_1000328 | 3300025302 | Bacteria | 90659 |
| 451 | Ga0207426_1000458 | 3300025302 | Bacteria | 64019 |
| 452 | Ga0207426_1006703 | 3300025302 | Bacteria | 4942 |
| 453 | Ga0209257_1001101 | 3300025304 | Bacteria | 35153 |
| 454 | Ga0209257_1011618 | 3300025304 | Bacteria | 4210 |
| 455 | Ga0207697_10000473 | 3300025315 | Bacteria | 22696 |
| 456 | Ga0207697_10021382 | 3300025315 | Bacteria | 2648 |
| 457 | Ga0207697_10044170 | 3300025315 | Bacteria | 1833 |
| 458 | Ga0207656_10001845 | 3300025321 | Bacteria | 7036 |
| 459 | Ga0207713_1001270 | 3300025735 | Bacteria | 20805 |
| 460 | Ga0207682_10001361 | 3300025893 | Bacteria | 11279 |
| 461 | Ga0207692_10015414 | 3300025898 | Bacteria | 3363 |
| 462 | Ga0207642_10022875 | 3300025899 | Bacteria | 2487 |
| 463 | Ga0207710_10003075 | 3300025900 | Bacteria | 7494 |
| 464 | Ga0207710_10019832 | 3300025900 | Bacteria | 2871 |
| 465 | Ga0207688_10000290 | 3300025901 | Bacteria | 22926 |
| 466 | Ga0207680_10000399 | 3300025903 | Bacteria | 20706 |
| 467 | Ga0207680_10023292 | 3300025903 | Bacteria | 3379 |
| 468 | Ga0207680_10032857 | 3300025903 | Bacteria | 2954 |
| 469 | Ga0207647_10000885 | 3300025904 | Bacteria | 23242 |
| 470 | Ga0207699_10001610 | 3300025906 | Bacteria | 10719 |
| 471 | Ga0207699_10034270 | 3300025906 | Bacteria | 2878 |
| 472 | Ga0207645_10009970 | 3300025907 | Bacteria | 6544 |
| 473 | Ga0207645_10033658 | 3300025907 | Bacteria | 3293 |
| 474 | Ga0207643_10003975 | 3300025908 | Bacteria | 7960 |
| 475 | Ga0207705_10001805 | 3300025909 | Bacteria | 16883 |
| 476 | Ga0207705_10042106 | 3300025909 | Bacteria | 3279 |
| 477 | Ga0207684_10001107 | 3300025910 | Bacteria | 30151 |
| 478 | Ga0207684_10007765 | 3300025910 | Bacteria | 9606 |
| 479 | Ga0207684_10027597 | 3300025910 | Bacteria | 4836 |
| 480 | Ga0207654_10005029 | 3300025911 | Bacteria | 6679 |
| 481 | Ga0207654_10046562 | 3300025911 | Bacteria | 2474 |
| 482 | Ga0207707_10000886 | 3300025912 | Bacteria | 29266 |
| 483 | Ga0207707_10029159 | 3300025912 | Bacteria | 4824 |
| 484 | Ga0207707_10042235 | 3300025912 | Bacteria | 3980 |
| 485 | Ga0207695_10000163 | 3300025913 | Bacteria | 197030 |
| 486 | Ga0207695_10000590 | 3300025913 | Bacteria | 73193 |
| 487 | Ga0207695_10005277 | 3300025913 | Bacteria | 17223 |
| 488 | Ga0207695_10005898 | 3300025913 | Bacteria | 16065 |
| 489 | Ga0207695_10013483 | 3300025913 | Bacteria | 9746 |
| 490 | Ga0207695_10045323 | 3300025913 | Bacteria | 4669 |
| 491 | Ga0207695_10062664 | 3300025913 | Bacteria | 3838 |
| 492 | Ga0207695_10085964 | 3300025913 | Bacteria | 3173 |
| 493 | Ga0207671_10001251 | 3300025914 | Bacteria | 29946 |
| 494 | Ga0207671_10004455 | 3300025914 | Bacteria | 13386 |
| 495 | Ga0207671_10004663 | 3300025914 | Bacteria | 12971 |
| 496 | Ga0207671_10019133 | 3300025914 | Bacteria | 5242 |
| 497 | Ga0207671_10114674 | 3300025914 | Bacteria | 2054 |
| 498 | Ga0207663_10007530 | 3300025916 | Bacteria | 5651 |
| 499 | Ga0207660_10017407 | 3300025917 | Bacteria | 4774 |
| 500 | Ga0207660_10037977 | 3300025917 | Bacteria | 3359 |
| 501 | Ga0207657_10007886 | 3300025919 | Bacteria | 10862 |
| 502 | Ga0207652_10013425 | 3300025921 | Bacteria | 6630 |
| 503 | Ga0207652_10126863 | 3300025921 | Bacteria | 2273 |
| 504 | Ga0207646_10023526 | 3300025922 | Bacteria | 5658 |
| 505 | Ga0207646_10036804 | 3300025922 | Bacteria | 4416 |
| 506 | Ga0207681_10000023 | 3300025923 | Bacteria | 229753 |
| 507 | Ga0207681_10000040 | 3300025923 | Bacteria | 147547 |
| 508 | Ga0207681_10000344 | 3300025923 | Bacteria | 33392 |
| 509 | Ga0207681_10051971 | 3300025923 | Bacteria | 2777 |
| 510 | Ga0207694_10001025 | 3300025924 | Bacteria | 24369 |
| 511 | Ga0207694_10020560 | 3300025924 | Bacteria | 4996 |
| 512 | Ga0207694_10081682 | 3300025924 | Bacteria | 2539 |
| 513 | Ga0207650_10000013 | 3300025925 | Bacteria | 409471 |
| 514 | Ga0207650_10000029 | 3300025925 | Bacteria | 236660 |
| 515 | Ga0207650_10000074 | 3300025925 | Bacteria | 134837 |
| 516 | Ga0207650_10010335 | 3300025925 | Bacteria | 6399 |
| 517 | Ga0207650_10016614 | 3300025925 | Bacteria | 5145 |
| 518 | Ga0207650_10030519 | 3300025925 | Bacteria | 3884 |
| 519 | Ga0207650_10039320 | 3300025925 | Bacteria | 3457 |
| 520 | Ga0207650_10130277 | 3300025925 | Bacteria | 1968 |
| 521 | Ga0207659_10000322 | 3300025926 | Bacteria | 28877 |
| 522 | Ga0207659_10013870 | 3300025926 | Bacteria | 5180 |
| 523 | Ga0207687_10010698 | 3300025927 | Bacteria | 5991 |
| 524 | Ga0207687_10025359 | 3300025927 | Bacteria | 3967 |
| 525 | Ga0207700_10019379 | 3300025928 | Bacteria | 4593 |
| 526 | Ga0207700_10030830 | 3300025928 | Bacteria | 3803 |
| 527 | Ga0207700_10031621 | 3300025928 | Bacteria | 3763 |
| 528 | Ga0207700_10081122 | 3300025928 | Bacteria | 2532 |
| 529 | Ga0207664_10007788 | 3300025929 | Bacteria | 7438 |
| 530 | Ga0207664_10168176 | 3300025929 | Bacteria | 1874 |
| 531 | Ga0207644_10000023 | 3300025931 | Bacteria | 156180 |
| 532 | Ga0207644_10000329 | 3300025931 | Bacteria | 30793 |
| 533 | Ga0207644_10000454 | 3300025931 | Bacteria | 26457 |
| 534 | Ga0207644_10000721 | 3300025931 | Bacteria | 20946 |
| 535 | Ga0207644_10000742 | 3300025931 | Bacteria | 20667 |
| 536 | Ga0207644_10001329 | 3300025931 | Bacteria | 15860 |
| 537 | Ga0207644_10001691 | 3300025931 | Bacteria | 14224 |
| 538 | Ga0207706_10001157 | 3300025933 | Bacteria | 26820 |
| 539 | Ga0207706_10026179 | 3300025933 | Bacteria | 5221 |
| 540 | Ga0207706_10031423 | 3300025933 | Bacteria | 4730 |
| 541 | Ga0207670_10000006 | 3300025936 | Bacteria | 401723 |
| 542 | Ga0207670_10001660 | 3300025936 | Bacteria | 11621 |
| 543 | Ga0207670_10026740 | 3300025936 | Bacteria | 3640 |
| 544 | Ga0207670_10028242 | 3300025936 | Bacteria | 3559 |
| 545 | Ga0207670_10103780 | 3300025936 | Bacteria | 2035 |
| 546 | Ga0207669_10009904 | 3300025937 | Bacteria | 4563 |
| 547 | Ga0207669_10072821 | 3300025937 | Bacteria | 2165 |
| 548 | Ga0207704_10002304 | 3300025938 | Bacteria | 8576 |
| 549 | Ga0207665_10000994 | 3300025939 | Bacteria | 19134 |
| 550 | Ga0207665_10012034 | 3300025939 | Bacteria | 5679 |
| 551 | Ga0207691_10001236 | 3300025940 | Bacteria | 25481 |
| 552 | Ga0207691_10013025 | 3300025940 | Bacteria | 7963 |
| 553 | Ga0207691_10014041 | 3300025940 | Bacteria | 7642 |
| 554 | Ga0207691_10020585 | 3300025940 | Bacteria | 6238 |
| 555 | Ga0207691_10047249 | 3300025940 | Bacteria | 3950 |
| 556 | Ga0207711_10000541 | 3300025941 | Bacteria | 38660 |
| 557 | Ga0207711_10001307 | 3300025941 | Bacteria | 23557 |
| 558 | Ga0207711_10003436 | 3300025941 | Bacteria | 13701 |
| 559 | Ga0207711_10005730 | 3300025941 | Bacteria | 10483 |
| 560 | Ga0207711_10010435 | 3300025941 | Bacteria | 7711 |
| 561 | Ga0207711_10024631 | 3300025941 | Bacteria | 5046 |
| 562 | Ga0207711_10122038 | 3300025941 | Bacteria | 2327 |
| 563 | Ga0207689_10000988 | 3300025942 | Bacteria | 27253 |
| 564 | Ga0207689_10025964 | 3300025942 | Bacteria | 4905 |
| 565 | Ga0207689_10059341 | 3300025942 | Bacteria | 3147 |
| 566 | Ga0207661_10019630 | 3300025944 | Bacteria | 5043 |
| 567 | Ga0207661_10127179 | 3300025944 | Bacteria | 2177 |
| 568 | Ga0207679_10012972 | 3300025945 | Bacteria | 5453 |
| 569 | Ga0207667_10000173 | 3300025949 | Bacteria | 95378 |
| 570 | Ga0207667_10002524 | 3300025949 | Bacteria | 22795 |
| 571 | Ga0207667_10011668 | 3300025949 | Bacteria | 10195 |
| 572 | Ga0207667_10017111 | 3300025949 | Bacteria | 8173 |
| 573 | Ga0207667_10050503 | 3300025949 | Bacteria | 4388 |
| 574 | Ga0207651_10012387 | 3300025960 | Bacteria | 4825 |
| 575 | Ga0207651_10018851 | 3300025960 | Bacteria | 4119 |
| 576 | Ga0207651_10058353 | 3300025960 | Bacteria | 2667 |
| 577 | Ga0207651_10111560 | 3300025960 | Bacteria | 2054 |
| 578 | Ga0207712_10000049 | 3300025961 | Bacteria | 160026 |
| 579 | Ga0207712_10001178 | 3300025961 | Bacteria | 18107 |
| 580 | Ga0207712_10011824 | 3300025961 | Bacteria | 5566 |
| 581 | Ga0207712_10045890 | 3300025961 | Bacteria | 3027 |
| 582 | Ga0207712_10084911 | 3300025961 | Bacteria | 2315 |
| 583 | Ga0207712_10119256 | 3300025961 | Bacteria | 1993 |
| 584 | Ga0207712_10130621 | 3300025961 | Bacteria | 1914 |
| 585 | Ga0207668_10000001 | 3300025972 | Bacteria | 266091 |
| 586 | Ga0207668_10000093 | 3300025972 | Bacteria | 64280 |
| 587 | Ga0207668_10000565 | 3300025972 | Bacteria | 23257 |
| 588 | Ga0207668_10002375 | 3300025972 | Bacteria | 10997 |
| 589 | Ga0207668_10006644 | 3300025972 | Bacteria | 6840 |
| 590 | Ga0207668_10015911 | 3300025972 | Bacteria | 4683 |
| 591 | Ga0207668_10016988 | 3300025972 | Bacteria | 4552 |
| 592 | Ga0207640_10013731 | 3300025981 | Bacteria | 4648 |
| 593 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 594 | Ga0207658_10000005 | 3300025986 | Bacteria | 408341 |
| 595 | Ga0207658_10000266 | 3300025986 | Bacteria | 55102 |
| 596 | Ga0207658_10001288 | 3300025986 | Bacteria | 19833 |
| 597 | Ga0207658_10004400 | 3300025986 | Bacteria | 9798 |
| 598 | Ga0207658_10008836 | 3300025986 | Bacteria | 6836 |
| 599 | Ga0207658_10013896 | 3300025986 | Bacteria | 5509 |
| 600 | Ga0207658_10029979 | 3300025986 | Bacteria | 3848 |
| 601 | Ga0207677_10009636 | 3300026023 | Bacteria | 5438 |
| 602 | Ga0207677_10030833 | 3300026023 | Bacteria | 3428 |
| 603 | Ga0207677_10032216 | 3300026023 | Bacteria | 3367 |
| 604 | Ga0207703_10000778 | 3300026035 | Bacteria | 31401 |
| 605 | Ga0207703_10000817 | 3300026035 | Bacteria | 30675 |
| 606 | Ga0207703_10003066 | 3300026035 | Bacteria | 14131 |
| 607 | Ga0207703_10003952 | 3300026035 | Bacteria | 12287 |
| 608 | Ga0207703_10005822 | 3300026035 | Bacteria | 9873 |
| 609 | Ga0207703_10006496 | 3300026035 | Bacteria | 9334 |
| 610 | Ga0207703_10016737 | 3300026035 | Bacteria | 5720 |
| 611 | Ga0207639_10001095 | 3300026041 | Bacteria | 18432 |
| 612 | Ga0207639_10002001 | 3300026041 | Bacteria | 13739 |
| 613 | Ga0207639_10006875 | 3300026041 | Bacteria | 7748 |
| 614 | Ga0207639_10013567 | 3300026041 | Bacteria | 5708 |
| 615 | Ga0207678_10003737 | 3300026067 | Bacteria | 13694 |
| 616 | Ga0207678_10009474 | 3300026067 | Bacteria | 8566 |
| 617 | Ga0207678_10012506 | 3300026067 | Bacteria | 7454 |
| 618 | Ga0207678_10014197 | 3300026067 | Bacteria | 7003 |
| 619 | Ga0207708_10003262 | 3300026075 | Bacteria | 11955 |
| 620 | Ga0207708_10010903 | 3300026075 | Bacteria | 6761 |
| 621 | Ga0207702_10014770 | 3300026078 | Bacteria | 6477 |
| 622 | Ga0207702_10024292 | 3300026078 | Bacteria | 5028 |
| 623 | Ga0207641_10000011 | 3300026088 | Bacteria | 384362 |
| 624 | Ga0207641_10000102 | 3300026088 | Bacteria | 122366 |
| 625 | Ga0207641_10000207 | 3300026088 | Bacteria | 77525 |
| 626 | Ga0207641_10001148 | 3300026088 | Bacteria | 26600 |
| 627 | Ga0207641_10002051 | 3300026088 | Bacteria | 19163 |
| 628 | Ga0207641_10006748 | 3300026088 | Bacteria | 9617 |
| 629 | Ga0207641_10009357 | 3300026088 | Bacteria | 8081 |
| 630 | Ga0207641_10011322 | 3300026088 | Bacteria | 7321 |
| 631 | Ga0207648_10003222 | 3300026089 | Bacteria | 17183 |
| 632 | Ga0207648_10006548 | 3300026089 | Bacteria | 11564 |
| 633 | Ga0207648_10010265 | 3300026089 | Bacteria | 8892 |
| 634 | Ga0207648_10085897 | 3300026089 | Bacteria | 2744 |
| 635 | Ga0207648_10101649 | 3300026089 | Bacteria | 2519 |
| 636 | Ga0207676_10000010 | 3300026095 | Bacteria | 519402 |
| 637 | Ga0207676_10000059 | 3300026095 | Bacteria | 119553 |
| 638 | Ga0207676_10000674 | 3300026095 | Bacteria | 27320 |
| 639 | Ga0207676_10000765 | 3300026095 | Bacteria | 25128 |
| 640 | Ga0207676_10002078 | 3300026095 | Bacteria | 14534 |
| 641 | Ga0207676_10024857 | 3300026095 | Bacteria | 4438 |
| 642 | Ga0207676_10031252 | 3300026095 | Bacteria | 4004 |
| 643 | Ga0207676_10068626 | 3300026095 | Bacteria | 2836 |
| 644 | Ga0207674_10004839 | 3300026116 | Bacteria | 16124 |
| 645 | Ga0207674_10033659 | 3300026116 | Bacteria | 5364 |
| 646 | Ga0207674_10066837 | 3300026116 | Bacteria | 3620 |
| 647 | Ga0207674_10105081 | 3300026116 | Bacteria | 2802 |
| 648 | Ga0207674_10151754 | 3300026116 | Bacteria | 2274 |
| 649 | Ga0207674_10167142 | 3300026116 | Bacteria | 2154 |
| 650 | Ga0207675_100000667 | 3300026118 | Bacteria | 33777 |
| 651 | Ga0207675_100003638 | 3300026118 | Bacteria | 15027 |
| 652 | Ga0207675_100010160 | 3300026118 | Bacteria | 8823 |
| 653 | Ga0207675_100024107 | 3300026118 | Bacteria | 5657 |
| 654 | Ga0207675_100026655 | 3300026118 | Bacteria | 5380 |
| 655 | Ga0207675_100026697 | 3300026118 | Bacteria | 5374 |
| 656 | Ga0207675_100053902 | 3300026118 | Bacteria | 3752 |
| 657 | Ga0207675_100146824 | 3300026118 | Bacteria | 2243 |
| 658 | Ga0207683_10015557 | 3300026121 | Bacteria | 6478 |
| 659 | Ga0207683_10038522 | 3300026121 | Bacteria | 4167 |
| 660 | Ga0207683_10040799 | 3300026121 | Bacteria | 4052 |
| 661 | Ga0207683_10044126 | 3300026121 | Bacteria | 3897 |
| 662 | Ga0207698_10009467 | 3300026142 | Bacteria | 6215 |
| 663 | Ga0207698_10036023 | 3300026142 | Bacteria | 3627 |
| 664 | Ga0207698_10087592 | 3300026142 | Bacteria | 2537 |
| 665 | Ga0209389_1000043 | 3300027296 | Bacteria | 123224 |
| 666 | Ga0209589_1000047 | 3300027357 | Bacteria | 118659 |
| 667 | Ga0209489_100075 | 3300027361 | Bacteria | 136991 |
| 668 | Ga0209813_10000286 | 3300027866 | Bacteria | 14129 |
| 669 | Ga0209813_10001620 | 3300027866 | Bacteria | 5067 |
| 670 | Ga0207428_10013649 | 3300027907 | Bacteria | 7087 |
| 671 | Ga0207428_10020735 | 3300027907 | Bacteria | 5575 |
| 672 | Ga0207428_10061807 | 3300027907 | Bacteria | 2963 |
| 673 | Ga0268266_10000289 | 3300028379 | Bacteria | 82515 |
| 674 | Ga0268266_10000616 | 3300028379 | Bacteria | 48562 |
| 675 | Ga0268266_10001288 | 3300028379 | Bacteria | 30547 |
| 676 | Ga0268266_10006154 | 3300028379 | Bacteria | 11038 |
| 677 | Ga0268266_10009379 | 3300028379 | Bacteria | 8622 |
| 678 | Ga0268266_10021656 | 3300028379 | Bacteria | 5477 |
| 679 | Ga0268266_10044436 | 3300028379 | Bacteria | 3797 |
| 680 | Ga0268266_10053622 | 3300028379 | Bacteria | 3465 |
| 681 | Ga0268266_10239470 | 3300028379 | Bacteria | 1674 |
| 682 | Ga0268265_10000018 | 3300028380 | Bacteria | 285651 |
| 683 | Ga0268265_10000098 | 3300028380 | Bacteria | 110108 |
| 684 | Ga0268265_10000113 | 3300028380 | Bacteria | 101546 |
| 685 | Ga0268265_10001685 | 3300028380 | Bacteria | 18014 |
| 686 | Ga0268265_10004032 | 3300028380 | Bacteria | 10339 |
| 687 | Ga0268265_10029151 | 3300028380 | Bacteria | 3959 |
| 688 | Ga0268265_10107530 | 3300028380 | Bacteria | 2268 |
| 689 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 690 | Ga0268264_10000016 | 3300028381 | Bacteria | 502537 |
| 691 | Ga0268264_10000030 | 3300028381 | Bacteria | 418542 |
| 692 | Ga0268264_10000045 | 3300028381 | Bacteria | 364764 |
| 693 | Ga0268264_10000068 | 3300028381 | Bacteria | 275708 |
| 694 | Ga0268264_10000128 | 3300028381 | Bacteria | 183164 |
| 695 | Ga0268264_10000141 | 3300028381 | Bacteria | 170966 |
| 696 | Ga0268264_10000672 | 3300028381 | Bacteria | 39982 |
| 697 | Ga0268264_10000828 | 3300028381 | Bacteria | 33168 |
| 698 | Ga0268264_10003137 | 3300028381 | Bacteria | 14329 |
| 699 | Ga0268264_10123908 | 3300028381 | Bacteria | 2281 |
| 700 | Ga0265326_10007004 | 3300028558 | Bacteria | 3474 |
| 701 | Ga0265319_1000212 | 3300028563 | Bacteria | 43934 |
| 702 | Ga0265319_1003155 | 3300028563 | Bacteria | 8684 |
| 703 | Ga0265319_1004330 | 3300028563 | Bacteria | 7048 |
| 704 | Ga0265334_10000218 | 3300028573 | Bacteria | 33090 |
| 705 | Ga0265334_10002358 | 3300028573 | Bacteria | 8890 |
| 706 | Ga0265334_10012354 | 3300028573 | Bacteria | 3590 |
| 707 | Ga0265334_10015220 | 3300028573 | Bacteria | 3199 |
| 708 | Ga0265318_10000012 | 3300028577 | Bacteria | 218292 |
| 709 | Ga0265318_10000236 | 3300028577 | Bacteria | 48002 |
| 710 | Ga0265318_10000302 | 3300028577 | Bacteria | 39987 |
| 711 | Ga0265318_10005337 | 3300028577 | Bacteria | 6045 |
| 712 | Ga0265318_10008041 | 3300028577 | Bacteria | 4721 |
| 713 | Ga0265318_10008342 | 3300028577 | Bacteria | 4619 |
| 714 | Ga0265318_10026127 | 3300028577 | Bacteria | 2301 |
| 715 | Ga0265323_10000434 | 3300028653 | Bacteria | 23913 |
| 716 | Ga0265323_10010258 | 3300028653 | Bacteria | 3802 |
| 717 | Ga0265322_10008928 | 3300028654 | Bacteria | 2915 |
| 718 | Ga0265336_10000649 | 3300028666 | Bacteria | 18964 |
| 719 | Ga0265336_10003752 | 3300028666 | Bacteria | 5876 |
| 720 | Ga0307517_10000279 | 3300028786 | Bacteria | 88025 |
| 721 | Ga0307515_10000131 | 3300028794 | Bacteria | 178919 |
| 722 | Ga0307515_10018110 | 3300028794 | Bacteria | 12780 |
| 723 | Ga0307515_10105023 | 3300028794 | Bacteria | 3367 |
| 724 | Ga0307515_10140827 | 3300028794 | Bacteria | 2588 |
| 725 | Ga0265338_10000280 | 3300028800 | Bacteria | 91942 |
| 726 | Ga0265338_10001103 | 3300028800 | Bacteria | 44947 |
| 727 | Ga0265338_10004109 | 3300028800 | Bacteria | 19938 |
| 728 | Ga0265338_10017545 | 3300028800 | Bacteria | 7710 |
| 729 | Ga0265338_10028156 | 3300028800 | Bacteria | 5613 |
| 730 | Ga0265338_10060329 | 3300028800 | Bacteria | 3334 |
| 731 | Ga0265324_10000040 | 3300029957 | Bacteria | 116473 |
| 732 | Ga0265324_10000174 | 3300029957 | Bacteria | 50027 |
| 733 | Ga0265324_10000316 | 3300029957 | Bacteria | 35472 |
| 734 | Ga0265324_10010442 | 3300029957 | Bacteria | 3579 |
| 735 | Ga0307511_10054250 | 3300030521 | Bacteria | 3163 |
| 736 | Ga0265760_10002753 | 3300031090 | Bacteria | 5144 |
| 737 | Ga0265330_10000009 | 3300031235 | Bacteria | 190785 |
| 738 | Ga0265330_10000072 | 3300031235 | Bacteria | 87680 |
| 739 | Ga0265330_10000354 | 3300031235 | Bacteria | 32334 |
| 740 | Ga0265330_10017581 | 3300031235 | Bacteria | 3290 |
| 741 | Ga0265330_10037183 | 3300031235 | Bacteria | 2168 |
| 742 | Ga0265332_10000194 | 3300031238 | Bacteria | 49527 |
| 743 | Ga0265332_10002865 | 3300031238 | Bacteria | 8529 |
| 744 | Ga0265332_10003878 | 3300031238 | Bacteria | 7142 |
| 745 | Ga0265332_10005012 | 3300031238 | Bacteria | 6154 |
| 746 | Ga0265332_10020287 | 3300031238 | Bacteria | 2934 |
| 747 | Ga0265328_10001090 | 3300031239 | Bacteria | 12455 |
| 748 | Ga0265328_10003523 | 3300031239 | Bacteria | 6902 |
| 749 | Ga0265328_10009579 | 3300031239 | Bacteria | 3939 |
| 750 | Ga0265328_10024805 | 3300031239 | Bacteria | 2262 |
| 751 | Ga0265320_10000003 | 3300031240 | Bacteria | 410153 |
| 752 | Ga0265320_10000038 | 3300031240 | Bacteria | 135648 |
| 753 | Ga0265320_10002099 | 3300031240 | Bacteria | 14024 |
| 754 | Ga0265320_10002226 | 3300031240 | Bacteria | 13596 |
| 755 | Ga0265320_10009072 | 3300031240 | Bacteria | 6032 |
| 756 | Ga0265320_10015075 | 3300031240 | Bacteria | 4377 |
| 757 | Ga0265320_10018943 | 3300031240 | Bacteria | 3775 |
| 758 | Ga0265325_10008489 | 3300031241 | Bacteria | 6058 |
| 759 | Ga0265325_10016566 | 3300031241 | Bacteria | 4118 |
| 760 | Ga0265329_10000104 | 3300031242 | Bacteria | 40556 |
| 761 | Ga0265329_10000491 | 3300031242 | Bacteria | 20514 |
| 762 | Ga0265329_10000631 | 3300031242 | Bacteria | 17989 |
| 763 | Ga0265329_10005454 | 3300031242 | Bacteria | 5139 |
| 764 | Ga0265329_10007780 | 3300031242 | Bacteria | 4114 |
| 765 | Ga0265329_10010898 | 3300031242 | Bacteria | 3324 |
| 766 | Ga0265329_10032021 | 3300031242 | Bacteria | 1705 |
| 767 | Ga0265340_10000256 | 3300031247 | Bacteria | 27740 |
| 768 | Ga0265340_10003153 | 3300031247 | Bacteria | 9350 |
| 769 | Ga0265340_10005099 | 3300031247 | Bacteria | 7310 |
| 770 | Ga0265340_10005148 | 3300031247 | Bacteria | 7271 |
| 771 | Ga0265340_10005200 | 3300031247 | Bacteria | 7228 |
| 772 | Ga0265340_10009402 | 3300031247 | Bacteria | 5248 |
| 773 | Ga0265340_10012494 | 3300031247 | Bacteria | 4483 |
| 774 | Ga0265340_10014618 | 3300031247 | Bacteria | 4095 |
| 775 | Ga0265339_10000188 | 3300031249 | Bacteria | 52215 |
| 776 | Ga0265339_10000900 | 3300031249 | Bacteria | 22829 |
| 777 | Ga0265339_10001668 | 3300031249 | Bacteria | 16396 |
| 778 | Ga0265339_10004146 | 3300031249 | Bacteria | 9978 |
| 779 | Ga0265339_10004932 | 3300031249 | Bacteria | 8991 |
| 780 | Ga0265339_10010237 | 3300031249 | Bacteria | 5836 |
| 781 | Ga0265339_10010417 | 3300031249 | Bacteria | 5776 |
| 782 | Ga0265339_10016164 | 3300031249 | Bacteria | 4455 |
| 783 | Ga0265331_10000098 | 3300031250 | Bacteria | 119302 |
| 784 | Ga0265331_10000421 | 3300031250 | Bacteria | 42955 |
| 785 | Ga0265331_10000862 | 3300031250 | Bacteria | 24653 |
| 786 | Ga0265331_10002331 | 3300031250 | Bacteria | 12915 |
| 787 | Ga0265331_10002513 | 3300031250 | Bacteria | 12372 |
| 788 | Ga0265331_10010509 | 3300031250 | Bacteria | 5119 |
| 789 | Ga0265331_10016119 | 3300031250 | Bacteria | 3930 |
| 790 | Ga0265331_10034447 | 3300031250 | Bacteria | 2498 |
| 791 | Ga0265327_10000044 | 3300031251 | Bacteria | 284808 |
| 792 | Ga0265327_10000149 | 3300031251 | Bacteria | 150385 |
| 793 | Ga0265316_10000930 | 3300031344 | Bacteria | 31824 |
| 794 | Ga0265316_10000951 | 3300031344 | Bacteria | 31569 |
| 795 | Ga0265316_10001076 | 3300031344 | Bacteria | 29533 |
| 796 | Ga0265316_10009307 | 3300031344 | Bacteria | 9050 |
| 797 | Ga0265316_10012949 | 3300031344 | Bacteria | 7444 |
| 798 | Ga0265316_10026947 | 3300031344 | Bacteria | 4770 |
| 799 | Ga0265316_10031732 | 3300031344 | Bacteria | 4317 |
| 800 | Ga0265316_10041019 | 3300031344 | Bacteria | 3708 |
| 801 | Ga0307513_10088845 | 3300031456 | Bacteria | 3157 |
| 802 | Ga0307513_10111515 | 3300031456 | Bacteria | 2728 |
| 803 | Ga0307513_10115328 | 3300031456 | Bacteria | 2669 |
| 804 | Ga0307509_10025035 | 3300031507 | Bacteria | 6671 |
| 805 | Ga0307408_100000062 | 3300031548 | Bacteria | 127855 |
| 806 | Ga0265313_10000171 | 3300031595 | Bacteria | 68612 |
| 807 | Ga0265313_10000311 | 3300031595 | Bacteria | 52824 |
| 808 | Ga0265313_10000640 | 3300031595 | Bacteria | 36071 |
| 809 | Ga0265313_10000856 | 3300031595 | Bacteria | 30671 |
| 810 | Ga0265313_10009850 | 3300031595 | Bacteria | 6149 |
| 811 | Ga0265313_10010550 | 3300031595 | Bacteria | 5826 |
| 812 | Ga0265313_10012826 | 3300031595 | Bacteria | 5085 |
| 813 | Ga0265313_10014710 | 3300031595 | Bacteria | 4606 |
| 814 | Ga0265313_10018307 | 3300031595 | Bacteria | 3938 |
| 815 | Ga0265313_10044992 | 3300031595 | Bacteria | 2151 |
| 816 | Ga0307508_10001411 | 3300031616 | Bacteria | 27053 |
| 817 | Ga0307508_10005665 | 3300031616 | Bacteria | 11840 |
| 818 | Ga0265314_10000001 | 3300031711 | Bacteria | 3792860 |
| 819 | Ga0265314_10000017 | 3300031711 | Bacteria | 340498 |
| 820 | Ga0265314_10000041 | 3300031711 | Bacteria | 218376 |
| 821 | Ga0265314_10000114 | 3300031711 | Bacteria | 124126 |
| 822 | Ga0265314_10000182 | 3300031711 | Bacteria | 92772 |
| 823 | Ga0265314_10001782 | 3300031711 | Bacteria | 23250 |
| 824 | Ga0265314_10003018 | 3300031711 | Bacteria | 16635 |
| 825 | Ga0265314_10009657 | 3300031711 | Bacteria | 8125 |
| 826 | Ga0265314_10010362 | 3300031711 | Bacteria | 7782 |
| 827 | Ga0265314_10011314 | 3300031711 | Bacteria | 7377 |
| 828 | Ga0265314_10013584 | 3300031711 | Bacteria | 6570 |
| 829 | Ga0265314_10015199 | 3300031711 | Bacteria | 6114 |
| 830 | Ga0265314_10018978 | 3300031711 | Bacteria | 5336 |
| 831 | Ga0265314_10020268 | 3300031711 | Bacteria | 5135 |
| 832 | Ga0265314_10024792 | 3300031711 | Bacteria | 4539 |
| 833 | Ga0265314_10027793 | 3300031711 | Bacteria | 4229 |
| 834 | Ga0265314_10043964 | 3300031711 | Bacteria | 3170 |
| 835 | Ga0265342_10000043 | 3300031712 | Bacteria | 137642 |
| 836 | Ga0265342_10000268 | 3300031712 | Bacteria | 58391 |
| 837 | Ga0265342_10000287 | 3300031712 | Bacteria | 57222 |
| 838 | Ga0265342_10000707 | 3300031712 | Bacteria | 34634 |
| 839 | Ga0265342_10001279 | 3300031712 | Bacteria | 23688 |
| 840 | Ga0265342_10003914 | 3300031712 | Bacteria | 11958 |
| 841 | Ga0265342_10004024 | 3300031712 | Bacteria | 11738 |
| 842 | Ga0265342_10040517 | 3300031712 | Bacteria | 2825 |
| 843 | Ga0265342_10050569 | 3300031712 | Bacteria | 2482 |
| 844 | Ga0265342_10072741 | 3300031712 | Bacteria | 2001 |
| 845 | Ga0307516_10000011 | 3300031730 | Bacteria | 224428 |
| 846 | Ga0307516_10000789 | 3300031730 | Bacteria | 43316 |
| 847 | Ga0307516_10024291 | 3300031730 | Bacteria | 6192 |
| 848 | Ga0307516_10033324 | 3300031730 | Bacteria | 5182 |
| 849 | Ga0307410_10000016 | 3300031852 | Bacteria | 72757 |
| 850 | Ga0307407_10003156 | 3300031903 | Bacteria | 6674 |
| 851 | Ga0307412_10026701 | 3300031911 | Bacteria | 3592 |
| 852 | Ga0307412_10062602 | 3300031911 | Bacteria | 2506 |
| 853 | Ga0307409_100000034 | 3300031995 | Bacteria | 48281 |
| 854 | Ga0307416_100000012 | 3300032002 | Bacteria | 296814 |
| 855 | Ga0307411_10002080 | 3300032005 | Bacteria | 8618 |
| 856 | Ga0307415_100090042 | 3300032126 | Bacteria | 2218 |
| 857 | Ga0307510_10097116 | 3300033180 | Bacteria | 2758 |
| 858 | Ga0373930_0000113 | 3300034816 | Bacteria | 8643 |
| 859 | Ga0373950_0000029 | 3300034818 | Bacteria | 165216 |
| 860 | Ga0373950_0000031 | 3300034818 | Bacteria | 162196 |
| 861 | Ga0373938_0003894 | 3300034957 | Bacteria | 2468 |
| 862 | Ga0373928_0000305 | 3300035084 | Bacteria | 9764 |
| 863 | Ga0373934_0003030 | 3300035086 | Bacteria | 6135 |
| 864 | Ga0373934_0010197 | 3300035086 | Bacteria | 3527 |
| 865 | Ga0373934_0031037 | 3300035086 | Bacteria | 2091 |
| 866 | Ga0373944_0000080 | 3300035089 | Bacteria | 16528 |
| 867 | Ga0373932_0000001 | 3300035112 | Bacteria | 1459067 |
| 868 | Ga0373936_0032142 | 3300035113 | Bacteria | 2075 |
| 869 | Ga0373945_0008060 | 3300035116 | Bacteria | 3422 |
| 870 | Ga0373945_0019037 | 3300035116 | Bacteria | 2341 |
| 871 | Ga0373954_0000084 | 3300035118 | Bacteria | 33354 |
| 872 | Ga0373956_0000384 | 3300035119 | Bacteria | 18025 |
| 873 | Ga0373956_0048116 | 3300035119 | Bacteria | 1909 |
| 874 | Ga0373957_0008762 | 3300035120 | Bacteria | 3293 |
| 875 | Ga0373943_0014882 | 3300035170 | Bacteria | 3530 |
| 876 | Ga0373943_0025979 | 3300035170 | Bacteria | 2740 |
| 877 | Ga0373943_0038440 | 3300035170 | Bacteria | 2301 |
| 878 | Ga0373943_0040553 | 3300035170 | Bacteria | 2248 |
| 879 | Ga0373946_0013817 | 3300035171 | Bacteria | 3039 |
| 880 | Ga0373955_0001982 | 3300035172 | Bacteria | 8821 |
| 881 | Ga0373955_0009166 | 3300035172 | Bacteria | 4626 |
| 882 | Ga0373955_0016122 | 3300035172 | Bacteria | 3673 |
| 883 | Ga0373955_0046149 | 3300035172 | Bacteria | 2354 |
| 884 | Ga0373961_0005234 | 3300035241 | Bacteria | 3120 |
| 885 | Ga0373962_0000013 | 3300035242 | Bacteria | 49373 |
| 886 | Ga0373924_0029572 | 3300035410 | Bacteria | 2191 |
| 887 | Ga0373931_0000002 | 3300035691 | Bacteria | 599830 |
| 888 | Ga0373931_0001597 | 3300035691 | Bacteria | 9796 |
| 889 | Ga0373931_0003800 | 3300035691 | Bacteria | 6831 |
| 890 | Ga0373931_0008056 | 3300035691 | Bacteria | 4986 |
| 891 | Ga0373931_0066644 | 3300035691 | Bacteria | 1954 |
| 892 | Ga0373935_0000244 | 3300035692 | Bacteria | 26819 |
| 893 | Ga0373935_0094939 | 3300035692 | Bacteria | 1958 |
| 894 | Ga0373927_0010602 | 3300035695 | Bacteria | 6142 |
| 895 | Ga0373927_0011775 | 3300035695 | Bacteria | 5824 |
| 896 | Ga0373927_0016320 | 3300035695 | Bacteria | 4901 |
| 897 | Ga0373927_0029296 | 3300035695 | Bacteria | 3587 |
| 898 | Ga0373933_0000576 | 3300035724 | Bacteria | 23018 |
| 899 | Ga0373933_0002444 | 3300035724 | Bacteria | 10470 |
| 900 | Ga0373933_0003599 | 3300035724 | Bacteria | 8600 |
| 901 | Ga0373933_0018992 | 3300035724 | Bacteria | 3874 |
| 902 | Ga0373947_0002144 | 3300035725 | Bacteria | 11991 |
| 903 | Ga0373947_0016812 | 3300035725 | Bacteria | 4203 |
| 904 | Ga0373937_0000995 | 3300036401 | Bacteria | 24075 |
| 905 | Ga0373937_0001469 | 3300036401 | Bacteria | 19735 |
| 906 | Ga0373937_0001753 | 3300036401 | Bacteria | 18252 |
| 907 | Ga0373937_0004952 | 3300036401 | Bacteria | 11323 |
| 908 | Ga0373937_0016403 | 3300036401 | Bacteria | 6579 |
| 909 | Ga0373937_0046678 | 3300036401 | Bacteria | 3961 |
| 910 | Ga0373937_0088807 | 3300036401 | Bacteria | 2862 |
| 911 | Ga0373925_0001674 | 3300037068 | Bacteria | 18651 |
| 912 | Ga0373925_0002323 | 3300037068 | Bacteria | 15297 |
| 913 | Ga0373925_0015046 | 3300037068 | Bacteria | 5594 |
| 914 | Ga0373925_0055603 | 3300037068 | Bacteria | 2963 |
| 915 | Ga0395905_0000250 | 3300037471 | Bacteria | 80488 |
| 916 | Ga0436364_0413488 | 3300037853 | Bacteria | 83589 |
| 917 | Ga0436364_0719430 | 3300037853 | Bacteria | 2006 |
| 918 | Ga0436365_0042250 | 3300039437 | Bacteria | 60076 |
| 919 | Ga0436365_0104564 | 3300039437 | Bacteria | 3407 |
| 920 | Ga0436365_0564112 | 3300039437 | Bacteria | 7504 |
| 921 | Ga0436365_0845153 | 3300039437 | Bacteria | 8729 |
| 922 | Ga0436365_0881693 | 3300039437 | Bacteria | 4323 |
| 923 | Ga0436365_1236739 | 3300039437 | Bacteria | 30341 |
| 924 | Ga0436360_0247830 | 3300039438 | Bacteria | 20307 |
| 925 | Ga0436360_0484380 | 3300039438 | Bacteria | 2544 |
| 926 | Ga0436360_1063097 | 3300039438 | Bacteria | 1668 |
| 927 | Ga0436361_0108686 | 3300039447 | Bacteria | 4031 |
| 928 | Ga0436361_0217304 | 3300039447 | Bacteria | 2727 |
| 929 | Ga0436361_0446852 | 3300039447 | Bacteria | 2036 |
| 930 | Ga0436361_0575778 | 3300039447 | Bacteria | 4567 |
| 931 | Ga0436361_0611093 | 3300039447 | Bacteria | 29254 |
| 932 | Ga0436361_0612836 | 3300039447 | Bacteria | 1828 |
| 933 | Ga0436361_0958358 | 3300039447 | Bacteria | 3411 |
| 934 | Ga0436363_1355831 | 3300039450 | Bacteria | 7359 |
| 935 | Ga0451791_1455622 | 3300041451 | Bacteria | 2059 |
| 936 | Ga0451807_1505972 | 3300041486 | Bacteria | 3952 |
| 937 | Ga0451849_0319247 | 3300041505 | Bacteria | 6280 |
| 938 | Ga0451853_0598287 | 3300041512 | Bacteria | 10480 |
| 939 | Ga0450923_007746 | 3300042125 | Bacteria | 1828 |
| 940 | Ga0466972_0000079 | 3300044658 | Bacteria | 90348 |
| 941 | Ga0466972_0001061 | 3300044658 | Bacteria | 13191 |
| 942 | Ga0466965_0059686 | 3300044683 | Bacteria | 1904 |
| 943 | Ga0466966_0000191 | 3300044684 | Bacteria | 40906 |
| 944 | Ga0466961_0000005 | 3300044693 | Bacteria | 173105 |
| 945 | Ga0466963_0070364 | 3300044694 | Bacteria | 2353 |
| 946 | Ga0453684_0325867 | 3300044712 | Bacteria | 1738 |
| 947 | Ga0466971_0000119 | 3300044719 | Bacteria | 28517 |
| 948 | Ga0466968_0007887 | 3300044735 | Bacteria | 4063 |
| 949 | Ga0466957_0013977 | 3300044842 | Bacteria | 4668 |
| 950 | Ga0466960_0015116 | 3300044901 | Bacteria | 3323 |
| 951 | Ga0466959_0003302 | 3300045049 | Bacteria | 10526 |
| 952 | Ga0451576_0067703 | 3300045051 | Bacteria | 3717 |
| 953 | Ga0451576_0113605 | 3300045051 | Bacteria | 2819 |
| 954 | Ga0466967_0038848 | 3300045976 | Bacteria | 4086 |
| 955 | Ga0466967_0179592 | 3300045976 | Bacteria | 1996 |
| 956 | Ga0495592_0010499 | 3300046454 | Bacteria | 6984 |
| 957 | Ga0495603_0000370 | 3300046455 | Bacteria | 24383 |
| 958 | Ga0495603_0040388 | 3300046455 | Bacteria | 2793 |
| 959 | Ga0495629_0001947 | 3300046459 | Bacteria | 16090 |
| 960 | Ga0495629_0006802 | 3300046459 | Bacteria | 8455 |
| 961 | Ga0495629_0111724 | 3300046459 | Bacteria | 1905 |
| 962 | Ga0495638_0089584 | 3300046460 | Bacteria | 1855 |
| 963 | Ga0495651_0001194 | 3300046462 | Bacteria | 20074 |
| 964 | Ga0495651_0015545 | 3300046462 | Bacteria | 5889 |
| 965 | Ga0495651_0027951 | 3300046462 | Bacteria | 4396 |
| 966 | Ga0495653_0000561 | 3300046463 | Bacteria | 28449 |
| 967 | Ga0495653_0102510 | 3300046463 | Bacteria | 2071 |
| 968 | Ga0495580_0000435 | 3300046472 | Bacteria | 34468 |
| 969 | Ga0495580_0109327 | 3300046472 | Bacteria | 1919 |
| 970 | Ga0495582_0000051 | 3300046473 | Bacteria | 59010 |
| 971 | Ga0495582_0041625 | 3300046473 | Bacteria | 2531 |
| 972 | Ga0495639_0000010 | 3300046475 | Bacteria | 93685 |
| 973 | Ga0495639_0010168 | 3300046475 | Bacteria | 4047 |
| 974 | Ga0495662_0000097 | 3300046476 | Bacteria | 31889 |
| 975 | Ga0495662_0045247 | 3300046476 | Bacteria | 2125 |
| 976 | Ga0495664_0035009 | 3300046477 | Bacteria | 2955 |
| 977 | Ga0495664_0035191 | 3300046477 | Bacteria | 2948 |
| 978 | Ga0495664_0036563 | 3300046477 | Bacteria | 2895 |
| 979 | Ga0495664_0074586 | 3300046477 | Bacteria | 2030 |
| 980 | Ga0495594_0001553 | 3300046499 | Bacteria | 11928 |
| 981 | Ga0495583_0032548 | 3300046506 | Bacteria | 2516 |
| 982 | Ga0495606_0000265 | 3300046507 | Bacteria | 92526 |
| 983 | Ga0495608_0026124 | 3300046511 | Bacteria | 3983 |
| 984 | Ga0495608_0026417 | 3300046511 | Bacteria | 3958 |
| 985 | Ga0495628_0056667 | 3300046516 | Bacteria | 3084 |
| 986 | Ga0495628_0084694 | 3300046516 | Bacteria | 2460 |
| 987 | Ga0495630_0000173 | 3300046517 | Bacteria | 50167 |
| 988 | Ga0495630_0010293 | 3300046517 | Bacteria | 6748 |
| 989 | Ga0495630_0019164 | 3300046517 | Bacteria | 5028 |
| 990 | Ga0495630_0040664 | 3300046517 | Bacteria | 3475 |
| 991 | Ga0495632_0013474 | 3300046519 | Bacteria | 4666 |
| 992 | Ga0495637_0023505 | 3300046520 | Bacteria | 2800 |
| 993 | Ga0495643_0000852 | 3300046522 | Bacteria | 32898 |
| 994 | Ga0495643_0006134 | 3300046522 | Bacteria | 7986 |
| 995 | Ga0495648_0002889 | 3300046524 | Bacteria | 15455 |
| 996 | Ga0495663_0010022 | 3300046525 | Bacteria | 2630 |
| 997 | Ga0495652_0003743 | 3300046529 | Bacteria | 14879 |
| 998 | Ga0495652_0005002 | 3300046529 | Bacteria | 12557 |
| 999 | Ga0495652_0007836 | 3300046529 | Bacteria | 9808 |
| 1000 | Ga0495652_0044462 | 3300046529 | Bacteria | 3824 |
| 1001 | Ga0495652_0044898 | 3300046529 | Bacteria | 3803 |
| 1002 | Ga0495654_0005844 | 3300046530 | Bacteria | 7081 |
| 1003 | Ga0495665_0000005 | 3300046531 | Bacteria | 86491 |
| 1004 | Ga0495640_0000301 | 3300046533 | Bacteria | 33996 |
| 1005 | Ga0495640_0008933 | 3300046533 | Bacteria | 7826 |
| 1006 | Ga0495640_0031720 | 3300046533 | Bacteria | 3769 |
| 1007 | Ga0495640_0066899 | 3300046533 | Bacteria | 2422 |
| 1008 | Ga0495587_0000608 | 3300046536 | Bacteria | 24349 |
| 1009 | Ga0495587_0019048 | 3300046536 | Bacteria | 4252 |
| 1010 | Ga0495597_0000634 | 3300046542 | Bacteria | 28662 |
| 1011 | Ga0495645_0010535 | 3300046543 | Bacteria | 6485 |
| 1012 | Ga0495645_0043804 | 3300046543 | Bacteria | 3265 |
| 1013 | Ga0495622_0003164 | 3300046557 | Bacteria | 7794 |
| 1014 | Ga0495622_0004381 | 3300046557 | Bacteria | 6572 |
| 1015 | Ga0495622_0011078 | 3300046557 | Bacteria | 4162 |
| 1016 | Ga0495622_0025083 | 3300046557 | Bacteria | 2785 |
| 1017 | Ga0495667_0010607 | 3300046559 | Bacteria | 6233 |
| 1018 | Ga0495667_0031389 | 3300046559 | Bacteria | 3567 |
| 1019 | Ga0495656_0001420 | 3300046615 | Bacteria | 7836 |
| 1020 | Ga0495668_0003522 | 3300046616 | Bacteria | 11660 |
| 1021 | Ga0495668_0040899 | 3300046616 | Bacteria | 2584 |
| 1022 | Ga0495634_0000878 | 3300046642 | Bacteria | 28888 |
| 1023 | Ga0495634_0001496 | 3300046642 | Bacteria | 20684 |
| 1024 | Ga0495634_0067650 | 3300046642 | Bacteria | 2362 |
| 1025 | Ga0495634_0082617 | 3300046642 | Bacteria | 2098 |
| 1026 | Ga0495625_0046431 | 3300046660 | Bacteria | 3135 |
| 1027 | Ga0495625_0101638 | 3300046660 | Bacteria | 1974 |
| 1028 | Ga0495635_0000259 | 3300046663 | Bacteria | 33960 |
| 1029 | Ga0495635_0001844 | 3300046663 | Bacteria | 14340 |
| 1030 | Ga0495635_0004612 | 3300046663 | Bacteria | 9560 |
| 1031 | Ga0495635_0092383 | 3300046663 | Bacteria | 2069 |
| 1032 | Ga0495657_0011319 | 3300046675 | Bacteria | 6675 |
| 1033 | Ga0495657_0011893 | 3300046675 | Bacteria | 6485 |
| 1034 | Ga0495657_0019856 | 3300046675 | Bacteria | 4843 |
| 1035 | Ga0495599_0003115 | 3300046678 | Bacteria | 9661 |
| 1036 | Ga0495623_0002010 | 3300046679 | Bacteria | 13656 |
| 1037 | Ga0495623_0007161 | 3300046679 | Bacteria | 7243 |
| 1038 | Ga0495646_0015040 | 3300046680 | Bacteria | 4915 |
| 1039 | Ga0495646_0033661 | 3300046680 | Bacteria | 3186 |
| 1040 | Ga0495658_0050687 | 3300046683 | Bacteria | 2349 |
| 1041 | Ga0495613_0001985 | 3300046689 | Bacteria | 15542 |
| 1042 | Ga0495613_0002444 | 3300046689 | Bacteria | 14016 |
| 1043 | Ga0495613_0004516 | 3300046689 | Bacteria | 10436 |
| 1044 | Ga0495613_0030462 | 3300046689 | Bacteria | 4008 |
| 1045 | Ga0495613_0056067 | 3300046689 | Bacteria | 2894 |
| 1046 | Ga0495613_0065381 | 3300046689 | Bacteria | 2658 |
| 1047 | Ga0495613_0076425 | 3300046689 | Bacteria | 2437 |
| 1048 | Ga0495624_0000094 | 3300046690 | Bacteria | 59911 |
| 1049 | Ga0495624_0009667 | 3300046690 | Bacteria | 6677 |
| 1050 | Ga0495670_0010707 | 3300046691 | Bacteria | 4507 |
| 1051 | Ga0495670_0017241 | 3300046691 | Bacteria | 3554 |
| 1052 | Ga0495649_0004358 | 3300046694 | Bacteria | 9269 |
| 1053 | Ga0495649_0036990 | 3300046694 | Bacteria | 2681 |
| 1054 | Ga0495600_0001094 | 3300046809 | Bacteria | 14750 |
| 1055 | Ga0495600_0001399 | 3300046809 | Bacteria | 13307 |
| 1056 | Ga0495600_0006454 | 3300046809 | Bacteria | 7142 |
| 1057 | Ga0495600_0007977 | 3300046809 | Bacteria | 6486 |
| 1058 | Ga0495581_0000810 | 3300047315 | Bacteria | 16618 |
| 1059 | Ga0495581_0036014 | 3300047315 | Bacteria | 2863 |
| 1060 | Ga0495581_0039280 | 3300047315 | Bacteria | 2740 |
| 1061 | Ga0495581_0050468 | 3300047315 | Bacteria | 2403 |
| 1062 | Ga0495604_0003631 | 3300047317 | Bacteria | 12306 |
| 1063 | Ga0495604_0005082 | 3300047317 | Bacteria | 10416 |
| 1064 | Ga0495604_0006658 | 3300047317 | Bacteria | 9154 |
| 1065 | Ga0495604_0055520 | 3300047317 | Bacteria | 3052 |
| 1066 | Ga0495674_0000955 | 3300047319 | Bacteria | 27621 |
| 1067 | Ga0495674_0001687 | 3300047319 | Bacteria | 21689 |
| 1068 | Ga0495674_0006393 | 3300047319 | Bacteria | 11295 |
| 1069 | Ga0495674_0010503 | 3300047319 | Bacteria | 8763 |
| 1070 | Ga0495674_0014488 | 3300047319 | Bacteria | 7379 |
| 1071 | Ga0495674_0067571 | 3300047319 | Bacteria | 3096 |
| 1072 | Ga0495676_0083113 | 3300047321 | Bacteria | 2421 |
| 1073 | Ga0495680_0000539 | 3300047322 | Bacteria | 42513 |
| 1074 | Ga0495680_0002965 | 3300047322 | Bacteria | 16974 |
| 1075 | Ga0495680_0038000 | 3300047322 | Bacteria | 3851 |
| 1076 | Ga0495687_002007 | 3300047443 | Bacteria | 17252 |
| 1077 | Ga0495687_002640 | 3300047443 | Bacteria | 14021 |
| 1078 | Ga0495675_0008558 | 3300047444 | Bacteria | 6342 |
| 1079 | Ga0495675_0011659 | 3300047444 | Bacteria | 5519 |
| 1080 | Ga0495675_0061202 | 3300047444 | Bacteria | 2385 |
| 1081 | Ga0495675_0066824 | 3300047444 | Bacteria | 2272 |
| 1082 | Ga0495684_0000266 | 3300047471 | Bacteria | 41618 |
| 1083 | Ga0495684_0000777 | 3300047471 | Bacteria | 25850 |
| 1084 | Ga0495684_0002819 | 3300047471 | Bacteria | 13707 |
| 1085 | Ga0495684_0005641 | 3300047471 | Bacteria | 9751 |
| 1086 | Ga0495684_0056485 | 3300047471 | Bacteria | 2993 |
| 1087 | Ga0495684_0127518 | 3300047471 | Bacteria | 1913 |
| 1088 | Ga0495593_0002656 | 3300047673 | Bacteria | 10746 |
| 1089 | Ga0495602_0001871 | 3300048088 | Bacteria | 21055 |
| 1090 | Ga0495602_0012527 | 3300048088 | Bacteria | 8709 |
| 1091 | Ga0496100_0041917 | 3300048903 | Bacteria | 2921 |
| 1092 | Ga0496100_0049080 | 3300048903 | Bacteria | 2727 |
| 1093 | Ga0496100_0084153 | 3300048903 | Bacteria | 2156 |
| 1094 | Ga0496101_0110773 | 3300048904 | Bacteria | 2066 |
| 1095 | Ga0496101_0136165 | 3300048904 | Bacteria | 1869 |
| 1096 | Ga0496102_0018812 | 3300048905 | Bacteria | 6076 |
| 1097 | Ga0496102_0096574 | 3300048905 | Bacteria | 2740 |
| 1098 | Ga0496102_0109610 | 3300048905 | Bacteria | 2573 |
| 1099 | Ga0496102_0133002 | 3300048905 | Bacteria | 2329 |
| 1100 | Ga0496102_0136501 | 3300048905 | Bacteria | 2298 |
| 1101 | Ga0496102_0142432 | 3300048905 | Bacteria | 2248 |
| 1102 | Ga0496103_0012210 | 3300048906 | Bacteria | 5100 |
| 1103 | Ga0496103_0012379 | 3300048906 | Bacteria | 5059 |
| 1104 | Ga0496103_0039593 | 3300048906 | Bacteria | 2897 |
| 1105 | Ga0496104_0000631 | 3300048907 | Bacteria | 30188 |
| 1106 | Ga0496104_0003007 | 3300048907 | Bacteria | 14514 |
| 1107 | Ga0496104_0031837 | 3300048907 | Bacteria | 4907 |
| 1108 | Ga0496104_0044499 | 3300048907 | Bacteria | 4171 |
| 1109 | Ga0496104_0071264 | 3300048907 | Bacteria | 3304 |
| 1110 | Ga0496104_0082259 | 3300048907 | Bacteria | 3070 |
| 1111 | Ga0496104_0151797 | 3300048907 | Bacteria | 2223 |
| 1112 | Ga0496105_0002656 | 3300048908 | Bacteria | 13019 |
| 1113 | Ga0496105_0027040 | 3300048908 | Bacteria | 4682 |
| 1114 | Ga0496105_0034147 | 3300048908 | Bacteria | 4182 |
| 1115 | Ga0496105_0038381 | 3300048908 | Bacteria | 3945 |
| 1116 | Ga0496105_0048946 | 3300048908 | Bacteria | 3489 |
| 1117 | Ga0496106_0006585 | 3300048909 | Bacteria | 8601 |
| 1118 | Ga0496106_0014414 | 3300048909 | Bacteria | 5840 |
| 1119 | Ga0496108_0000401 | 3300048911 | Bacteria | 35822 |
| 1120 | Ga0496108_0026218 | 3300048911 | Bacteria | 4806 |
| 1121 | Ga0496108_0049073 | 3300048911 | Bacteria | 3530 |
| 1122 | Ga0496109_0006972 | 3300048912 | Bacteria | 9537 |
| 1123 | Ga0496109_0008941 | 3300048912 | Bacteria | 8533 |
| 1124 | Ga0496109_0011092 | 3300048912 | Bacteria | 7726 |
| 1125 | Ga0496109_0040813 | 3300048912 | Bacteria | 4203 |
| 1126 | Ga0496109_0070516 | 3300048912 | Bacteria | 3207 |
| 1127 | Ga0496109_0128691 | 3300048912 | Bacteria | 2362 |
| 1128 | Ga0496109_0170958 | 3300048912 | Bacteria | 2039 |
| 1129 | Ga0496110_0003071 | 3300048913 | Bacteria | 12658 |
| 1130 | Ga0496110_0003215 | 3300048913 | Bacteria | 12440 |
| 1131 | Ga0496110_0092088 | 3300048913 | Bacteria | 2712 |
| 1132 | Ga0496110_0092134 | 3300048913 | Bacteria | 2711 |
| 1133 | Ga0496110_0100818 | 3300048913 | Bacteria | 2588 |
| 1134 | Ga0496110_0114993 | 3300048913 | Bacteria | 2421 |
| 1135 | Ga0496110_0120056 | 3300048913 | Bacteria | 2368 |
| 1136 | Ga0496111_0006918 | 3300048914 | Bacteria | 7403 |
| 1137 | Ga0496111_0032125 | 3300048914 | Bacteria | 3742 |
| 1138 | Ga0496111_0044181 | 3300048914 | Bacteria | 3202 |
| 1139 | Ga0496111_0044978 | 3300048914 | Bacteria | 3175 |
| 1140 | Ga0496111_0081028 | 3300048914 | Bacteria | 2369 |
| 1141 | Ga0496111_0101648 | 3300048914 | Bacteria | 2112 |
| 1142 | Ga0496112_0000019 | 3300048915 | Bacteria | 185531 |
| 1143 | Ga0496112_0006000 | 3300048915 | Bacteria | 10602 |
| 1144 | Ga0496112_0010357 | 3300048915 | Bacteria | 8455 |
| 1145 | Ga0496112_0072708 | 3300048915 | Bacteria | 3399 |
| 1146 | Ga0496112_0108981 | 3300048915 | Bacteria | 2740 |
| 1147 | Ga0496113_0000120 | 3300048916 | Bacteria | 33811 |
| 1148 | Ga0496113_0002345 | 3300048916 | Bacteria | 10957 |
| 1149 | Ga0496113_0007321 | 3300048916 | Bacteria | 7086 |
| 1150 | Ga0496113_0032298 | 3300048916 | Bacteria | 3805 |
| 1151 | Ga0496113_0072022 | 3300048916 | Bacteria | 2629 |
| 1152 | Ga0496114_0001911 | 3300048917 | Bacteria | 15861 |
| 1153 | Ga0496114_0003558 | 3300048917 | Bacteria | 11964 |
| 1154 | Ga0496114_0009131 | 3300048917 | Bacteria | 7861 |
| 1155 | Ga0496114_0049882 | 3300048917 | Bacteria | 3483 |
| 1156 | Ga0496114_0119094 | 3300048917 | Bacteria | 2269 |
| 1157 | Ga0496114_0133596 | 3300048917 | Bacteria | 2145 |
| 1158 | Ga0496114_0144437 | 3300048917 | Bacteria | 2062 |
| 1159 | Ga0496115_0014571 | 3300048918 | Bacteria | 5952 |
| 1160 | Ga0496115_0019418 | 3300048918 | Bacteria | 5229 |
| 1161 | Ga0496115_0065605 | 3300048918 | Bacteria | 2932 |
| 1162 | Ga0496116_0004642 | 3300048919 | Bacteria | 13010 |
| 1163 | Ga0496116_0017333 | 3300048919 | Bacteria | 5593 |
| 1164 | Ga0496117_0028571 | 3300048920 | Bacteria | 4316 |
| 1165 | Ga0496117_0029077 | 3300048920 | Bacteria | 4267 |
| 1166 | Ga0496117_0057840 | 3300048920 | Bacteria | 2689 |
| 1167 | Ga0496118_0004973 | 3300048921 | Bacteria | 15376 |
| 1168 | Ga0496118_0008432 | 3300048921 | Bacteria | 10656 |
| 1169 | Ga0496118_0010334 | 3300048921 | Bacteria | 9254 |
| 1170 | Ga0496118_0018408 | 3300048921 | Bacteria | 6305 |
| 1171 | Ga0496118_0035458 | 3300048921 | Bacteria | 4050 |
| 1172 | Ga0496119_0000597 | 3300048922 | Bacteria | 48924 |
| 1173 | Ga0496119_0012249 | 3300048922 | Bacteria | 6991 |
| 1174 | Ga0496119_0029020 | 3300048922 | Bacteria | 3762 |
| 1175 | Ga0496119_0053880 | 3300048922 | Bacteria | 2453 |
| 1176 | Ga0496120_0040547 | 3300048923 | Bacteria | 2735 |
| 1177 | Ga0496121_0000089 | 3300048924 | Bacteria | 219007 |
| 1178 | Ga0496121_0000627 | 3300048924 | Bacteria | 65883 |
| 1179 | Ga0496121_0002110 | 3300048924 | Bacteria | 31261 |
| 1180 | Ga0496121_0002541 | 3300048924 | Bacteria | 27654 |
| 1181 | Ga0496121_0005680 | 3300048924 | Bacteria | 15870 |
| 1182 | Ga0496121_0009971 | 3300048924 | Bacteria | 10803 |
| 1183 | Ga0496121_0010787 | 3300048924 | Bacteria | 10240 |
| 1184 | Ga0496122_0001337 | 3300048925 | Bacteria | 40284 |
| 1185 | Ga0496122_0068513 | 3300048925 | Bacteria | 2547 |
| 1186 | Ga0496123_0001933 | 3300048926 | Bacteria | 27009 |
| 1187 | Ga0496123_0014430 | 3300048926 | Bacteria | 6550 |
| 1188 | Ga0496124_0004464 | 3300048927 | Bacteria | 16323 |
| 1189 | Ga0496124_0135883 | 3300048927 | Bacteria | 1947 |
| 1190 | Ga0496124_0150981 | 3300048927 | Bacteria | 1822 |
| 1191 | Ga0496125_0000048 | 3300048928 | Bacteria | 290651 |
| 1192 | Ga0496125_0008939 | 3300048928 | Bacteria | 10399 |
| 1193 | Ga0496125_0051025 | 3300048928 | Bacteria | 3416 |
| 1194 | Ga0496125_0061560 | 3300048928 | Bacteria | 3009 |
| 1195 | Ga0496126_0001629 | 3300048929 | Bacteria | 33942 |
| 1196 | Ga0496126_0002122 | 3300048929 | Bacteria | 27701 |
| 1197 | Ga0496126_0005869 | 3300048929 | Bacteria | 13853 |
| 1198 | Ga0496126_0035854 | 3300048929 | Bacteria | 4643 |
| 1199 | Ga0496126_0052410 | 3300048929 | Bacteria | 3708 |
| 1200 | Ga0496126_0058324 | 3300048929 | Bacteria | 3480 |
| 1201 | Ga0496126_0070800 | 3300048929 | Bacteria | 3106 |
| 1202 | Ga0496126_0102048 | 3300048929 | Bacteria | 2508 |
| 1203 | Ga0496126_0104168 | 3300048929 | Bacteria | 2479 |
| 1204 | Ga0501292_000003 | 3300049515 | Bacteria | 161908 |
| 1205 | Ga0501294_000016 | 3300049517 | Bacteria | 18550 |
| 1206 | Ga0501031_0004751 | 3300049568 | Bacteria | 8822 |
| 1207 | Ga0501033_0000083 | 3300049570 | Bacteria | 89452 |
| 1208 | Ga0501034_0000019 | 3300049571 | Bacteria | 282405 |
| 1209 | Ga0501034_0114472 | 3300049571 | Bacteria | 2685 |
| 1210 | Ga0501036_0011075 | 3300049572 | Bacteria | 7458 |
| 1211 | Ga0501036_0023857 | 3300049572 | Bacteria | 5155 |
| 1212 | Ga0501037_0000083 | 3300049573 | Bacteria | 86322 |
| 1213 | Ga0501039_0157282 | 3300049575 | Bacteria | 1786 |
| 1214 | Ga0501040_0062497 | 3300049576 | Bacteria | 2562 |
| 1215 | Ga0501043_0000195 | 3300049579 | Bacteria | 55394 |
| 1216 | Ga0501043_0001626 | 3300049579 | Bacteria | 19542 |
| 1217 | Ga0501043_0032309 | 3300049579 | Bacteria | 4115 |
| 1218 | Ga0501046_0001737 | 3300049580 | Bacteria | 20771 |
| 1219 | Ga0501047_0000007 | 3300049581 | Bacteria | 443240 |
| 1220 | Ga0501047_0001199 | 3300049581 | Bacteria | 25679 |
| 1221 | Ga0501047_0001255 | 3300049581 | Bacteria | 25105 |
| 1222 | Ga0501048_0000943 | 3300049582 | Bacteria | 21492 |
| 1223 | Ga0501067_0000087 | 3300049583 | Bacteria | 53713 |
| 1224 | Ga0501067_0006889 | 3300049583 | Bacteria | 6306 |
| 1225 | Ga0501067_0010606 | 3300049583 | Bacteria | 5099 |
| 1226 | Ga0501067_0023980 | 3300049583 | Bacteria | 3383 |
| 1227 | Ga0501068_0000120 | 3300049584 | Bacteria | 34509 |
| 1228 | Ga0501068_0002120 | 3300049584 | Bacteria | 10584 |
| 1229 | Ga0501068_0006369 | 3300049584 | Bacteria | 6505 |
| 1230 | Ga0501070_0000083 | 3300049586 | Bacteria | 80820 |
| 1231 | Ga0501070_0000884 | 3300049586 | Bacteria | 27205 |
| 1232 | Ga0501070_0002364 | 3300049586 | Bacteria | 16541 |
| 1233 | Ga0501071_0084639 | 3300049587 | Bacteria | 2325 |
| 1234 | Ga0501072_0000008 | 3300049588 | Bacteria | 216818 |
| 1235 | Ga0501072_0000026 | 3300049588 | Bacteria | 140606 |
| 1236 | Ga0501072_0045773 | 3300049588 | Bacteria | 3441 |
| 1237 | Ga0501073_0000273 | 3300049589 | Bacteria | 34201 |
| 1238 | Ga0501073_0000740 | 3300049589 | Bacteria | 23114 |
| 1239 | Ga0501073_0001487 | 3300049589 | Bacteria | 17375 |
| 1240 | Ga0501073_0016789 | 3300049589 | Bacteria | 5303 |
| 1241 | Ga0501073_0018397 | 3300049589 | Bacteria | 5049 |
| 1242 | Ga0501073_0055969 | 3300049589 | Bacteria | 2759 |
| 1243 | Ga0501073_0073838 | 3300049589 | Bacteria | 2374 |
| 1244 | Ga0501074_0002872 | 3300049590 | Bacteria | 12069 |
| 1245 | Ga0501074_0031011 | 3300049590 | Bacteria | 3873 |
| 1246 | Ga0501222_000150 | 3300049662 | Bacteria | 14309 |
| 1247 | Ga0501223_000241 | 3300049663 | Bacteria | 13964 |
| 1248 | Ga0501259_001070 | 3300049688 | Bacteria | 4572 |
| 1249 | Ga0501261_000007 | 3300049690 | Bacteria | 60773 |
| 1250 | Ga0501079_0000166 | 3300049741 | Bacteria | 36526 |
| 1251 | Ga0501079_0011888 | 3300049741 | Bacteria | 6642 |
| 1252 | Ga0501080_0004571 | 3300049742 | Bacteria | 12338 |
| 1253 | Ga0501080_0005109 | 3300049742 | Bacteria | 11689 |
| 1254 | Ga0501080_0014877 | 3300049742 | Bacteria | 7164 |
| 1255 | Ga0501080_0028749 | 3300049742 | Bacteria | 5175 |
| 1256 | Ga0501080_0043578 | 3300049742 | Bacteria | 4178 |
| 1257 | Ga0501083_0003843 | 3300049744 | Bacteria | 10546 |
| 1258 | Ga0501083_0023744 | 3300049744 | Bacteria | 4252 |
| 1259 | Ga0501083_0045137 | 3300049744 | Bacteria | 2981 |
| 1260 | Ga0501083_0065733 | 3300049744 | Bacteria | 2416 |
| 1261 | Ga0501279_000009 | 3300049775 | Bacteria | 117146 |
| 1262 | Ga0501280_000022 | 3300049776 | Bacteria | 51958 |
| 1263 | Ga0501281_00089 | 3300049777 | Bacteria | 10755 |
| 1264 | Ga0501282_000069 | 3300049778 | Bacteria | 12604 |
| 1265 | Ga0501035_0000001 | 3300049822 | Bacteria | 1037138 |
| 1266 | Ga0501044_0000159 | 3300049823 | Bacteria | 83639 |
| 1267 | Ga0501044_0022678 | 3300049823 | Bacteria | 6685 |
| 1268 | Ga0501044_0225016 | 3300049823 | Bacteria | 1826 |
| 1269 | nmdc:mga03683_233_c1 | 3300050489 | Bacteria | 17402 |
| 1270 | nmdc:mga03683_3_c1 | 3300050489 | Bacteria | 285872 |
| 1271 | nmdc:mga03n38_1577_c1 | 3300050490 | Bacteria | 6628 |
| 1272 | nmdc:mga00v17_14448_c1 | 3300050491 | Bacteria | 4406 |
| 1273 | nmdc:mga00v17_15664_c1 | 3300050491 | Bacteria | 4259 |
| 1274 | nmdc:mga00v17_21920_c1 | 3300050491 | Bacteria | 3680 |
| 1275 | nmdc:mga0yw44_108142_c1 | 3300050492 | Bacteria | 1779 |
| 1276 | nmdc:mga0yw44_19556_c1 | 3300050492 | Bacteria | 3737 |
| 1277 | nmdc:mga0yw44_55460_c1 | 3300050492 | Bacteria | 2411 |
| 1278 | nmdc:mga0k408_26576_c1 | 3300050493 | Bacteria | 3282 |
| 1279 | nmdc:mga0k408_2_c1 | 3300050493 | Bacteria | 395671 |
| 1280 | nmdc:mga0k408_81667_c1 | 3300050493 | Bacteria | 1893 |
| 1281 | nmdc:mga06z11_13397_c1 | 3300050494 | Bacteria | 3600 |
| 1282 | nmdc:mga06z11_1483_c1 | 3300050494 | Bacteria | 8709 |
| 1283 | nmdc:mga06z11_16446_c1 | 3300050494 | Bacteria | 3333 |
| 1284 | nmdc:mga04h51_77_c1 | 3300050495 | Bacteria | 31782 |
| 1285 | nmdc:mga07m45_163_c1 | 3300050496 | Bacteria | 26703 |
| 1286 | nmdc:mga07m45_22_c1 | 3300050496 | Bacteria | 117399 |
| 1287 | nmdc:mga07m45_6319_c1 | 3300050496 | Bacteria | 4931 |
| 1288 | nmdc:mga05p37_25169_c1 | 3300050507 | Bacteria | 7238 |
| 1289 | nmdc:mga0qj67_235_c1 | 3300050509 | Bacteria | 37732 |
| 1290 | nmdc:mga08y16_108426_c1 | 3300050511 | Bacteria | 2891 |
| 1291 | nmdc:mga08y16_12581_c1 | 3300050511 | Bacteria | 8903 |
| 1292 | nmdc:mga08y16_29163_c1 | 3300050511 | Bacteria | 5815 |
| 1293 | nmdc:mga08y16_40831_c1 | 3300050511 | Bacteria | 4861 |
| 1294 | nmdc:mga08y16_87533_c1 | 3300050511 | Bacteria | 3246 |
| 1295 | nmdc:mga0n895_38751_c1 | 3300050512 | Bacteria | 4619 |
| 1296 | nmdc:mga0n895_7400_c1 | 3300050512 | Bacteria | 9421 |
| 1297 | nmdc:mga0rr50_37882_c1 | 3300050513 | Bacteria | 3484 |
| 1298 | nmdc:mga0a205_8462_c1 | 3300050515 | Bacteria | 9363 |
| 1299 | nmdc:mga0sz30_162_c1 | 3300050516 | Bacteria | 24511 |
| 1300 | nmdc:mga0sz30_2049_c1 | 3300050516 | Bacteria | 5539 |
| 1301 | Ga0495601_0014613 | 3300053077 | Bacteria | 4733 |
| 1302 | Ga0495612_0004149 | 3300053078 | Bacteria | 6003 |
| 1303 | Ga0500610_0039973 | 3300053079 | Bacteria | 2423 |
| 1304 | Ga0500635_0000045 | 3300053080 | Bacteria | 87314 |
| 1305 | Ga0495595_0000250 | 3300053084 | Bacteria | 21281 |
| 1306 | Ga0495595_0008027 | 3300053084 | Bacteria | 4325 |
| 1307 | Ga0495619_0002268 | 3300053085 | Bacteria | 12701 |
| 1308 | Ga0495619_0024706 | 3300053085 | Bacteria | 3855 |
| 1309 | Ga0495619_0038523 | 3300053085 | Bacteria | 3118 |
| 1310 | Ga0495619_0082652 | 3300053085 | Bacteria | 2165 |
| 1311 | Ga0500643_000150 | 3300053087 | Bacteria | 71016 |
| 1312 | Ga0500643_000544 | 3300053087 | Bacteria | 26284 |
| 1313 | Ga0500643_010091 | 3300053087 | Bacteria | 3546 |
| 1314 | Ga0500644_0000897 | 3300053088 | Bacteria | 9589 |
| 1315 | Ga0500651_0001180 | 3300053093 | Bacteria | 12952 |
| 1316 | Ga0500651_0006247 | 3300053093 | Bacteria | 6856 |
| 1317 | Ga0500566_0000011 | 3300053094 | Bacteria | 118644 |
| 1318 | Ga0500566_0000144 | 3300053094 | Bacteria | 36317 |
| 1319 | Ga0500566_0000412 | 3300053094 | Bacteria | 23818 |
| 1320 | Ga0500641_0008960 | 3300053096 | Bacteria | 3586 |
| 1321 | Ga0500641_0042066 | 3300053096 | Bacteria | 1850 |
| 1322 | Ga0500650_0065374 | 3300053098 | Bacteria | 1699 |
| 1323 | Ga0500554_003790 | 3300053102 | Bacteria | 3130 |
| 1324 | Ga0500556_0000306 | 3300053104 | Bacteria | 37363 |
| 1325 | Ga0500556_0000879 | 3300053104 | Bacteria | 16883 |
| 1326 | Ga0500557_000025 | 3300053105 | Bacteria | 84884 |
| 1327 | Ga0500569_000575 | 3300053109 | Bacteria | 6187 |
| 1328 | Ga0500569_001093 | 3300053109 | Bacteria | 4957 |
| 1329 | Ga0500572_000065 | 3300053111 | Bacteria | 32713 |
| 1330 | Ga0500572_001006 | 3300053111 | Bacteria | 8512 |
| 1331 | Ga0500592_000056 | 3300053116 | Bacteria | 31914 |
| 1332 | Ga0500592_002419 | 3300053116 | Bacteria | 3011 |
| 1333 | Ga0500595_000006 | 3300053119 | Bacteria | 300857 |
| 1334 | Ga0500595_000364 | 3300053119 | Bacteria | 29229 |
| 1335 | Ga0500595_003806 | 3300053119 | Bacteria | 6938 |
| 1336 | Ga0500595_007204 | 3300053119 | Bacteria | 4634 |
| 1337 | Ga0500595_008317 | 3300053119 | Bacteria | 4246 |
| 1338 | Ga0500607_000006 | 3300053121 | Bacteria | 136863 |
| 1339 | Ga0500607_000573 | 3300053121 | Bacteria | 35378 |
| 1340 | Ga0500608_005329 | 3300053122 | Bacteria | 5097 |
| 1341 | Ga0500614_002633 | 3300053123 | Bacteria | 3974 |
| 1342 | Ga0500642_0000017 | 3300053130 | Bacteria | 167670 |
| 1343 | Ga0500642_0000127 | 3300053130 | Bacteria | 34341 |
| 1344 | Ga0500642_0021316 | 3300053130 | Bacteria | 2564 |
| 1345 | Ga0500652_000168 | 3300053131 | Bacteria | 25261 |
| 1346 | Ga0500652_000454 | 3300053131 | Bacteria | 14537 |
| 1347 | Ga0500655_000017 | 3300053133 | Bacteria | 46539 |
| 1348 | Ga0500559_0001342 | 3300053136 | Bacteria | 14123 |
| 1349 | Ga0500559_0001551 | 3300053136 | Bacteria | 12857 |
| 1350 | Ga0500559_0001798 | 3300053136 | Bacteria | 11758 |
| 1351 | Ga0500559_0023050 | 3300053136 | Bacteria | 2642 |
| 1352 | Ga0500568_0003553 | 3300053139 | Bacteria | 8628 |
| 1353 | Ga0500568_0038550 | 3300053139 | Bacteria | 1934 |
| 1354 | Ga0500577_0000563 | 3300053142 | Bacteria | 9566 |
| 1355 | Ga0500590_004244 | 3300053148 | Bacteria | 6737 |
| 1356 | Ga0500603_000269 | 3300053150 | Bacteria | 13789 |
| 1357 | Ga0500603_000319 | 3300053150 | Bacteria | 12617 |
| 1358 | Ga0500604_0004004 | 3300053151 | Bacteria | 3933 |
| 1359 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 1360 | Ga0500616_0000118 | 3300053153 | Bacteria | 143496 |
| 1361 | Ga0500616_0006394 | 3300053153 | Bacteria | 7723 |
| 1362 | Ga0500616_0007796 | 3300053153 | Bacteria | 6750 |
| 1363 | Ga0500622_0000315 | 3300053156 | Bacteria | 49087 |
| 1364 | Ga0500622_0003396 | 3300053156 | Bacteria | 10710 |
| 1365 | Ga0500624_000184 | 3300053157 | Bacteria | 24693 |
| 1366 | Ga0500627_0001052 | 3300053158 | Bacteria | 7519 |
| 1367 | Ga0500627_0006100 | 3300053158 | Bacteria | 4072 |
| 1368 | Ga0500630_000832 | 3300053159 | Bacteria | 14267 |
| 1369 | Ga0500634_0043227 | 3300053161 | Bacteria | 2443 |
| 1370 | Ga0500638_000081 | 3300053162 | Bacteria | 17034 |
| 1371 | Ga0500639_000079 | 3300053163 | Bacteria | 45631 |
| 1372 | Ga0500636_0000041 | 3300053177 | Bacteria | 69687 |
| 1373 | Ga0500636_0000720 | 3300053177 | Bacteria | 17792 |
| 1374 | Ga0500636_0000970 | 3300053177 | Bacteria | 15430 |
| 1375 | Ga0500636_0002589 | 3300053177 | Bacteria | 10039 |
| 1376 | Ga0500636_0007376 | 3300053177 | Bacteria | 6359 |
| 1377 | Ga0500636_0011668 | 3300053177 | Bacteria | 5143 |
| 1378 | Ga0500636_0042972 | 3300053177 | Bacteria | 2670 |
| 1379 | Ga0500636_0070189 | 3300053177 | Bacteria | 2033 |
| 1380 | Ga0500637_0001657 | 3300053178 | Bacteria | 9584 |
| 1381 | Ga0500637_0002424 | 3300053178 | Bacteria | 8296 |
| 1382 | Ga0500570_026039 | 3300053724 | Bacteria | 3210 |
| 1383 | Ga0500576_001460 | 3300053725 | Bacteria | 7974 |
| 1384 | Ga0500625_002974 | 3300053729 | Bacteria | 6540 |
| 1385 | Ga0500625_009276 | 3300053729 | Bacteria | 4382 |
| 1386 | Ga0500645_000106 | 3300053730 | Bacteria | 67066 |
| 1387 | Ga0500645_006021 | 3300053730 | Bacteria | 4378 |
| 1388 | Ga0500645_006831 | 3300053730 | Bacteria | 4033 |
| 1389 | Ga0500645_009789 | 3300053730 | Bacteria | 3206 |
| 1390 | Ga0500596_000987 | 3300053735 | Bacteria | 5689 |
| 1391 | Ga0500596_002181 | 3300053735 | Bacteria | 3879 |
| 1392 | Ga0500601_000306 | 3300053737 | Bacteria | 9164 |
| 1393 | Ga0501084_0000005 | 3300054114 | Bacteria | 237244 |
| 1394 | Ga0501084_0000021 | 3300054114 | Bacteria | 146118 |
| 1395 | Ga0500661_001337 | 3300055283 | Bacteria | 4597 |
| 1396 | Ga0501082_0000171 | 3300060353 | Bacteria | 56020 |
| 1397 | Ga0501082_0000615 | 3300060353 | Bacteria | 31401 |
| 1398 | Ga0501082_0002259 | 3300060353 | Bacteria | 16870 |
| 1399 | Ga0501082_0045105 | 3300060353 | Bacteria | 3802 |
| 1400 | Ga0466962_0000006 | 3300061719 | Bacteria | 168917 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014326 | Ga0157380_10236974 | Ga0157380_102369741 | 418 |
| 2 | 3300027907 | Ga0207428_10061807 | Ga0207428_100618072 | 443 |
| 3 | 3300045976 | Ga0466967_0038848 | Ga0466967_0038848_21_1442 | 452 |
| 4 | 3300025925 | Ga0207650_10130277 | Ga0207650_101302772 | 453 |
| 5 | 3300049744 | Ga0501083_0065733 | Ga0501083_0065733_895_2406 | 455 |
| 6 | 3300047319 | Ga0495674_0067571 | Ga0495674_0067571_1642_3075 | 457 |
| 7 | 3300035113 | Ga0373936_0032142 | Ga0373936_0032142_661_2058 | 460 |
| 8 | 3300047471 | Ga0495684_0127518 | Ga0495684_0127518_17_1477 | 462 |
| 9 | 3300049590 | Ga0501074_0031011 | Ga0501074_0031011_2434_3849 | 462 |
| 10 | 3300049744 | Ga0501083_0003843 | Ga0501083_0003843_12_1427 | 462 |
| 11 | 3300048903 | Ga0496100_0084153 | Ga0496100_0084153_728_2140 | 463 |
| 12 | 3300035172 | Ga0373955_0046149 | Ga0373955_0046149_14_1519 | 465 |
| 13 | 3300044658 | Ga0466972_0001061 | Ga0466972_0001061_9372_11021 | 467 |
| 14 | 3300044735 | Ga0466968_0007887 | Ga0466968_0007887_131_1780 | 467 |
| 15 | 3300048905 | Ga0496102_0136501 | Ga0496102_0136501_363_2021 | 467 |
| 16 | 3300028563 | Ga0265319_1004330 | Ga0265319_10043305 | 468 |
| 17 | 3300048914 | Ga0496111_0101648 | Ga0496111_0101648_12_1472 | 468 |
| 18 | 3300025304 | Ga0209257_1011618 | Ga0209257_10116183 | 469 |
| 19 | 3300025315 | Ga0207697_10044170 | Ga0207697_100441702 | 469 |
| 20 | 3300053087 | Ga0500643_000150 | Ga0500643_000150_59538_61187 | 469 |
| 21 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_391951_393459 | 469 |
| 22 | iso_pu_bacteria | 8019619141 | 8019620031 | 469 |
| 23 | 3300005436 | Ga0070713_100007472 | Ga0070713_1000074723 | 470 |
| 24 | 3300006028 | Ga0070717_10131083 | Ga0070717_101310832 | 470 |
| 25 | 3300005616 | Ga0068852_100039558 | Ga0068852_1000395582 | 471 |
| 26 | 3300006038 | Ga0075365_10025507 | Ga0075365_100255072 | 473 |
| 27 | 3300007788 | Ga0099795_10009280 | Ga0099795_100092802 | 473 |
| 28 | 3300050492 | nmdc:mga0yw44_19556_c1 | nmdc:mga0yw44_19556_c1_1401_2990 | 473 |
| 29 | 3300005983 | Ga0081540_1030478 | Ga0081540_10304783 | 474 |
| 30 | 3300039447 | Ga0436361_0612836 | Ga0436361_0612836_102_1655 | 477 |
| 31 | 3300028577 | Ga0265318_10026127 | Ga0265318_100261272 | 480 |
| 32 | 3300046680 | Ga0495646_0033661 | Ga0495646_0033661_1371_3017 | 480 |
| 33 | 3300026121 | Ga0207683_10015557 | Ga0207683_100155572 | 481 |
| 34 | iso_pu_bacteria | 8019638758 | 8019646828 | 481 |
| 35 | 3300048927 | Ga0496124_0150981 | Ga0496124_0150981_173_1744 | 482 |
| 36 | 3300049571 | Ga0501034_0114472 | Ga0501034_0114472_825_2486 | 482 |
| 37 | 3300003215 | JGI25153J46596_10013376 | JGI25153J46596_100133762 | 483 |
| 38 | 3300009094 | Ga0111539_10043837 | Ga0111539_100438372 | 483 |
| 39 | 3300025230 | Ga0209563_100325 | Ga0209563_1003257 | 483 |
| 40 | 3300025253 | Ga0209677_102346 | Ga0209677_1023463 | 483 |
| 41 | 3300025297 | Ga0209758_1008838 | Ga0209758_10088386 | 483 |
| 42 | 3300050511 | nmdc:mga08y16_29163_c1 | nmdc:mga08y16_29163_c1_2206_3798 | 483 |
| 43 | 3300053094 | Ga0500566_0000412 | Ga0500566_0000412_17880_19532 | 483 |
| 44 | 3300005262 | Ga0065165_1000747 | Ga0065165_100074712 | 484 |
| 45 | 3300025261 | Ga0209233_1002110 | Ga0209233_10021104 | 484 |
| 46 | 3300048908 | Ga0496105_0038381 | Ga0496105_0038381_1418_3085 | 484 |
| 47 | 3300005937 | Ga0081455_10001999 | Ga0081455_100019992 | 486 |
| 48 | 3300049576 | Ga0501040_0062497 | Ga0501040_0062497_38_1570 | 486 |
| 49 | 3300037471 | Ga0395905_0000250 | Ga0395905_0000250_20350_21945 | 488 |
| 50 | 3300009093 | Ga0105240_10004238 | Ga0105240_1000423811 | 489 |
| 51 | 3300009545 | Ga0105237_10000940 | Ga0105237_100009402 | 489 |
| 52 | 3300025913 | Ga0207695_10005277 | Ga0207695_1000527710 | 489 |
| 53 | 3300025914 | Ga0207671_10001251 | Ga0207671_100012515 | 489 |
| 54 | 3300026116 | Ga0207674_10167142 | Ga0207674_101671421 | 489 |
| 55 | 3300031240 | Ga0265320_10015075 | Ga0265320_100150751 | 489 |
| 56 | 3300031595 | Ga0265313_10009850 | Ga0265313_100098505 | 489 |
| 57 | 3300031712 | Ga0265342_10072741 | Ga0265342_100727412 | 489 |
| 58 | 3300046463 | Ga0495653_0102510 | Ga0495653_0102510_150_1751 | 489 |
| 59 | 3300046516 | Ga0495628_0056667 | Ga0495628_0056667_674_2275 | 489 |
| 60 | 3300046517 | Ga0495630_0000173 | Ga0495630_0000173_31396_32997 | 489 |
| 61 | 3300046690 | Ga0495624_0009667 | Ga0495624_0009667_3282_4883 | 489 |
| 62 | 3300047471 | Ga0495684_0000266 | Ga0495684_0000266_16505_18106 | 489 |
| 63 | 3300025936 | Ga0207670_10026740 | Ga0207670_100267402 | 490 |
| 64 | 3300028573 | Ga0265334_10015220 | Ga0265334_100152202 | 490 |
| 65 | 3300048913 | Ga0496110_0114993 | Ga0496110_0114993_917_2410 | 490 |
| 66 | 3300031344 | Ga0265316_10026947 | Ga0265316_100269471 | 491 |
| 67 | 3300031456 | Ga0307513_10111515 | Ga0307513_101115151 | 491 |
| 68 | 3300048904 | Ga0496101_0136165 | Ga0496101_0136165_22_1587 | 491 |
| 69 | 3300005455 | Ga0070663_100074836 | Ga0070663_1000748362 | 492 |
| 70 | 3300007076 | Ga0075435_100006360 | Ga0075435_1000063607 | 492 |
| 71 | 3300028794 | Ga0307515_10105023 | Ga0307515_101050232 | 492 |
| 72 | 3300046455 | Ga0495603_0040388 | Ga0495603_0040388_1234_2733 | 492 |
| 73 | 3300046691 | Ga0495670_0017241 | Ga0495670_0017241_225_1868 | 492 |
| 74 | 3300048923 | Ga0496120_0040547 | Ga0496120_0040547_191_1834 | 492 |
| 75 | 3300048924 | Ga0496121_0009971 | Ga0496121_0009971_5924_7567 | 492 |
| 76 | 3300048926 | Ga0496123_0014430 | Ga0496123_0014430_4701_6344 | 492 |
| 77 | 3300053093 | Ga0500651_0006247 | Ga0500651_0006247_3293_4936 | 492 |
| 78 | 3300053096 | Ga0500641_0008960 | Ga0500641_0008960_15_1658 | 492 |
| 79 | 3300053104 | Ga0500556_0000306 | Ga0500556_0000306_14497_16140 | 492 |
| 80 | 3300053109 | Ga0500569_000575 | Ga0500569_000575_2226_3869 | 492 |
| 81 | 3300053116 | Ga0500592_002419 | Ga0500592_002419_891_2534 | 492 |
| 82 | 3300053130 | Ga0500642_0000017 | Ga0500642_0000017_146055_147698 | 492 |
| 83 | 3300053139 | Ga0500568_0003553 | Ga0500568_0003553_2939_4582 | 492 |
| 84 | 3300053151 | Ga0500604_0004004 | Ga0500604_0004004_1943_3586 | 492 |
| 85 | 3300053156 | Ga0500622_0003396 | Ga0500622_0003396_3222_4865 | 492 |
| 86 | 3300005614 | Ga0068856_100029183 | Ga0068856_1000291837 | 493 |
| 87 | 3300005843 | Ga0068860_100075068 | Ga0068860_1000750681 | 493 |
| 88 | 3300026067 | Ga0207678_10003737 | Ga0207678_100037372 | 493 |
| 89 | 3300053153 | Ga0500616_0000118 | Ga0500616_0000118_136028_137671 | 493 |
| 90 | 3300048907 | Ga0496104_0000631 | Ga0496104_0000631_22805_24394 | 494 |
| 91 | 3300048913 | Ga0496110_0003215 | Ga0496110_0003215_864_2453 | 494 |
| 92 | 3300048915 | Ga0496112_0010357 | Ga0496112_0010357_5151_6740 | 494 |
| 93 | 3300048916 | Ga0496113_0072022 | Ga0496113_0072022_580_2169 | 494 |
| 94 | 3300053105 | Ga0500557_000025 | Ga0500557_000025_317_1969 | 494 |
| 95 | 3300053177 | Ga0500636_0000720 | Ga0500636_0000720_8912_10528 | 494 |
| 96 | 3300053178 | Ga0500637_0001657 | Ga0500637_0001657_748_2328 | 494 |
| 97 | 3300053729 | Ga0500625_002974 | Ga0500625_002974_383_2035 | 494 |
| 98 | 3300053729 | Ga0500625_009276 | Ga0500625_009276_270_1850 | 494 |
| 99 | 3300005340 | Ga0070689_100031683 | Ga0070689_1000316832 | 495 |
| 100 | 3300005356 | Ga0070674_100010930 | Ga0070674_1000109303 | 495 |
| 101 | 3300005365 | Ga0070688_100032741 | Ga0070688_1000327411 | 495 |
| 102 | 3300005456 | Ga0070678_100017215 | Ga0070678_1000172155 | 495 |
| 103 | 3300005543 | Ga0070672_100009235 | Ga0070672_1000092354 | 495 |
| 104 | 3300005548 | Ga0070665_100004291 | Ga0070665_10000429111 | 495 |
| 105 | 3300005983 | Ga0081540_1000483 | Ga0081540_100048333 | 495 |
| 106 | 3300025936 | Ga0207670_10001660 | Ga0207670_1000166010 | 495 |
| 107 | 3300025940 | Ga0207691_10020585 | Ga0207691_100205854 | 495 |
| 108 | 3300028379 | Ga0268266_10021656 | Ga0268266_100216565 | 495 |
| 109 | 3300049584 | Ga0501068_0002120 | Ga0501068_0002120_4990_6573 | 495 |
| 110 | 3300049589 | Ga0501073_0001487 | Ga0501073_0001487_2522_4180 | 495 |
| 111 | 3300049742 | Ga0501080_0014877 | Ga0501080_0014877_386_1969 | 495 |
| 112 | 3300003762 | Ga0055542_1005518 | Ga0055542_10055182 | 496 |
| 113 | 3300007265 | Ga0099794_10035438 | Ga0099794_100354382 | 496 |
| 114 | 3300009094 | Ga0111539_10041562 | Ga0111539_100415624 | 496 |
| 115 | 3300025254 | Ga0209148_1000812 | Ga0209148_10008127 | 496 |
| 116 | 3300025261 | Ga0209233_1008168 | Ga0209233_10081682 | 496 |
| 117 | 3300025272 | Ga0209455_1001400 | Ga0209455_10014007 | 496 |
| 118 | 3300048917 | Ga0496114_0009131 | Ga0496114_0009131_5669_7252 | 496 |
| 119 | 3300050511 | nmdc:mga08y16_108426_c1 | nmdc:mga08y16_108426_c1_1098_2699 | 496 |
| 120 | 3300053730 | Ga0500645_000106 | Ga0500645_000106_23601_25199 | 496 |
| 121 | 3300039447 | Ga0436361_0958358 | Ga0436361_0958358_222_1811 | 497 |
| 122 | 3300053088 | Ga0500644_0000897 | Ga0500644_0000897_4930_6528 | 497 |
| 123 | 3300053131 | Ga0500652_000454 | Ga0500652_000454_1193_2836 | 497 |
| 124 | 3300005364 | Ga0070673_100000314 | Ga0070673_10000031418 | 498 |
| 125 | 3300005719 | Ga0068861_100006818 | Ga0068861_1000068184 | 498 |
| 126 | 3300021384 | Ga0213876_10000789 | Ga0213876_100007893 | 498 |
| 127 | 3300026118 | Ga0207675_100010160 | Ga0207675_1000101605 | 498 |
| 128 | 3300039437 | Ga0436365_0042250 | Ga0436365_0042250_48416_50005 | 498 |
| 129 | 3300005548 | Ga0070665_100014726 | Ga0070665_1000147268 | 499 |
| 130 | 3300014325 | Ga0163163_10070525 | Ga0163163_100705254 | 499 |
| 131 | 3300048903 | Ga0496100_0041917 | Ga0496100_0041917_462_2069 | 499 |
| 132 | 3300048905 | Ga0496102_0109610 | Ga0496102_0109610_719_2326 | 499 |
| 133 | 3300048907 | Ga0496104_0071264 | Ga0496104_0071264_451_2058 | 499 |
| 134 | 3300048908 | Ga0496105_0034147 | Ga0496105_0034147_248_1855 | 499 |
| 135 | 3300048911 | Ga0496108_0049073 | Ga0496108_0049073_398_2005 | 499 |
| 136 | 3300048912 | Ga0496109_0006972 | Ga0496109_0006972_4969_6576 | 499 |
| 137 | 3300048913 | Ga0496110_0003071 | Ga0496110_0003071_7902_9509 | 499 |
| 138 | 3300048914 | Ga0496111_0032125 | Ga0496111_0032125_330_1937 | 499 |
| 139 | 3300048918 | Ga0496115_0065605 | Ga0496115_0065605_271_1878 | 499 |
| 140 | 3300050493 | nmdc:mga0k408_26576_c1 | nmdc:mga0k408_26576_c1_1572_3167 | 499 |
| 141 | 3300005337 | Ga0070682_100044241 | Ga0070682_1000442412 | 500 |
| 142 | 3300005355 | Ga0070671_100178932 | Ga0070671_1001789321 | 500 |
| 143 | 3300005455 | Ga0070663_100007115 | Ga0070663_1000071154 | 500 |
| 144 | 3300005563 | Ga0068855_100119725 | Ga0068855_1001197252 | 500 |
| 145 | 3300005841 | Ga0068863_100048364 | Ga0068863_1000483642 | 500 |
| 146 | 3300005937 | Ga0081455_10002788 | Ga0081455_100027884 | 500 |
| 147 | 3300005985 | Ga0081539_10005165 | Ga0081539_100051654 | 500 |
| 148 | 3300006163 | Ga0070715_10037981 | Ga0070715_100379811 | 500 |
| 149 | 3300006852 | Ga0075433_10002626 | Ga0075433_100026263 | 500 |
| 150 | 3300006871 | Ga0075434_100129165 | Ga0075434_1001291652 | 500 |
| 151 | 3300007076 | Ga0075435_100021990 | Ga0075435_1000219904 | 500 |
| 152 | 3300009094 | Ga0111539_10144080 | Ga0111539_101440802 | 500 |
| 153 | 3300009098 | Ga0105245_10032182 | Ga0105245_100321822 | 500 |
| 154 | 3300009101 | Ga0105247_10072346 | Ga0105247_100723462 | 500 |
| 155 | 3300009147 | Ga0114129_10046183 | Ga0114129_100461835 | 500 |
| 156 | 3300009174 | Ga0105241_10046041 | Ga0105241_100460412 | 500 |
| 157 | 3300009177 | Ga0105248_10002280 | Ga0105248_100022807 | 500 |
| 158 | 3300013297 | Ga0157378_10165201 | Ga0157378_101652012 | 500 |
| 159 | 3300013308 | Ga0157375_10019930 | Ga0157375_100199305 | 500 |
| 160 | 3300025917 | Ga0207660_10037977 | Ga0207660_100379775 | 500 |
| 161 | 3300025926 | Ga0207659_10013870 | Ga0207659_100138702 | 500 |
| 162 | 3300025942 | Ga0207689_10000988 | Ga0207689_1000098816 | 500 |
| 163 | 3300025949 | Ga0207667_10050503 | Ga0207667_100505033 | 500 |
| 164 | 3300026041 | Ga0207639_10006875 | Ga0207639_100068753 | 500 |
| 165 | 3300026067 | Ga0207678_10009474 | Ga0207678_100094742 | 500 |
| 166 | 3300026089 | Ga0207648_10010265 | Ga0207648_100102655 | 500 |
| 167 | 3300031250 | Ga0265331_10000862 | Ga0265331_100008626 | 500 |
| 168 | 3300031251 | Ga0265327_10000149 | Ga0265327_10000149132 | 500 |
| 169 | 3300039438 | Ga0436360_0247830 | Ga0436360_0247830_17071_18675 | 500 |
| 170 | 3300049572 | Ga0501036_0011075 | Ga0501036_0011075_4755_6335 | 500 |
| 171 | 3300049823 | Ga0501044_0225016 | Ga0501044_0225016_82_1662 | 500 |
| 172 | 3300050512 | nmdc:mga0n895_7400_c1 | nmdc:mga0n895_7400_c1_7299_8888 | 500 |
| 173 | 3300050515 | nmdc:mga0a205_8462_c1 | nmdc:mga0a205_8462_c1_939_2528 | 500 |
| 174 | 3300053119 | Ga0500595_000006 | Ga0500595_000006_110641_112239 | 500 |
| 175 | 3300060353 | Ga0501082_0045105 | Ga0501082_0045105_1650_3230 | 500 |
| 176 | iso_pu_bacteria | 2824714736 | 2824722858 | 500 |
| 177 | 3300013306 | Ga0163162_10188099 | Ga0163162_101880992 | 501 |
| 178 | 3300026118 | Ga0207675_100026655 | Ga0207675_1000266554 | 501 |
| 179 | 3300031711 | Ga0265314_10001782 | Ga0265314_1000178219 | 501 |
| 180 | 3300035172 | Ga0373955_0009166 | Ga0373955_0009166_2641_4230 | 501 |
| 181 | 3300035410 | Ga0373924_0029572 | Ga0373924_0029572_221_1807 | 501 |
| 182 | 3300036401 | Ga0373937_0001753 | Ga0373937_0001753_3083_4669 | 501 |
| 183 | 3300039438 | Ga0436360_1063097 | Ga0436360_1063097_15_1610 | 501 |
| 184 | 3300048912 | Ga0496109_0170958 | Ga0496109_0170958_277_1884 | 501 |
| 185 | 3300005330 | Ga0070690_100031826 | Ga0070690_1000318262 | 502 |
| 186 | 3300005844 | Ga0068862_100056981 | Ga0068862_1000569813 | 502 |
| 187 | 3300006881 | Ga0068865_100007553 | Ga0068865_1000075533 | 502 |
| 188 | 3300010375 | Ga0105239_10195070 | Ga0105239_101950701 | 502 |
| 189 | 3300025261 | Ga0209233_1006415 | Ga0209233_10064152 | 502 |
| 190 | 3300025938 | Ga0207704_10002304 | Ga0207704_100023046 | 502 |
| 191 | 3300025972 | Ga0207668_10006644 | Ga0207668_100066445 | 502 |
| 192 | 3300026075 | Ga0207708_10003262 | Ga0207708_1000326212 | 502 |
| 193 | 3300039437 | Ga0436365_0564112 | Ga0436365_0564112_2199_3797 | 502 |
| 194 | 3300046462 | Ga0495651_0015545 | Ga0495651_0015545_2562_4211 | 502 |
| 195 | 3300046477 | Ga0495664_0035191 | Ga0495664_0035191_104_1753 | 502 |
| 196 | 3300046511 | Ga0495608_0026417 | Ga0495608_0026417_159_1808 | 502 |
| 197 | 3300046529 | Ga0495652_0007836 | Ga0495652_0007836_2457_4106 | 502 |
| 198 | 3300046533 | Ga0495640_0031720 | Ga0495640_0031720_1902_3551 | 502 |
| 199 | 3300046543 | Ga0495645_0010535 | Ga0495645_0010535_1421_3070 | 502 |
| 200 | 3300046559 | Ga0495667_0031389 | Ga0495667_0031389_1249_2898 | 502 |
| 201 | 3300046679 | Ga0495623_0007161 | Ga0495623_0007161_5527_7176 | 502 |
| 202 | 3300046689 | Ga0495613_0030462 | Ga0495613_0030462_1770_3419 | 502 |
| 203 | 3300046809 | Ga0495600_0001399 | Ga0495600_0001399_9296_10945 | 502 |
| 204 | 3300047317 | Ga0495604_0005082 | Ga0495604_0005082_3150_4799 | 502 |
| 205 | 3300047319 | Ga0495674_0014488 | Ga0495674_0014488_3341_4990 | 502 |
| 206 | 3300047322 | Ga0495680_0002965 | Ga0495680_0002965_2379_4028 | 502 |
| 207 | 3300047444 | Ga0495675_0061202 | Ga0495675_0061202_98_1747 | 502 |
| 208 | 3300047471 | Ga0495684_0056485 | Ga0495684_0056485_1170_2819 | 502 |
| 209 | 3300048088 | Ga0495602_0012527 | Ga0495602_0012527_5003_6652 | 502 |
| 210 | 3300053130 | Ga0500642_0000127 | Ga0500642_0000127_25362_27014 | 502 |
| 211 | 3300053737 | Ga0500601_000306 | Ga0500601_000306_6433_8082 | 502 |
| 212 | 3300005337 | Ga0070682_100004003 | Ga0070682_1000040038 | 503 |
| 213 | 3300005843 | Ga0068860_100014117 | Ga0068860_1000141176 | 503 |
| 214 | 3300005983 | Ga0081540_1028930 | Ga0081540_10289303 | 503 |
| 215 | 3300009174 | Ga0105241_10032799 | Ga0105241_100327993 | 503 |
| 216 | 3300021361 | Ga0213872_10035346 | Ga0213872_100353462 | 503 |
| 217 | 3300028666 | Ga0265336_10003752 | Ga0265336_100037522 | 503 |
| 218 | 3300031238 | Ga0265332_10020287 | Ga0265332_100202872 | 503 |
| 219 | 3300031240 | Ga0265320_10002226 | Ga0265320_100022265 | 503 |
| 220 | 3300031251 | Ga0265327_10000044 | Ga0265327_10000044127 | 503 |
| 221 | 3300031711 | Ga0265314_10020268 | Ga0265314_100202686 | 503 |
| 222 | 3300031712 | Ga0265342_10000043 | Ga0265342_1000004362 | 503 |
| 223 | 3300032005 | Ga0307411_10002080 | Ga0307411_100020808 | 503 |
| 224 | 3300035170 | Ga0373943_0040553 | Ga0373943_0040553_604_2232 | 503 |
| 225 | 3300039438 | Ga0436360_0484380 | Ga0436360_0484380_816_2399 | 503 |
| 226 | 3300046529 | Ga0495652_0044898 | Ga0495652_0044898_162_1802 | 503 |
| 227 | 3300046557 | Ga0495622_0011078 | Ga0495622_0011078_19_1659 | 503 |
| 228 | 3300046663 | Ga0495635_0004612 | Ga0495635_0004612_7586_9226 | 503 |
| 229 | 3300046675 | Ga0495657_0011893 | Ga0495657_0011893_4567_6207 | 503 |
| 230 | 3300046809 | Ga0495600_0006454 | Ga0495600_0006454_2353_3993 | 503 |
| 231 | 3300047317 | Ga0495604_0055520 | Ga0495604_0055520_85_1725 | 503 |
| 232 | 3300048907 | Ga0496104_0082259 | Ga0496104_0082259_1364_3004 | 503 |
| 233 | 3300048922 | Ga0496119_0053880 | Ga0496119_0053880_35_1675 | 503 |
| 234 | 3300048928 | Ga0496125_0061560 | Ga0496125_0061560_431_2071 | 503 |
| 235 | 3300048929 | Ga0496126_0052410 | Ga0496126_0052410_1879_3519 | 503 |
| 236 | 3300049575 | Ga0501039_0157282 | Ga0501039_0157282_24_1679 | 503 |
| 237 | 3300003323 | rootH1_10002054 | rootH1_1000205437 | 504 |
| 238 | 3300005436 | Ga0070713_100023480 | Ga0070713_1000234804 | 504 |
| 239 | 3300006028 | Ga0070717_10035686 | Ga0070717_100356863 | 504 |
| 240 | 3300025302 | Ga0207426_1000328 | Ga0207426_100032810 | 504 |
| 241 | 3300028577 | Ga0265318_10008342 | Ga0265318_100083424 | 504 |
| 242 | 3300028794 | Ga0307515_10000131 | Ga0307515_1000013129 | 504 |
| 243 | 3300028800 | Ga0265338_10004109 | Ga0265338_100041096 | 504 |
| 244 | 3300031235 | Ga0265330_10017581 | Ga0265330_100175811 | 504 |
| 245 | 3300031240 | Ga0265320_10018943 | Ga0265320_100189434 | 504 |
| 246 | 3300031242 | Ga0265329_10007780 | Ga0265329_100077802 | 504 |
| 247 | 3300031247 | Ga0265340_10014618 | Ga0265340_100146183 | 504 |
| 248 | 3300031249 | Ga0265339_10010237 | Ga0265339_100102377 | 504 |
| 249 | 3300031250 | Ga0265331_10010509 | Ga0265331_100105093 | 504 |
| 250 | 3300031456 | Ga0307513_10115328 | Ga0307513_101153282 | 504 |
| 251 | 3300031595 | Ga0265313_10010550 | Ga0265313_100105504 | 504 |
| 252 | 3300031711 | Ga0265314_10027793 | Ga0265314_100277932 | 504 |
| 253 | 3300031712 | Ga0265342_10050569 | Ga0265342_100505692 | 504 |
| 254 | 3300035119 | Ga0373956_0048116 | Ga0373956_0048116_142_1719 | 504 |
| 255 | 3300035692 | Ga0373935_0094939 | Ga0373935_0094939_15_1565 | 504 |
| 256 | 3300035724 | Ga0373933_0018992 | Ga0373933_0018992_311_1888 | 504 |
| 257 | 3300036401 | Ga0373937_0046678 | Ga0373937_0046678_104_1681 | 504 |
| 258 | 3300044658 | Ga0466972_0000079 | Ga0466972_0000079_62229_63881 | 504 |
| 259 | 3300046522 | Ga0495643_0000852 | Ga0495643_0000852_13380_14993 | 504 |
| 260 | 3300049742 | Ga0501080_0004571 | Ga0501080_0004571_7642_9240 | 504 |
| 261 | 3300005617 | Ga0068859_100047291 | Ga0068859_1000472912 | 505 |
| 262 | 3300005618 | Ga0068864_100080946 | Ga0068864_1000809463 | 505 |
| 263 | 3300005937 | Ga0081455_10000015 | Ga0081455_10000015179 | 505 |
| 264 | 3300006931 | Ga0097620_100047297 | Ga0097620_1000472974 | 505 |
| 265 | 3300021388 | Ga0213875_10000009 | Ga0213875_10000009373 | 505 |
| 266 | 3300026095 | Ga0207676_10024857 | Ga0207676_100248575 | 505 |
| 267 | 3300026116 | Ga0207674_10033659 | Ga0207674_100336594 | 505 |
| 268 | 3300028786 | Ga0307517_10000279 | Ga0307517_1000027980 | 505 |
| 269 | 3300037853 | Ga0436364_0413488 | Ga0436364_0413488_24330_25919 | 505 |
| 270 | 3300048907 | Ga0496104_0044499 | Ga0496104_0044499_265_1851 | 505 |
| 271 | 3300048917 | Ga0496114_0119094 | Ga0496114_0119094_641_2227 | 505 |
| 272 | 3300049587 | Ga0501071_0084639 | Ga0501071_0084639_603_2183 | 505 |
| 273 | 3300001991 | JGI24743J22301_10000006 | JGI24743J22301_1000000621 | 506 |
| 274 | 3300010375 | Ga0105239_10021238 | Ga0105239_100212386 | 506 |
| 275 | 3300026118 | Ga0207675_100026697 | Ga0207675_1000266975 | 506 |
| 276 | 3300028563 | Ga0265319_1000212 | Ga0265319_10002128 | 506 |
| 277 | 3300028577 | Ga0265318_10000302 | Ga0265318_1000030219 | 506 |
| 278 | 3300028794 | Ga0307515_10140827 | Ga0307515_101408272 | 506 |
| 279 | 3300031235 | Ga0265330_10000072 | Ga0265330_1000007234 | 506 |
| 280 | 3300031238 | Ga0265332_10000194 | Ga0265332_1000019419 | 506 |
| 281 | 3300031239 | Ga0265328_10003523 | Ga0265328_100035236 | 506 |
| 282 | 3300031240 | Ga0265320_10000038 | Ga0265320_1000003878 | 506 |
| 283 | 3300031242 | Ga0265329_10000104 | Ga0265329_1000010418 | 506 |
| 284 | 3300031249 | Ga0265339_10010417 | Ga0265339_100104175 | 506 |
| 285 | 3300031250 | Ga0265331_10000421 | Ga0265331_1000042115 | 506 |
| 286 | 3300031344 | Ga0265316_10000930 | Ga0265316_1000093019 | 506 |
| 287 | 3300031595 | Ga0265313_10000311 | Ga0265313_1000031127 | 506 |
| 288 | 3300031711 | Ga0265314_10000114 | Ga0265314_1000011478 | 506 |
| 289 | 3300031712 | Ga0265342_10000268 | Ga0265342_1000026819 | 506 |
| 290 | 3300031730 | Ga0307516_10000011 | Ga0307516_10000011172 | 506 |
| 291 | 3300044683 | Ga0466965_0059686 | Ga0466965_0059686_52_1635 | 506 |
| 292 | 3300044719 | Ga0466971_0000119 | Ga0466971_0000119_16616_18199 | 506 |
| 293 | 3300044842 | Ga0466957_0013977 | Ga0466957_0013977_1266_2849 | 506 |
| 294 | 3300049573 | Ga0501037_0000083 | Ga0501037_0000083_11954_13537 | 506 |
| 295 | 3300049579 | Ga0501043_0032309 | Ga0501043_0032309_1151_2752 | 506 |
| 296 | 3300049581 | Ga0501047_0001199 | Ga0501047_0001199_9184_10785 | 506 |
| 297 | 3300049583 | Ga0501067_0006889 | Ga0501067_0006889_2016_3617 | 506 |
| 298 | 3300049584 | Ga0501068_0000120 | Ga0501068_0000120_5261_6862 | 506 |
| 299 | 3300049588 | Ga0501072_0000008 | Ga0501072_0000008_205572_207173 | 506 |
| 300 | 3300049589 | Ga0501073_0073838 | Ga0501073_0073838_282_1883 | 506 |
| 301 | 3300049741 | Ga0501079_0011888 | Ga0501079_0011888_4266_5867 | 506 |
| 302 | 3300049742 | Ga0501080_0005109 | Ga0501080_0005109_4367_5968 | 506 |
| 303 | 3300049744 | Ga0501083_0023744 | Ga0501083_0023744_590_2191 | 506 |
| 304 | 3300049823 | Ga0501044_0000159 | Ga0501044_0000159_81444_83027 | 506 |
| 305 | 3300053177 | Ga0500636_0070189 | Ga0500636_0070189_223_1794 | 506 |
| 306 | 3300054114 | Ga0501084_0000005 | Ga0501084_0000005_35507_37108 | 506 |
| 307 | 3300060353 | Ga0501082_0000171 | Ga0501082_0000171_24273_25874 | 506 |
| 308 | 3300061719 | Ga0466962_0000006 | Ga0466962_0000006_19867_21450 | 506 |
| 309 | 3300003323 | rootH1_10030737 | rootH1_1003073710 | 507 |
| 310 | 3300005338 | Ga0068868_100001290 | Ga0068868_10000129016 | 507 |
| 311 | 3300005340 | Ga0070689_100024687 | Ga0070689_1000246872 | 507 |
| 312 | 3300005354 | Ga0070675_100001026 | Ga0070675_10000102617 | 507 |
| 313 | 3300005364 | Ga0070673_100000679 | Ga0070673_1000006792 | 507 |
| 314 | 3300005367 | Ga0070667_100021473 | Ga0070667_1000214733 | 507 |
| 315 | 3300005456 | Ga0070678_100024704 | Ga0070678_1000247043 | 507 |
| 316 | 3300005459 | Ga0068867_100123124 | Ga0068867_1001231241 | 507 |
| 317 | 3300005617 | Ga0068859_100032021 | Ga0068859_1000320214 | 507 |
| 318 | 3300005842 | Ga0068858_100002570 | Ga0068858_1000025702 | 507 |
| 319 | 3300006173 | Ga0070716_100019006 | Ga0070716_1000190063 | 507 |
| 320 | 3300006358 | Ga0068871_100055688 | Ga0068871_1000556883 | 507 |
| 321 | 3300006931 | Ga0097620_100032022 | Ga0097620_1000320223 | 507 |
| 322 | 3300009545 | Ga0105237_10106046 | Ga0105237_101060462 | 507 |
| 323 | 3300009553 | Ga0105249_10078257 | Ga0105249_100782573 | 507 |
| 324 | 3300013296 | Ga0157374_10036932 | Ga0157374_100369323 | 507 |
| 325 | 3300014325 | Ga0163163_10050619 | Ga0163163_100506193 | 507 |
| 326 | 3300014968 | Ga0157379_10029114 | Ga0157379_100291144 | 507 |
| 327 | 3300025926 | Ga0207659_10000322 | Ga0207659_1000032225 | 507 |
| 328 | 3300025933 | Ga0207706_10031423 | Ga0207706_100314233 | 507 |
| 329 | 3300025941 | Ga0207711_10005730 | Ga0207711_100057303 | 507 |
| 330 | 3300025960 | Ga0207651_10012387 | Ga0207651_100123872 | 507 |
| 331 | 3300026023 | Ga0207677_10009636 | Ga0207677_100096365 | 507 |
| 332 | 3300026121 | Ga0207683_10040799 | Ga0207683_100407993 | 507 |
| 333 | 3300028577 | Ga0265318_10008041 | Ga0265318_100080413 | 507 |
| 334 | 3300028800 | Ga0265338_10001103 | Ga0265338_100011036 | 507 |
| 335 | 3300031239 | Ga0265328_10009579 | Ga0265328_100095792 | 507 |
| 336 | 3300031240 | Ga0265320_10002099 | Ga0265320_1000209910 | 507 |
| 337 | 3300031247 | Ga0265340_10005200 | Ga0265340_100052003 | 507 |
| 338 | 3300031249 | Ga0265339_10016164 | Ga0265339_100161644 | 507 |
| 339 | 3300031344 | Ga0265316_10000951 | Ga0265316_100009519 | 507 |
| 340 | 3300031595 | Ga0265313_10014710 | Ga0265313_100147103 | 507 |
| 341 | 3300031711 | Ga0265314_10024792 | Ga0265314_100247922 | 507 |
| 342 | 3300031712 | Ga0265342_10001279 | Ga0265342_1000127911 | 507 |
| 343 | 3300034957 | Ga0373938_0003894 | Ga0373938_0003894_572_2155 | 507 |
| 344 | 3300035241 | Ga0373961_0005234 | Ga0373961_0005234_752_2335 | 507 |
| 345 | 3300035691 | Ga0373931_0003800 | Ga0373931_0003800_3945_5528 | 507 |
| 346 | 3300039447 | Ga0436361_0575778 | Ga0436361_0575778_2352_3953 | 507 |
| 347 | 3300039450 | Ga0436363_1355831 | Ga0436363_1355831_807_2408 | 507 |
| 348 | 3300049568 | Ga0501031_0004751 | Ga0501031_0004751_6869_8452 | 507 |
| 349 | 3300049570 | Ga0501033_0000083 | Ga0501033_0000083_72384_73967 | 507 |
| 350 | 3300049579 | Ga0501043_0001626 | Ga0501043_0001626_14225_15808 | 507 |
| 351 | 3300049581 | Ga0501047_0001255 | Ga0501047_0001255_9389_10972 | 507 |
| 352 | 3300049586 | Ga0501070_0000884 | Ga0501070_0000884_20624_22207 | 507 |
| 353 | 3300049822 | Ga0501035_0000001 | Ga0501035_0000001_467072_468655 | 507 |
| 354 | 3300050516 | nmdc:mga0sz30_2049_c1 | nmdc:mga0sz30_2049_c1_619_2211 | 507 |
| 355 | 3300053094 | Ga0500566_0000144 | Ga0500566_0000144_612_2258 | 507 |
| 356 | 3300003215 | JGI25153J46596_10004006 | JGI25153J46596_100040064 | 508 |
| 357 | 3300005340 | Ga0070689_100070032 | Ga0070689_1000700322 | 508 |
| 358 | 3300005563 | Ga0068855_100007625 | Ga0068855_10000762512 | 508 |
| 359 | 3300005614 | Ga0068856_100005399 | Ga0068856_1000053995 | 508 |
| 360 | 3300005616 | Ga0068852_100006452 | Ga0068852_1000064522 | 508 |
| 361 | 3300005617 | Ga0068859_100143786 | Ga0068859_1001437862 | 508 |
| 362 | 3300006042 | Ga0075368_10016963 | Ga0075368_100169631 | 508 |
| 363 | 3300006846 | Ga0075430_100000066 | Ga0075430_10000006630 | 508 |
| 364 | 3300006931 | Ga0097620_100143785 | Ga0097620_1001437852 | 508 |
| 365 | 3300013306 | Ga0163162_10288388 | Ga0163162_102883881 | 508 |
| 366 | 3300025297 | Ga0209758_1001848 | Ga0209758_100184821 | 508 |
| 367 | 3300025302 | Ga0207426_1000458 | Ga0207426_10004588 | 508 |
| 368 | 3300025907 | Ga0207645_10009970 | Ga0207645_100099703 | 508 |
| 369 | 3300025913 | Ga0207695_10000163 | Ga0207695_1000016315 | 508 |
| 370 | 3300025914 | Ga0207671_10004663 | Ga0207671_100046632 | 508 |
| 371 | 3300025940 | Ga0207691_10013025 | Ga0207691_100130252 | 508 |
| 372 | 3300025949 | Ga0207667_10017111 | Ga0207667_100171112 | 508 |
| 373 | 3300026023 | Ga0207677_10032216 | Ga0207677_100322162 | 508 |
| 374 | 3300026078 | Ga0207702_10014770 | Ga0207702_100147704 | 508 |
| 375 | 3300026089 | Ga0207648_10006548 | Ga0207648_1000654811 | 508 |
| 376 | 3300044684 | Ga0466966_0000191 | Ga0466966_0000191_25105_26778 | 508 |
| 377 | 3300044693 | Ga0466961_0000005 | Ga0466961_0000005_65131_66804 | 508 |
| 378 | 3300044712 | Ga0453684_0325867 | Ga0453684_0325867_56_1666 | 508 |
| 379 | 3300045049 | Ga0466959_0003302 | Ga0466959_0003302_1799_3472 | 508 |
| 380 | 3300049583 | Ga0501067_0023980 | Ga0501067_0023980_1269_2870 | 508 |
| 381 | 3300050509 | nmdc:mga0qj67_235_c1 | nmdc:mga0qj67_235_c1_3855_5453 | 508 |
| 382 | 3300005290 | Ga0065712_10025524 | Ga0065712_100255241 | 509 |
| 383 | 3300005331 | Ga0070670_100000302 | Ga0070670_10000030231 | 509 |
| 384 | 3300005355 | Ga0070671_100000185 | Ga0070671_10000018526 | 509 |
| 385 | 3300005365 | Ga0070688_100013390 | Ga0070688_1000133904 | 509 |
| 386 | 3300005367 | Ga0070667_100000060 | Ga0070667_10000006061 | 509 |
| 387 | 3300005456 | Ga0070678_100069299 | Ga0070678_1000692991 | 509 |
| 388 | 3300005466 | Ga0070685_10000048 | Ga0070685_1000004860 | 509 |
| 389 | 3300005548 | Ga0070665_100036542 | Ga0070665_1000365422 | 509 |
| 390 | 3300005564 | Ga0070664_100092724 | Ga0070664_1000927242 | 509 |
| 391 | 3300005617 | Ga0068859_100029751 | Ga0068859_1000297516 | 509 |
| 392 | 3300005618 | Ga0068864_100000119 | Ga0068864_10000011962 | 509 |
| 393 | 3300005843 | Ga0068860_100000875 | Ga0068860_1000008754 | 509 |
| 394 | 3300005843 | Ga0068860_100001922 | Ga0068860_1000019224 | 509 |
| 395 | 3300005844 | Ga0068862_100003179 | Ga0068862_1000031793 | 509 |
| 396 | 3300006844 | Ga0075428_100087762 | Ga0075428_1000877622 | 509 |
| 397 | 3300006931 | Ga0097620_100029750 | Ga0097620_1000297502 | 509 |
| 398 | 3300009101 | Ga0105247_10027718 | Ga0105247_100277183 | 509 |
| 399 | 3300009177 | Ga0105248_10037389 | Ga0105248_100373894 | 509 |
| 400 | 3300009177 | Ga0105248_10075191 | Ga0105248_100751914 | 509 |
| 401 | 3300009545 | Ga0105237_10008601 | Ga0105237_100086013 | 509 |
| 402 | 3300009553 | Ga0105249_10045509 | Ga0105249_100455094 | 509 |
| 403 | 3300014325 | Ga0163163_10000160 | Ga0163163_1000016029 | 509 |
| 404 | 3300021320 | Ga0214544_1000001 | Ga0214544_1000001543 | 509 |
| 405 | 3300021321 | Ga0214542_1001925 | Ga0214542_100192530 | 509 |
| 406 | 3300021324 | Ga0214545_1000003 | Ga0214545_1000003219 | 509 |
| 407 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002547 | 509 |
| 408 | 3300025893 | Ga0207682_10001361 | Ga0207682_100013615 | 509 |
| 409 | 3300025903 | Ga0207680_10023292 | Ga0207680_100232922 | 509 |
| 410 | 3300025925 | Ga0207650_10000013 | Ga0207650_1000001398 | 509 |
| 411 | 3300025931 | Ga0207644_10000742 | Ga0207644_100007427 | 509 |
| 412 | 3300025941 | Ga0207711_10003436 | Ga0207711_1000343614 | 509 |
| 413 | 3300025961 | Ga0207712_10119256 | Ga0207712_101192562 | 509 |
| 414 | 3300025986 | Ga0207658_10000005 | Ga0207658_1000000599 | 509 |
| 415 | 3300026095 | Ga0207676_10000010 | Ga0207676_10000010196 | 509 |
| 416 | 3300026121 | Ga0207683_10044126 | Ga0207683_100441261 | 509 |
| 417 | 3300027296 | Ga0209389_1000043 | Ga0209389_100004321 | 509 |
| 418 | 3300027357 | Ga0209589_1000047 | Ga0209589_100004790 | 509 |
| 419 | 3300027361 | Ga0209489_100075 | Ga0209489_100075122 | 509 |
| 420 | 3300028379 | Ga0268266_10009379 | Ga0268266_1000937910 | 509 |
| 421 | 3300028380 | Ga0268265_10001685 | Ga0268265_100016859 | 509 |
| 422 | 3300028381 | Ga0268264_10000016 | Ga0268264_1000001659 | 509 |
| 423 | 3300028381 | Ga0268264_10000672 | Ga0268264_1000067231 | 509 |
| 424 | 3300028794 | Ga0307515_10018110 | Ga0307515_1001811010 | 509 |
| 425 | 3300031548 | Ga0307408_100000062 | Ga0307408_10000006295 | 509 |
| 426 | 3300031911 | Ga0307412_10062602 | Ga0307412_100626022 | 509 |
| 427 | 3300032002 | Ga0307416_100000012 | Ga0307416_100000012250 | 509 |
| 428 | 3300047443 | Ga0495687_002640 | Ga0495687_002640_12114_13715 | 509 |
| 429 | 3300048927 | Ga0496124_0135883 | Ga0496124_0135883_231_1802 | 509 |
| 430 | 3300048928 | Ga0496125_0000048 | Ga0496125_0000048_216564_218189 | 509 |
| 431 | 3300005295 | Ga0065707_10084154 | Ga0065707_100841545 | 510 |
| 432 | 3300005329 | Ga0070683_100074629 | Ga0070683_1000746292 | 510 |
| 433 | 3300005334 | Ga0068869_100001294 | Ga0068869_10000129410 | 510 |
| 434 | 3300005338 | Ga0068868_100032633 | Ga0068868_1000326332 | 510 |
| 435 | 3300005355 | Ga0070671_100116174 | Ga0070671_1001161742 | 510 |
| 436 | 3300005459 | Ga0068867_100000865 | Ga0068867_1000008656 | 510 |
| 437 | 3300005535 | Ga0070684_100085007 | Ga0070684_1000850072 | 510 |
| 438 | 3300006237 | Ga0097621_100002597 | Ga0097621_1000025975 | 510 |
| 439 | 3300006358 | Ga0068871_100004107 | Ga0068871_1000041076 | 510 |
| 440 | 3300006881 | Ga0068865_100003223 | Ga0068865_1000032236 | 510 |
| 441 | 3300009098 | Ga0105245_10007663 | Ga0105245_100076634 | 510 |
| 442 | 3300025912 | Ga0207707_10000886 | Ga0207707_1000088626 | 510 |
| 443 | 3300025912 | Ga0207707_10042235 | Ga0207707_100422353 | 510 |
| 444 | 3300025927 | Ga0207687_10025359 | Ga0207687_100253593 | 510 |
| 445 | 3300025942 | Ga0207689_10059341 | Ga0207689_100593412 | 510 |
| 446 | 3300025944 | Ga0207661_10019630 | Ga0207661_100196305 | 510 |
| 447 | 3300025944 | Ga0207661_10127179 | Ga0207661_101271792 | 510 |
| 448 | 3300026023 | Ga0207677_10030833 | Ga0207677_100308332 | 510 |
| 449 | 3300026089 | Ga0207648_10003222 | Ga0207648_100032228 | 510 |
| 450 | 3300035086 | Ga0373934_0031037 | Ga0373934_0031037_135_1787 | 510 |
| 451 | 3300036401 | Ga0373937_0016403 | Ga0373937_0016403_3946_5598 | 510 |
| 452 | 3300037068 | Ga0373925_0055603 | Ga0373925_0055603_64_1716 | 510 |
| 453 | 3300046459 | Ga0495629_0111724 | Ga0495629_0111724_150_1802 | 510 |
| 454 | 3300046472 | Ga0495580_0109327 | Ga0495580_0109327_161_1813 | 510 |
| 455 | 3300046473 | Ga0495582_0041625 | Ga0495582_0041625_210_1862 | 510 |
| 456 | 3300046475 | Ga0495639_0010168 | Ga0495639_0010168_181_1833 | 510 |
| 457 | 3300046477 | Ga0495664_0035009 | Ga0495664_0035009_817_2469 | 510 |
| 458 | 3300046517 | Ga0495630_0019164 | Ga0495630_0019164_2066_3718 | 510 |
| 459 | 3300046533 | Ga0495640_0066899 | Ga0495640_0066899_254_1906 | 510 |
| 460 | 3300046642 | Ga0495634_0067650 | Ga0495634_0067650_638_2290 | 510 |
| 461 | 3300047471 | Ga0495684_0005641 | Ga0495684_0005641_5916_7568 | 510 |
| 462 | 3300048922 | Ga0496119_0000597 | Ga0496119_0000597_32715_34337 | 510 |
| 463 | 3300048922 | Ga0496119_0012249 | Ga0496119_0012249_3239_4825 | 510 |
| 464 | 3300048925 | Ga0496122_0001337 | Ga0496122_0001337_3584_5206 | 510 |
| 465 | 3300048926 | Ga0496123_0001933 | Ga0496123_0001933_21752_23374 | 510 |
| 466 | 3300053104 | Ga0500556_0000879 | Ga0500556_0000879_3714_5336 | 510 |
| 467 | 3300053122 | Ga0500608_005329 | Ga0500608_005329_1599_3242 | 510 |
| 468 | 3300053136 | Ga0500559_0001551 | Ga0500559_0001551_1907_3550 | 510 |
| 469 | 3300053177 | Ga0500636_0002589 | Ga0500636_0002589_1903_3546 | 510 |
| 470 | 3300053730 | Ga0500645_006021 | Ga0500645_006021_1227_2849 | 510 |
| 471 | 3300005337 | Ga0070682_100003941 | Ga0070682_1000039417 | 511 |
| 472 | 3300005340 | Ga0070689_100117882 | Ga0070689_1001178822 | 511 |
| 473 | 3300005365 | Ga0070688_100073945 | Ga0070688_1000739452 | 511 |
| 474 | 3300005467 | Ga0070706_100074355 | Ga0070706_1000743552 | 511 |
| 475 | 3300005468 | Ga0070707_100115885 | Ga0070707_1001158852 | 511 |
| 476 | 3300005471 | Ga0070698_100016070 | Ga0070698_1000160706 | 511 |
| 477 | 3300005518 | Ga0070699_100117393 | Ga0070699_1001173932 | 511 |
| 478 | 3300005536 | Ga0070697_100056218 | Ga0070697_1000562183 | 511 |
| 479 | 3300005536 | Ga0070697_100058461 | Ga0070697_1000584612 | 511 |
| 480 | 3300009094 | Ga0111539_10281037 | Ga0111539_102810371 | 511 |
| 481 | 3300025910 | Ga0207684_10001107 | Ga0207684_1000110731 | 511 |
| 482 | 3300025936 | Ga0207670_10103780 | Ga0207670_101037801 | 511 |
| 483 | 3300025960 | Ga0207651_10111560 | Ga0207651_101115601 | 511 |
| 484 | 3300025961 | Ga0207712_10084911 | Ga0207712_100849111 | 511 |
| 485 | 3300026035 | Ga0207703_10000817 | Ga0207703_100008175 | 511 |
| 486 | 3300028379 | Ga0268266_10239470 | Ga0268266_102394701 | 511 |
| 487 | 3300028380 | Ga0268265_10107530 | Ga0268265_101075302 | 511 |
| 488 | 3300031247 | Ga0265340_10005148 | Ga0265340_100051483 | 511 |
| 489 | 3300031249 | Ga0265339_10001668 | Ga0265339_100016688 | 511 |
| 490 | 3300031249 | Ga0265339_10004146 | Ga0265339_100041464 | 511 |
| 491 | 3300031344 | Ga0265316_10009307 | Ga0265316_100093076 | 511 |
| 492 | 3300031595 | Ga0265313_10044992 | Ga0265313_100449923 | 511 |
| 493 | 3300031711 | Ga0265314_10000001 | Ga0265314_100000011649 | 511 |
| 494 | 3300031711 | Ga0265314_10010362 | Ga0265314_100103626 | 511 |
| 495 | 3300046477 | Ga0495664_0074586 | Ga0495664_0074586_282_1877 | 511 |
| 496 | 3300046557 | Ga0495622_0003164 | Ga0495622_0003164_5869_7476 | 511 |
| 497 | 3300046689 | Ga0495613_0002444 | Ga0495613_0002444_2921_4516 | 511 |
| 498 | 3300048915 | Ga0496112_0072708 | Ga0496112_0072708_467_2026 | 511 |
| 499 | 3300050491 | nmdc:mga00v17_14448_c1 | nmdc:mga00v17_14448_c1_2645_4225 | 511 |
| 500 | 3300053177 | Ga0500636_0000041 | Ga0500636_0000041_30543_32198 | 511 |
| 501 | iso_pu_bacteria | 2738541276 | 2738714707 | 511 |
| 502 | iso_pu_bacteria | 2894772417 | 2894774530 | 511 |
| 503 | iso_pu_bacteria | 2929199973 | 2929201529 | 511 |
| 504 | iso_pu_bacteria | 8055909800 | 8055916129 | 511 |
| 505 | 3300005617 | Ga0068859_100044417 | Ga0068859_1000444173 | 512 |
| 506 | 3300006931 | Ga0097620_100044417 | Ga0097620_1000444173 | 512 |
| 507 | 3300009545 | Ga0105237_10008112 | Ga0105237_100081123 | 512 |
| 508 | 3300013296 | Ga0157374_10139391 | Ga0157374_101393912 | 512 |
| 509 | 3300025909 | Ga0207705_10001805 | Ga0207705_1000180513 | 512 |
| 510 | 3300028379 | Ga0268266_10044436 | Ga0268266_100444362 | 512 |
| 511 | 3300028800 | Ga0265338_10028156 | Ga0265338_100281562 | 512 |
| 512 | 3300029957 | Ga0265324_10000316 | Ga0265324_1000031614 | 512 |
| 513 | 3300034816 | Ga0373930_0000113 | Ga0373930_0000113_6350_7930 | 512 |
| 514 | 3300035084 | Ga0373928_0000305 | Ga0373928_0000305_857_2437 | 512 |
| 515 | 3300035089 | Ga0373944_0000080 | Ga0373944_0000080_789_2369 | 512 |
| 516 | 3300035112 | Ga0373932_0000001 | Ga0373932_0000001_1270266_1271846 | 512 |
| 517 | 3300035170 | Ga0373943_0025979 | Ga0373943_0025979_795_2426 | 512 |
| 518 | 3300035242 | Ga0373962_0000013 | Ga0373962_0000013_142_1722 | 512 |
| 519 | 3300035691 | Ga0373931_0000002 | Ga0373931_0000002_223552_225132 | 512 |
| 520 | 3300035695 | Ga0373927_0010602 | Ga0373927_0010602_3383_4963 | 512 |
| 521 | 3300035725 | Ga0373947_0016812 | Ga0373947_0016812_2027_3658 | 512 |
| 522 | 3300037068 | Ga0373925_0002323 | Ga0373925_0002323_7421_9001 | 512 |
| 523 | 3300044694 | Ga0466963_0070364 | Ga0466963_0070364_115_1755 | 512 |
| 524 | 3300046529 | Ga0495652_0044462 | Ga0495652_0044462_579_2147 | 512 |
| 525 | 3300048917 | Ga0496114_0003558 | Ga0496114_0003558_8300_9895 | 512 |
| 526 | 3300048924 | Ga0496121_0005680 | Ga0496121_0005680_3267_4919 | 512 |
| 527 | 3300002459 | JGI24751J29686_10006798 | JGI24751J29686_100067982 | 513 |
| 528 | 3300005331 | Ga0070670_100008482 | Ga0070670_1000084828 | 513 |
| 529 | 3300005331 | Ga0070670_100016572 | Ga0070670_1000165723 | 513 |
| 530 | 3300005347 | Ga0070668_100000300 | Ga0070668_10000030014 | 513 |
| 531 | 3300005355 | Ga0070671_100001904 | Ga0070671_10000190417 | 513 |
| 532 | 3300005367 | Ga0070667_100000019 | Ga0070667_100000019116 | 513 |
| 533 | 3300005618 | Ga0068864_100018783 | Ga0068864_1000187835 | 513 |
| 534 | 3300005842 | Ga0068858_100000138 | Ga0068858_10000013883 | 513 |
| 535 | 3300005843 | Ga0068860_100000042 | Ga0068860_10000004265 | 513 |
| 536 | 3300005937 | Ga0081455_10053851 | Ga0081455_100538511 | 513 |
| 537 | 3300006051 | Ga0075364_10021089 | Ga0075364_100210893 | 513 |
| 538 | 3300006177 | Ga0075362_10009394 | Ga0075362_100093945 | 513 |
| 539 | 3300006178 | Ga0075367_10016941 | Ga0075367_100169413 | 513 |
| 540 | 3300006186 | Ga0075369_10018978 | Ga0075369_100189782 | 513 |
| 541 | 3300006353 | Ga0075370_10001199 | Ga0075370_1000119911 | 513 |
| 542 | 3300006353 | Ga0075370_10098227 | Ga0075370_100982271 | 513 |
| 543 | 3300025925 | Ga0207650_10010335 | Ga0207650_100103353 | 513 |
| 544 | 3300025925 | Ga0207650_10030519 | Ga0207650_100305195 | 513 |
| 545 | 3300025931 | Ga0207644_10000721 | Ga0207644_1000072113 | 513 |
| 546 | 3300025937 | Ga0207669_10072821 | Ga0207669_100728211 | 513 |
| 547 | 3300025972 | Ga0207668_10000565 | Ga0207668_100005653 | 513 |
| 548 | 3300025986 | Ga0207658_10000002 | Ga0207658_10000002144 | 513 |
| 549 | 3300026035 | Ga0207703_10016737 | Ga0207703_100167375 | 513 |
| 550 | 3300026088 | Ga0207641_10000207 | Ga0207641_1000020758 | 513 |
| 551 | 3300026095 | Ga0207676_10068626 | Ga0207676_100686263 | 513 |
| 552 | 3300028381 | Ga0268264_10000001 | Ga0268264_10000001469 | 513 |
| 553 | 3300031616 | Ga0307508_10005665 | Ga0307508_100056656 | 513 |
| 554 | 3300031711 | Ga0265314_10015199 | Ga0265314_100151994 | 513 |
| 555 | 3300031852 | Ga0307410_10000016 | Ga0307410_1000001649 | 513 |
| 556 | 3300031903 | Ga0307407_10003156 | Ga0307407_100031562 | 513 |
| 557 | 3300031995 | Ga0307409_100000034 | Ga0307409_10000003429 | 513 |
| 558 | 3300036401 | Ga0373937_0088807 | Ga0373937_0088807_729_2318 | 513 |
| 559 | 3300044901 | Ga0466960_0015116 | Ga0466960_0015116_1232_2818 | 513 |
| 560 | 3300046689 | Ga0495613_0076425 | Ga0495613_0076425_138_1733 | 513 |
| 561 | 3300048905 | Ga0496102_0133002 | Ga0496102_0133002_460_2055 | 513 |
| 562 | 3300048907 | Ga0496104_0003007 | Ga0496104_0003007_10107_11702 | 513 |
| 563 | 3300048908 | Ga0496105_0002656 | Ga0496105_0002656_2610_4205 | 513 |
| 564 | 3300048911 | Ga0496108_0000401 | Ga0496108_0000401_32162_33757 | 513 |
| 565 | 3300048912 | Ga0496109_0008941 | Ga0496109_0008941_6067_7662 | 513 |
| 566 | 3300048913 | Ga0496110_0092134 | Ga0496110_0092134_436_2031 | 513 |
| 567 | 3300048915 | Ga0496112_0006000 | Ga0496112_0006000_5881_7476 | 513 |
| 568 | 3300048916 | Ga0496113_0000120 | Ga0496113_0000120_29278_30873 | 513 |
| 569 | 3300049579 | Ga0501043_0000195 | Ga0501043_0000195_28241_29824 | 513 |
| 570 | 3300050491 | nmdc:mga00v17_15664_c1 | nmdc:mga00v17_15664_c1_94_1674 | 513 |
| 571 | 3300050493 | nmdc:mga0k408_81667_c1 | nmdc:mga0k408_81667_c1_187_1767 | 513 |
| 572 | 3300050494 | nmdc:mga06z11_16446_c1 | nmdc:mga06z11_16446_c1_1590_3170 | 513 |
| 573 | 3300050507 | nmdc:mga05p37_25169_c1 | nmdc:mga05p37_25169_c1_2896_4491 | 513 |
| 574 | iso_pu_bacteria | 2841911363 | 2841917045 | 513 |
| 575 | iso_pu_bacteria | 2841917233 | 2841922666 | 513 |
| 576 | 3300003203 | JGI25406J46586_10009867 | JGI25406J46586_100098673 | 514 |
| 577 | 3300005335 | Ga0070666_10050526 | Ga0070666_100505263 | 514 |
| 578 | 3300005467 | Ga0070706_100002539 | Ga0070706_10000253911 | 514 |
| 579 | 3300005577 | Ga0068857_100095759 | Ga0068857_1000957591 | 514 |
| 580 | 3300005578 | Ga0068854_100011592 | Ga0068854_1000115923 | 514 |
| 581 | 3300005937 | Ga0081455_10011336 | Ga0081455_100113367 | 514 |
| 582 | 3300005985 | Ga0081539_10000118 | Ga0081539_1000011824 | 514 |
| 583 | 3300006042 | Ga0075368_10013943 | Ga0075368_100139432 | 514 |
| 584 | 3300006353 | Ga0075370_10021876 | Ga0075370_100218762 | 514 |
| 585 | 3300009093 | Ga0105240_10000053 | Ga0105240_10000053149 | 514 |
| 586 | 3300009148 | Ga0105243_10092413 | Ga0105243_100924132 | 514 |
| 587 | 3300009545 | Ga0105237_10067881 | Ga0105237_100678812 | 514 |
| 588 | 3300025298 | Ga0209050_1001613 | Ga0209050_100161314 | 514 |
| 589 | 3300025910 | Ga0207684_10007765 | Ga0207684_100077653 | 514 |
| 590 | 3300025913 | Ga0207695_10000590 | Ga0207695_1000059015 | 514 |
| 591 | 3300025914 | Ga0207671_10019133 | Ga0207671_100191332 | 514 |
| 592 | 3300025933 | Ga0207706_10026179 | Ga0207706_100261792 | 514 |
| 593 | 3300025981 | Ga0207640_10013731 | Ga0207640_100137314 | 514 |
| 594 | 3300026116 | Ga0207674_10105081 | Ga0207674_101050811 | 514 |
| 595 | 3300027866 | Ga0209813_10001620 | Ga0209813_100016203 | 514 |
| 596 | 3300029957 | Ga0265324_10010442 | Ga0265324_100104425 | 514 |
| 597 | 3300031241 | Ga0265325_10016566 | Ga0265325_100165664 | 514 |
| 598 | 3300046519 | Ga0495632_0013474 | Ga0495632_0013474_573_2186 | 514 |
| 599 | 3300046694 | Ga0495649_0004358 | Ga0495649_0004358_4062_5675 | 514 |
| 600 | 3300047443 | Ga0495687_002007 | Ga0495687_002007_6375_7988 | 514 |
| 601 | 3300050494 | nmdc:mga06z11_13397_c1 | nmdc:mga06z11_13397_c1_438_2039 | 514 |
| 602 | 3300050496 | nmdc:mga07m45_6319_c1 | nmdc:mga07m45_6319_c1_2320_3933 | 514 |
| 603 | iso_pu_bacteria | 2786546517 | 2787436468 | 514 |
| 604 | iso_pu_bacteria | 8001522603 | 8001525916 | 514 |
| 605 | 3300005356 | Ga0070674_100033968 | Ga0070674_1000339682 | 515 |
| 606 | 3300005543 | Ga0070672_100027081 | Ga0070672_1000270813 | 515 |
| 607 | 3300009093 | Ga0105240_10000535 | Ga0105240_1000053554 | 515 |
| 608 | 3300025913 | Ga0207695_10005898 | Ga0207695_1000589821 | 515 |
| 609 | 3300025931 | Ga0207644_10000454 | Ga0207644_1000045414 | 515 |
| 610 | 3300028577 | Ga0265318_10000012 | Ga0265318_10000012172 | 515 |
| 611 | 3300031090 | Ga0265760_10002753 | Ga0265760_100027536 | 515 |
| 612 | 3300031235 | Ga0265330_10000009 | Ga0265330_10000009116 | 515 |
| 613 | 3300031238 | Ga0265332_10002865 | Ga0265332_100028657 | 515 |
| 614 | 3300031239 | Ga0265328_10024805 | Ga0265328_100248052 | 515 |
| 615 | 3300031240 | Ga0265320_10000003 | Ga0265320_10000003334 | 515 |
| 616 | 3300031242 | Ga0265329_10005454 | Ga0265329_100054542 | 515 |
| 617 | 3300031249 | Ga0265339_10000900 | Ga0265339_1000090019 | 515 |
| 618 | 3300031250 | Ga0265331_10000098 | Ga0265331_100000989 | 515 |
| 619 | 3300031344 | Ga0265316_10031732 | Ga0265316_100317322 | 515 |
| 620 | 3300031595 | Ga0265313_10000171 | Ga0265313_1000017119 | 515 |
| 621 | 3300031595 | Ga0265313_10000640 | Ga0265313_100006404 | 515 |
| 622 | 3300031711 | Ga0265314_10000041 | Ga0265314_10000041171 | 515 |
| 623 | 3300031711 | Ga0265314_10018978 | Ga0265314_100189784 | 515 |
| 624 | 3300053142 | Ga0500577_0000563 | Ga0500577_0000563_237_1862 | 515 |
| 625 | 3300053177 | Ga0500636_0042972 | Ga0500636_0042972_890_2551 | 515 |
| 626 | iso_pu_bacteria | 2545555834 | 2545676798 | 515 |
| 627 | iso_pu_bacteria | 2775506901 | 2776266367 | 515 |
| 628 | iso_pu_bacteria | 641522639 | 641642871 | 515 |
| 629 | 3300003659 | JGI25404J52841_10010314 | JGI25404J52841_100103142 | 516 |
| 630 | 3300005563 | Ga0068855_100000192 | Ga0068855_10000019234 | 516 |
| 631 | 3300005983 | Ga0081540_1027883 | Ga0081540_10278832 | 516 |
| 632 | 3300006028 | Ga0070717_10140851 | Ga0070717_101408512 | 516 |
| 633 | 3300006038 | Ga0075365_10070297 | Ga0075365_100702972 | 516 |
| 634 | 3300006048 | Ga0075363_100002722 | Ga0075363_1000027224 | 516 |
| 635 | 3300007076 | Ga0075435_100014544 | Ga0075435_1000145442 | 516 |
| 636 | 3300009553 | Ga0105249_10068040 | Ga0105249_100680402 | 516 |
| 637 | 3300025906 | Ga0207699_10034270 | Ga0207699_100342702 | 516 |
| 638 | 3300025940 | Ga0207691_10047249 | Ga0207691_100472493 | 516 |
| 639 | 3300025949 | Ga0207667_10000173 | Ga0207667_1000017321 | 516 |
| 640 | 3300026089 | Ga0207648_10085897 | Ga0207648_100858972 | 516 |
| 641 | 3300026118 | Ga0207675_100024107 | Ga0207675_1000241072 | 516 |
| 642 | 3300027907 | Ga0207428_10020735 | Ga0207428_100207354 | 516 |
| 643 | 3300028558 | Ga0265326_10007004 | Ga0265326_100070043 | 516 |
| 644 | 3300028577 | Ga0265318_10005337 | Ga0265318_100053375 | 516 |
| 645 | 3300028800 | Ga0265338_10060329 | Ga0265338_100603296 | 516 |
| 646 | 3300030521 | Ga0307511_10054250 | Ga0307511_100542502 | 516 |
| 647 | 3300031235 | Ga0265330_10037183 | Ga0265330_100371832 | 516 |
| 648 | 3300031238 | Ga0265332_10003878 | Ga0265332_100038785 | 516 |
| 649 | 3300031242 | Ga0265329_10032021 | Ga0265329_100320211 | 516 |
| 650 | 3300031250 | Ga0265331_10002331 | Ga0265331_100023314 | 516 |
| 651 | 3300031507 | Ga0307509_10025035 | Ga0307509_100250352 | 516 |
| 652 | 3300031711 | Ga0265314_10003018 | Ga0265314_1000301816 | 516 |
| 653 | 3300031730 | Ga0307516_10000789 | Ga0307516_1000078914 | 516 |
| 654 | 3300037853 | Ga0436364_0719430 | Ga0436364_0719430_14_1594 | 516 |
| 655 | 3300039447 | Ga0436361_0108686 | Ga0436361_0108686_2048_3706 | 516 |
| 656 | 3300048907 | Ga0496104_0151797 | Ga0496104_0151797_58_1695 | 516 |
| 657 | 3300048908 | Ga0496105_0048946 | Ga0496105_0048946_1608_3245 | 516 |
| 658 | 3300050490 | nmdc:mga03n38_1577_c1 | nmdc:mga03n38_1577_c1_3627_5198 | 516 |
| 659 | 3300050511 | nmdc:mga08y16_12581_c1 | nmdc:mga08y16_12581_c1_5439_7040 | 516 |
| 660 | 3300050513 | nmdc:mga0rr50_37882_c1 | nmdc:mga0rr50_37882_c1_716_2305 | 516 |
| 661 | 3300053098 | Ga0500650_0065374 | Ga0500650_0065374_44_1657 | 516 |
| 662 | 3300053119 | Ga0500595_007204 | Ga0500595_007204_540_2129 | 516 |
| 663 | 3300053131 | Ga0500652_000168 | Ga0500652_000168_17974_19563 | 516 |
| 664 | 3300053177 | Ga0500636_0011668 | Ga0500636_0011668_1554_3143 | 516 |
| 665 | iso_pu_bacteria | 2643221547 | 2643757718 | 516 |
| 666 | iso_pu_bacteria | 2824644064 | 2824651763 | 516 |
| 667 | iso_pu_bacteria | 2842694124 | 2842697031 | 516 |
| 668 | 3300005354 | Ga0070675_100057929 | Ga0070675_1000579294 | 517 |
| 669 | 3300005364 | Ga0070673_100011417 | Ga0070673_1000114176 | 517 |
| 670 | 3300005471 | Ga0070698_100213584 | Ga0070698_1002135841 | 517 |
| 671 | 3300005563 | Ga0068855_100002197 | Ga0068855_10000219716 | 517 |
| 672 | 3300005614 | Ga0068856_100027049 | Ga0068856_1000270493 | 517 |
| 673 | 3300005618 | Ga0068864_100052272 | Ga0068864_1000522723 | 517 |
| 674 | 3300005842 | Ga0068858_100038967 | Ga0068858_1000389672 | 517 |
| 675 | 3300005843 | Ga0068860_100003716 | Ga0068860_10000371610 | 517 |
| 676 | 3300009093 | Ga0105240_10024203 | Ga0105240_100242037 | 517 |
| 677 | 3300009094 | Ga0111539_10079286 | Ga0111539_100792862 | 517 |
| 678 | 3300009177 | Ga0105248_10006264 | Ga0105248_100062642 | 517 |
| 679 | 3300014325 | Ga0163163_10032475 | Ga0163163_100324754 | 517 |
| 680 | 3300014968 | Ga0157379_10006700 | Ga0157379_100067002 | 517 |
| 681 | 3300025913 | Ga0207695_10062664 | Ga0207695_100626643 | 517 |
| 682 | 3300025941 | Ga0207711_10122038 | Ga0207711_101220382 | 517 |
| 683 | 3300025949 | Ga0207667_10011668 | Ga0207667_1001166810 | 517 |
| 684 | 3300025960 | Ga0207651_10018851 | Ga0207651_100188514 | 517 |
| 685 | 3300027907 | Ga0207428_10013649 | Ga0207428_100136494 | 517 |
| 686 | 3300028381 | Ga0268264_10123908 | Ga0268264_101239081 | 517 |
| 687 | 3300028573 | Ga0265334_10000218 | Ga0265334_100002182 | 517 |
| 688 | 3300031241 | Ga0265325_10008489 | Ga0265325_100084893 | 517 |
| 689 | 3300031242 | Ga0265329_10000631 | Ga0265329_1000063111 | 517 |
| 690 | 3300031247 | Ga0265340_10012494 | Ga0265340_100124943 | 517 |
| 691 | 3300031456 | Ga0307513_10088845 | Ga0307513_100888451 | 517 |
| 692 | 3300031595 | Ga0265313_10000856 | Ga0265313_100008566 | 517 |
| 693 | 3300031711 | Ga0265314_10000182 | Ga0265314_1000018227 | 517 |
| 694 | 3300035691 | Ga0373931_0001597 | Ga0373931_0001597_6351_7934 | 517 |
| 695 | 3300045051 | Ga0451576_0067703 | Ga0451576_0067703_1949_3532 | 517 |
| 696 | 3300048903 | Ga0496100_0049080 | Ga0496100_0049080_289_1872 | 517 |
| 697 | 3300048905 | Ga0496102_0142432 | Ga0496102_0142432_617_2200 | 517 |
| 698 | 3300048906 | Ga0496103_0039593 | Ga0496103_0039593_598_2181 | 517 |
| 699 | 3300048912 | Ga0496109_0128691 | Ga0496109_0128691_476_2059 | 517 |
| 700 | 3300048914 | Ga0496111_0044978 | Ga0496111_0044978_785_2368 | 517 |
| 701 | 3300048917 | Ga0496114_0133596 | Ga0496114_0133596_474_2075 | 517 |
| 702 | 3300050492 | nmdc:mga0yw44_108142_c1 | nmdc:mga0yw44_108142_c1_90_1664 | 517 |
| 703 | 3300050511 | nmdc:mga08y16_87533_c1 | nmdc:mga08y16_87533_c1_1162_2772 | 517 |
| 704 | iso_pu_bacteria | 2851182111 | 2851183752 | 517 |
| 705 | 3300003215 | JGI25153J46596_10002852 | JGI25153J46596_100028527 | 518 |
| 706 | 3300003354 | JGI25160J50197_1007102 | JGI25160J50197_10071022 | 518 |
| 707 | 3300003794 | Ga0055531_10009524 | Ga0055531_100095244 | 518 |
| 708 | 3300005262 | Ga0065165_1010604 | Ga0065165_10106045 | 518 |
| 709 | 3300009093 | Ga0105240_10004473 | Ga0105240_1000447312 | 518 |
| 710 | 3300009093 | Ga0105240_10097372 | Ga0105240_100973723 | 518 |
| 711 | 3300009545 | Ga0105237_10000523 | Ga0105237_1000052315 | 518 |
| 712 | 3300009545 | Ga0105237_10125072 | Ga0105237_101250722 | 518 |
| 713 | 3300010159 | Ga0099796_10007159 | Ga0099796_100071592 | 518 |
| 714 | 3300021361 | Ga0213872_10005329 | Ga0213872_100053295 | 518 |
| 715 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011540 | 518 |
| 716 | 3300025302 | Ga0207426_1006703 | Ga0207426_10067036 | 518 |
| 717 | 3300025304 | Ga0209257_1001101 | Ga0209257_10011016 | 518 |
| 718 | 3300025913 | Ga0207695_10045323 | Ga0207695_100453233 | 518 |
| 719 | 3300025913 | Ga0207695_10085964 | Ga0207695_100859643 | 518 |
| 720 | 3300025914 | Ga0207671_10114674 | Ga0207671_101146741 | 518 |
| 721 | 3300025924 | Ga0207694_10081682 | Ga0207694_100816822 | 518 |
| 722 | 3300025940 | Ga0207691_10001236 | Ga0207691_100012365 | 518 |
| 723 | 3300028379 | Ga0268266_10001288 | Ga0268266_1000128823 | 518 |
| 724 | 3300028573 | Ga0265334_10012354 | Ga0265334_100123543 | 518 |
| 725 | 3300028577 | Ga0265318_10000236 | Ga0265318_1000023614 | 518 |
| 726 | 3300029957 | Ga0265324_10000040 | Ga0265324_1000004080 | 518 |
| 727 | 3300031235 | Ga0265330_10000354 | Ga0265330_1000035417 | 518 |
| 728 | 3300031239 | Ga0265328_10001090 | Ga0265328_100010902 | 518 |
| 729 | 3300031240 | Ga0265320_10009072 | Ga0265320_100090723 | 518 |
| 730 | 3300031242 | Ga0265329_10000491 | Ga0265329_1000049112 | 518 |
| 731 | 3300031242 | Ga0265329_10010898 | Ga0265329_100108982 | 518 |
| 732 | 3300031250 | Ga0265331_10002513 | Ga0265331_100025139 | 518 |
| 733 | 3300031344 | Ga0265316_10001076 | Ga0265316_1000107618 | 518 |
| 734 | 3300031344 | Ga0265316_10041019 | Ga0265316_100410191 | 518 |
| 735 | 3300031711 | Ga0265314_10009657 | Ga0265314_100096571 | 518 |
| 736 | 3300031712 | Ga0265342_10000707 | Ga0265342_100007077 | 518 |
| 737 | 3300035116 | Ga0373945_0019037 | Ga0373945_0019037_623_2206 | 518 |
| 738 | 3300035120 | Ga0373957_0008762 | Ga0373957_0008762_1339_2922 | 518 |
| 739 | 3300039437 | Ga0436365_0881693 | Ga0436365_0881693_2006_3589 | 518 |
| 740 | 3300039447 | Ga0436361_0217304 | Ga0436361_0217304_707_2287 | 518 |
| 741 | 3300039447 | Ga0436361_0446852 | Ga0436361_0446852_186_1766 | 518 |
| 742 | 3300039447 | Ga0436361_0611093 | Ga0436361_0611093_3065_4645 | 518 |
| 743 | 3300045051 | Ga0451576_0113605 | Ga0451576_0113605_32_1636 | 518 |
| 744 | 3300045976 | Ga0466967_0179592 | Ga0466967_0179592_159_1793 | 518 |
| 745 | 3300046477 | Ga0495664_0036563 | Ga0495664_0036563_749_2422 | 518 |
| 746 | 3300046517 | Ga0495630_0010293 | Ga0495630_0010293_3510_5126 | 518 |
| 747 | 3300046615 | Ga0495656_0001420 | Ga0495656_0001420_1477_3072 | 518 |
| 748 | 3300046642 | Ga0495634_0001496 | Ga0495634_0001496_3700_5316 | 518 |
| 749 | 3300046691 | Ga0495670_0010707 | Ga0495670_0010707_2429_4087 | 518 |
| 750 | 3300047319 | Ga0495674_0006393 | Ga0495674_0006393_4716_6332 | 518 |
| 751 | 3300048915 | Ga0496112_0108981 | Ga0496112_0108981_569_2155 | 518 |
| 752 | iso_pu_bacteria | 2829745981 | 2829746945 | 518 |
| 753 | 3300002987 | JGI25159J45721_1004900 | JGI25159J45721_10049003 | 519 |
| 754 | 3300003771 | Ga0055526_1000447 | Ga0055526_10004472 | 519 |
| 755 | 3300005262 | Ga0065165_1000641 | Ga0065165_100064129 | 519 |
| 756 | 3300005333 | Ga0070677_10019275 | Ga0070677_100192751 | 519 |
| 757 | 3300005355 | Ga0070671_100118523 | Ga0070671_1001185231 | 519 |
| 758 | 3300005365 | Ga0070688_100025596 | Ga0070688_1000255962 | 519 |
| 759 | 3300005459 | Ga0068867_100025407 | Ga0068867_1000254073 | 519 |
| 760 | 3300005468 | Ga0070707_100018724 | Ga0070707_1000187242 | 519 |
| 761 | 3300005471 | Ga0070698_100006949 | Ga0070698_1000069497 | 519 |
| 762 | 3300005518 | Ga0070699_100030551 | Ga0070699_1000305514 | 519 |
| 763 | 3300005536 | Ga0070697_100038189 | Ga0070697_1000381892 | 519 |
| 764 | 3300005983 | Ga0081540_1003649 | Ga0081540_100364911 | 519 |
| 765 | 3300006038 | Ga0075365_10067876 | Ga0075365_100678761 | 519 |
| 766 | 3300006173 | Ga0070716_100007202 | Ga0070716_1000072025 | 519 |
| 767 | 3300006173 | Ga0070716_100031176 | Ga0070716_1000311762 | 519 |
| 768 | 3300009094 | Ga0111539_10053062 | Ga0111539_100530626 | 519 |
| 769 | 3300025284 | Ga0209130_1000648 | Ga0209130_10006489 | 519 |
| 770 | 3300025295 | Ga0209564_1000031 | Ga0209564_1000031238 | 519 |
| 771 | 3300025299 | Ga0209256_1000128 | Ga0209256_100012897 | 519 |
| 772 | 3300025899 | Ga0207642_10022875 | Ga0207642_100228752 | 519 |
| 773 | 3300025936 | Ga0207670_10028242 | Ga0207670_100282422 | 519 |
| 774 | 3300025939 | Ga0207665_10000994 | Ga0207665_100009945 | 519 |
| 775 | 3300025941 | Ga0207711_10010435 | Ga0207711_100104355 | 519 |
| 776 | 3300026121 | Ga0207683_10038522 | Ga0207683_100385222 | 519 |
| 777 | 3300028653 | Ga0265323_10010258 | Ga0265323_100102582 | 519 |
| 778 | 3300028800 | Ga0265338_10017545 | Ga0265338_100175453 | 519 |
| 779 | 3300029957 | Ga0265324_10000174 | Ga0265324_1000017418 | 519 |
| 780 | 3300031238 | Ga0265332_10005012 | Ga0265332_100050121 | 519 |
| 781 | 3300031247 | Ga0265340_10000256 | Ga0265340_100002564 | 519 |
| 782 | 3300031247 | Ga0265340_10003153 | Ga0265340_100031534 | 519 |
| 783 | 3300031247 | Ga0265340_10005099 | Ga0265340_100050996 | 519 |
| 784 | 3300031249 | Ga0265339_10000188 | Ga0265339_1000018821 | 519 |
| 785 | 3300031250 | Ga0265331_10016119 | Ga0265331_100161192 | 519 |
| 786 | 3300031344 | Ga0265316_10012949 | Ga0265316_100129492 | 519 |
| 787 | 3300031595 | Ga0265313_10012826 | Ga0265313_100128261 | 519 |
| 788 | 3300031595 | Ga0265313_10018307 | Ga0265313_100183072 | 519 |
| 789 | 3300031711 | Ga0265314_10000017 | Ga0265314_1000001730 | 519 |
| 790 | 3300031711 | Ga0265314_10013584 | Ga0265314_100135842 | 519 |
| 791 | 3300031711 | Ga0265314_10043964 | Ga0265314_100439642 | 519 |
| 792 | 3300031712 | Ga0265342_10000287 | Ga0265342_1000028726 | 519 |
| 793 | 3300031712 | Ga0265342_10003914 | Ga0265342_100039145 | 519 |
| 794 | 3300031712 | Ga0265342_10004024 | Ga0265342_100040245 | 519 |
| 795 | 3300031712 | Ga0265342_10040517 | Ga0265342_100405171 | 519 |
| 796 | 3300041451 | Ga0451791_1455622 | Ga0451791_1455622_84_1676 | 519 |
| 797 | 3300041486 | Ga0451807_1505972 | Ga0451807_1505972_2245_3837 | 519 |
| 798 | 3300048917 | Ga0496114_0144437 | Ga0496114_0144437_212_1843 | 519 |
| 799 | 3300048924 | Ga0496121_0002110 | Ga0496121_0002110_27950_29548 | 519 |
| 800 | 3300048929 | Ga0496126_0058324 | Ga0496126_0058324_584_2182 | 519 |
| 801 | 3300049584 | Ga0501068_0006369 | Ga0501068_0006369_722_2350 | 519 |
| 802 | 3300050492 | nmdc:mga0yw44_55460_c1 | nmdc:mga0yw44_55460_c1_742_2325 | 519 |
| 803 | 3300050511 | nmdc:mga08y16_40831_c1 | nmdc:mga08y16_40831_c1_3146_4738 | 519 |
| 804 | 3300053079 | Ga0500610_0039973 | Ga0500610_0039973_220_1803 | 519 |
| 805 | 3300053153 | Ga0500616_0007796 | Ga0500616_0007796_4726_6330 | 519 |
| 806 | 3300053177 | Ga0500636_0000970 | Ga0500636_0000970_8533_10143 | 519 |
| 807 | iso_pu_bacteria | 2929615660 | 2929621258 | 519 |
| 808 | iso_pu_bacteria | 2929624759 | 2929625911 | 519 |
| 809 | iso_pu_bacteria | 2933577622 | 2933582873 | 519 |
| 810 | iso_pu_bacteria | 8055742211 | 8055744881 | 519 |
| 811 | 3300005340 | Ga0070689_100000003 | Ga0070689_100000003136 | 520 |
| 812 | 3300005937 | Ga0081455_10008730 | Ga0081455_100087306 | 520 |
| 813 | 3300005983 | Ga0081540_1033317 | Ga0081540_10333172 | 520 |
| 814 | 3300005985 | Ga0081539_10000220 | Ga0081539_100002206 | 520 |
| 815 | 3300007788 | Ga0099795_10000439 | Ga0099795_100004395 | 520 |
| 816 | 3300009177 | Ga0105248_10265288 | Ga0105248_102652881 | 520 |
| 817 | 3300010159 | Ga0099796_10000306 | Ga0099796_100003065 | 520 |
| 818 | 3300025936 | Ga0207670_10000006 | Ga0207670_10000006136 | 520 |
| 819 | 3300036401 | Ga0373937_0001469 | Ga0373937_0001469_11592_13181 | 520 |
| 820 | 3300039437 | Ga0436365_0104564 | Ga0436365_0104564_719_2359 | 520 |
| 821 | 3300041505 | Ga0451849_0319247 | Ga0451849_0319247_1447_3093 | 520 |
| 822 | 3300041512 | Ga0451853_0598287 | Ga0451853_0598287_3932_5578 | 520 |
| 823 | iso_pu_bacteria | 2511231028 | 2511398970 | 520 |
| 824 | iso_pu_bacteria | 2513237101 | 2513693776 | 520 |
| 825 | iso_pu_bacteria | 2513237104 | 2513721529 | 520 |
| 826 | iso_pu_bacteria | 2791355199 | 2793077835 | 520 |
| 827 | iso_pu_bacteria | 2824704595 | 2824711119 | 520 |
| 828 | iso_pu_bacteria | 2824753945 | 2824760446 | 520 |
| 829 | iso_pu_bacteria | 2824763712 | 2824766565 | 520 |
| 830 | iso_pu_bacteria | 2842698319 | 2842702894 | 520 |
| 831 | iso_pu_bacteria | 2844315083 | 2844320220 | 520 |
| 832 | iso_pu_bacteria | 2874604998 | 2874611643 | 520 |
| 833 | iso_pu_bacteria | 2874628541 | 2874630108 | 520 |
| 834 | iso_pu_bacteria | 2876808645 | 2876813551 | 520 |
| 835 | iso_pu_bacteria | 2879110137 | 2879117508 | 520 |
| 836 | iso_pu_bacteria | 2889033259 | 2889037755 | 520 |
| 837 | iso_pu_bacteria | 2903727486 | 2903731190 | 520 |
| 838 | iso_pu_bacteria | 2904711408 | 2904711737 | 520 |
| 839 | iso_pu_bacteria | 2906602504 | 2906610043 | 520 |
| 840 | iso_pu_bacteria | 2906626472 | 2906629214 | 520 |
| 841 | iso_pu_bacteria | 2922361189 | 2922361697 | 520 |
| 842 | iso_pu_bacteria | 2935769743 | 2935776452 | 520 |
| 843 | iso_pu_bacteria | 2935785616 | 2935792323 | 520 |
| 844 | iso_pu_bacteria | 2935793552 | 2935800502 | 520 |
| 845 | iso_pu_bacteria | 2935959822 | 2935962913 | 520 |
| 846 | iso_pu_bacteria | 3005710791 | 3005716007 | 520 |
| 847 | iso_pu_bacteria | 8006964411 | 8006966813 | 520 |
| 848 | iso_pu_bacteria | 8006984368 | 8006984683 | 520 |
| 849 | iso_pu_bacteria | 8006994254 | 8006994676 | 520 |
| 850 | iso_pu_bacteria | 8016583857 | 8016594608 | 520 |
| 851 | 3300005435 | Ga0070714_100166027 | Ga0070714_1001660271 | 521 |
| 852 | 3300005535 | Ga0070684_100009421 | Ga0070684_1000094214 | 521 |
| 853 | 3300049571 | Ga0501034_0000019 | Ga0501034_0000019_211376_213004 | 521 |
| 854 | 3300049572 | Ga0501036_0023857 | Ga0501036_0023857_2163_3791 | 521 |
| 855 | 3300049580 | Ga0501046_0001737 | Ga0501046_0001737_5009_6637 | 521 |
| 856 | 3300049581 | Ga0501047_0000007 | Ga0501047_0000007_229981_231609 | 521 |
| 857 | 3300049582 | Ga0501048_0000943 | Ga0501048_0000943_6842_8470 | 521 |
| 858 | 3300049583 | Ga0501067_0010606 | Ga0501067_0010606_17_1621 | 521 |
| 859 | 3300049586 | Ga0501070_0002364 | Ga0501070_0002364_4501_6129 | 521 |
| 860 | 3300049588 | Ga0501072_0000026 | Ga0501072_0000026_68897_70525 | 521 |
| 861 | 3300049588 | Ga0501072_0045773 | Ga0501072_0045773_1583_3211 | 521 |
| 862 | 3300049589 | Ga0501073_0016789 | Ga0501073_0016789_1803_3431 | 521 |
| 863 | 3300049741 | Ga0501079_0000166 | Ga0501079_0000166_13689_15317 | 521 |
| 864 | 3300049742 | Ga0501080_0028749 | Ga0501080_0028749_1745_3373 | 521 |
| 865 | 3300049744 | Ga0501083_0045137 | Ga0501083_0045137_204_1832 | 521 |
| 866 | 3300049823 | Ga0501044_0022678 | Ga0501044_0022678_3150_4775 | 521 |
| 867 | 3300053153 | Ga0500616_0006394 | Ga0500616_0006394_95_1687 | 521 |
| 868 | 3300054114 | Ga0501084_0000021 | Ga0501084_0000021_32826_34454 | 521 |
| 869 | 3300060353 | Ga0501082_0002259 | Ga0501082_0002259_5137_6765 | 521 |
| 870 | iso_pu_bacteria | 2507262055 | 2507507455 | 521 |
| 871 | iso_pu_bacteria | 2508501009 | 2508541569 | 521 |
| 872 | iso_pu_bacteria | 2508501042 | 2508692888 | 521 |
| 873 | iso_pu_bacteria | 2513237092 | 2513621664 | 521 |
| 874 | iso_pu_bacteria | 2513237094 | 2513636912 | 521 |
| 875 | iso_pu_bacteria | 2513237095 | 2513651143 | 521 |
| 876 | iso_pu_bacteria | 2513237102 | 2513700653 | 521 |
| 877 | iso_pu_bacteria | 2513237139 | 2513878363 | 521 |
| 878 | iso_pu_bacteria | 2513237161 | 2514011707 | 521 |
| 879 | iso_pu_bacteria | 2515154112 | 2515626278 | 521 |
| 880 | iso_pu_bacteria | 2517093001 | 2517107845 | 521 |
| 881 | iso_pu_bacteria | 2528768022 | 2528852881 | 521 |
| 882 | iso_pu_bacteria | 2602042107 | 2603858146 | 521 |
| 883 | iso_pu_bacteria | 2617270735 | 2617352713 | 521 |
| 884 | iso_pu_bacteria | 2617270741 | 2617372944 | 521 |
| 885 | iso_pu_bacteria | 2791355196 | 2793061087 | 521 |
| 886 | iso_pu_bacteria | 2802429603 | 2805920586 | 521 |
| 887 | iso_pu_bacteria | 2816332527 | 2818236777 | 521 |
| 888 | iso_pu_bacteria | 2824617872 | 2824622030 | 521 |
| 889 | iso_pu_bacteria | 2824626560 | 2824629294 | 521 |
| 890 | iso_pu_bacteria | 2824635225 | 2824639173 | 521 |
| 891 | iso_pu_bacteria | 2824661429 | 2824664040 | 521 |
| 892 | iso_pu_bacteria | 2824671348 | 2824675210 | 521 |
| 893 | iso_pu_bacteria | 2824679649 | 2824681567 | 521 |
| 894 | iso_pu_bacteria | 2824687955 | 2824690042 | 521 |
| 895 | iso_pu_bacteria | 2824696289 | 2824701155 | 521 |
| 896 | iso_pu_bacteria | 2824723954 | 2824731756 | 521 |
| 897 | iso_pu_bacteria | 2824732956 | 2824735652 | 521 |
| 898 | iso_pu_bacteria | 2824746037 | 2824752150 | 521 |
| 899 | iso_pu_bacteria | 2824773399 | 2824776685 | 521 |
| 900 | iso_pu_bacteria | 2838122688 | 2838127365 | 521 |
| 901 | iso_pu_bacteria | 2841941048 | 2841946384 | 521 |
| 902 | iso_pu_bacteria | 2841949485 | 2841957103 | 521 |
| 903 | iso_pu_bacteria | 2841957949 | 2841965623 | 521 |
| 904 | iso_pu_bacteria | 2841966195 | 2841972894 | 521 |
| 905 | iso_pu_bacteria | 2841974524 | 2841978434 | 521 |
| 906 | iso_pu_bacteria | 2841983080 | 2841987464 | 521 |
| 907 | iso_pu_bacteria | 2842038055 | 2842040860 | 521 |
| 908 | iso_pu_bacteria | 2842045827 | 2842046195 | 521 |
| 909 | iso_pu_bacteria | 2847939898 | 2847947967 | 521 |
| 910 | iso_pu_bacteria | 2849076700 | 2849078185 | 521 |
| 911 | iso_pu_bacteria | 2857524615 | 2857527535 | 521 |
| 912 | iso_pu_bacteria | 2874590934 | 2874598571 | 521 |
| 913 | iso_pu_bacteria | 2874612657 | 2874616759 | 521 |
| 914 | iso_pu_bacteria | 2874620515 | 2874628294 | 521 |
| 915 | iso_pu_bacteria | 2874645413 | 2874652024 | 521 |
| 916 | iso_pu_bacteria | 2876761206 | 2876768299 | 521 |
| 917 | iso_pu_bacteria | 2876771140 | 2876778609 | 521 |
| 918 | iso_pu_bacteria | 2876818435 | 2876823414 | 521 |
| 919 | iso_pu_bacteria | 2879074833 | 2879082402 | 521 |
| 920 | iso_pu_bacteria | 2879099564 | 2879107938 | 521 |
| 921 | iso_pu_bacteria | 2879127579 | 2879131817 | 521 |
| 922 | iso_pu_bacteria | 2879142872 | 2879150153 | 521 |
| 923 | iso_pu_bacteria | 2881364244 | 2881370119 | 521 |
| 924 | iso_pu_bacteria | 2881665667 | 2881670119 | 521 |
| 925 | iso_pu_bacteria | 2885366525 | 2885370184 | 521 |
| 926 | iso_pu_bacteria | 2885409591 | 2885414380 | 521 |
| 927 | iso_pu_bacteria | 2888378607 | 2888385700 | 521 |
| 928 | iso_pu_bacteria | 2888388044 | 2888392572 | 521 |
| 929 | iso_pu_bacteria | 2893066018 | 2893067029 | 521 |
| 930 | iso_pu_bacteria | 2904666416 | 2904674087 | 521 |
| 931 | iso_pu_bacteria | 2908775508 | 2908781393 | 521 |
| 932 | iso_pu_bacteria | 2919073203 | 2919073384 | 521 |
| 933 | iso_pu_bacteria | 2922368715 | 2922375948 | 521 |
| 934 | iso_pu_bacteria | 2922393267 | 2922396852 | 521 |
| 935 | iso_pu_bacteria | 2932784394 | 2932785205 | 521 |
| 936 | iso_pu_bacteria | 2932801729 | 2932808754 | 521 |
| 937 | iso_pu_bacteria | 2932809354 | 2932810238 | 521 |
| 938 | iso_pu_bacteria | 2932818245 | 2932821810 | 521 |
| 939 | iso_pu_bacteria | 2932828146 | 2932829041 | 521 |
| 940 | iso_pu_bacteria | 2935608549 | 2935610041 | 521 |
| 941 | iso_pu_bacteria | 2935616580 | 2935619539 | 521 |
| 942 | iso_pu_bacteria | 2935638405 | 2935638519 | 521 |
| 943 | iso_pu_bacteria | 2935648319 | 2935656349 | 521 |
| 944 | iso_pu_bacteria | 2935656913 | 2935660095 | 521 |
| 945 | iso_pu_bacteria | 2935665750 | 2935666629 | 521 |
| 946 | iso_pu_bacteria | 2935675223 | 2935682182 | 521 |
| 947 | iso_pu_bacteria | 2935684952 | 2935691164 | 521 |
| 948 | iso_pu_bacteria | 2935694250 | 2935694412 | 521 |
| 949 | iso_pu_bacteria | 2935703347 | 2935703525 | 521 |
| 950 | iso_pu_bacteria | 2935713505 | 2935718545 | 521 |
| 951 | iso_pu_bacteria | 2935722832 | 2935727475 | 521 |
| 952 | iso_pu_bacteria | 2935732158 | 2935736178 | 521 |
| 953 | iso_pu_bacteria | 2935741537 | 2935745558 | 521 |
| 954 | iso_pu_bacteria | 2935750917 | 2935755939 | 521 |
| 955 | iso_pu_bacteria | 2935760218 | 2935760797 | 521 |
| 956 | iso_pu_bacteria | 2935801545 | 2935801662 | 521 |
| 957 | iso_pu_bacteria | 2935810662 | 2935814927 | 521 |
| 958 | iso_pu_bacteria | 2935819856 | 2935823201 | 521 |
| 959 | iso_pu_bacteria | 2935827899 | 2935828013 | 521 |
| 960 | iso_pu_bacteria | 2935837841 | 2935842218 | 521 |
| 961 | iso_pu_bacteria | 2935847175 | 2935848783 | 521 |
| 962 | iso_pu_bacteria | 2935855204 | 2935858145 | 521 |
| 963 | iso_pu_bacteria | 2935864058 | 2935868050 | 521 |
| 964 | iso_pu_bacteria | 2935873716 | 2935873927 | 521 |
| 965 | iso_pu_bacteria | 2935883170 | 2935885683 | 521 |
| 966 | iso_pu_bacteria | 2935908558 | 2935909415 | 521 |
| 967 | iso_pu_bacteria | 2935916978 | 2935917137 | 521 |
| 968 | iso_pu_bacteria | 2935926038 | 2935926896 | 521 |
| 969 | iso_pu_bacteria | 2935934488 | 2935937260 | 521 |
| 970 | iso_pu_bacteria | 2935942939 | 2935944437 | 521 |
| 971 | iso_pu_bacteria | 2935951376 | 2935952874 | 521 |
| 972 | iso_pu_bacteria | 2935967501 | 2935969714 | 521 |
| 973 | iso_pu_bacteria | 2935975950 | 2935976325 | 521 |
| 974 | iso_pu_bacteria | 2935984226 | 2935991834 | 521 |
| 975 | iso_pu_bacteria | 2935992306 | 2935993149 | 521 |
| 976 | iso_pu_bacteria | 2936002035 | 2936003086 | 521 |
| 977 | iso_pu_bacteria | 2936011229 | 2936014511 | 521 |
| 978 | iso_pu_bacteria | 2936019824 | 2936027822 | 521 |
| 979 | iso_pu_bacteria | 2936028420 | 2936031292 | 521 |
| 980 | iso_pu_bacteria | 2936037263 | 2936040430 | 521 |
| 981 | iso_pu_bacteria | 2936046547 | 2936049617 | 521 |
| 982 | iso_pu_bacteria | 2936055302 | 2936061167 | 521 |
| 983 | iso_pu_bacteria | 2940556831 | 2940562086 | 521 |
| 984 | iso_pu_bacteria | 2941538514 | 2941542267 | 521 |
| 985 | iso_pu_bacteria | 3005483717 | 3005488452 | 521 |
| 986 | iso_pu_bacteria | 3005506211 | 3005508226 | 521 |
| 987 | iso_pu_bacteria | 3005587118 | 3005588275 | 521 |
| 988 | iso_pu_bacteria | 3005594810 | 3005600533 | 521 |
| 989 | iso_pu_bacteria | 3005718088 | 3005723356 | 521 |
| 990 | iso_pu_bacteria | 8006926726 | 8006928641 | 521 |
| 991 | iso_pu_bacteria | 8016511872 | 8016520419 | 521 |
| 992 | iso_pu_bacteria | 8016630954 | 8016638941 | 521 |
| 993 | iso_pu_bacteria | 8017057580 | 8017065155 | 521 |
| 994 | iso_pu_bacteria | 8019586578 | 8019592319 | 521 |
| 995 | iso_pu_bacteria | 8019608314 | 8019609407 | 521 |
| 996 | iso_pu_bacteria | 8019629233 | 8019633075 | 521 |
| 997 | iso_pu_bacteria | 8019648815 | 8019649602 | 521 |
| 998 | iso_pu_bacteria | 8019668869 | 8019670516 | 521 |
| 999 | iso_pu_bacteria | 8019687851 | 8019691292 | 521 |
| 1000 | iso_pu_bacteria | 8056967851 | 8056974847 | 521 |
| 1001 | 3300002070 | JGI24750J21931_1000961 | JGI24750J21931_10009612 | 522 |
| 1002 | 3300005327 | Ga0070658_10030065 | Ga0070658_100300653 | 522 |
| 1003 | 3300005336 | Ga0070680_100006002 | Ga0070680_1000060025 | 522 |
| 1004 | 3300005338 | Ga0068868_100004970 | Ga0068868_1000049704 | 522 |
| 1005 | 3300005340 | Ga0070689_100003777 | Ga0070689_1000037775 | 522 |
| 1006 | 3300005347 | Ga0070668_100002551 | Ga0070668_1000025513 | 522 |
| 1007 | 3300005355 | Ga0070671_100001960 | Ga0070671_1000019606 | 522 |
| 1008 | 3300005364 | Ga0070673_100018372 | Ga0070673_1000183723 | 522 |
| 1009 | 3300005367 | Ga0070667_100043409 | Ga0070667_1000434092 | 522 |
| 1010 | 3300005367 | Ga0070667_100065659 | Ga0070667_1000656592 | 522 |
| 1011 | 3300005438 | Ga0070701_10003498 | Ga0070701_100034983 | 522 |
| 1012 | 3300005441 | Ga0070700_100029752 | Ga0070700_1000297522 | 522 |
| 1013 | 3300005530 | Ga0070679_100028198 | Ga0070679_1000281983 | 522 |
| 1014 | 3300005539 | Ga0068853_100005048 | Ga0068853_1000050482 | 522 |
| 1015 | 3300005544 | Ga0070686_100005830 | Ga0070686_1000058303 | 522 |
| 1016 | 3300005548 | Ga0070665_100044258 | Ga0070665_1000442582 | 522 |
| 1017 | 3300005563 | Ga0068855_100070333 | Ga0068855_1000703333 | 522 |
| 1018 | 3300005578 | Ga0068854_100046172 | Ga0068854_1000461722 | 522 |
| 1019 | 3300005615 | Ga0070702_100002985 | Ga0070702_1000029852 | 522 |
| 1020 | 3300005617 | Ga0068859_100000234 | Ga0068859_10000023416 | 522 |
| 1021 | 3300005617 | Ga0068859_100015278 | Ga0068859_1000152783 | 522 |
| 1022 | 3300005618 | Ga0068864_100016415 | Ga0068864_1000164154 | 522 |
| 1023 | 3300005841 | Ga0068863_100011468 | Ga0068863_1000114686 | 522 |
| 1024 | 3300005842 | Ga0068858_100002969 | Ga0068858_10000296912 | 522 |
| 1025 | 3300005843 | Ga0068860_100023935 | Ga0068860_1000239355 | 522 |
| 1026 | 3300005843 | Ga0068860_100026183 | Ga0068860_1000261832 | 522 |
| 1027 | 3300006358 | Ga0068871_100040734 | Ga0068871_1000407342 | 522 |
| 1028 | 3300006931 | Ga0097620_100000234 | Ga0097620_10000023416 | 522 |
| 1029 | 3300006931 | Ga0097620_100015278 | Ga0097620_1000152784 | 522 |
| 1030 | 3300007265 | Ga0099794_10054279 | Ga0099794_100542792 | 522 |
| 1031 | 3300007788 | Ga0099795_10003692 | Ga0099795_100036921 | 522 |
| 1032 | 3300009176 | Ga0105242_10016950 | Ga0105242_100169503 | 522 |
| 1033 | 3300009551 | Ga0105238_10003007 | Ga0105238_100030073 | 522 |
| 1034 | 3300013306 | Ga0163162_10016774 | Ga0163162_100167743 | 522 |
| 1035 | 3300014325 | Ga0163163_10002766 | Ga0163163_1000276610 | 522 |
| 1036 | 3300014325 | Ga0163163_10032153 | Ga0163163_100321534 | 522 |
| 1037 | 3300014968 | Ga0157379_10000171 | Ga0157379_1000017121 | 522 |
| 1038 | 3300014969 | Ga0157376_10039904 | Ga0157376_100399043 | 522 |
| 1039 | 3300025900 | Ga0207710_10019832 | Ga0207710_100198322 | 522 |
| 1040 | 3300025901 | Ga0207688_10000290 | Ga0207688_1000029017 | 522 |
| 1041 | 3300025907 | Ga0207645_10033658 | Ga0207645_100336582 | 522 |
| 1042 | 3300025908 | Ga0207643_10003975 | Ga0207643_100039755 | 522 |
| 1043 | 3300025909 | Ga0207705_10042106 | Ga0207705_100421063 | 522 |
| 1044 | 3300025917 | Ga0207660_10017407 | Ga0207660_100174073 | 522 |
| 1045 | 3300025921 | Ga0207652_10013425 | Ga0207652_100134255 | 522 |
| 1046 | 3300025921 | Ga0207652_10126863 | Ga0207652_101268632 | 522 |
| 1047 | 3300025923 | Ga0207681_10051971 | Ga0207681_100519712 | 522 |
| 1048 | 3300025924 | Ga0207694_10020560 | Ga0207694_100205602 | 522 |
| 1049 | 3300025925 | Ga0207650_10039320 | Ga0207650_100393203 | 522 |
| 1050 | 3300025927 | Ga0207687_10010698 | Ga0207687_100106984 | 522 |
| 1051 | 3300025931 | Ga0207644_10001329 | Ga0207644_100013299 | 522 |
| 1052 | 3300025937 | Ga0207669_10009904 | Ga0207669_100099042 | 522 |
| 1053 | 3300025942 | Ga0207689_10025964 | Ga0207689_100259643 | 522 |
| 1054 | 3300025960 | Ga0207651_10058353 | Ga0207651_100583532 | 522 |
| 1055 | 3300025986 | Ga0207658_10029979 | Ga0207658_100299792 | 522 |
| 1056 | 3300026035 | Ga0207703_10003952 | Ga0207703_100039522 | 522 |
| 1057 | 3300026075 | Ga0207708_10010903 | Ga0207708_100109035 | 522 |
| 1058 | 3300026088 | Ga0207641_10009357 | Ga0207641_100093578 | 522 |
| 1059 | 3300028379 | Ga0268266_10053622 | Ga0268266_100536222 | 522 |
| 1060 | 3300031249 | Ga0265339_10004932 | Ga0265339_100049324 | 522 |
| 1061 | 3300031730 | Ga0307516_10033324 | Ga0307516_100333243 | 522 |
| 1062 | 3300035116 | Ga0373945_0008060 | Ga0373945_0008060_556_2208 | 522 |
| 1063 | 3300035171 | Ga0373946_0013817 | Ga0373946_0013817_1259_2911 | 522 |
| 1064 | 3300035172 | Ga0373955_0016122 | Ga0373955_0016122_737_2389 | 522 |
| 1065 | 3300035691 | Ga0373931_0008056 | Ga0373931_0008056_278_1870 | 522 |
| 1066 | 3300035692 | Ga0373935_0000244 | Ga0373935_0000244_7308_8960 | 522 |
| 1067 | 3300035695 | Ga0373927_0029296 | Ga0373927_0029296_1245_2837 | 522 |
| 1068 | 3300035725 | Ga0373947_0002144 | Ga0373947_0002144_4475_6127 | 522 |
| 1069 | 3300036401 | Ga0373937_0004952 | Ga0373937_0004952_3030_4682 | 522 |
| 1070 | 3300037068 | Ga0373925_0001674 | Ga0373925_0001674_3588_5240 | 522 |
| 1071 | 3300037068 | Ga0373925_0015046 | Ga0373925_0015046_1111_2757 | 522 |
| 1072 | 3300042125 | Ga0450923_007746 | Ga0450923_007746_143_1789 | 522 |
| 1073 | 3300046455 | Ga0495603_0000370 | Ga0495603_0000370_2384_4036 | 522 |
| 1074 | 3300046472 | Ga0495580_0000435 | Ga0495580_0000435_28365_30017 | 522 |
| 1075 | 3300046473 | Ga0495582_0000051 | Ga0495582_0000051_22146_23798 | 522 |
| 1076 | 3300046475 | Ga0495639_0000010 | Ga0495639_0000010_76639_78291 | 522 |
| 1077 | 3300046476 | Ga0495662_0000097 | Ga0495662_0000097_28099_29751 | 522 |
| 1078 | 3300046499 | Ga0495594_0001553 | Ga0495594_0001553_4030_5682 | 522 |
| 1079 | 3300046531 | Ga0495665_0000005 | Ga0495665_0000005_63766_65418 | 522 |
| 1080 | 3300046533 | Ga0495640_0000301 | Ga0495640_0000301_16923_18575 | 522 |
| 1081 | 3300046663 | Ga0495635_0000259 | Ga0495635_0000259_10239_11891 | 522 |
| 1082 | 3300046663 | Ga0495635_0092383 | Ga0495635_0092383_154_1806 | 522 |
| 1083 | 3300046689 | Ga0495613_0001985 | Ga0495613_0001985_10466_12118 | 522 |
| 1084 | 3300046690 | Ga0495624_0000094 | Ga0495624_0000094_41396_43048 | 522 |
| 1085 | 3300047315 | Ga0495581_0000810 | Ga0495581_0000810_8970_10622 | 522 |
| 1086 | 3300047319 | Ga0495674_0000955 | Ga0495674_0000955_17138_18790 | 522 |
| 1087 | 3300047444 | Ga0495675_0066824 | Ga0495675_0066824_189_1841 | 522 |
| 1088 | 3300048904 | Ga0496101_0110773 | Ga0496101_0110773_433_2040 | 522 |
| 1089 | 3300048909 | Ga0496106_0006585 | Ga0496106_0006585_2742_4331 | 522 |
| 1090 | 3300048911 | Ga0496108_0026218 | Ga0496108_0026218_2429_4018 | 522 |
| 1091 | 3300048912 | Ga0496109_0011092 | Ga0496109_0011092_4069_5658 | 522 |
| 1092 | 3300048915 | Ga0496112_0000019 | Ga0496112_0000019_77440_79092 | 522 |
| 1093 | 3300048916 | Ga0496113_0007321 | Ga0496113_0007321_4191_5780 | 522 |
| 1094 | 3300048917 | Ga0496114_0001911 | Ga0496114_0001911_2001_3608 | 522 |
| 1095 | 3300048918 | Ga0496115_0014571 | Ga0496115_0014571_669_2276 | 522 |
| 1096 | 3300048918 | Ga0496115_0019418 | Ga0496115_0019418_917_2506 | 522 |
| 1097 | 3300048929 | Ga0496126_0102048 | Ga0496126_0102048_670_2322 | 522 |
| 1098 | 3300049589 | Ga0501073_0018397 | Ga0501073_0018397_3243_4913 | 522 |
| 1099 | 3300050512 | nmdc:mga0n895_38751_c1 | nmdc:mga0n895_38751_c1_2198_3790 | 522 |
| 1100 | 3300053077 | Ga0495601_0014613 | Ga0495601_0014613_1690_3339 | 522 |
| 1101 | 3300053085 | Ga0495619_0038523 | Ga0495619_0038523_879_2528 | 522 |
| 1102 | iso_pu_bacteria | 2513237098 | 2513674091 | 522 |
| 1103 | iso_pu_bacteria | 2513237141 | 2513892568 | 522 |
| 1104 | iso_pu_bacteria | 2524023210 | 2524465547 | 522 |
| 1105 | iso_pu_bacteria | 2721755755 | 2723843443 | 522 |
| 1106 | iso_pu_bacteria | 2903768456 | 2903770714 | 522 |
| 1107 | iso_pu_bacteria | 2922386360 | 2922387042 | 522 |
| 1108 | iso_pu_bacteria | 2932794094 | 2932799657 | 522 |
| 1109 | iso_pu_bacteria | 8056673599 | 8056680856 | 522 |
| 1110 | 3300005347 | Ga0070668_100003954 | Ga0070668_10000395410 | 523 |
| 1111 | 3300005353 | Ga0070669_100000962 | Ga0070669_1000009622 | 523 |
| 1112 | 3300005367 | Ga0070667_100020729 | Ga0070667_1000207293 | 523 |
| 1113 | 3300005434 | Ga0070709_10002197 | Ga0070709_100021972 | 523 |
| 1114 | 3300005435 | Ga0070714_100002801 | Ga0070714_1000028016 | 523 |
| 1115 | 3300005435 | Ga0070714_100191273 | Ga0070714_1001912731 | 523 |
| 1116 | 3300005437 | Ga0070710_10033066 | Ga0070710_100330661 | 523 |
| 1117 | 3300005439 | Ga0070711_100003772 | Ga0070711_1000037727 | 523 |
| 1118 | 3300005439 | Ga0070711_100006265 | Ga0070711_1000062652 | 523 |
| 1119 | 3300005439 | Ga0070711_100012735 | Ga0070711_1000127354 | 523 |
| 1120 | 3300005458 | Ga0070681_10048858 | Ga0070681_100488583 | 523 |
| 1121 | 3300005539 | Ga0068853_100001192 | Ga0068853_10000119210 | 523 |
| 1122 | 3300005548 | Ga0070665_100000507 | Ga0070665_10000050721 | 523 |
| 1123 | 3300005577 | Ga0068857_100066482 | Ga0068857_1000664823 | 523 |
| 1124 | 3300005834 | Ga0068851_10056742 | Ga0068851_100567422 | 523 |
| 1125 | 3300005843 | Ga0068860_100000101 | Ga0068860_1000001014 | 523 |
| 1126 | 3300005843 | Ga0068860_100014572 | Ga0068860_1000145726 | 523 |
| 1127 | 3300005844 | Ga0068862_100083157 | Ga0068862_1000831573 | 523 |
| 1128 | 3300006163 | Ga0070715_10001127 | Ga0070715_100011272 | 523 |
| 1129 | 3300006186 | Ga0075369_10026585 | Ga0075369_100265852 | 523 |
| 1130 | 3300009011 | Ga0105251_10000989 | Ga0105251_100009893 | 523 |
| 1131 | 3300009101 | Ga0105247_10066045 | Ga0105247_100660452 | 523 |
| 1132 | 3300014969 | Ga0157376_10115038 | Ga0157376_101150382 | 523 |
| 1133 | 3300025297 | Ga0209758_1001027 | Ga0209758_100102723 | 523 |
| 1134 | 3300025315 | Ga0207697_10021382 | Ga0207697_100213823 | 523 |
| 1135 | 3300025735 | Ga0207713_1001270 | Ga0207713_100127018 | 523 |
| 1136 | 3300025906 | Ga0207699_10001610 | Ga0207699_100016102 | 523 |
| 1137 | 3300025912 | Ga0207707_10029159 | Ga0207707_100291596 | 523 |
| 1138 | 3300025923 | Ga0207681_10000344 | Ga0207681_1000034412 | 523 |
| 1139 | 3300025928 | Ga0207700_10030830 | Ga0207700_100308302 | 523 |
| 1140 | 3300025929 | Ga0207664_10007788 | Ga0207664_100077886 | 523 |
| 1141 | 3300025939 | Ga0207665_10012034 | Ga0207665_100120342 | 523 |
| 1142 | 3300025972 | Ga0207668_10002375 | Ga0207668_100023753 | 523 |
| 1143 | 3300025986 | Ga0207658_10008836 | Ga0207658_100088363 | 523 |
| 1144 | 3300026041 | Ga0207639_10001095 | Ga0207639_100010958 | 523 |
| 1145 | 3300026067 | Ga0207678_10014197 | Ga0207678_100141975 | 523 |
| 1146 | 3300026088 | Ga0207641_10002051 | Ga0207641_1000205112 | 523 |
| 1147 | 3300026116 | Ga0207674_10004839 | Ga0207674_100048396 | 523 |
| 1148 | 3300026116 | Ga0207674_10151754 | Ga0207674_101517542 | 523 |
| 1149 | 3300026142 | Ga0207698_10036023 | Ga0207698_100360233 | 523 |
| 1150 | 3300028379 | Ga0268266_10000616 | Ga0268266_100006167 | 523 |
| 1151 | 3300028381 | Ga0268264_10000030 | Ga0268264_10000030224 | 523 |
| 1152 | 3300028381 | Ga0268264_10003137 | Ga0268264_100031377 | 523 |
| 1153 | 3300028563 | Ga0265319_1003155 | Ga0265319_10031552 | 523 |
| 1154 | 3300028573 | Ga0265334_10002358 | Ga0265334_100023587 | 523 |
| 1155 | 3300028653 | Ga0265323_10000434 | Ga0265323_1000043416 | 523 |
| 1156 | 3300028654 | Ga0265322_10008928 | Ga0265322_100089283 | 523 |
| 1157 | 3300028666 | Ga0265336_10000649 | Ga0265336_100006499 | 523 |
| 1158 | 3300028800 | Ga0265338_10000280 | Ga0265338_1000028042 | 523 |
| 1159 | 3300031250 | Ga0265331_10034447 | Ga0265331_100344472 | 523 |
| 1160 | 3300031616 | Ga0307508_10001411 | Ga0307508_1000141115 | 523 |
| 1161 | 3300031711 | Ga0265314_10011314 | Ga0265314_100113143 | 523 |
| 1162 | 3300035695 | Ga0373927_0011775 | Ga0373927_0011775_3910_5508 | 523 |
| 1163 | 3300035724 | Ga0373933_0003599 | Ga0373933_0003599_6774_8372 | 523 |
| 1164 | 3300036401 | Ga0373937_0000995 | Ga0373937_0000995_12179_13777 | 523 |
| 1165 | 3300039437 | Ga0436365_1236739 | Ga0436365_1236739_28361_30010 | 523 |
| 1166 | 3300046454 | Ga0495592_0010499 | Ga0495592_0010499_337_1935 | 523 |
| 1167 | 3300046459 | Ga0495629_0001947 | Ga0495629_0001947_1157_2755 | 523 |
| 1168 | 3300046462 | Ga0495651_0001194 | Ga0495651_0001194_12712_14310 | 523 |
| 1169 | 3300046463 | Ga0495653_0000561 | Ga0495653_0000561_13905_15503 | 523 |
| 1170 | 3300046516 | Ga0495628_0084694 | Ga0495628_0084694_221_1819 | 523 |
| 1171 | 3300046517 | Ga0495630_0040664 | Ga0495630_0040664_508_2106 | 523 |
| 1172 | 3300046524 | Ga0495648_0002889 | Ga0495648_0002889_5895_7520 | 523 |
| 1173 | 3300046529 | Ga0495652_0005002 | Ga0495652_0005002_3073_4671 | 523 |
| 1174 | 3300046536 | Ga0495587_0000608 | Ga0495587_0000608_20202_21800 | 523 |
| 1175 | 3300046642 | Ga0495634_0000878 | Ga0495634_0000878_8885_10483 | 523 |
| 1176 | 3300046675 | Ga0495657_0019856 | Ga0495657_0019856_1856_3454 | 523 |
| 1177 | 3300046679 | Ga0495623_0002010 | Ga0495623_0002010_6833_8431 | 523 |
| 1178 | 3300046680 | Ga0495646_0015040 | Ga0495646_0015040_448_2046 | 523 |
| 1179 | 3300046683 | Ga0495658_0050687 | Ga0495658_0050687_619_2217 | 523 |
| 1180 | 3300046689 | Ga0495613_0056067 | Ga0495613_0056067_861_2459 | 523 |
| 1181 | 3300046689 | Ga0495613_0065381 | Ga0495613_0065381_152_1825 | 523 |
| 1182 | 3300046809 | Ga0495600_0001094 | Ga0495600_0001094_4544_6142 | 523 |
| 1183 | 3300047315 | Ga0495581_0050468 | Ga0495581_0050468_652_2250 | 523 |
| 1184 | 3300047317 | Ga0495604_0003631 | Ga0495604_0003631_4931_6529 | 523 |
| 1185 | 3300047319 | Ga0495674_0001687 | Ga0495674_0001687_4701_6299 | 523 |
| 1186 | 3300047322 | Ga0495680_0000539 | Ga0495680_0000539_4223_5821 | 523 |
| 1187 | 3300047444 | Ga0495675_0011659 | Ga0495675_0011659_1167_2765 | 523 |
| 1188 | 3300047471 | Ga0495684_0002819 | Ga0495684_0002819_3817_5415 | 523 |
| 1189 | 3300048905 | Ga0496102_0018812 | Ga0496102_0018812_1348_3003 | 523 |
| 1190 | 3300048906 | Ga0496103_0012379 | Ga0496103_0012379_2019_3602 | 523 |
| 1191 | 3300048912 | Ga0496109_0070516 | Ga0496109_0070516_1386_3041 | 523 |
| 1192 | 3300048913 | Ga0496110_0100818 | Ga0496110_0100818_425_2080 | 523 |
| 1193 | 3300048916 | Ga0496113_0032298 | Ga0496113_0032298_1393_3048 | 523 |
| 1194 | 3300048919 | Ga0496116_0004642 | Ga0496116_0004642_9292_10938 | 523 |
| 1195 | 3300048919 | Ga0496116_0017333 | Ga0496116_0017333_2152_3735 | 523 |
| 1196 | 3300048920 | Ga0496117_0028571 | Ga0496117_0028571_1398_3044 | 523 |
| 1197 | 3300048921 | Ga0496118_0008432 | Ga0496118_0008432_5870_7453 | 523 |
| 1198 | 3300048921 | Ga0496118_0018408 | Ga0496118_0018408_919_2565 | 523 |
| 1199 | 3300048922 | Ga0496119_0029020 | Ga0496119_0029020_718_2301 | 523 |
| 1200 | 3300048924 | Ga0496121_0010787 | Ga0496121_0010787_3300_4883 | 523 |
| 1201 | 3300049589 | Ga0501073_0000273 | Ga0501073_0000273_22436_24058 | 523 |
| 1202 | 3300053078 | Ga0495612_0004149 | Ga0495612_0004149_1093_2691 | 523 |
| 1203 | 3300053084 | Ga0495595_0000250 | Ga0495595_0000250_9982_11580 | 523 |
| 1204 | 3300053085 | Ga0495619_0002268 | Ga0495619_0002268_5009_6607 | 523 |
| 1205 | 3300053093 | Ga0500651_0001180 | Ga0500651_0001180_10818_12470 | 523 |
| 1206 | 3300053119 | Ga0500595_008317 | Ga0500595_008317_1266_2918 | 523 |
| 1207 | 3300053139 | Ga0500568_0038550 | Ga0500568_0038550_132_1784 | 523 |
| 1208 | iso_pu_bacteria | 2919450847 | 2919451966 | 523 |
| 1209 | iso_pu_bacteria | 8001845381 | 8001849946 | 523 |
| 1210 | 3300003203 | JGI25406J46586_10000471 | JGI25406J46586_100004715 | 524 |
| 1211 | 3300003215 | JGI25153J46596_10000317 | JGI25153J46596_100003174 | 524 |
| 1212 | 3300005331 | Ga0070670_100106820 | Ga0070670_1001068202 | 524 |
| 1213 | 3300005347 | Ga0070668_100023571 | Ga0070668_1000235713 | 524 |
| 1214 | 3300005347 | Ga0070668_100081988 | Ga0070668_1000819882 | 524 |
| 1215 | 3300005434 | Ga0070709_10009537 | Ga0070709_100095374 | 524 |
| 1216 | 3300005435 | Ga0070714_100033885 | Ga0070714_1000338854 | 524 |
| 1217 | 3300005436 | Ga0070713_100007044 | Ga0070713_1000070445 | 524 |
| 1218 | 3300005436 | Ga0070713_100029458 | Ga0070713_1000294584 | 524 |
| 1219 | 3300005436 | Ga0070713_100119994 | Ga0070713_1001199942 | 524 |
| 1220 | 3300005456 | Ga0070678_100042026 | Ga0070678_1000420262 | 524 |
| 1221 | 3300005466 | Ga0070685_10036955 | Ga0070685_100369552 | 524 |
| 1222 | 3300005468 | Ga0070707_100058714 | Ga0070707_1000587142 | 524 |
| 1223 | 3300005518 | Ga0070699_100005556 | Ga0070699_1000055562 | 524 |
| 1224 | 3300005983 | Ga0081540_1006453 | Ga0081540_10064536 | 524 |
| 1225 | 3300005985 | Ga0081539_10000048 | Ga0081539_1000004818 | 524 |
| 1226 | 3300006028 | Ga0070717_10001656 | Ga0070717_100016568 | 524 |
| 1227 | 3300006038 | Ga0075365_10041229 | Ga0075365_100412292 | 524 |
| 1228 | 3300006163 | Ga0070715_10019430 | Ga0070715_100194301 | 524 |
| 1229 | 3300006173 | Ga0070716_100006731 | Ga0070716_1000067311 | 524 |
| 1230 | 3300006237 | Ga0097621_100108212 | Ga0097621_1001082122 | 524 |
| 1231 | 3300006871 | Ga0075434_100006092 | Ga0075434_1000060924 | 524 |
| 1232 | 3300006881 | Ga0068865_100070136 | Ga0068865_1000701362 | 524 |
| 1233 | 3300007265 | Ga0099794_10019822 | Ga0099794_100198223 | 524 |
| 1234 | 3300009147 | Ga0114129_10420069 | Ga0114129_104200691 | 524 |
| 1235 | 3300009148 | Ga0105243_10143483 | Ga0105243_101434831 | 524 |
| 1236 | 3300009174 | Ga0105241_10090950 | Ga0105241_100909502 | 524 |
| 1237 | 3300009551 | Ga0105238_10027647 | Ga0105238_100276472 | 524 |
| 1238 | 3300009553 | Ga0105249_10099150 | Ga0105249_100991502 | 524 |
| 1239 | 3300013297 | Ga0157378_10037039 | Ga0157378_100370392 | 524 |
| 1240 | 3300025297 | Ga0209758_1000120 | Ga0209758_100012042 | 524 |
| 1241 | 3300025297 | Ga0209758_1005026 | Ga0209758_10050262 | 524 |
| 1242 | 3300025297 | Ga0209758_1018545 | Ga0209758_10185452 | 524 |
| 1243 | 3300025898 | Ga0207692_10015414 | Ga0207692_100154142 | 524 |
| 1244 | 3300025910 | Ga0207684_10027597 | Ga0207684_100275974 | 524 |
| 1245 | 3300025911 | Ga0207654_10046562 | Ga0207654_100465622 | 524 |
| 1246 | 3300025916 | Ga0207663_10007530 | Ga0207663_100075303 | 524 |
| 1247 | 3300025922 | Ga0207646_10023526 | Ga0207646_100235262 | 524 |
| 1248 | 3300025922 | Ga0207646_10036804 | Ga0207646_100368043 | 524 |
| 1249 | 3300025928 | Ga0207700_10019379 | Ga0207700_100193792 | 524 |
| 1250 | 3300025928 | Ga0207700_10031621 | Ga0207700_100316212 | 524 |
| 1251 | 3300025928 | Ga0207700_10081122 | Ga0207700_100811222 | 524 |
| 1252 | 3300025929 | Ga0207664_10168176 | Ga0207664_101681761 | 524 |
| 1253 | 3300025940 | Ga0207691_10014041 | Ga0207691_100140415 | 524 |
| 1254 | 3300025961 | Ga0207712_10130621 | Ga0207712_101306211 | 524 |
| 1255 | 3300026067 | Ga0207678_10012506 | Ga0207678_100125066 | 524 |
| 1256 | 3300026089 | Ga0207648_10101649 | Ga0207648_101016492 | 524 |
| 1257 | 3300026118 | Ga0207675_100146824 | Ga0207675_1001468242 | 524 |
| 1258 | 3300031247 | Ga0265340_10009402 | Ga0265340_100094024 | 524 |
| 1259 | 3300032126 | Ga0307415_100090042 | Ga0307415_1000900421 | 524 |
| 1260 | 3300033180 | Ga0307510_10097116 | Ga0307510_100971162 | 524 |
| 1261 | 3300034818 | Ga0373950_0000031 | Ga0373950_0000031_71104_72729 | 524 |
| 1262 | 3300035086 | Ga0373934_0003030 | Ga0373934_0003030_1961_3619 | 524 |
| 1263 | 3300035086 | Ga0373934_0010197 | Ga0373934_0010197_1893_3512 | 524 |
| 1264 | 3300035118 | Ga0373954_0000084 | Ga0373954_0000084_11237_12895 | 524 |
| 1265 | 3300035119 | Ga0373956_0000384 | Ga0373956_0000384_5697_7355 | 524 |
| 1266 | 3300035170 | Ga0373943_0014882 | Ga0373943_0014882_1551_3209 | 524 |
| 1267 | 3300035170 | Ga0373943_0038440 | Ga0373943_0038440_82_1677 | 524 |
| 1268 | 3300035172 | Ga0373955_0001982 | Ga0373955_0001982_2278_3936 | 524 |
| 1269 | 3300035691 | Ga0373931_0066644 | Ga0373931_0066644_116_1777 | 524 |
| 1270 | 3300035695 | Ga0373927_0016320 | Ga0373927_0016320_1194_2789 | 524 |
| 1271 | 3300035724 | Ga0373933_0000576 | Ga0373933_0000576_3758_5377 | 524 |
| 1272 | 3300035724 | Ga0373933_0002444 | Ga0373933_0002444_2919_4577 | 524 |
| 1273 | 3300046459 | Ga0495629_0006802 | Ga0495629_0006802_5052_6710 | 524 |
| 1274 | 3300046460 | Ga0495638_0089584 | Ga0495638_0089584_17_1675 | 524 |
| 1275 | 3300046462 | Ga0495651_0027951 | Ga0495651_0027951_1203_2861 | 524 |
| 1276 | 3300046476 | Ga0495662_0045247 | Ga0495662_0045247_237_1895 | 524 |
| 1277 | 3300046507 | Ga0495606_0000265 | Ga0495606_0000265_8363_10021 | 524 |
| 1278 | 3300046511 | Ga0495608_0026124 | Ga0495608_0026124_1664_3322 | 524 |
| 1279 | 3300046525 | Ga0495663_0010022 | Ga0495663_0010022_555_2213 | 524 |
| 1280 | 3300046529 | Ga0495652_0003743 | Ga0495652_0003743_1664_3322 | 524 |
| 1281 | 3300046533 | Ga0495640_0008933 | Ga0495640_0008933_927_2585 | 524 |
| 1282 | 3300046536 | Ga0495587_0019048 | Ga0495587_0019048_662_2320 | 524 |
| 1283 | 3300046543 | Ga0495645_0043804 | Ga0495645_0043804_1192_2850 | 524 |
| 1284 | 3300046559 | Ga0495667_0010607 | Ga0495667_0010607_1746_3404 | 524 |
| 1285 | 3300046642 | Ga0495634_0082617 | Ga0495634_0082617_120_1778 | 524 |
| 1286 | 3300046663 | Ga0495635_0001844 | Ga0495635_0001844_4725_6383 | 524 |
| 1287 | 3300046675 | Ga0495657_0011319 | Ga0495657_0011319_2060_3718 | 524 |
| 1288 | 3300046678 | Ga0495599_0003115 | Ga0495599_0003115_3655_5313 | 524 |
| 1289 | 3300046689 | Ga0495613_0004516 | Ga0495613_0004516_1084_2742 | 524 |
| 1290 | 3300046809 | Ga0495600_0007977 | Ga0495600_0007977_1999_3657 | 524 |
| 1291 | 3300047315 | Ga0495581_0036014 | Ga0495581_0036014_699_2363 | 524 |
| 1292 | 3300047317 | Ga0495604_0006658 | Ga0495604_0006658_4578_6236 | 524 |
| 1293 | 3300047319 | Ga0495674_0010503 | Ga0495674_0010503_271_1929 | 524 |
| 1294 | 3300047321 | Ga0495676_0083113 | Ga0495676_0083113_68_1726 | 524 |
| 1295 | 3300047322 | Ga0495680_0038000 | Ga0495680_0038000_254_1912 | 524 |
| 1296 | 3300047444 | Ga0495675_0008558 | Ga0495675_0008558_1467_3125 | 524 |
| 1297 | 3300047471 | Ga0495684_0000777 | Ga0495684_0000777_22541_24199 | 524 |
| 1298 | 3300047673 | Ga0495593_0002656 | Ga0495593_0002656_4311_5969 | 524 |
| 1299 | 3300048088 | Ga0495602_0001871 | Ga0495602_0001871_3277_4935 | 524 |
| 1300 | 3300048906 | Ga0496103_0012210 | Ga0496103_0012210_2769_4364 | 524 |
| 1301 | 3300048913 | Ga0496110_0092088 | Ga0496110_0092088_628_2289 | 524 |
| 1302 | 3300048913 | Ga0496110_0120056 | Ga0496110_0120056_38_1699 | 524 |
| 1303 | 3300048914 | Ga0496111_0006918 | Ga0496111_0006918_824_2485 | 524 |
| 1304 | 3300048914 | Ga0496111_0081028 | Ga0496111_0081028_107_1702 | 524 |
| 1305 | 3300048917 | Ga0496114_0049882 | Ga0496114_0049882_1569_3179 | 524 |
| 1306 | 3300048920 | Ga0496117_0057840 | Ga0496117_0057840_682_2343 | 524 |
| 1307 | 3300048925 | Ga0496122_0068513 | Ga0496122_0068513_132_1790 | 524 |
| 1308 | 3300048929 | Ga0496126_0001629 | Ga0496126_0001629_28742_30403 | 524 |
| 1309 | 3300048929 | Ga0496126_0035854 | Ga0496126_0035854_2317_3975 | 524 |
| 1310 | 3300049586 | Ga0501070_0000083 | Ga0501070_0000083_3374_4984 | 524 |
| 1311 | 3300049589 | Ga0501073_0055969 | Ga0501073_0055969_881_2491 | 524 |
| 1312 | 3300049742 | Ga0501080_0043578 | Ga0501080_0043578_2026_3636 | 524 |
| 1313 | 3300050489 | nmdc:mga03683_3_c1 | nmdc:mga03683_3_c1_256173_257759 | 524 |
| 1314 | 3300050493 | nmdc:mga0k408_2_c1 | nmdc:mga0k408_2_c1_292988_294574 | 524 |
| 1315 | 3300050516 | nmdc:mga0sz30_162_c1 | nmdc:mga0sz30_162_c1_2244_3830 | 524 |
| 1316 | 3300053084 | Ga0495595_0008027 | Ga0495595_0008027_1697_3307 | 524 |
| 1317 | 3300053085 | Ga0495619_0024706 | Ga0495619_0024706_662_2320 | 524 |
| 1318 | 3300053085 | Ga0495619_0082652 | Ga0495619_0082652_350_2008 | 524 |
| 1319 | 3300053094 | Ga0500566_0000011 | Ga0500566_0000011_65345_67003 | 524 |
| 1320 | 3300053102 | Ga0500554_003790 | Ga0500554_003790_1293_2951 | 524 |
| 1321 | 3300053111 | Ga0500572_000065 | Ga0500572_000065_3415_5073 | 524 |
| 1322 | 3300053111 | Ga0500572_001006 | Ga0500572_001006_6446_8104 | 524 |
| 1323 | 3300053119 | Ga0500595_000364 | Ga0500595_000364_7708_9366 | 524 |
| 1324 | 3300053136 | Ga0500559_0001342 | Ga0500559_0001342_6413_8071 | 524 |
| 1325 | 3300053136 | Ga0500559_0001798 | Ga0500559_0001798_8847_10505 | 524 |
| 1326 | 3300053150 | Ga0500603_000269 | Ga0500603_000269_5271_6929 | 524 |
| 1327 | 3300053150 | Ga0500603_000319 | Ga0500603_000319_2454_4112 | 524 |
| 1328 | 3300053159 | Ga0500630_000832 | Ga0500630_000832_9396_11054 | 524 |
| 1329 | 3300053161 | Ga0500634_0043227 | Ga0500634_0043227_736_2394 | 524 |
| 1330 | 3300053162 | Ga0500638_000081 | Ga0500638_000081_209_1867 | 524 |
| 1331 | 3300053163 | Ga0500639_000079 | Ga0500639_000079_7559_9217 | 524 |
| 1332 | 3300053178 | Ga0500637_0002424 | Ga0500637_0002424_5703_7361 | 524 |
| 1333 | 3300053725 | Ga0500576_001460 | Ga0500576_001460_396_2054 | 524 |
| 1334 | 3300053735 | Ga0500596_000987 | Ga0500596_000987_3541_5199 | 524 |
| 1335 | 3300055283 | Ga0500661_001337 | Ga0500661_001337_757_2415 | 524 |
| 1336 | 3300060353 | Ga0501082_0000615 | Ga0501082_0000615_9162_10772 | 524 |
| 1337 | 3300005436 | Ga0070713_100095835 | Ga0070713_1000958352 | 525 |
| 1338 | 3300006028 | Ga0070717_10008544 | Ga0070717_100085444 | 525 |
| 1339 | 3300006931 | Ga0097620_100192051 | Ga0097620_1001920512 | 525 |
| 1340 | 3300031730 | Ga0307516_10024291 | Ga0307516_100242912 | 525 |
| 1341 | 3300034818 | Ga0373950_0000029 | Ga0373950_0000029_144462_146087 | 525 |
| 1342 | 3300046557 | Ga0495622_0025083 | Ga0495622_0025083_640_2310 | 525 |
| 1343 | 3300048921 | Ga0496118_0035458 | Ga0496118_0035458_209_1879 | 525 |
| 1344 | 3300048924 | Ga0496121_0000089 | Ga0496121_0000089_3058_4728 | 525 |
| 1345 | 3300048927 | Ga0496124_0004464 | Ga0496124_0004464_696_2366 | 525 |
| 1346 | 3300048929 | Ga0496126_0002122 | Ga0496126_0002122_3278_4948 | 525 |
| 1347 | 3300049583 | Ga0501067_0000087 | Ga0501067_0000087_37931_39556 | 525 |
| 1348 | 3300049589 | Ga0501073_0000740 | Ga0501073_0000740_9363_10988 | 525 |
| 1349 | 3300053121 | Ga0500607_000573 | Ga0500607_000573_33139_34734 | 525 |
| 1350 | iso_pu_bacteria | 2582581305 | 2585262654 | 525 |
| 1351 | 3300002076 | JGI24749J21850_1000081 | JGI24749J21850_10000812 | 526 |
| 1352 | 3300002459 | JGI24751J29686_10000128 | JGI24751J29686_1000012830 | 526 |
| 1353 | 3300005295 | Ga0065707_10124715 | Ga0065707_101247152 | 526 |
| 1354 | 3300005331 | Ga0070670_100000282 | Ga0070670_10000028214 | 526 |
| 1355 | 3300005347 | Ga0070668_100000702 | Ga0070668_10000070224 | 526 |
| 1356 | 3300005347 | Ga0070668_100008213 | Ga0070668_1000082137 | 526 |
| 1357 | 3300005353 | Ga0070669_100000243 | Ga0070669_10000024322 | 526 |
| 1358 | 3300005367 | Ga0070667_100000387 | Ga0070667_10000038714 | 526 |
| 1359 | 3300005367 | Ga0070667_100000881 | Ga0070667_10000088113 | 526 |
| 1360 | 3300005548 | Ga0070665_100001151 | Ga0070665_10000115125 | 526 |
| 1361 | 3300005617 | Ga0068859_100008985 | Ga0068859_1000089855 | 526 |
| 1362 | 3300005618 | Ga0068864_100000289 | Ga0068864_10000028914 | 526 |
| 1363 | 3300005618 | Ga0068864_100000491 | Ga0068864_10000049125 | 526 |
| 1364 | 3300005719 | Ga0068861_100010355 | Ga0068861_1000103554 | 526 |
| 1365 | 3300005841 | Ga0068863_100004096 | Ga0068863_1000040963 | 526 |
| 1366 | 3300005842 | Ga0068858_100023028 | Ga0068858_1000230287 | 526 |
| 1367 | 3300005843 | Ga0068860_100000167 | Ga0068860_10000016756 | 526 |
| 1368 | 3300005844 | Ga0068862_100000073 | Ga0068862_10000007328 | 526 |
| 1369 | 3300005844 | Ga0068862_100003402 | Ga0068862_1000034029 | 526 |
| 1370 | 3300006048 | Ga0075363_100000226 | Ga0075363_10000022618 | 526 |
| 1371 | 3300006177 | Ga0075362_10000015 | Ga0075362_1000001532 | 526 |
| 1372 | 3300006186 | Ga0075369_10000089 | Ga0075369_100000894 | 526 |
| 1373 | 3300006195 | Ga0075366_10000072 | Ga0075366_1000007232 | 526 |
| 1374 | 3300006931 | Ga0097620_100008985 | Ga0097620_1000089855 | 526 |
| 1375 | 3300009177 | Ga0105248_10000493 | Ga0105248_1000049328 | 526 |
| 1376 | 3300009553 | Ga0105249_10002340 | Ga0105249_100023408 | 526 |
| 1377 | 3300010375 | Ga0105239_10046277 | Ga0105239_100462773 | 526 |
| 1378 | 3300013306 | Ga0163162_10043667 | Ga0163162_100436673 | 526 |
| 1379 | 3300014326 | Ga0157380_10000347 | Ga0157380_1000034713 | 526 |
| 1380 | 3300017792 | Ga0163161_10083594 | Ga0163161_100835941 | 526 |
| 1381 | 3300025903 | Ga0207680_10032857 | Ga0207680_100328573 | 526 |
| 1382 | 3300025923 | Ga0207681_10000023 | Ga0207681_10000023147 | 526 |
| 1383 | 3300025925 | Ga0207650_10000029 | Ga0207650_10000029155 | 526 |
| 1384 | 3300025925 | Ga0207650_10000074 | Ga0207650_1000007457 | 526 |
| 1385 | 3300025941 | Ga0207711_10000541 | Ga0207711_1000054110 | 526 |
| 1386 | 3300025961 | Ga0207712_10001178 | Ga0207712_100011788 | 526 |
| 1387 | 3300025972 | Ga0207668_10000093 | Ga0207668_1000009355 | 526 |
| 1388 | 3300025972 | Ga0207668_10015911 | Ga0207668_100159113 | 526 |
| 1389 | 3300025986 | Ga0207658_10000266 | Ga0207658_1000026643 | 526 |
| 1390 | 3300025986 | Ga0207658_10001288 | Ga0207658_100012889 | 526 |
| 1391 | 3300026035 | Ga0207703_10005822 | Ga0207703_1000582210 | 526 |
| 1392 | 3300026088 | Ga0207641_10006748 | Ga0207641_100067481 | 526 |
| 1393 | 3300026095 | Ga0207676_10000059 | Ga0207676_1000005976 | 526 |
| 1394 | 3300026095 | Ga0207676_10000674 | Ga0207676_1000067423 | 526 |
| 1395 | 3300026118 | Ga0207675_100003638 | Ga0207675_1000036386 | 526 |
| 1396 | 3300028379 | Ga0268266_10006154 | Ga0268266_100061543 | 526 |
| 1397 | 3300028380 | Ga0268265_10000018 | Ga0268265_1000001830 | 526 |
| 1398 | 3300028380 | Ga0268265_10004032 | Ga0268265_1000403211 | 526 |
| 1399 | 3300028381 | Ga0268264_10000068 | Ga0268264_1000006871 | 526 |
| 1400 | 3300046557 | Ga0495622_0004381 | Ga0495622_0004381_237_1874 | 526 |
| 1401 | 3300046694 | Ga0495649_0036990 | Ga0495649_0036990_176_1762 | 526 |
| 1402 | 3300049590 | Ga0501074_0002872 | Ga0501074_0002872_9148_10782 | 526 |
| 1403 | 3300050491 | nmdc:mga00v17_21920_c1 | nmdc:mga00v17_21920_c1_1698_3290 | 526 |
| 1404 | 3300053080 | Ga0500635_0000045 | Ga0500635_0000045_9035_10672 | 526 |
| 1405 | 3300053116 | Ga0500592_000056 | Ga0500592_000056_22151_23737 | 526 |
| 1406 | 3300053119 | Ga0500595_003806 | Ga0500595_003806_1074_2711 | 526 |
| 1407 | 3300053123 | Ga0500614_002633 | Ga0500614_002633_1739_3376 | 526 |
| 1408 | 3300053136 | Ga0500559_0023050 | Ga0500559_0023050_315_1952 | 526 |
| 1409 | 3300053158 | Ga0500627_0001052 | Ga0500627_0001052_2394_3980 | 526 |
| 1410 | 3300053735 | Ga0500596_002181 | Ga0500596_002181_1756_3393 | 526 |
| 1411 | 3300005367 | Ga0070667_100004769 | Ga0070667_1000047692 | 527 |
| 1412 | 3300005367 | Ga0070667_100007142 | Ga0070667_1000071423 | 527 |
| 1413 | 3300005548 | Ga0070665_100000758 | Ga0070665_1000007587 | 527 |
| 1414 | 3300005841 | Ga0068863_100000045 | Ga0068863_100000045149 | 527 |
| 1415 | 3300005841 | Ga0068863_100000182 | Ga0068863_10000018264 | 527 |
| 1416 | 3300005842 | Ga0068858_100002443 | Ga0068858_1000024438 | 527 |
| 1417 | 3300005842 | Ga0068858_100080443 | Ga0068858_1000804432 | 527 |
| 1418 | 3300005843 | Ga0068860_100000119 | Ga0068860_10000011974 | 527 |
| 1419 | 3300009177 | Ga0105248_10034363 | Ga0105248_100343632 | 527 |
| 1420 | 3300025941 | Ga0207711_10001307 | Ga0207711_100013072 | 527 |
| 1421 | 3300025961 | Ga0207712_10045890 | Ga0207712_100458903 | 527 |
| 1422 | 3300025972 | Ga0207668_10000001 | Ga0207668_10000001133 | 527 |
| 1423 | 3300025986 | Ga0207658_10004400 | Ga0207658_1000440010 | 527 |
| 1424 | 3300026035 | Ga0207703_10000778 | Ga0207703_1000077821 | 527 |
| 1425 | 3300026035 | Ga0207703_10006496 | Ga0207703_100064963 | 527 |
| 1426 | 3300026088 | Ga0207641_10000011 | Ga0207641_1000001114 | 527 |
| 1427 | 3300026088 | Ga0207641_10000102 | Ga0207641_100001027 | 527 |
| 1428 | 3300026095 | Ga0207676_10002078 | Ga0207676_1000207814 | 527 |
| 1429 | 3300028379 | Ga0268266_10000289 | Ga0268266_1000028952 | 527 |
| 1430 | 3300028381 | Ga0268264_10000128 | Ga0268264_10000128116 | 527 |
| 1431 | 3300046506 | Ga0495583_0032548 | Ga0495583_0032548_700_2322 | 527 |
| 1432 | 3300046522 | Ga0495643_0006134 | Ga0495643_0006134_3431_5053 | 527 |
| 1433 | 3300046542 | Ga0495597_0000634 | Ga0495597_0000634_6272_7894 | 527 |
| 1434 | 3300047315 | Ga0495581_0039280 | Ga0495581_0039280_146_1780 | 527 |
| 1435 | 3300048905 | Ga0496102_0096574 | Ga0496102_0096574_1041_2663 | 527 |
| 1436 | 3300048907 | Ga0496104_0031837 | Ga0496104_0031837_2911_4506 | 527 |
| 1437 | 3300048908 | Ga0496105_0027040 | Ga0496105_0027040_197_1792 | 527 |
| 1438 | 3300048920 | Ga0496117_0029077 | Ga0496117_0029077_2204_3799 | 527 |
| 1439 | 3300048921 | Ga0496118_0004973 | Ga0496118_0004973_5160_6782 | 527 |
| 1440 | 3300048921 | Ga0496118_0010334 | Ga0496118_0010334_7022_8617 | 527 |
| 1441 | 3300048924 | Ga0496121_0000627 | Ga0496121_0000627_26838_28460 | 527 |
| 1442 | 3300048924 | Ga0496121_0002541 | Ga0496121_0002541_20953_22548 | 527 |
| 1443 | 3300053087 | Ga0500643_010091 | Ga0500643_010091_1218_2816 | 527 |
| 1444 | 3300053109 | Ga0500569_001093 | Ga0500569_001093_1001_2623 | 527 |
| 1445 | 3300053157 | Ga0500624_000184 | Ga0500624_000184_19181_20779 | 527 |
| 1446 | 3300053177 | Ga0500636_0007376 | Ga0500636_0007376_1392_2990 | 527 |
| 1447 | 3300005335 | Ga0070666_10000098 | Ga0070666_1000009839 | 528 |
| 1448 | 3300005353 | Ga0070669_100000029 | Ga0070669_100000029114 | 528 |
| 1449 | 3300005355 | Ga0070671_100000016 | Ga0070671_10000001644 | 528 |
| 1450 | 3300005617 | Ga0068859_100006298 | Ga0068859_1000062986 | 528 |
| 1451 | 3300005618 | Ga0068864_100002845 | Ga0068864_1000028458 | 528 |
| 1452 | 3300005842 | Ga0068858_100003323 | Ga0068858_1000033239 | 528 |
| 1453 | 3300005844 | Ga0068862_100004039 | Ga0068862_1000040396 | 528 |
| 1454 | 3300005844 | Ga0068862_100026916 | Ga0068862_1000269163 | 528 |
| 1455 | 3300006042 | Ga0075368_10000162 | Ga0075368_100001629 | 528 |
| 1456 | 3300006177 | Ga0075362_10001505 | Ga0075362_100015054 | 528 |
| 1457 | 3300006178 | Ga0075367_10027414 | Ga0075367_100274143 | 528 |
| 1458 | 3300006186 | Ga0075369_10004561 | Ga0075369_100045615 | 528 |
| 1459 | 3300006931 | Ga0097620_100006299 | Ga0097620_1000062995 | 528 |
| 1460 | 3300009101 | Ga0105247_10004980 | Ga0105247_100049805 | 528 |
| 1461 | 3300009177 | Ga0105248_10009662 | Ga0105248_100096623 | 528 |
| 1462 | 3300021384 | Ga0213876_10025680 | Ga0213876_100256802 | 528 |
| 1463 | 3300025315 | Ga0207697_10000473 | Ga0207697_100004738 | 528 |
| 1464 | 3300025900 | Ga0207710_10003075 | Ga0207710_100030756 | 528 |
| 1465 | 3300025903 | Ga0207680_10000399 | Ga0207680_100003995 | 528 |
| 1466 | 3300025923 | Ga0207681_10000040 | Ga0207681_10000040112 | 528 |
| 1467 | 3300025925 | Ga0207650_10016614 | Ga0207650_100166145 | 528 |
| 1468 | 3300025931 | Ga0207644_10000023 | Ga0207644_1000002344 | 528 |
| 1469 | 3300025961 | Ga0207712_10011824 | Ga0207712_100118245 | 528 |
| 1470 | 3300025972 | Ga0207668_10016988 | Ga0207668_100169883 | 528 |
| 1471 | 3300025986 | Ga0207658_10013896 | Ga0207658_100138962 | 528 |
| 1472 | 3300026088 | Ga0207641_10011322 | Ga0207641_100113223 | 528 |
| 1473 | 3300026095 | Ga0207676_10000765 | Ga0207676_100007658 | 528 |
| 1474 | 3300026118 | Ga0207675_100000667 | Ga0207675_10000066710 | 528 |
| 1475 | 3300027866 | Ga0209813_10000286 | Ga0209813_100002865 | 528 |
| 1476 | 3300028380 | Ga0268265_10000098 | Ga0268265_1000009829 | 528 |
| 1477 | 3300028380 | Ga0268265_10029151 | Ga0268265_100291514 | 528 |
| 1478 | 3300028381 | Ga0268264_10000141 | Ga0268264_1000014168 | 528 |
| 1479 | 3300039437 | Ga0436365_0845153 | Ga0436365_0845153_2050_3669 | 528 |
| 1480 | 3300050489 | nmdc:mga03683_233_c1 | nmdc:mga03683_233_c1_10463_12064 | 528 |
| 1481 | 3300050494 | nmdc:mga06z11_1483_c1 | nmdc:mga06z11_1483_c1_4777_6378 | 528 |
| 1482 | 3300050495 | nmdc:mga04h51_77_c1 | nmdc:mga04h51_77_c1_19968_21569 | 528 |
| 1483 | 3300050496 | nmdc:mga07m45_22_c1 | nmdc:mga07m45_22_c1_76932_78533 | 528 |
| 1484 | 3300053121 | Ga0500607_000006 | Ga0500607_000006_25963_27579 | 528 |
| 1485 | 3300053730 | Ga0500645_006831 | Ga0500645_006831_156_1772 | 528 |
| 1486 | 3300053730 | Ga0500645_009789 | Ga0500645_009789_1202_2803 | 528 |
| 1487 | 3300006353 | Ga0075370_10000082 | Ga0075370_100000827 | 529 |
| 1488 | 3300025931 | Ga0207644_10001691 | Ga0207644_1000169110 | 529 |
| 1489 | 3300046520 | Ga0495637_0023505 | Ga0495637_0023505_352_1950 | 529 |
| 1490 | 3300046616 | Ga0495668_0003522 | Ga0495668_0003522_662_2263 | 529 |
| 1491 | 3300046660 | Ga0495625_0046431 | Ga0495625_0046431_968_2569 | 529 |
| 1492 | 3300046660 | Ga0495625_0101638 | Ga0495625_0101638_149_1747 | 529 |
| 1493 | 3300048928 | Ga0496125_0008939 | Ga0496125_0008939_4146_5747 | 529 |
| 1494 | 3300048928 | Ga0496125_0051025 | Ga0496125_0051025_663_2267 | 529 |
| 1495 | 3300048929 | Ga0496126_0070800 | Ga0496126_0070800_94_1698 | 529 |
| 1496 | 3300048929 | Ga0496126_0104168 | Ga0496126_0104168_683_2287 | 529 |
| 1497 | 3300050496 | nmdc:mga07m45_163_c1 | nmdc:mga07m45_163_c1_18383_19984 | 529 |
| 1498 | 3300053096 | Ga0500641_0042066 | Ga0500641_0042066_101_1699 | 529 |
| 1499 | 3300053130 | Ga0500642_0021316 | Ga0500642_0021316_861_2459 | 529 |
| 1500 | 3300053133 | Ga0500655_000017 | Ga0500655_000017_17148_18746 | 529 |
| 1501 | 3300053148 | Ga0500590_004244 | Ga0500590_004244_1414_3012 | 529 |
| 1502 | 3300053156 | Ga0500622_0000315 | Ga0500622_0000315_7135_8736 | 529 |
| 1503 | 3300053724 | Ga0500570_026039 | Ga0500570_026039_828_2426 | 529 |
| 1504 | 3300001904 | JGI24736J21556_1000003 | JGI24736J21556_100000334 | 530 |
| 1505 | 3300001915 | JGI24741J21665_1004125 | JGI24741J21665_10041253 | 530 |
| 1506 | 3300001979 | JGI24740J21852_10000141 | JGI24740J21852_1000014124 | 530 |
| 1507 | 3300001989 | JGI24739J22299_10003411 | JGI24739J22299_100034116 | 530 |
| 1508 | 3300001989 | JGI24739J22299_10008663 | JGI24739J22299_100086632 | 530 |
| 1509 | 3300001990 | JGI24737J22298_10000271 | JGI24737J22298_100002717 | 530 |
| 1510 | 3300002075 | JGI24738J21930_10000901 | JGI24738J21930_100009017 | 530 |
| 1511 | 3300002459 | JGI24751J29686_10000557 | JGI24751J29686_100005575 | 530 |
| 1512 | 3300005295 | Ga0065707_10081846 | Ga0065707_1008184623 | 530 |
| 1513 | 3300005327 | Ga0070658_10005612 | Ga0070658_1000561210 | 530 |
| 1514 | 3300005344 | Ga0070661_100005157 | Ga0070661_1000051577 | 530 |
| 1515 | 3300005355 | Ga0070671_100000398 | Ga0070671_10000039825 | 530 |
| 1516 | 3300005457 | Ga0070662_100000370 | Ga0070662_1000003706 | 530 |
| 1517 | 3300005539 | Ga0068853_100008986 | Ga0068853_1000089868 | 530 |
| 1518 | 3300005539 | Ga0068853_100011526 | Ga0068853_1000115266 | 530 |
| 1519 | 3300005564 | Ga0070664_100003613 | Ga0070664_1000036135 | 530 |
| 1520 | 3300005577 | Ga0068857_100010298 | Ga0068857_1000102985 | 530 |
| 1521 | 3300005577 | Ga0068857_100197455 | Ga0068857_1001974552 | 530 |
| 1522 | 3300005578 | Ga0068854_100003709 | Ga0068854_1000037095 | 530 |
| 1523 | 3300005614 | Ga0068856_100074519 | Ga0068856_1000745192 | 530 |
| 1524 | 3300005617 | Ga0068859_100002952 | Ga0068859_10000295210 | 530 |
| 1525 | 3300005617 | Ga0068859_100019239 | Ga0068859_1000192395 | 530 |
| 1526 | 3300005618 | Ga0068864_100081382 | Ga0068864_1000813823 | 530 |
| 1527 | 3300005719 | Ga0068861_100042615 | Ga0068861_1000426153 | 530 |
| 1528 | 3300005834 | Ga0068851_10008653 | Ga0068851_100086533 | 530 |
| 1529 | 3300005841 | Ga0068863_100072031 | Ga0068863_1000720312 | 530 |
| 1530 | 3300005842 | Ga0068858_100003875 | Ga0068858_1000038757 | 530 |
| 1531 | 3300005843 | Ga0068860_100000032 | Ga0068860_100000032169 | 530 |
| 1532 | 3300005843 | Ga0068860_100004785 | Ga0068860_10000478516 | 530 |
| 1533 | 3300005843 | Ga0068860_100015206 | Ga0068860_1000152065 | 530 |
| 1534 | 3300005844 | Ga0068862_100000074 | Ga0068862_10000007442 | 530 |
| 1535 | 3300006931 | Ga0097620_100002952 | Ga0097620_10000295210 | 530 |
| 1536 | 3300006931 | Ga0097620_100019239 | Ga0097620_1000192395 | 530 |
| 1537 | 3300009093 | Ga0105240_10114939 | Ga0105240_101149392 | 530 |
| 1538 | 3300009101 | Ga0105247_10004758 | Ga0105247_1000475811 | 530 |
| 1539 | 3300009177 | Ga0105248_10019871 | Ga0105248_100198714 | 530 |
| 1540 | 3300009545 | Ga0105237_10048817 | Ga0105237_100488174 | 530 |
| 1541 | 3300009551 | Ga0105238_10077462 | Ga0105238_100774622 | 530 |
| 1542 | 3300009553 | Ga0105249_10000167 | Ga0105249_1000016753 | 530 |
| 1543 | 3300013104 | Ga0157370_10009206 | Ga0157370_100092063 | 530 |
| 1544 | 3300013105 | Ga0157369_10139654 | Ga0157369_101396541 | 530 |
| 1545 | 3300013297 | Ga0157378_10023381 | Ga0157378_100233814 | 530 |
| 1546 | 3300013306 | Ga0163162_10139244 | Ga0163162_101392442 | 530 |
| 1547 | 3300025321 | Ga0207656_10001845 | Ga0207656_100018454 | 530 |
| 1548 | 3300025904 | Ga0207647_10000885 | Ga0207647_1000088522 | 530 |
| 1549 | 3300025911 | Ga0207654_10005029 | Ga0207654_100050293 | 530 |
| 1550 | 3300025913 | Ga0207695_10013483 | Ga0207695_100134837 | 530 |
| 1551 | 3300025914 | Ga0207671_10004455 | Ga0207671_100044559 | 530 |
| 1552 | 3300025919 | Ga0207657_10007886 | Ga0207657_100078863 | 530 |
| 1553 | 3300025924 | Ga0207694_10001025 | Ga0207694_1000102521 | 530 |
| 1554 | 3300025931 | Ga0207644_10000329 | Ga0207644_100003295 | 530 |
| 1555 | 3300025933 | Ga0207706_10001157 | Ga0207706_100011576 | 530 |
| 1556 | 3300025941 | Ga0207711_10024631 | Ga0207711_100246314 | 530 |
| 1557 | 3300025945 | Ga0207679_10012972 | Ga0207679_100129722 | 530 |
| 1558 | 3300025949 | Ga0207667_10002524 | Ga0207667_1000252422 | 530 |
| 1559 | 3300025961 | Ga0207712_10000049 | Ga0207712_1000004975 | 530 |
| 1560 | 3300026035 | Ga0207703_10003066 | Ga0207703_100030666 | 530 |
| 1561 | 3300026041 | Ga0207639_10002001 | Ga0207639_100020015 | 530 |
| 1562 | 3300026041 | Ga0207639_10013567 | Ga0207639_100135675 | 530 |
| 1563 | 3300026078 | Ga0207702_10024292 | Ga0207702_100242921 | 530 |
| 1564 | 3300026088 | Ga0207641_10001148 | Ga0207641_1000114817 | 530 |
| 1565 | 3300026095 | Ga0207676_10031252 | Ga0207676_100312523 | 530 |
| 1566 | 3300026116 | Ga0207674_10066837 | Ga0207674_100668373 | 530 |
| 1567 | 3300026118 | Ga0207675_100053902 | Ga0207675_1000539022 | 530 |
| 1568 | 3300026142 | Ga0207698_10009467 | Ga0207698_100094675 | 530 |
| 1569 | 3300026142 | Ga0207698_10087592 | Ga0207698_100875922 | 530 |
| 1570 | 3300028380 | Ga0268265_10000113 | Ga0268265_1000011357 | 530 |
| 1571 | 3300028381 | Ga0268264_10000045 | Ga0268264_10000045184 | 530 |
| 1572 | 3300028381 | Ga0268264_10000828 | Ga0268264_1000082827 | 530 |
| 1573 | 3300031911 | Ga0307412_10026701 | Ga0307412_100267012 | 530 |
| 1574 | 3300046530 | Ga0495654_0005844 | Ga0495654_0005844_3839_5440 | 530 |
| 1575 | 3300046616 | Ga0495668_0040899 | Ga0495668_0040899_884_2485 | 530 |
| 1576 | 3300048909 | Ga0496106_0014414 | Ga0496106_0014414_1246_2862 | 530 |
| 1577 | 3300048912 | Ga0496109_0040813 | Ga0496109_0040813_1231_2847 | 530 |
| 1578 | 3300048914 | Ga0496111_0044181 | Ga0496111_0044181_315_1931 | 530 |
| 1579 | 3300048916 | Ga0496113_0002345 | Ga0496113_0002345_5947_7563 | 530 |
| 1580 | 3300048929 | Ga0496126_0005869 | Ga0496126_0005869_5020_6636 | 530 |
| 1581 | 3300049515 | Ga0501292_000003 | Ga0501292_000003_46624_48222 | 530 |
| 1582 | 3300049517 | Ga0501294_000016 | Ga0501294_000016_15953_17551 | 530 |
| 1583 | 3300049662 | Ga0501222_000150 | Ga0501222_000150_7866_9464 | 530 |
| 1584 | 3300049663 | Ga0501223_000241 | Ga0501223_000241_6269_7867 | 530 |
| 1585 | 3300049688 | Ga0501259_001070 | Ga0501259_001070_2849_4447 | 530 |
| 1586 | 3300049690 | Ga0501261_000007 | Ga0501261_000007_56661_58259 | 530 |
| 1587 | 3300049775 | Ga0501279_000009 | Ga0501279_000009_17496_19094 | 530 |
| 1588 | 3300049776 | Ga0501280_000022 | Ga0501280_000022_30778_32376 | 530 |
| 1589 | 3300049777 | Ga0501281_00089 | Ga0501281_00089_2474_4072 | 530 |
| 1590 | 3300049778 | Ga0501282_000069 | Ga0501282_000069_974_2572 | 530 |
| 1591 | 3300053087 | Ga0500643_000544 | Ga0500643_000544_15458_17059 | 530 |
| 1592 | 3300053158 | Ga0500627_0006100 | Ga0500627_0006100_1726_3327 | 530 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ki1-assembly2.cif.gz_B | the transmembrane domain of a cyanobacterium bicarbonate transporter bica | 0.6889 | 18 | 408 |
| 7v73-assembly1.cif.gz_A | thermostabilized human prestin in complex with chloride | 0.6809 | 9 | 458 |
| 7v75-assembly1.cif.gz_A | thermostabilized human prestin in complex with salicylate | 0.672 | 9 | 458 |
| 5iof-assembly1.cif.gz_A | structure of the transmembrane domain of the transporter slc26dg | 0.6693 | 16 | 462 |
| 5da0-assembly1.cif.gz_A | structure of the the slc26 transporter slc26dg in complex with a nanobody | 0.6693 | 16 | 462 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76103_4_381_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.7156 | 12 | 454 | 1.20.1740.10 |
| af_P76103_4_381_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.7056 | 12 | 454 | 1.20.1740.10 |
| af_Q57772_21_432_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.6877 | 20 | 505 | 1.20.1740.10 |
| af_Q57772_21_432_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.6802 | 20 | 505 | 1.20.1740.10 |
| af_Q6ZIE6_46_504_1.20.1730.10 | Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter | 0.5761 | 27 | 469 | 1.20.1730.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0NTC5-F1-model_v4 | Regulator | 0.9881 | 7 | 390 |
GO:0016020
|
| AF-A0A3C0NTC5-F1-model_v4 | Regulator | 0.9856 | 7 | 390 |
GO:0016020
|
| AF-A0A7V9BX27-F1-model_v4 | Regulator | 0.9766 | 3 | 515 |
GO:0016020
|
| AF-A0A1Z4BWK6-F1-model_v4 | Regulator | 0.9724 | 8 | 530 |
GO:0016020
|
| AF-A0A7V9BX27-F1-model_v4 | Regulator | 0.9709 | 3 | 515 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar