F494963

General Info

Members Datasets Scaffolds Average Seq Length
1595 661 1464 265

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0056656|Ga0453684_0056656_1724_2584
Length 286
Sequence MARDYTFPVRPASMQPYLDLMRHVLAHGHSKSDRTGTGTRSVFGWQMRFDLAQGFPLLTTKKLHLRSIIHELLWFLQGDTNIGYLKHNGVRIWDEWADANGDLGPVYGHQWRHWPKPDGGEVDQITELIDGLKRNPDSRRHIVSAWNPGDVPRMQLPPCHALFQFYVAPAAATAADPRGRLSCQLYQRSADIFLGVPFNIASYALLTMMVAQVCDLVPGDFVHTLGDAHLYTNHVEQAQLQLARATRTLPTMHLNPAVKDIFGFRYEDFTLEGYDPHPHIAAPVAV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
3 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
4 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
5 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
6 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
7 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
8 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
9 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
10 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
11 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
12 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
13 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
14 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
15 2643221604 Nocardioides sp. Root190 Isolate Unclassified
16 2643221629 Devosia sp. Root105 Isolate Unclassified
17 2643221651 Afipia sp. Root123D2 Isolate Unclassified
18 2643221662 Devosia sp. Root413D1 Isolate Unclassified
19 2643221733 Bosea sp. Root381 Isolate Unclassified
20 2643221734 Bosea sp. Root670 Isolate Unclassified
21 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
22 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
23 2738541284 Pedobacter sp. YR016 Isolate Unclassified
24 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
25 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
26 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
27 2791355199
28 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
29 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
30 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
31 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
32 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
33 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
34 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
35 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
36 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
37 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
38 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
39 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
40 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
41 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
42 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
43 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
44 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
45 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
46 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
47 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
48 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
49 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
50 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
51 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
52 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
53 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
54 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
55 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
56 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
57 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
58 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
59 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
60 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
61 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
62 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
63 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
64 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
65 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
66 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
67 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
68 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
69 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
70 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
71 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
72 2922368715
73 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
74 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
75 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
76 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
77 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
78 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
79 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
80 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
81 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
82 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
83 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
84 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
85 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
86 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
87 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
88 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
89 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
90 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
91 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
92 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
93 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
94 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
95 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
96 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
97 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
98 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
99 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
100 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
101 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
102 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
103 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
104 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
105 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
106 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
107 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
108 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
109 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
110 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
111 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
112 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
113 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
114 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
115 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
116 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
117 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
118 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
119 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
120 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
121 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
122 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
123 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
124 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
125 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
126 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
127 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
128 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
129 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
130 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
131 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
132 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
133 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
134 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
135 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
136 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
137 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
138 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
139 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
140 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
141 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
142 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
143 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
144 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
145 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
146 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
147 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
148 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
149 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
150 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
151 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
152 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
153 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
154 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
155 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
156 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
157 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
158 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
159 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
160 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
161 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
162 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
163 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
164 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
165 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
166 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
167 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
168 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
169 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
170 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
171 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
172 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
173 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
174 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
175 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
176 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
177 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
178 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
179 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
180 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
181 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
182 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
183 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
184 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
185 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
186 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
187 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
188 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
189 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
190 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
191 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
192 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
193 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
194 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
195 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
196 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
197 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
198 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
199 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
200 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
201 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
202 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
203 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
204 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
205 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
206 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
207 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
208 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
209 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
210 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
211 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
212 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
213 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
214 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
215 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
216 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
217 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
218 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
219 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
220 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
221 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
222 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
223 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
224 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
225 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
226 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
227 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
228 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
229 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
230 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
231 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
232 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
233 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
234 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
235 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
236 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
237 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
238 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
239 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
240 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
241 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
242 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
243 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
244 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
245 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
246 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
247 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
248 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
249 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
250 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
251 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
252 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
253 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
254 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
255 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
256 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
257 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
258 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
259 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
260 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
261 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
262 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
263 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
264 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
265 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
266 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
267 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
268 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
269 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
270 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
271 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
272 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
273 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
274 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
275 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
276 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
277 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
278 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
280 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
281 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
282 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
283 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
284 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
285 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
286 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
287 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
349 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
350 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
351 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
353 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
354 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
358 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
359 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
360 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
361 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
362 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
363 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
364 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
365 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
366 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
367 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
368 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
369 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
370 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
371 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
372 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
373 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
374 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
375 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
376 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
377 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
378 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
379 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
380 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
381 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
382 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
383 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
384 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
385 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
386 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
387 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
388 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
389 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
390 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
391 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
392 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
393 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
394 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
395 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
396 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
397 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
398 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
399 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
400 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
401 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
402 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
403 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
404 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
405 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
406 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
407 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
408 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
409 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
410 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
411 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
412 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
413 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
414 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
415 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
416 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
417 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
418 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
419 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
420 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
421 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
422 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
423 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
424 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
425 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
426 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
427 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
428 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
429 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
430 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
431 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
432 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
433 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
434 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
435 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
436 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
437 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
438 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
439 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
440 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
441 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
442 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
443 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
444 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
445 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
446 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
447 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
448 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
449 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
450 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
451 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
452 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
453 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
454 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
455 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
456 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
457 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
458 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
459 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
460 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
461 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
462 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
463 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
464 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
465 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
466 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
467 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
468 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
469 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
470 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
471 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
472 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
473 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
474 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
475 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
476 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
477 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
478 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
479 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
480 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
481 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
482 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
483 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
484 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
485 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
486 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
487 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
488 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
489 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
490 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
491 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
492 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
493 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
494 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
495 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
496 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
497 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
498 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
499 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
500 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
501 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
502 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
503 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
504 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
505 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
506 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
507 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
508 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
509 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
510 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
511 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
512 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
513 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
514 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
515 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
516 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
517 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
518 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
519 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
520 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
521 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
522 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
523 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
524 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
525 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
526 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
527 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
528 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
529 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
530 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
531 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
532 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
533 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
534 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
535 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
536 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
537 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
538 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
539 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
540 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
541 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
542 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
543 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
544 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
545 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
546 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
547 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
548 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
549 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
550 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
551 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
552 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
553 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
554 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
555 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
556 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
557 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
558 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
559 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
560 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
561 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
562 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
563 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
564 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
565 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
566 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
567 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
568 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
569 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
570 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
571 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
572 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
573 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
574 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
575 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
576 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
577 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
578 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
579 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
580 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
581 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
582 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
583 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
584 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
585 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
586 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
587 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
588 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
589 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
590 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
591 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
592 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
593 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
594 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
595 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
596 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
597 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
598 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
599 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
600 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
601 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
602 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
603 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
604 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
605 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
606 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
607 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
608 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
609 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
610 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
611 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
612 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
613 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
614 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
615 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
616 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
617 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
618 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
619 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
620 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
621 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
622 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
623 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
624 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
625 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
626 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
627 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
628 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
629 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
630 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
631 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
632 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
633 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
634 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
635 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
636 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
637 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
638 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
639 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
640 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
641 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
642 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
643 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
644 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
645 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
646 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
647 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
648 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
649 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
650 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
651 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
652 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
653 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
654 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
655 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
656 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
657 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
658 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
659 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
660 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
661 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.65
Metatranscriptomes 0.25
Isolates 8.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.15
Nodule 5.14
Rhizoplane 5.96
Rhizosphere 71.85
Stem 0
Stem Tuber 0
Unclassified 8.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2388475 2162886007 Bacteria 3464
2 LJQas_1004670 3300000549 Bacteria 1773
3 JGI24740J21852_10015371 3300001979 Bacteria 2797
4 JGI24740J21852_10025518 3300001979 Bacteria 1991
5 JGI24750J21931_1014577 3300002070 Bacteria 1058
6 JGI25154J39366_1000007 3300002738 Bacteria 335932
7 JGI25151J46595_10000028 3300003187 Bacteria 208373
8 JGI25406J46586_10000196 3300003203 Bacteria 26875
9 JGI25165J46597_1005748 3300003214 Bacteria 2324
10 JGI25153J46596_10000738 3300003215 Bacteria 20026
11 JGI25153J46596_10001748 3300003215 Bacteria 12881
12 rootH1_10034177 3300003323 Bacteria 5322
13 rootH1_10106887 3300003323 Bacteria 2486
14 JGI25160J50197_1012427 3300003354 Bacteria 2956
15 JGI25404J52841_10008621 3300003659 Bacteria 2175
16 Ga0055539_1007171 3300003752 Bacteria 1413
17 Ga0055526_1000938 3300003771 Bacteria 21601
18 Ga0055526_1005211 3300003771 Bacteria 7549
19 Ga0055524_1000020 3300003775 Bacteria 227971
20 Ga0055524_1007655 3300003775 Bacteria 4564
21 Ga0065165_1002837 3300005262 Bacteria 13516
22 Ga0065714_10002655 3300005288 Bacteria 18426
23 Ga0065714_10064924 3300005288 Bacteria 15372
24 Ga0065714_10105188 3300005288 Bacteria 1549
25 Ga0065704_10000422 3300005289 Bacteria 22124
26 Ga0065704_10226758 3300005289 Bacteria 1056
27 Ga0065715_10165122 3300005293 Bacteria 1593
28 Ga0070658_10034361 3300005327 Bacteria 4080
29 Ga0070658_10094348 3300005327 Bacteria 2469
30 Ga0070658_10181622 3300005327 Bacteria 1770
31 Ga0070658_10295126 3300005327 Bacteria 1382
32 Ga0070676_10144069 3300005328 Bacteria 1519
33 Ga0070683_100002255 3300005329 Bacteria 15294
34 Ga0070683_100017424 3300005329 Bacteria 6350
35 Ga0070683_100046407 3300005329 Bacteria 4013
36 Ga0070683_100053085 3300005329 Bacteria 3756
37 Ga0070690_100013883 3300005330 Bacteria 4774
38 Ga0070690_100167770 3300005330 Bacteria 1509
39 Ga0070690_100206861 3300005330 Bacteria 1368
40 Ga0070670_100097680 3300005331 Bacteria 2527
41 Ga0070670_100132060 3300005331 Bacteria 2157
42 Ga0068869_100038274 3300005334 Bacteria 3417
43 Ga0070666_10214446 3300005335 Bacteria 1357
44 Ga0070680_100221804 3300005336 Bacteria 1596
45 Ga0070682_100000014 3300005337 Bacteria 249552
46 Ga0070682_100080195 3300005337 Bacteria 2110
47 Ga0070682_100466373 3300005337 Bacteria 971
48 Ga0068868_100002673 3300005338 Bacteria 12360
49 Ga0068868_100050231 3300005338 Bacteria 3274
50 Ga0070660_100010424 3300005339 Bacteria 6568
51 Ga0070660_100396392 3300005339 Bacteria 1141
52 Ga0070689_100000488 3300005340 Bacteria 23423
53 Ga0070689_100002204 3300005340 Bacteria 12627
54 Ga0070689_100189445 3300005340 Bacteria 1674
55 Ga0070689_100237511 3300005340 Bacteria 1500
56 Ga0070689_100415257 3300005340 Bacteria 1140
57 Ga0070691_10017425 3300005341 Bacteria 3305
58 Ga0070691_10018051 3300005341 Bacteria 3249
59 Ga0070661_100008367 3300005344 Bacteria 7147
60 Ga0070661_100204853 3300005344 Bacteria 1508
61 Ga0070692_10007686 3300005345 Bacteria 4766
62 Ga0070692_10014150 3300005345 Bacteria 3737
63 Ga0070668_100002031 3300005347 Bacteria 14798
64 Ga0070668_100041237 3300005347 Bacteria 3536
65 Ga0070668_100108937 3300005347 Bacteria 2203
66 Ga0070668_100331079 3300005347 Bacteria 1284
67 Ga0070668_100371797 3300005347 Bacteria 1214
68 Ga0070669_100027197 3300005353 Bacteria 4117
69 Ga0070675_100007206 3300005354 Bacteria 8573
70 Ga0070675_100499022 3300005354 Bacteria 1096
71 Ga0070671_100006436 3300005355 Bacteria 9384
72 Ga0070674_100035143 3300005356 Bacteria 3354
73 Ga0070674_100388937 3300005356 Bacteria 1136
74 Ga0070673_100097811 3300005364 Bacteria 2411
75 Ga0070673_100113737 3300005364 Bacteria 2248
76 Ga0070673_100153375 3300005364 Bacteria 1953
77 Ga0070688_100225593 3300005365 Bacteria 1323
78 Ga0070688_100353997 3300005365 Bacteria 1076
79 Ga0070659_100145758 3300005366 Bacteria 1929
80 Ga0070659_100358993 3300005366 Bacteria 1224
81 Ga0070667_100071427 3300005367 Bacteria 2956
82 Ga0070667_100094555 3300005367 Bacteria 2575
83 Ga0070667_100187955 3300005367 Bacteria 1829
84 Ga0070667_100203201 3300005367 Bacteria 1758
85 Ga0070667_100333620 3300005367 Bacteria 1370
86 Ga0070709_10025330 3300005434 Bacteria 3503
87 Ga0070709_10025693 3300005434 Bacteria 3482
88 Ga0070709_10056857 3300005434 Bacteria 2476
89 Ga0070714_100002013 3300005435 Bacteria 14875
90 Ga0070714_100038279 3300005435 Bacteria 4032
91 Ga0070714_100041967 3300005435 Bacteria 3863
92 Ga0070714_100134050 3300005435 Bacteria 2216
93 Ga0070714_100168946 3300005435 Bacteria 1984
94 Ga0070714_100240705 3300005435 Bacteria 1670
95 Ga0070714_100253223 3300005435 Bacteria 1629
96 Ga0070713_100000639 3300005436 Bacteria 22363
97 Ga0070713_100162001 3300005436 Bacteria 1998
98 Ga0070710_10000587 3300005437 Bacteria 17296
99 Ga0070710_10011649 3300005437 Bacteria 4349
100 Ga0070711_100002894 3300005439 Bacteria 9893
101 Ga0070711_100010862 3300005439 Bacteria 5645
102 Ga0070711_100092843 3300005439 Bacteria 2179
103 Ga0070711_100135860 3300005439 Bacteria 1838
104 Ga0070711_100208229 3300005439 Bacteria 1513
105 Ga0070705_100001167 3300005440 Bacteria 14363
106 Ga0070705_100143726 3300005440 Bacteria 1574
107 Ga0070700_100003520 3300005441 Bacteria 8075
108 Ga0070700_100062744 3300005441 Bacteria 2349
109 Ga0070700_100150313 3300005441 Bacteria 1592
110 Ga0070694_100009831 3300005444 Bacteria 5878
111 Ga0070663_100047725 3300005455 Bacteria 3033
112 Ga0070663_100074216 3300005455 Bacteria 2483
113 Ga0070663_100136230 3300005455 Bacteria 1870
114 Ga0070663_100174501 3300005455 Bacteria 1663
115 Ga0070678_100007967 3300005456 Bacteria 6315
116 Ga0070678_100035283 3300005456 Bacteria 3490
117 Ga0070678_100039559 3300005456 Bacteria 3328
118 Ga0070678_100066179 3300005456 Bacteria 2686
119 Ga0070678_100091852 3300005456 Bacteria 2331
120 Ga0070678_100182435 3300005456 Bacteria 1719
121 Ga0070662_100050830 3300005457 Bacteria 2991
122 Ga0070681_10069164 3300005458 Bacteria 3497
123 Ga0070681_10085157 3300005458 Bacteria 3113
124 Ga0068867_100165645 3300005459 Bacteria 1746
125 Ga0070685_10000250 3300005466 Bacteria 35267
126 Ga0070685_10073780 3300005466 Bacteria 2029
127 Ga0070706_100467803 3300005467 Bacteria 1173
128 Ga0070698_100001623 3300005471 Bacteria 25049
129 Ga0070699_100000147 3300005518 Bacteria 66774
130 Ga0070679_100009879 3300005530 Bacteria 9027
131 Ga0070679_100019162 3300005530 Bacteria 6648
132 Ga0070679_100037593 3300005530 Bacteria 4810
133 Ga0070679_100189878 3300005530 Bacteria 2024
134 Ga0070679_100374925 3300005530 Bacteria 1370
135 Ga0070684_100027286 3300005535 Bacteria 4817
136 Ga0070684_100033649 3300005535 Bacteria 4377
137 Ga0070684_100094496 3300005535 Bacteria 2663
138 Ga0070684_100354154 3300005535 Bacteria 1350
139 Ga0070697_100044081 3300005536 Bacteria 3613
140 Ga0068853_100021436 3300005539 Bacteria 5388
141 Ga0068853_100022775 3300005539 Bacteria 5236
142 Ga0068853_100091534 3300005539 Bacteria 2675
143 Ga0068853_100256421 3300005539 Bacteria 1607
144 Ga0068853_100277868 3300005539 Bacteria 1543
145 Ga0068853_100322378 3300005539 Bacteria 1432
146 Ga0068853_100445302 3300005539 Bacteria 1218
147 Ga0070672_100000746 3300005543 Bacteria 19295
148 Ga0070672_100089558 3300005543 Bacteria 2480
149 Ga0070672_100249753 3300005543 Bacteria 1494
150 Ga0070686_100112425 3300005544 Bacteria 1857
151 Ga0070695_100011698 3300005545 Bacteria 5252
152 Ga0070696_100000503 3300005546 Bacteria 24690
153 Ga0070696_100108170 3300005546 Bacteria 2000
154 Ga0070696_100178163 3300005546 Bacteria 1575
155 Ga0070693_100016097 3300005547 Bacteria 3864
156 Ga0070693_100132752 3300005547 Bacteria 1559
157 Ga0070693_100240139 3300005547 Bacteria 1196
158 Ga0070665_100004481 3300005548 Bacteria 14668
159 Ga0070665_100020950 3300005548 Bacteria 6570
160 Ga0070665_100033592 3300005548 Bacteria 5162
161 Ga0070665_100043567 3300005548 Bacteria 4510
162 Ga0070665_100141030 3300005548 Bacteria 2413
163 Ga0070665_100142500 3300005548 Bacteria 2400
164 Ga0070665_100152095 3300005548 Bacteria 2317
165 Ga0070665_100160316 3300005548 Bacteria 2251
166 Ga0070665_100190871 3300005548 Bacteria 2049
167 Ga0070665_100529821 3300005548 Bacteria 1190
168 Ga0070704_100014566 3300005549 Bacteria 4914
169 Ga0070704_100139027 3300005549 Bacteria 1894
170 Ga0068855_100036490 3300005563 Bacteria 5850
171 Ga0068855_100037992 3300005563 Bacteria 5723
172 Ga0068855_100084586 3300005563 Bacteria 3672
173 Ga0068855_100436150 3300005563 Bacteria 1431
174 Ga0070664_100115042 3300005564 Bacteria 2351
175 Ga0068857_100002373 3300005577 Bacteria 15346
176 Ga0068857_100051526 3300005577 Bacteria 3652
177 Ga0068857_100060313 3300005577 Bacteria 3370
178 Ga0068857_100096949 3300005577 Bacteria 2643
179 Ga0068857_100210098 3300005577 Bacteria 1776
180 Ga0068857_100450862 3300005577 Bacteria 1203
181 Ga0068854_100115871 3300005578 Bacteria 2027
182 Ga0068854_100133269 3300005578 Bacteria 1899
183 Ga0068856_100002538 3300005614 Bacteria 18824
184 Ga0068856_100025782 3300005614 Bacteria 5732
185 Ga0068856_100118188 3300005614 Bacteria 2652
186 Ga0068856_100206953 3300005614 Bacteria 1976
187 Ga0068856_100390813 3300005614 Bacteria 1411
188 Ga0068856_100403938 3300005614 Bacteria 1386
189 Ga0070702_100162301 3300005615 Bacteria 1446
190 Ga0068852_100001168 3300005616 Bacteria 17390
191 Ga0068852_100016778 3300005616 Bacteria 5723
192 Ga0068852_100019720 3300005616 Bacteria 5345
193 Ga0068852_100045654 3300005616 Bacteria 3728
194 Ga0068852_100103442 3300005616 Bacteria 2576
195 Ga0068852_100121441 3300005616 Bacteria 2393
196 Ga0068852_100174247 3300005616 Bacteria 2019
197 Ga0068859_100003136 3300005617 Bacteria 16805
198 Ga0068859_100041987 3300005617 Bacteria 4594
199 Ga0068859_100067475 3300005617 Bacteria 3611
200 Ga0068859_100079191 3300005617 Bacteria 3325
201 Ga0068859_100208224 3300005617 Bacteria 2041
202 Ga0068864_100000097 3300005618 Bacteria 85717
203 Ga0068864_100083220 3300005618 Bacteria 2810
204 Ga0068864_100163314 3300005618 Bacteria 2026
205 Ga0068861_100000391 3300005719 Bacteria 25251
206 Ga0068861_100066467 3300005719 Bacteria 2779
207 Ga0068861_100080561 3300005719 Bacteria 2547
208 Ga0068851_10020777 3300005834 Bacteria 3183
209 Ga0068851_10023616 3300005834 Bacteria 3007
210 Ga0068870_10058104 3300005840 Bacteria 2070
211 Ga0068863_100057565 3300005841 Bacteria 3679
212 Ga0068863_100064453 3300005841 Bacteria 3465
213 Ga0068858_100000243 3300005842 Bacteria 58808
214 Ga0068858_100037282 3300005842 Bacteria 4508
215 Ga0068858_100176044 3300005842 Bacteria 2019
216 Ga0068858_100359903 3300005842 Bacteria 1395
217 Ga0068858_100412713 3300005842 Bacteria 1298
218 Ga0068858_100468617 3300005842 Bacteria 1215
219 Ga0068860_100004632 3300005843 Bacteria 14042
220 Ga0068860_100013122 3300005843 Bacteria 8131
221 Ga0068860_100020886 3300005843 Bacteria 6344
222 Ga0068860_100056526 3300005843 Bacteria 3730
223 Ga0068860_100128258 3300005843 Bacteria 2432
224 Ga0068860_100582969 3300005843 Bacteria 1123
225 Ga0068862_100001552 3300005844 Bacteria 21005
226 Ga0068862_100002918 3300005844 Bacteria 14944
227 Ga0068862_100418100 3300005844 Bacteria 1257
228 Ga0081455_10008277 3300005937 Bacteria 10837
229 Ga0081455_10019690 3300005937 Bacteria 6374
230 Ga0081455_10067883 3300005937 Bacteria 2970
231 Ga0081455_10070603 3300005937 Bacteria 2899
232 Ga0081538_10017929 3300005981 Bacteria 5346
233 Ga0081540_1000996 3300005983 Bacteria 25476
234 Ga0081540_1008013 3300005983 Bacteria 7435
235 Ga0081540_1010852 3300005983 Bacteria 6123
236 Ga0081540_1028988 3300005983 Bacteria 3094
237 Ga0081540_1071022 3300005983 Bacteria 1610
238 Ga0081539_10000748 3300005985 Bacteria 64594
239 Ga0081539_10030261 3300005985 Bacteria 3365
240 Ga0070717_10010072 3300006028 Bacteria 7119
241 Ga0070717_10014303 3300006028 Bacteria 6103
242 Ga0070717_10016137 3300006028 Bacteria 5786
243 Ga0070717_10128031 3300006028 Bacteria 2181
244 Ga0070717_10321136 3300006028 Bacteria 1379
245 Ga0075365_10067201 3300006038 Bacteria 2406
246 Ga0075365_10081134 3300006038 Bacteria 2197
247 Ga0075365_10192006 3300006038 Bacteria 1429
248 Ga0075368_10018880 3300006042 Bacteria 2598
249 Ga0075368_10069009 3300006042 Bacteria 1425
250 Ga0075363_100032234 3300006048 Bacteria 2720
251 Ga0075364_10022187 3300006051 Bacteria 4007
252 Ga0075364_10044496 3300006051 Bacteria 2887
253 Ga0075364_10146731 3300006051 Bacteria 1589
254 Ga0075364_10213375 3300006051 Bacteria 1309
255 Ga0070715_10000260 3300006163 Bacteria 12808
256 Ga0070716_100000213 3300006173 Bacteria 23132
257 Ga0070716_100020768 3300006173 Bacteria 3452
258 Ga0070712_100010117 3300006175 Bacteria 5945
259 Ga0070712_100016528 3300006175 Bacteria 4768
260 Ga0075362_10000655 3300006177 Bacteria 10192
261 Ga0075362_10008950 3300006177 Bacteria 3850
262 Ga0075367_10038229 3300006178 Bacteria 2793
263 Ga0075369_10002063 3300006186 Bacteria 7088
264 Ga0075369_10011190 3300006186 Bacteria 3524
265 Ga0075366_10242998 3300006195 Bacteria 1097
266 Ga0097621_100029889 3300006237 Bacteria 4307
267 Ga0097621_100041480 3300006237 Bacteria 3705
268 Ga0097621_100146155 3300006237 Bacteria 2024
269 Ga0097621_100185039 3300006237 Bacteria 1801
270 Ga0075370_10042568 3300006353 Bacteria 2565
271 Ga0075370_10083703 3300006353 Bacteria 1835
272 Ga0075370_10087666 3300006353 Bacteria 1793
273 Ga0075370_10123414 3300006353 Bacteria 1508
274 Ga0068871_100001292 3300006358 Bacteria 16740
275 Ga0068871_100058705 3300006358 Bacteria 3133
276 Ga0068871_100107291 3300006358 Bacteria 2345
277 Ga0075428_100002030 3300006844 Bacteria 21820
278 Ga0075428_100003578 3300006844 Bacteria 17023
279 Ga0075428_100013501 3300006844 Bacteria 9091
280 Ga0075428_100068789 3300006844 Bacteria 3873
281 Ga0075431_100014541 3300006847 Bacteria 7962
282 Ga0075433_10023832 3300006852 Bacteria 5156
283 Ga0075434_100033264 3300006871 Bacteria 5087
284 Ga0075429_100002394 3300006880 Bacteria 15806
285 Ga0075429_100060260 3300006880 Bacteria 3306
286 Ga0068865_100035745 3300006881 Bacteria 3344
287 Ga0068865_100094453 3300006881 Bacteria 2176
288 Ga0068865_100191024 3300006881 Bacteria 1584
289 Ga0068865_100443697 3300006881 Bacteria 1071
290 Ga0068865_100467125 3300006881 Bacteria 1046
291 Ga0097620_100003136 3300006931 Bacteria 16805
292 Ga0097620_100041987 3300006931 Bacteria 4594
293 Ga0097620_100067486 3300006931 Bacteria 3611
294 Ga0097620_100079191 3300006931 Bacteria 3325
295 Ga0097620_100208232 3300006931 Bacteria 2041
296 Ga0099824_1013210 3300006942 Bacteria 8667
297 Ga0075435_100073070 3300007076 Bacteria 2803
298 Ga0075435_100570589 3300007076 Bacteria 980
299 Ga0075435_100595263 3300007076 Bacteria 959
300 Ga0099794_10047410 3300007265 Bacteria 2060
301 Ga0099795_10023637 3300007788 Bacteria 2041
302 Ga0105240_10000876 3300009093 Bacteria 54171
303 Ga0105240_10000946 3300009093 Bacteria 51674
304 Ga0105240_10023381 3300009093 Bacteria 8174
305 Ga0105240_10343595 3300009093 Bacteria 1695
306 Ga0111539_10002382 3300009094 Bacteria 24956
307 Ga0111539_10007116 3300009094 Bacteria 14343
308 Ga0111539_10012046 3300009094 Bacteria 10846
309 Ga0111539_10015447 3300009094 Bacteria 9497
310 Ga0111539_10089698 3300009094 Bacteria 3613
311 Ga0111539_10294080 3300009094 Bacteria 1890
312 Ga0111539_10461243 3300009094 Bacteria 1480
313 Ga0111539_11042298 3300009094 Bacteria 951
314 Ga0105245_10000024 3300009098 Bacteria 178565
315 Ga0105245_10002720 3300009098 Bacteria 15913
316 Ga0105245_10003410 3300009098 Bacteria 14233
317 Ga0105245_10005629 3300009098 Bacteria 11010
318 Ga0105245_10085154 3300009098 Bacteria 2897
319 Ga0105245_10118752 3300009098 Bacteria 2468
320 Ga0105245_10131020 3300009098 Bacteria 2352
321 Ga0105245_10217779 3300009098 Bacteria 1841
322 Ga0105245_10287109 3300009098 Bacteria 1610
323 Ga0105245_10421353 3300009098 Bacteria 1338
324 Ga0105247_10041178 3300009101 Bacteria 2826
325 Ga0105247_10238139 3300009101 Bacteria 1239
326 Ga0105247_10346834 3300009101 Bacteria 1043
327 Ga0114129_10107850 3300009147 Bacteria 3845
328 Ga0114129_10118296 3300009147 Bacteria 3650
329 Ga0105243_10042437 3300009148 Bacteria 3561
330 Ga0105243_10075153 3300009148 Bacteria 2742
331 Ga0105243_10184710 3300009148 Bacteria 1816
332 Ga0105243_10660491 3300009148 Bacteria 1014
333 Ga0105241_10004477 3300009174 Bacteria 10333
334 Ga0105241_10075673 3300009174 Bacteria 2623
335 Ga0105241_10287200 3300009174 Bacteria 1407
336 Ga0105242_10132099 3300009176 Bacteria 2156
337 Ga0105248_10064938 3300009177 Bacteria 4097
338 Ga0105248_10121324 3300009177 Bacteria 2949
339 Ga0105248_10160474 3300009177 Bacteria 2536
340 Ga0105248_10186176 3300009177 Bacteria 2339
341 Ga0105248_10252582 3300009177 Bacteria 1984
342 Ga0105248_11004952 3300009177 Bacteria 942
343 Ga0105237_10000233 3300009545 Bacteria 79346
344 Ga0105237_10005728 3300009545 Bacteria 13958
345 Ga0105237_10019359 3300009545 Bacteria 7030
346 Ga0105237_10022378 3300009545 Bacteria 6485
347 Ga0105237_10042957 3300009545 Bacteria 4556
348 Ga0105237_10094823 3300009545 Bacteria 2973
349 Ga0105237_10516181 3300009545 Bacteria 1201
350 Ga0105238_10004976 3300009551 Bacteria 13140
351 Ga0105238_10008040 3300009551 Bacteria 10550
352 Ga0105238_10215847 3300009551 Bacteria 1894
353 Ga0105249_10006733 3300009553 Bacteria 10011
354 Ga0105249_10110119 3300009553 Bacteria 2602
355 Ga0105249_10578157 3300009553 Bacteria 1176
356 Ga0105249_10812335 3300009553 Bacteria 999
357 Ga0099796_10015265 3300010159 Bacteria 2242
358 Ga0105239_10000120 3300010375 Bacteria 110003
359 Ga0105239_10001640 3300010375 Bacteria 29511
360 Ga0105239_10013259 3300010375 Bacteria 9160
361 Ga0105239_10024893 3300010375 Bacteria 6592
362 Ga0105239_10091956 3300010375 Bacteria 3348
363 Ga0105239_10096136 3300010375 Bacteria 3273
364 Ga0105239_10242659 3300010375 Bacteria 2022
365 Ga0105239_10260202 3300010375 Bacteria 1950
366 Ga0105239_10408747 3300010375 Bacteria 1537
367 Ga0105239_10759717 3300010375 Bacteria 1110
368 Ga0105246_10024005 3300011119 Bacteria 3954
369 Ga0157327_1011436 3300012512 Bacteria 857
370 Ga0157373_10002272 3300013100 Bacteria 14563
371 Ga0157371_10003535 3300013102 Bacteria 14102
372 Ga0157371_10012477 3300013102 Bacteria 6493
373 Ga0157371_10014832 3300013102 Bacteria 5867
374 Ga0157371_10030480 3300013102 Bacteria 3892
375 Ga0157370_10018060 3300013104 Bacteria 7099
376 Ga0157370_10036890 3300013104 Bacteria 4742
377 Ga0157370_10096746 3300013104 Bacteria 2769
378 Ga0157370_10099723 3300013104 Bacteria 2722
379 Ga0157370_10310718 3300013104 Bacteria 1455
380 Ga0157369_10005591 3300013105 Bacteria 14600
381 Ga0157369_10043505 3300013105 Bacteria 4895
382 Ga0157369_10457380 3300013105 Bacteria 1322
383 Ga0157369_10661123 3300013105 Bacteria 1077
384 Ga0157374_10061312 3300013296 Bacteria 3522
385 Ga0157378_10485051 3300013297 Bacteria 1232
386 Ga0163162_10055397 3300013306 Bacteria 3992
387 Ga0163162_10062679 3300013306 Bacteria 3759
388 Ga0163162_10081293 3300013306 Bacteria 3311
389 Ga0163162_10095526 3300013306 Bacteria 3059
390 Ga0157372_10001329 3300013307 Bacteria 26726
391 Ga0157372_10004023 3300013307 Bacteria 15768
392 Ga0157372_10019917 3300013307 Bacteria 7232
393 Ga0157372_10046686 3300013307 Bacteria 4808
394 Ga0157372_10095853 3300013307 Bacteria 3381
395 Ga0157372_10463599 3300013307 Bacteria 1477
396 Ga0157375_10000001 3300013308 Bacteria 696576
397 Ga0157375_10005472 3300013308 Bacteria 11043
398 Ga0157375_10015648 3300013308 Bacteria 6795
399 Ga0157375_10047205 3300013308 Bacteria 4204
400 Ga0157375_10124879 3300013308 Bacteria 2687
401 Ga0157375_10264323 3300013308 Bacteria 1882
402 Ga0157375_10332404 3300013308 Bacteria 1684
403 Ga0163163_10070660 3300014325 Bacteria 3477
404 Ga0163163_10250536 3300014325 Bacteria 1821
405 Ga0163163_10254406 3300014325 Bacteria 1807
406 Ga0163163_10740804 3300014325 Bacteria 1046
407 Ga0157380_10002658 3300014326 Bacteria 12115
408 Ga0157380_10052545 3300014326 Bacteria 3227
409 Ga0182008_10000023 3300014497 Bacteria 201526
410 Ga0182008_10118496 3300014497 Bacteria 1315
411 Ga0157377_10429198 3300014745 Bacteria 907
412 Ga0157379_10004846 3300014968 Bacteria 11553
413 Ga0157376_10195673 3300014969 Bacteria 1857
414 Ga0157376_10429912 3300014969 Bacteria 1283
415 Ga0157376_10899430 3300014969 Bacteria 903
416 Ga0182006_1003750 3300015261 Bacteria 7668
417 Ga0182006_1011496 3300015261 Bacteria 3893
418 Ga0163161_10027330 3300017792 Bacteria 4047
419 Ga0206351_10377797 3300020077 Bacteria 887
420 Ga0206354_10242601 3300020081 Bacteria 1341
421 Ga0206354_11168486 3300020081 Bacteria 5368
422 Ga0206353_10210928 3300020082 Bacteria 3561
423 Ga0214544_1000026 3300021320 Bacteria 161530
424 Ga0214542_1000025 3300021321 Bacteria 183588
425 Ga0214545_1000014 3300021324 Bacteria 183588
426 Ga0214543_1000034 3300021327 Bacteria 183712
427 Ga0213876_10021664 3300021384 Bacteria 3398
428 Ga0228598_1002128 3300024227 Bacteria 4335
429 Ga0209646_1000002 3300025246 Bacteria 1425781
430 Ga0209026_1000086 3300025250 Bacteria 185551
431 Ga0209026_1007300 3300025250 Bacteria 2519
432 Ga0209677_100874 3300025253 Bacteria 14845
433 Ga0209233_1000766 3300025261 Bacteria 14467
434 Ga0209233_1004428 3300025261 Bacteria 4778
435 Ga0209233_1027131 3300025261 Bacteria 1392
436 Ga0207666_1013043 3300025271 Bacteria 1164
437 Ga0209455_1003984 3300025272 Bacteria 5009
438 Ga0209455_1006055 3300025272 Bacteria 3635
439 Ga0209673_1045515 3300025273 Bacteria 1205
440 Ga0209675_1000692 3300025291 Bacteria 23450
441 Ga0209025_1000008 3300025294 Bacteria 1130876
442 Ga0209564_1000049 3300025295 Bacteria 362075
443 Ga0209564_1000065 3300025295 Bacteria 315205
444 Ga0209564_1000248 3300025295 Bacteria 116617
445 Ga0209758_1001510 3300025297 Bacteria 27007
446 Ga0209758_1004242 3300025297 Bacteria 12127
447 Ga0209758_1037278 3300025297 Bacteria 1881
448 Ga0209256_1000014 3300025299 Bacteria 687409
449 Ga0209256_1000200 3300025299 Bacteria 112931
450 Ga0207426_1001097 3300025302 Bacteria 24936
451 Ga0207426_1029203 3300025302 Bacteria 1821
452 Ga0207697_10042990 3300025315 Bacteria 1858
453 Ga0207697_10067325 3300025315 Bacteria 1497
454 Ga0207697_10078409 3300025315 Bacteria 1390
455 Ga0207656_10021724 3300025321 Bacteria 2567
456 Ga0207656_10162837 3300025321 Bacteria 1062
457 Ga0207653_10000605 3300025885 Bacteria 12539
458 Ga0207692_10000295 3300025898 Bacteria 17307
459 Ga0207692_10013187 3300025898 Bacteria 3578
460 Ga0207710_10048100 3300025900 Bacteria 1908
461 Ga0207710_10053962 3300025900 Bacteria 1809
462 Ga0207680_10104280 3300025903 Bacteria 1827
463 Ga0207647_10028419 3300025904 Bacteria 3632
464 Ga0207685_10115129 3300025905 Bacteria 1172
465 Ga0207699_10007555 3300025906 Bacteria 5320
466 Ga0207699_10023406 3300025906 Bacteria 3362
467 Ga0207699_10102766 3300025906 Bacteria 1817
468 Ga0207645_10080365 3300025907 Bacteria 2090
469 Ga0207645_10288376 3300025907 Bacteria 1091
470 Ga0207705_10002850 3300025909 Bacteria 13226
471 Ga0207705_10020137 3300025909 Bacteria 4772
472 Ga0207705_10020562 3300025909 Bacteria 4713
473 Ga0207705_10033577 3300025909 Bacteria 3666
474 Ga0207654_10011026 3300025911 Bacteria 4600
475 Ga0207654_10040629 3300025911 Bacteria 2622
476 Ga0207654_10085782 3300025911 Bacteria 1907
477 Ga0207654_10135041 3300025911 Bacteria 1566
478 Ga0207654_10377771 3300025911 Bacteria 981
479 Ga0207707_10000455 3300025912 Bacteria 42610
480 Ga0207707_10008592 3300025912 Bacteria 8854
481 Ga0207707_10039737 3300025912 Bacteria 4112
482 Ga0207707_10160761 3300025912 Bacteria 1964
483 Ga0207707_10220712 3300025912 Bacteria 1650
484 Ga0207707_10265207 3300025912 Bacteria 1489
485 Ga0207695_10000013 3300025913 Bacteria 821265
486 Ga0207695_10000014 3300025913 Bacteria 812599
487 Ga0207695_10001701 3300025913 Bacteria 35229
488 Ga0207695_10126008 3300025913 Bacteria 2523
489 Ga0207671_10000663 3300025914 Bacteria 44922
490 Ga0207671_10045318 3300025914 Bacteria 3252
491 Ga0207671_10046369 3300025914 Bacteria 3215
492 Ga0207671_10055028 3300025914 Bacteria 2948
493 Ga0207693_10000674 3300025915 Bacteria 30670
494 Ga0207693_10001851 3300025915 Bacteria 18534
495 Ga0207693_10067664 3300025915 Bacteria 2797
496 Ga0207693_10071644 3300025915 Bacteria 2713
497 Ga0207663_10001588 3300025916 Bacteria 10673
498 Ga0207663_10180901 3300025916 Bacteria 1506
499 Ga0207663_10213684 3300025916 Bacteria 1399
500 Ga0207660_10049603 3300025917 Bacteria 2977
501 Ga0207660_10106305 3300025917 Bacteria 2104
502 Ga0207660_10108200 3300025917 Bacteria 2087
503 Ga0207660_10402205 3300025917 Bacteria 1103
504 Ga0207657_10001360 3300025919 Bacteria 26055
505 Ga0207657_10010706 3300025919 Bacteria 9132
506 Ga0207657_10022581 3300025919 Bacteria 5883
507 Ga0207657_10025657 3300025919 Bacteria 5430
508 Ga0207657_10103629 3300025919 Bacteria 2358
509 Ga0207657_10141242 3300025919 Bacteria 1967
510 Ga0207657_10268549 3300025919 Bacteria 1356
511 Ga0207649_10258166 3300025920 Bacteria 1258
512 Ga0207652_10001894 3300025921 Bacteria 18100
513 Ga0207652_10011235 3300025921 Bacteria 7213
514 Ga0207652_10014967 3300025921 Bacteria 6292
515 Ga0207652_10049693 3300025921 Bacteria 3591
516 Ga0207652_10312129 3300025921 Bacteria 1419
517 Ga0207652_10499422 3300025921 Bacteria 1095
518 Ga0207646_10097938 3300025922 Bacteria 2628
519 Ga0207694_10010880 3300025924 Bacteria 6869
520 Ga0207650_10026446 3300025925 Bacteria 4139
521 Ga0207650_10049296 3300025925 Bacteria 3109
522 Ga0207650_10152134 3300025925 Bacteria 1827
523 Ga0207650_10381831 3300025925 Bacteria 1163
524 Ga0207659_10021567 3300025926 Bacteria 4278
525 Ga0207659_10118249 3300025926 Bacteria 2027
526 Ga0207659_10129623 3300025926 Bacteria 1945
527 Ga0207659_10137642 3300025926 Bacteria 1892
528 Ga0207687_10000003 3300025927 Bacteria 875159
529 Ga0207687_10003248 3300025927 Bacteria 11011
530 Ga0207687_10022444 3300025927 Bacteria 4201
531 Ga0207687_10052440 3300025927 Bacteria 2847
532 Ga0207687_10141134 3300025927 Bacteria 1828
533 Ga0207687_10199626 3300025927 Bacteria 1562
534 Ga0207687_10233614 3300025927 Bacteria 1454
535 Ga0207700_10007259 3300025928 Bacteria 6760
536 Ga0207700_10074150 3300025928 Bacteria 2631
537 Ga0207700_10101643 3300025928 Bacteria 2294
538 Ga0207664_10037043 3300025929 Bacteria 3772
539 Ga0207664_10055294 3300025929 Bacteria 3149
540 Ga0207664_10211874 3300025929 Bacteria 1677
541 Ga0207664_10229713 3300025929 Bacteria 1612
542 Ga0207644_10010758 3300025931 Bacteria 6035
543 Ga0207690_10088745 3300025932 Bacteria 2179
544 Ga0207690_10458793 3300025932 Bacteria 1025
545 Ga0207706_10036474 3300025933 Bacteria 4367
546 Ga0207706_10069282 3300025933 Bacteria 3103
547 Ga0207706_10510997 3300025933 Bacteria 1036
548 Ga0207686_10156952 3300025934 Bacteria 1591
549 Ga0207709_10164127 3300025935 Bacteria 1552
550 Ga0207670_10001802 3300025936 Bacteria 11198
551 Ga0207670_10001926 3300025936 Bacteria 10864
552 Ga0207669_10018303 3300025937 Bacteria 3618
553 Ga0207669_10229945 3300025937 Bacteria 1367
554 Ga0207704_10029068 3300025938 Bacteria 3076
555 Ga0207704_10030086 3300025938 Bacteria 3040
556 Ga0207704_10179751 3300025938 Bacteria 1527
557 Ga0207704_10468658 3300025938 Bacteria 1009
558 Ga0207704_10515052 3300025938 Bacteria 966
559 Ga0207665_10000214 3300025939 Bacteria 39213
560 Ga0207665_10033322 3300025939 Bacteria 3413
561 Ga0207665_10033533 3300025939 Bacteria 3404
562 Ga0207691_10003072 3300025940 Bacteria 16287
563 Ga0207691_10065199 3300025940 Bacteria 3298
564 Ga0207711_10040565 3300025941 Bacteria 3961
565 Ga0207711_10301715 3300025941 Bacteria 1477
566 Ga0207689_10022903 3300025942 Bacteria 5247
567 Ga0207689_10278977 3300025942 Bacteria 1384
568 Ga0207661_10016302 3300025944 Bacteria 5482
569 Ga0207661_10079882 3300025944 Bacteria 2697
570 Ga0207661_10156701 3300025944 Bacteria 1973
571 Ga0207661_10176576 3300025944 Bacteria 1863
572 Ga0207661_10224409 3300025944 Bacteria 1661
573 Ga0207661_10294037 3300025944 Bacteria 1454
574 Ga0207679_10284023 3300025945 Bacteria 1420
575 Ga0207679_10301114 3300025945 Bacteria 1382
576 Ga0207667_10003451 3300025949 Bacteria 19512
577 Ga0207667_10023687 3300025949 Bacteria 6758
578 Ga0207667_10026202 3300025949 Bacteria 6373
579 Ga0207667_10049551 3300025949 Bacteria 4435
580 Ga0207667_10131918 3300025949 Bacteria 2573
581 Ga0207667_10133252 3300025949 Bacteria 2560
582 Ga0207667_10318830 3300025949 Bacteria 1587
583 Ga0207667_10593511 3300025949 Bacteria 1117
584 Ga0207667_10692218 3300025949 Bacteria 1022
585 Ga0207651_10001255 3300025960 Bacteria 11421
586 Ga0207651_10022078 3300025960 Bacteria 3883
587 Ga0207651_10071638 3300025960 Bacteria 2458
588 Ga0207651_10113782 3300025960 Bacteria 2037
589 Ga0207651_10288804 3300025960 Bacteria 1359
590 Ga0207712_10004027 3300025961 Bacteria 9282
591 Ga0207712_10100054 3300025961 Bacteria 2154
592 Ga0207712_10234213 3300025961 Bacteria 1476
593 Ga0207668_10008276 3300025972 Bacteria 6197
594 Ga0207668_10044071 3300025972 Bacteria 3032
595 Ga0207668_10047201 3300025972 Bacteria 2947
596 Ga0207668_10330858 3300025972 Bacteria 1267
597 Ga0207640_10000958 3300025981 Bacteria 16038
598 Ga0207658_10086543 3300025986 Bacteria 2417
599 Ga0207658_10141078 3300025986 Bacteria 1950
600 Ga0207677_10000035 3300026023 Bacteria 117469
601 Ga0207677_10058641 3300026023 Bacteria 2652
602 Ga0207703_10000046 3300026035 Bacteria 154474
603 Ga0207703_10191991 3300026035 Bacteria 1809
604 Ga0207639_10010790 3300026041 Bacteria 6333
605 Ga0207639_10016673 3300026041 Bacteria 5203
606 Ga0207639_10457561 3300026041 Bacteria 1159
607 Ga0207678_10015383 3300026067 Bacteria 6728
608 Ga0207678_10029610 3300026067 Bacteria 4780
609 Ga0207678_10035630 3300026067 Bacteria 4332
610 Ga0207678_10051481 3300026067 Bacteria 3555
611 Ga0207678_10154120 3300026067 Bacteria 1962
612 Ga0207708_10000034 3300026075 Bacteria 144931
613 Ga0207708_10002177 3300026075 Bacteria 14456
614 Ga0207708_10019003 3300026075 Bacteria 5175
615 Ga0207708_10089051 3300026075 Bacteria 2378
616 Ga0207702_10000041 3300026078 Bacteria 150754
617 Ga0207702_10041037 3300026078 Bacteria 3879
618 Ga0207702_10173471 3300026078 Bacteria 1979
619 Ga0207641_10093622 3300026088 Bacteria 2634
620 Ga0207641_10100166 3300026088 Bacteria 2551
621 Ga0207648_10129348 3300026089 Bacteria 2222
622 Ga0207648_10217306 3300026089 Bacteria 1698
623 Ga0207648_10311891 3300026089 Bacteria 1412
624 Ga0207676_10000013 3300026095 Bacteria 343067
625 Ga0207676_10165996 3300026095 Bacteria 1918
626 Ga0207676_10277754 3300026095 Bacteria 1519
627 Ga0207674_10004439 3300026116 Bacteria 16862
628 Ga0207674_10006751 3300026116 Bacteria 13473
629 Ga0207674_10008394 3300026116 Bacteria 11940
630 Ga0207674_10024824 3300026116 Bacteria 6398
631 Ga0207674_10043139 3300026116 Bacteria 4652
632 Ga0207674_10054103 3300026116 Bacteria 4088
633 Ga0207674_10603900 3300026116 Bacteria 1060
634 Ga0207675_100000058 3300026118 Bacteria 81487
635 Ga0207675_100015761 3300026118 Bacteria 7048
636 Ga0207675_100098698 3300026118 Bacteria 2751
637 Ga0207675_100099716 3300026118 Bacteria 2736
638 Ga0207675_100112893 3300026118 Bacteria 2565
639 Ga0207675_100224130 3300026118 Bacteria 1812
640 Ga0207683_10037653 3300026121 Bacteria 4213
641 Ga0207683_10038663 3300026121 Bacteria 4161
642 Ga0207683_10060645 3300026121 Bacteria 3326
643 Ga0207683_10067429 3300026121 Bacteria 3157
644 Ga0207698_10000882 3300026142 Bacteria 17381
645 Ga0207698_10016150 3300026142 Bacteria 5023
646 Ga0207698_10024459 3300026142 Bacteria 4239
647 Ga0207698_10035640 3300026142 Bacteria 3643
648 Ga0207698_10097212 3300026142 Bacteria 2429
649 Ga0207698_10106270 3300026142 Bacteria 2341
650 Ga0207698_10355920 3300026142 Bacteria 1384
651 Ga0209389_1000023 3300027296 Bacteria 150730
652 Ga0209589_1000010 3300027357 Bacteria 237657
653 Ga0209489_100011 3300027361 Bacteria 244710
654 Ga0209588_1017474 3300027671 Bacteria 2224
655 Ga0209813_10006099 3300027866 Bacteria 2962
656 Ga0207428_10000061 3300027907 Bacteria 155152
657 Ga0207428_10003490 3300027907 Bacteria 15246
658 Ga0207428_10060402 3300027907 Bacteria 3004
659 Ga0207428_10064444 3300027907 Bacteria 2893
660 Ga0268266_10013121 3300028379 Bacteria 7144
661 Ga0268266_10016287 3300028379 Bacteria 6355
662 Ga0268266_10054094 3300028379 Bacteria 3450
663 Ga0268266_10385033 3300028379 Bacteria 1323
664 Ga0268266_10619450 3300028379 Bacteria 1040
665 Ga0268265_10000170 3300028380 Bacteria 78404
666 Ga0268265_10002176 3300028380 Bacteria 15162
667 Ga0268264_10000093 3300028381 Bacteria 232057
668 Ga0268264_10014852 3300028381 Bacteria 6396
669 Ga0268264_10112031 3300028381 Bacteria 2392
670 Ga0268264_10295862 3300028381 Bacteria 1522
671 Ga0268264_10787041 3300028381 Bacteria 949
672 Ga0265319_1095150 3300028563 Bacteria 938
673 Ga0265334_10027999 3300028573 Bacteria 2267
674 Ga0265323_10003068 3300028653 Bacteria 7438
675 Ga0265336_10000859 3300028666 Bacteria 15784
676 Ga0265336_10003744 3300028666 Bacteria 5884
677 Ga0265336_10022562 3300028666 Bacteria 2003
678 Ga0307517_10000085 3300028786 Bacteria 131200
679 Ga0307517_10070050 3300028786 Bacteria 3166
680 Ga0307517_10082837 3300028786 Bacteria 2719
681 Ga0307517_10212282 3300028786 Bacteria 1190
682 Ga0307515_10011214 3300028794 Bacteria 17023
683 Ga0307515_10043225 3300028794 Bacteria 7014
684 Ga0307515_10104231 3300028794 Bacteria 3390
685 Ga0307515_10116112 3300028794 Bacteria 3076
686 Ga0265338_10000013 3300028800 Bacteria 379065
687 Ga0265338_10011715 3300028800 Bacteria 10095
688 Ga0265338_10020201 3300028800 Bacteria 7018
689 Ga0265324_10000030 3300029957 Bacteria 126471
690 Ga0265324_10012333 3300029957 Bacteria 3225
691 Ga0265324_10118916 3300029957 Bacteria 897
692 Ga0307511_10141145 3300030521 Bacteria 1415
693 Ga0307512_10011391 3300030522 Bacteria 8429
694 Ga0307512_10030839 3300030522 Bacteria 4655
695 Ga0265330_10006124 3300031235 Bacteria 5957
696 Ga0265328_10000120 3300031239 Bacteria 37260
697 Ga0265328_10056618 3300031239 Bacteria 1439
698 Ga0265320_10001892 3300031240 Bacteria 14763
699 Ga0265325_10000289 3300031241 Bacteria 35297
700 Ga0265325_10004960 3300031241 Bacteria 8297
701 Ga0265325_10016721 3300031241 Bacteria 4094
702 Ga0265339_10001605 3300031249 Bacteria 16732
703 Ga0265339_10013486 3300031249 Bacteria 4950
704 Ga0265339_10019139 3300031249 Bacteria 4024
705 Ga0265339_10082151 3300031249 Bacteria 1701
706 Ga0265339_10197389 3300031249 Bacteria 994
707 Ga0265327_10038302 3300031251 Bacteria 2617
708 Ga0265327_10070456 3300031251 Bacteria 1752
709 Ga0265316_10142157 3300031344 Bacteria 1802
710 Ga0307513_10009510 3300031456 Bacteria 12293
711 Ga0307513_10028716 3300031456 Bacteria 6354
712 Ga0307509_10086802 3300031507 Bacteria 3216
713 Ga0307408_100000183 3300031548 Bacteria 69517
714 Ga0307408_100546737 3300031548 Bacteria 1021
715 Ga0307408_100557376 3300031548 Bacteria 1012
716 Ga0265313_10000644 3300031595 Bacteria 35985
717 Ga0265313_10002595 3300031595 Bacteria 15390
718 Ga0265313_10011673 3300031595 Bacteria 5442
719 Ga0307508_10025462 3300031616 Bacteria 5364
720 Ga0307508_10053920 3300031616 Bacteria 3566
721 Ga0307508_10056249 3300031616 Bacteria 3484
722 Ga0265314_10024736 3300031711 Bacteria 4546
723 Ga0265314_10034452 3300031711 Bacteria 3701
724 Ga0265314_10052431 3300031711 Bacteria 2836
725 Ga0265342_10005779 3300031712 Bacteria 9351
726 Ga0265342_10135373 3300031712 Bacteria 1377
727 Ga0316576_10052362 3300031727 Bacteria 2973
728 Ga0316576_10121529 3300031727 Bacteria 1961
729 Ga0316578_10006597 3300031728 Bacteria 5746
730 Ga0307516_10000683 3300031730 Bacteria 46007
731 Ga0307516_10025519 3300031730 Bacteria 6017
732 Ga0307516_10025796 3300031730 Bacteria 5978
733 Ga0307516_10033423 3300031730 Bacteria 5174
734 Ga0307516_10119591 3300031730 Bacteria 2427
735 Ga0307516_10226214 3300031730 Bacteria 1577
736 Ga0307516_10357482 3300031730 Bacteria 1125
737 Ga0307405_10322622 3300031731 Bacteria 1180
738 Ga0316577_10012248 3300031733 Bacteria 4671
739 Ga0307410_10124823 3300031852 Bacteria 1883
740 Ga0307406_10586094 3300031901 Bacteria 917
741 Ga0307406_10605590 3300031901 Bacteria 904
742 Ga0307407_10063330 3300031903 Bacteria 2169
743 Ga0307412_10000004 3300031911 Bacteria 544053
744 Ga0307412_10043611 3300031911 Bacteria 2922
745 Ga0307412_10128262 3300031911 Bacteria 1838
746 Ga0307409_100034390 3300031995 Bacteria 3700
747 Ga0307409_100226263 3300031995 Bacteria 1692
748 Ga0307409_100381920 3300031995 Bacteria 1339
749 Ga0307409_100877577 3300031995 Bacteria 909
750 Ga0307416_100104122 3300032002 Bacteria 2480
751 Ga0307416_100379893 3300032002 Bacteria 1442
752 Ga0307414_10000028 3300032004 Bacteria 192108
753 Ga0307414_10000313 3300032004 Bacteria 28201
754 Ga0307414_10048793 3300032004 Bacteria 2923
755 Ga0307414_10213170 3300032004 Bacteria 1580
756 Ga0307411_10020733 3300032005 Bacteria 3831
757 Ga0307411_10075747 3300032005 Bacteria 2298
758 Ga0307415_100012029 3300032126 Bacteria 4986
759 Ga0307415_100326991 3300032126 Bacteria 1281
760 Ga0316583_10023870 3300032133 Bacteria 2183
761 Ga0307507_10077207 3300033179 Bacteria 2964
762 Ga0307510_10009700 3300033180 Bacteria 11458
763 Ga0307510_10038953 3300033180 Bacteria 5246
764 Ga0307510_10147399 3300033180 Bacteria 1982
765 Ga0373928_0023913 3300035084 Bacteria 1306
766 Ga0373929_0016201 3300035085 Bacteria 1458
767 Ga0373934_0092763 3300035086 Bacteria 1218
768 Ga0373949_0057431 3300035090 Bacteria 994
769 Ga0373952_0004006 3300035092 Bacteria 2662
770 Ga0373936_0119026 3300035113 Bacteria 1126
771 Ga0373939_0042943 3300035114 Bacteria 1369
772 Ga0373945_0023726 3300035116 Bacteria 2121
773 Ga0373953_0015389 3300035117 Bacteria 2771
774 Ga0373954_0046188 3300035118 Bacteria 2035
775 Ga0373956_0166097 3300035119 Bacteria 1041
776 Ga0373943_0026562 3300035170 Bacteria 2713
777 Ga0373946_0014317 3300035171 Bacteria 2990
778 Ga0373946_0092576 3300035171 Bacteria 1342
779 Ga0373955_0011011 3300035172 Bacteria 4294
780 Ga0373955_0067511 3300035172 Bacteria 1991
781 Ga0373955_0363132 3300035172 Bacteria 878
782 Ga0373942_0027692 3300035207 Bacteria 1476
783 Ga0373961_0004146 3300035241 Bacteria 3523
784 Ga0373961_0038190 3300035241 Bacteria 1375
785 Ga0373961_0042104 3300035241 Bacteria 1322
786 Ga0373962_0007004 3300035242 Bacteria 2749
787 Ga0316574_0008438 3300035398 Bacteria 5721
788 Ga0316574_0074147 3300035398 Bacteria 2153
789 Ga0316574_0240295 3300035398 Bacteria 1158
790 Ga0373924_0033016 3300035410 Bacteria 2087
791 Ga0373924_0041591 3300035410 Bacteria 1883
792 Ga0373931_0000311 3300035691 Bacteria 20588
793 Ga0373931_0001895 3300035691 Bacteria 9143
794 Ga0373931_0002367 3300035691 Bacteria 8338
795 Ga0373931_0015481 3300035691 Bacteria 3741
796 Ga0373931_0075912 3300035691 Bacteria 1845
797 Ga0373931_0186725 3300035691 Bacteria 1231
798 Ga0373935_0003068 3300035692 Bacteria 9628
799 Ga0373935_0080381 3300035692 Bacteria 2118
800 Ga0373935_0211476 3300035692 Bacteria 1344
801 Ga0373935_0270836 3300035692 Bacteria 1193
802 Ga0373927_0004108 3300035695 Bacteria 10256
803 Ga0373927_0005360 3300035695 Bacteria 8859
804 Ga0373927_0052572 3300035695 Bacteria 2635
805 Ga0373933_0000933 3300035724 Bacteria 17845
806 Ga0373933_0061032 3300035724 Bacteria 2274
807 Ga0373947_0006080 3300035725 Bacteria 7033
808 Ga0373947_0008409 3300035725 Bacteria 5947
809 Ga0373937_0045613 3300036401 Bacteria 4006
810 Ga0373937_0088430 3300036401 Bacteria 2868
811 Ga0373937_0121480 3300036401 Bacteria 2434
812 Ga0373937_0168020 3300036401 Bacteria 2057
813 Ga0316582_0026741 3300036647 Bacteria 3476
814 Ga0316584_0011555 3300036712 Bacteria 6208
815 Ga0316584_0091839 3300036712 Bacteria 2273
816 Ga0373925_0028943 3300037068 Bacteria 4061
817 Ga0373925_0068998 3300037068 Bacteria 2670
818 Ga0373925_0284042 3300037068 Bacteria 1333
819 Ga0373925_0501794 3300037068 Bacteria 996
820 Ga0373925_0549490 3300037068 Bacteria 950
821 Ga0395899_0005004 3300037312 Bacteria 10314
822 Ga0395900_0000126 3300037418 Bacteria 127586
823 Ga0395900_0186497 3300037418 Bacteria 2105
824 Ga0395900_0255536 3300037418 Bacteria 1752
825 Ga0395900_0367860 3300037418 Bacteria 1408
826 Ga0395898_0031059 3300037466 Bacteria 5343
827 Ga0395898_0193692 3300037466 Bacteria 1942
828 Ga0395905_0001098 3300037471 Bacteria 34054
829 Ga0395905_0100628 3300037471 Bacteria 2714
830 Ga0395901_0000249 3300038443 Bacteria 66993
831 Ga0395901_0046475 3300038443 Bacteria 4509
832 Ga0395901_0068530 3300038443 Bacteria 3696
833 Ga0395901_0227851 3300038443 Bacteria 1946
834 Ga0395901_0322404 3300038443 Bacteria 1598
835 Ga0395901_0460761 3300038443 Bacteria 1299
836 Ga0436365_0021051 3300039437 Bacteria 1184
837 Ga0436365_0523062 3300039437 Bacteria 9388
838 Ga0436365_1782545 3300039437 Bacteria 4773
839 Ga0436361_0728889 3300039447 Bacteria 3011
840 Ga0436363_0751650 3300039450 Bacteria 972
841 Ga0436362_0128160 3300039453 Bacteria 8388
842 Ga0439466_0069963 3300041411 Bacteria 1119
843 Ga0439465_0088166 3300041413 Bacteria 1059
844 Ga0451853_2754853 3300041512 Bacteria 3184
845 Ga0439433_0009247 3300041999 Bacteria 2145
846 Ga0439454_004785 3300042011 Bacteria 1582
847 Ga0439446_0107479 3300042156 Bacteria 887
848 Ga0451577_0000339 3300042876 Bacteria 87540
849 Ga0451577_0002271 3300042876 Bacteria 23248
850 Ga0466972_0000185 3300044658 Bacteria 48335
851 Ga0466972_0134507 3300044658 Bacteria 1164
852 Ga0466982_0000003 3300044672 Bacteria 417243
853 Ga0453683_0006567 3300044673 Bacteria 7969
854 Ga0453683_0352300 3300044673 Bacteria 946
855 Ga0466966_0003932 3300044684 Bacteria 9811
856 Ga0466966_0072786 3300044684 Bacteria 2151
857 Ga0466964_0001690 3300044706 Bacteria 7619
858 Ga0453684_0000063 3300044712 Bacteria 486079
859 Ga0453684_0000065 3300044712 Bacteria 468481
860 Ga0453684_0000369 3300044712 Bacteria 184784
861 Ga0453684_0000677 3300044712 Bacteria 122140
862 Ga0453684_0000846 3300044712 Bacteria 103225
863 Ga0453684_0001472 3300044712 Bacteria 66447
864 Ga0453684_0008351 3300044712 Bacteria 18604
865 Ga0453684_0056656 3300044712 Bacteria 5081
866 Ga0453684_0211122 3300044712 Bacteria 2256
867 Ga0453684_0230091 3300044712 Bacteria 2140
868 Ga0453684_0300239 3300044712 Bacteria 1825
869 Ga0466971_0012312 3300044719 Bacteria 3747
870 Ga0466968_0001743 3300044735 Bacteria 7850
871 Ga0466970_0014536 3300044765 Bacteria 4043
872 Ga0451576_0000175 3300045051 Bacteria 161976
873 Ga0451576_0002720 3300045051 Bacteria 25673
874 Ga0451576_0005625 3300045051 Bacteria 15649
875 Ga0451576_0013554 3300045051 Bacteria 9117
876 Ga0451576_0108803 3300045051 Bacteria 2884
877 Ga0451576_0766263 3300045051 Bacteria 1013
878 Ga0466967_0781313 3300045976 Bacteria 948
879 Ga0495592_0006658 3300046454 Bacteria 8614
880 Ga0495603_0000064 3300046455 Bacteria 46716
881 Ga0495603_0023901 3300046455 Bacteria 3697
882 Ga0495603_0029475 3300046455 Bacteria 3308
883 Ga0495629_0001385 3300046459 Bacteria 19116
884 Ga0495629_0056265 3300046459 Bacteria 2751
885 Ga0495629_0095759 3300046459 Bacteria 2071
886 Ga0495629_0139921 3300046459 Bacteria 1684
887 Ga0495629_0381925 3300046459 Bacteria 958
888 Ga0495638_0007547 3300046460 Bacteria 7783
889 Ga0495638_0021678 3300046460 Bacteria 4228
890 Ga0495638_0086312 3300046460 Bacteria 1897
891 Ga0495641_0005307 3300046461 Bacteria 8752
892 Ga0495651_0056086 3300046462 Bacteria 3026
893 Ga0495653_0332515 3300046463 Bacteria 981
894 Ga0495650_0063228 3300046471 Bacteria 1477
895 Ga0495580_0006847 3300046472 Bacteria 9227
896 Ga0495580_0190002 3300046472 Bacteria 1417
897 Ga0495582_0000173 3300046473 Bacteria 35208
898 Ga0495582_0149179 3300046473 Bacteria 1327
899 Ga0495639_0000218 3300046475 Bacteria 29492
900 Ga0495639_0085081 3300046475 Bacteria 1478
901 Ga0495639_0189848 3300046475 Bacteria 1003
902 Ga0495639_0265184 3300046475 Bacteria 851
903 Ga0495664_0041556 3300046477 Bacteria 2721
904 Ga0495664_0045785 3300046477 Bacteria 2595
905 Ga0495664_0078800 3300046477 Bacteria 1974
906 Ga0495664_0134197 3300046477 Bacteria 1500
907 Ga0495584_0189261 3300046491 Bacteria 1046
908 Ga0495585_0105649 3300046492 Bacteria 1502
909 Ga0495594_0000590 3300046499 Bacteria 18674
910 Ga0495583_0138352 3300046506 Bacteria 1015
911 Ga0495606_0000976 3300046507 Bacteria 41812
912 Ga0495606_0040906 3300046507 Bacteria 3111
913 Ga0495606_0084562 3300046507 Bacteria 1965
914 Ga0495606_0189410 3300046507 Bacteria 1180
915 Ga0495616_0152310 3300046513 Bacteria 1045
916 Ga0495618_0380725 3300046514 Bacteria 866
917 Ga0495628_0020280 3300046516 Bacteria 5487
918 Ga0495628_0123368 3300046516 Bacteria 1985
919 Ga0495630_0000613 3300046517 Bacteria 25849
920 Ga0495630_0161775 3300046517 Bacteria 1704
921 Ga0495630_0210794 3300046517 Bacteria 1483
922 Ga0495631_0025561 3300046518 Bacteria 2718
923 Ga0495631_0102424 3300046518 Bacteria 1232
924 Ga0495632_0061385 3300046519 Bacteria 1824
925 Ga0495644_0083683 3300046523 Bacteria 1203
926 Ga0495648_0003170 3300046524 Bacteria 14641
927 Ga0495648_0006291 3300046524 Bacteria 9710
928 Ga0495648_0010776 3300046524 Bacteria 6942
929 Ga0495648_0060459 3300046524 Bacteria 2254
930 Ga0495666_0015057 3300046526 Bacteria 3849
931 Ga0495642_0086051 3300046528 Bacteria 1327
932 Ga0495652_0050312 3300046529 Bacteria 3563
933 Ga0495652_0106248 3300046529 Bacteria 2267
934 Ga0495652_0200960 3300046529 Bacteria 1512
935 Ga0495654_0068911 3300046530 Bacteria 1680
936 Ga0495665_0000531 3300046531 Bacteria 19287
937 Ga0495640_0001572 3300046533 Bacteria 17991
938 Ga0495640_0173760 3300046533 Bacteria 1376
939 Ga0495640_0266369 3300046533 Bacteria 1069
940 Ga0495587_0089108 3300046536 Bacteria 1783
941 Ga0495587_0236491 3300046536 Bacteria 1028
942 Ga0495598_0022585 3300046537 Bacteria 1685
943 Ga0495645_0017708 3300046543 Bacteria 5108
944 Ga0495645_0200435 3300046543 Bacteria 1354
945 Ga0495622_0004472 3300046557 Bacteria 6485
946 Ga0495622_0007156 3300046557 Bacteria 5185
947 Ga0495667_0011222 3300046559 Bacteria 6068
948 Ga0495667_0185640 3300046559 Bacteria 1333
949 Ga0495656_0005268 3300046615 Bacteria 4455
950 Ga0495668_0044002 3300046616 Bacteria 2481
951 Ga0495634_0005581 3300046642 Bacteria 9654
952 Ga0495611_0101743 3300046648 Bacteria 1335
953 Ga0495625_0026116 3300046660 Bacteria 4416
954 Ga0495625_0245479 3300046660 Bacteria 1164
955 Ga0495625_0292825 3300046660 Bacteria 1044
956 Ga0495635_0125225 3300046663 Bacteria 1752
957 Ga0495659_0006815 3300046664 Bacteria 3610
958 Ga0495661_0071445 3300046665 Bacteria 2028
959 Ga0495588_0022423 3300046674 Bacteria 3121
960 Ga0495588_0025243 3300046674 Bacteria 2959
961 Ga0495588_0043652 3300046674 Bacteria 2295
962 Ga0495657_0067110 3300046675 Bacteria 2355
963 Ga0495599_0091836 3300046678 Bacteria 1894
964 Ga0495623_0005573 3300046679 Bacteria 8220
965 Ga0495623_0015377 3300046679 Bacteria 4945
966 Ga0495623_0039786 3300046679 Bacteria 3003
967 Ga0495623_0127850 3300046679 Bacteria 1524
968 Ga0495646_0007737 3300046680 Bacteria 6829
969 Ga0495646_0018063 3300046680 Bacteria 4466
970 Ga0495646_0177824 3300046680 Bacteria 1169
971 Ga0495647_0001441 3300046681 Bacteria 7369
972 Ga0495647_0189555 3300046681 Bacteria 898
973 Ga0495658_0001201 3300046683 Bacteria 13610
974 Ga0495658_0121574 3300046683 Bacteria 1580
975 Ga0495658_0173644 3300046683 Bacteria 1335
976 Ga0495658_0194425 3300046683 Bacteria 1262
977 Ga0495669_0000675 3300046684 Bacteria 14839
978 Ga0495613_0004213 3300046689 Bacteria 10767
979 Ga0495613_0022119 3300046689 Bacteria 4738
980 Ga0495624_0005853 3300046690 Bacteria 8795
981 Ga0495624_0156857 3300046690 Bacteria 1391
982 Ga0495670_0012092 3300046691 Bacteria 4246
983 Ga0495649_0192146 3300046694 Bacteria 1062
984 Ga0495600_0134287 3300046809 Bacteria 1607
985 Ga0495581_0000015 3300047315 Bacteria 59214
986 Ga0495604_0007695 3300047317 Bacteria 8534
987 Ga0495604_0184641 3300047317 Bacteria 1457
988 Ga0495674_0023636 3300047319 Bacteria 5661
989 Ga0495674_0188042 3300047319 Bacteria 1717
990 Ga0495674_0260327 3300047319 Bacteria 1425
991 Ga0495672_0029388 3300047320 Bacteria 3461
992 Ga0495672_0030049 3300047320 Bacteria 3414
993 Ga0495672_0078929 3300047320 Bacteria 1840
994 Ga0495676_0010028 3300047321 Bacteria 8605
995 Ga0495676_0068201 3300047321 Bacteria 2749
996 Ga0495680_0028809 3300047322 Bacteria 4551
997 Ga0495680_0286456 3300047322 Bacteria 1160
998 Ga0495687_000014 3300047443 Bacteria 366896
999 Ga0495675_0184391 3300047444 Bacteria 1276
1000 Ga0495677_0050316 3300047445 Bacteria 1533
1001 Ga0495677_0062158 3300047445 Bacteria 1386
1002 Ga0495673_0011722 3300047469 Bacteria 4694
1003 Ga0495673_0122979 3300047469 Bacteria 1026
1004 Ga0495684_0020248 3300047471 Bacteria 5125
1005 Ga0495684_0107992 3300047471 Bacteria 2102
1006 Ga0495684_0142254 3300047471 Bacteria 1798
1007 Ga0495686_0118536 3300047472 Bacteria 1580
1008 Ga0495593_0000053 3300047673 Bacteria 47697
1009 Ga0495602_0028411 3300048088 Bacteria 5352
1010 Ga0495602_0233166 3300048088 Bacteria 1381
1011 Ga0495602_0517644 3300048088 Bacteria 831
1012 Ga0495614_0013513 3300048089 Bacteria 3580
1013 Ga0496100_0001613 3300048903 Bacteria 11146
1014 Ga0496100_0022737 3300048903 Bacteria 3798
1015 Ga0496100_0103566 3300048903 Bacteria 1965
1016 Ga0496100_0157079 3300048903 Bacteria 1627
1017 Ga0496100_0163165 3300048903 Bacteria 1599
1018 Ga0496101_0004421 3300048904 Bacteria 8844
1019 Ga0496101_0009601 3300048904 Bacteria 6365
1020 Ga0496101_0016002 3300048904 Bacteria 5062
1021 Ga0496101_0051545 3300048904 Bacteria 2966
1022 Ga0496101_0194944 3300048904 Bacteria 1564
1023 Ga0496101_0323504 3300048904 Bacteria 1210
1024 Ga0496102_0002733 3300048905 Bacteria 15037
1025 Ga0496102_0004127 3300048905 Bacteria 12315
1026 Ga0496102_0010509 3300048905 Bacteria 7970
1027 Ga0496102_0012054 3300048905 Bacteria 7470
1028 Ga0496102_0039048 3300048905 Bacteria 4287
1029 Ga0496102_0075894 3300048905 Bacteria 3090
1030 Ga0496102_0374801 3300048905 Bacteria 1339
1031 Ga0496102_0466179 3300048905 Bacteria 1184
1032 Ga0496103_0018374 3300048906 Bacteria 4193
1033 Ga0496103_0024344 3300048906 Bacteria 3654
1034 Ga0496103_0028159 3300048906 Bacteria 3408
1035 Ga0496103_0060299 3300048906 Bacteria 2358
1036 Ga0496104_0005875 3300048907 Bacteria 10748
1037 Ga0496104_0107198 3300048907 Bacteria 2677
1038 Ga0496104_0156129 3300048907 Bacteria 2189
1039 Ga0496104_0241888 3300048907 Bacteria 1717
1040 Ga0496104_0544724 3300048907 Bacteria 1071
1041 Ga0496105_0004722 3300048908 Bacteria 10282
1042 Ga0496105_0011342 3300048908 Bacteria 7039
1043 Ga0496105_0031311 3300048908 Bacteria 4361
1044 Ga0496105_0058692 3300048908 Bacteria 3175
1045 Ga0496105_0502404 3300048908 Bacteria 952
1046 Ga0496106_0001015 3300048909 Bacteria 20580
1047 Ga0496106_0005543 3300048909 Bacteria 9342
1048 Ga0496106_0009070 3300048909 Bacteria 7350
1049 Ga0496106_0033461 3300048909 Bacteria 3835
1050 Ga0496106_0040286 3300048909 Bacteria 3498
1051 Ga0496106_0130287 3300048909 Bacteria 1972
1052 Ga0496107_0004695 3300048910 Bacteria 9281
1053 Ga0496107_0004750 3300048910 Bacteria 9230
1054 Ga0496107_0010483 3300048910 Bacteria 6442
1055 Ga0496107_0021151 3300048910 Bacteria 4598
1056 Ga0496107_0025412 3300048910 Bacteria 4193
1057 Ga0496107_0040274 3300048910 Bacteria 3353
1058 Ga0496107_0135756 3300048910 Bacteria 1817
1059 Ga0496108_0001846 3300048911 Bacteria 16935
1060 Ga0496108_0056123 3300048911 Bacteria 3308
1061 Ga0496108_0059130 3300048911 Bacteria 3223
1062 Ga0496108_0067242 3300048911 Bacteria 3022
1063 Ga0496108_0068040 3300048911 Bacteria 3004
1064 Ga0496108_0134300 3300048911 Bacteria 2128
1065 Ga0496108_0144379 3300048911 Bacteria 2051
1066 Ga0496108_0162530 3300048911 Bacteria 1930
1067 Ga0496108_0195638 3300048911 Bacteria 1753
1068 Ga0496109_0001905 3300048912 Bacteria 17328
1069 Ga0496109_0007688 3300048912 Bacteria 9135
1070 Ga0496109_0010512 3300048912 Bacteria 7909
1071 Ga0496109_0021929 3300048912 Bacteria 5654
1072 Ga0496109_0090748 3300048912 Bacteria 2826
1073 Ga0496109_0135180 3300048912 Bacteria 2303
1074 Ga0496109_0181768 3300048912 Bacteria 1975
1075 Ga0496110_0000747 3300048913 Bacteria 22458
1076 Ga0496110_0007695 3300048913 Bacteria 8620
1077 Ga0496110_0018621 3300048913 Bacteria 5824
1078 Ga0496110_0045963 3300048913 Bacteria 3818
1079 Ga0496110_0175184 3300048913 Bacteria 1947
1080 Ga0496110_0244693 3300048913 Bacteria 1632
1081 Ga0496111_0002943 3300048914 Bacteria 10415
1082 Ga0496111_0003597 3300048914 Bacteria 9607
1083 Ga0496111_0060507 3300048914 Bacteria 2745
1084 Ga0496111_0082770 3300048914 Bacteria 2344
1085 Ga0496111_0127639 3300048914 Bacteria 1881
1086 Ga0496111_0569807 3300048914 Bacteria 830
1087 Ga0496112_0000008 3300048915 Bacteria 310323
1088 Ga0496112_0002552 3300048915 Bacteria 14709
1089 Ga0496112_0025326 3300048915 Bacteria 5697
1090 Ga0496112_0025430 3300048915 Bacteria 5685
1091 Ga0496112_0070372 3300048915 Bacteria 3457
1092 Ga0496112_0080021 3300048915 Bacteria 3232
1093 Ga0496112_0109901 3300048915 Bacteria 2727
1094 Ga0496112_0128842 3300048915 Bacteria 2501
1095 Ga0496112_0181220 3300048915 Bacteria 2070
1096 Ga0496113_0005354 3300048916 Bacteria 7996
1097 Ga0496113_0006480 3300048916 Bacteria 7425
1098 Ga0496113_0066360 3300048916 Bacteria 2733
1099 Ga0496114_0004664 3300048917 Bacteria 10654
1100 Ga0496114_0008103 3300048917 Bacteria 8322
1101 Ga0496114_0046088 3300048917 Bacteria 3622
1102 Ga0496114_0116474 3300048917 Bacteria 2294
1103 Ga0496114_0197004 3300048917 Bacteria 1763
1104 Ga0496115_0005898 3300048918 Bacteria 8932
1105 Ga0496115_0018787 3300048918 Bacteria 5313
1106 Ga0496115_0049876 3300048918 Bacteria 3352
1107 Ga0496116_0014758 3300048919 Bacteria 6214
1108 Ga0496116_0024015 3300048919 Bacteria 4521
1109 Ga0496117_0034418 3300048920 Bacteria 3816
1110 Ga0496117_0134878 3300048920 Bacteria 1489
1111 Ga0496117_0149044 3300048920 Bacteria 1388
1112 Ga0496118_0006042 3300048921 Bacteria 13485
1113 Ga0496118_0012813 3300048921 Bacteria 8004
1114 Ga0496118_0022887 3300048921 Bacteria 5446
1115 Ga0496118_0059237 3300048921 Bacteria 2853
1116 Ga0496118_0062556 3300048921 Bacteria 2746
1117 Ga0496118_0134632 3300048921 Bacteria 1579
1118 Ga0496119_0033029 3300048922 Bacteria 3440
1119 Ga0496119_0108770 3300048922 Bacteria 1543
1120 Ga0496120_0040615 3300048923 Bacteria 2732
1121 Ga0496120_0052278 3300048923 Bacteria 2328
1122 Ga0496120_0074274 3300048923 Bacteria 1858
1123 Ga0496121_0000178 3300048924 Bacteria 141429
1124 Ga0496121_0000381 3300048924 Bacteria 90593
1125 Ga0496121_0000894 3300048924 Bacteria 53831
1126 Ga0496121_0019860 3300048924 Bacteria 6691
1127 Ga0496121_0035897 3300048924 Bacteria 4429
1128 Ga0496121_0038473 3300048924 Bacteria 4235
1129 Ga0496121_0100972 3300048924 Bacteria 2226
1130 Ga0496121_0117262 3300048924 Bacteria 2017
1131 Ga0496121_0393422 3300048924 Bacteria 910
1132 Ga0496122_0000772 3300048925 Bacteria 61688
1133 Ga0496122_0048671 3300048925 Bacteria 3255
1134 Ga0496122_0064902 3300048925 Bacteria 2652
1135 Ga0496122_0213233 3300048925 Bacteria 1116
1136 Ga0496123_0000613 3300048926 Bacteria 59887
1137 Ga0496124_0000599 3300048927 Bacteria 60657
1138 Ga0496125_0000203 3300048928 Bacteria 125569
1139 Ga0496125_0003472 3300048928 Bacteria 19083
1140 Ga0496125_0009067 3300048928 Bacteria 10297
1141 Ga0496125_0021155 3300048928 Bacteria 6078
1142 Ga0496125_0060231 3300048928 Bacteria 3053
1143 Ga0496125_0076632 3300048928 Bacteria 2581
1144 Ga0496125_0080380 3300048928 Bacteria 2495
1145 Ga0496125_0089567 3300048928 Bacteria 2314
1146 Ga0496125_0111111 3300048928 Bacteria 1984
1147 Ga0496126_0003737 3300048929 Bacteria 18962
1148 Ga0496126_0030746 3300048929 Bacteria 5083
1149 Ga0496126_0041962 3300048929 Bacteria 4230
1150 Ga0496126_0048684 3300048929 Bacteria 3872
1151 Ga0496126_0051129 3300048929 Bacteria 3763
1152 Ga0496126_0051770 3300048929 Bacteria 3736
1153 Ga0496126_0183448 3300048929 Bacteria 1776
1154 Ga0496126_0191388 3300048929 Bacteria 1732
1155 Ga0496126_0320870 3300048929 Bacteria 1273
1156 Ga0496126_0359553 3300048929 Bacteria 1189
1157 Ga0496126_0397270 3300048929 Bacteria 1119
1158 Ga0501031_0000294 3300049568 Bacteria 28430
1159 Ga0501031_0000497 3300049568 Bacteria 22970
1160 Ga0501031_0006681 3300049568 Bacteria 7524
1161 Ga0501031_0312876 3300049568 Bacteria 1017
1162 Ga0501032_0000076 3300049569 Bacteria 83609
1163 Ga0501032_0000269 3300049569 Bacteria 43721
1164 Ga0501032_0011920 3300049569 Bacteria 6226
1165 Ga0501032_0019279 3300049569 Bacteria 4772
1166 Ga0501032_0030743 3300049569 Bacteria 3685
1167 Ga0501032_0071308 3300049569 Bacteria 2315
1168 Ga0501032_0074823 3300049569 Bacteria 2256
1169 Ga0501032_0079297 3300049569 Bacteria 2186
1170 Ga0501032_0079410 3300049569 Bacteria 2184
1171 Ga0501032_0181351 3300049569 Bacteria 1378
1172 Ga0501032_0295516 3300049569 Bacteria 1047
1173 Ga0501033_0000093 3300049570 Bacteria 85243
1174 Ga0501033_0000399 3300049570 Bacteria 41761
1175 Ga0501033_0003630 3300049570 Bacteria 12586
1176 Ga0501033_0017232 3300049570 Bacteria 5459
1177 Ga0501033_0040575 3300049570 Bacteria 3474
1178 Ga0501034_0000039 3300049571 Bacteria 237357
1179 Ga0501034_0001247 3300049571 Bacteria 34598
1180 Ga0501034_0005187 3300049571 Bacteria 14295
1181 Ga0501034_0025868 3300049571 Bacteria 5977
1182 Ga0501034_0156474 3300049571 Bacteria 2252
1183 Ga0501034_0256405 3300049571 Bacteria 1693
1184 Ga0501034_0767866 3300049571 Bacteria 858
1185 Ga0501036_0000035 3300049572 Bacteria 88062
1186 Ga0501036_0000817 3300049572 Bacteria 23119
1187 Ga0501036_0006639 3300049572 Bacteria 9403
1188 Ga0501036_0017189 3300049572 Bacteria 6046
1189 Ga0501036_0044313 3300049572 Bacteria 3768
1190 Ga0501036_0046764 3300049572 Bacteria 3664
1191 Ga0501036_0060679 3300049572 Bacteria 3203
1192 Ga0501036_0085973 3300049572 Bacteria 2658
1193 Ga0501036_0616106 3300049572 Bacteria 900
1194 Ga0501037_0000026 3300049573 Bacteria 142936
1195 Ga0501037_0000279 3300049573 Bacteria 43594
1196 Ga0501037_0001130 3300049573 Bacteria 19761
1197 Ga0501037_0006086 3300049573 Bacteria 8818
1198 Ga0501037_0027335 3300049573 Bacteria 4215
1199 Ga0501037_0032508 3300049573 Bacteria 3852
1200 Ga0501037_0129863 3300049573 Bacteria 1807
1201 Ga0501037_0204702 3300049573 Bacteria 1393
1202 Ga0501037_0227389 3300049573 Bacteria 1310
1203 Ga0501037_0273383 3300049573 Bacteria 1178
1204 Ga0501038_0000037 3300049574 Bacteria 124444
1205 Ga0501038_0000069 3300049574 Bacteria 84666
1206 Ga0501038_0000727 3300049574 Bacteria 29411
1207 Ga0501038_0006733 3300049574 Bacteria 10616
1208 Ga0501038_0020364 3300049574 Bacteria 5964
1209 Ga0501038_0138174 3300049574 Bacteria 1995
1210 Ga0501038_0160890 3300049574 Bacteria 1824
1211 Ga0501038_0385146 3300049574 Bacteria 1087
1212 Ga0501038_0392038 3300049574 Bacteria 1075
1213 Ga0501039_0000146 3300049575 Bacteria 47895
1214 Ga0501039_0000263 3300049575 Bacteria 38312
1215 Ga0501039_0010044 3300049575 Bacteria 7218
1216 Ga0501039_0026624 3300049575 Bacteria 4443
1217 Ga0501039_0212020 3300049575 Bacteria 1523
1218 Ga0501040_0008550 3300049576 Bacteria 6644
1219 Ga0501040_0066461 3300049576 Bacteria 2484
1220 Ga0501041_0095772 3300049577 Bacteria 1834
1221 Ga0501041_0198082 3300049577 Bacteria 1259
1222 Ga0501042_0039183 3300049578 Bacteria 3366
1223 Ga0501042_0047957 3300049578 Bacteria 3045
1224 Ga0501042_0233669 3300049578 Bacteria 1326
1225 Ga0501043_0000115 3300049579 Bacteria 75659
1226 Ga0501043_0000257 3300049579 Bacteria 48196
1227 Ga0501043_0016842 3300049579 Bacteria 5728
1228 Ga0501043_0022318 3300049579 Bacteria 4966
1229 Ga0501043_0133135 3300049579 Bacteria 1948
1230 Ga0501043_0220240 3300049579 Bacteria 1468
1231 Ga0501046_0000210 3300049580 Bacteria 60801
1232 Ga0501046_0001438 3300049580 Bacteria 22913
1233 Ga0501046_0036917 3300049580 Bacteria 3929
1234 Ga0501046_0050155 3300049580 Bacteria 3298
1235 Ga0501046_0422356 3300049580 Bacteria 961
1236 Ga0501047_0000094 3300049581 Bacteria 109928
1237 Ga0501047_0000186 3300049581 Bacteria 75102
1238 Ga0501047_0000892 3300049581 Bacteria 30468
1239 Ga0501047_0010143 3300049581 Bacteria 8909
1240 Ga0501047_0014304 3300049581 Bacteria 7547
1241 Ga0501047_0032596 3300049581 Bacteria 5030
1242 Ga0501047_0043616 3300049581 Bacteria 4332
1243 Ga0501047_0137786 3300049581 Bacteria 2320
1244 Ga0501047_0286409 3300049581 Bacteria 1491
1245 Ga0501047_0357158 3300049581 Bacteria 1297
1246 Ga0501048_0000306 3300049582 Bacteria 33320
1247 Ga0501048_0000856 3300049582 Bacteria 22438
1248 Ga0501048_0002557 3300049582 Bacteria 13928
1249 Ga0501048_0009695 3300049582 Bacteria 7226
1250 Ga0501048_0132263 3300049582 Bacteria 1763
1251 Ga0501067_0000220 3300049583 Bacteria 31959
1252 Ga0501067_0010936 3300049583 Bacteria 5024
1253 Ga0501067_0013507 3300049583 Bacteria 4524
1254 Ga0501067_0073388 3300049583 Bacteria 1896
1255 Ga0501068_0003939 3300049584 Bacteria 8077
1256 Ga0501068_0004373 3300049584 Bacteria 7688
1257 Ga0501068_0019306 3300049584 Bacteria 3956
1258 Ga0501068_0020312 3300049584 Bacteria 3867
1259 Ga0501068_0043380 3300049584 Bacteria 2705
1260 Ga0501068_0089412 3300049584 Bacteria 1898
1261 Ga0501068_0169307 3300049584 Bacteria 1378
1262 Ga0501069_0004135 3300049585 Bacteria 7495
1263 Ga0501069_0006557 3300049585 Bacteria 6086
1264 Ga0501069_0009362 3300049585 Bacteria 5171
1265 Ga0501069_0021290 3300049585 Bacteria 3518
1266 Ga0501069_0060565 3300049585 Bacteria 2113
1267 Ga0501069_0068487 3300049585 Bacteria 1986
1268 Ga0501069_0072286 3300049585 Bacteria 1934
1269 Ga0501070_0000134 3300049586 Bacteria 66993
1270 Ga0501070_0013023 3300049586 Bacteria 7009
1271 Ga0501070_0013228 3300049586 Bacteria 6956
1272 Ga0501070_0024108 3300049586 Bacteria 5102
1273 Ga0501070_0040276 3300049586 Bacteria 3896
1274 Ga0501070_0047476 3300049586 Bacteria 3568
1275 Ga0501070_0051850 3300049586 Bacteria 3404
1276 Ga0501070_0081847 3300049586 Bacteria 2671
1277 Ga0501070_0090225 3300049586 Bacteria 2536
1278 Ga0501070_0210137 3300049586 Bacteria 1597
1279 Ga0501070_0543874 3300049586 Bacteria 930
1280 Ga0501071_0016014 3300049587 Bacteria 5151
1281 Ga0501071_0216956 3300049587 Bacteria 1439
1282 Ga0501071_0442318 3300049587 Bacteria 995
1283 Ga0501072_0001542 3300049588 Bacteria 17220
1284 Ga0501072_0018872 3300049588 Bacteria 5320
1285 Ga0501072_0055128 3300049588 Bacteria 3133
1286 Ga0501073_0000131 3300049589 Bacteria 48153
1287 Ga0501073_0005409 3300049589 Bacteria 9564
1288 Ga0501073_0010210 3300049589 Bacteria 6897
1289 Ga0501073_0015631 3300049589 Bacteria 5506
1290 Ga0501073_0023953 3300049589 Bacteria 4383
1291 Ga0501073_0024458 3300049589 Bacteria 4337
1292 Ga0501074_0000514 3300049590 Bacteria 23769
1293 Ga0501074_0006996 3300049590 Bacteria 8148
1294 Ga0501074_0013074 3300049590 Bacteria 6034
1295 Ga0501074_0016442 3300049590 Bacteria 5372
1296 Ga0501074_0033237 3300049590 Bacteria 3737
1297 Ga0501074_0148952 3300049590 Bacteria 1673
1298 Ga0501075_0341702 3300049591 Bacteria 1141
1299 Ga0501075_0400381 3300049591 Bacteria 1046
1300 Ga0501076_0010682 3300049592 Bacteria 6822
1301 Ga0501076_0098869 3300049592 Bacteria 2351
1302 Ga0501076_0129214 3300049592 Bacteria 2049
1303 Ga0501079_0003357 3300049741 Bacteria 11739
1304 Ga0501079_0003839 3300049741 Bacteria 11093
1305 Ga0501079_0051618 3300049741 Bacteria 3175
1306 Ga0501079_0066832 3300049741 Bacteria 2774
1307 Ga0501079_0097009 3300049741 Bacteria 2285
1308 Ga0501079_0298526 3300049741 Bacteria 1260
1309 Ga0501080_0000299 3300049742 Bacteria 37707
1310 Ga0501080_0000387 3300049742 Bacteria 33900
1311 Ga0501080_0001809 3300049742 Bacteria 18336
1312 Ga0501080_0023167 3300049742 Bacteria 5757
1313 Ga0501080_0102012 3300049742 Bacteria 2662
1314 Ga0501080_0162316 3300049742 Bacteria 2063
1315 Ga0501080_0163965 3300049742 Bacteria 2051
1316 Ga0501080_0196287 3300049742 Bacteria 1854
1317 Ga0501080_0292258 3300049742 Bacteria 1479
1318 Ga0501080_0329267 3300049742 Bacteria 1381
1319 Ga0501080_0372142 3300049742 Bacteria 1288
1320 Ga0501081_0001664 3300049743 Bacteria 13747
1321 Ga0501081_0155934 3300049743 Bacteria 1643
1322 Ga0501083_0000213 3300049744 Bacteria 37485
1323 Ga0501083_0000302 3300049744 Bacteria 31114
1324 Ga0501083_0013866 3300049744 Bacteria 5635
1325 Ga0501083_0211437 3300049744 Bacteria 1264
1326 Ga0501083_0274611 3300049744 Bacteria 1096
1327 Ga0501241_005327 3300049758 Bacteria 2402
1328 Ga0501035_0000523 3300049822 Bacteria 43259
1329 Ga0501035_0000533 3300049822 Bacteria 42510
1330 Ga0501035_0009857 3300049822 Bacteria 8871
1331 Ga0501035_0015394 3300049822 Bacteria 7056
1332 Ga0501035_0021633 3300049822 Bacteria 5914
1333 Ga0501035_0052530 3300049822 Bacteria 3646
1334 Ga0501035_0054995 3300049822 Bacteria 3554
1335 Ga0501035_0071552 3300049822 Bacteria 3070
1336 Ga0501035_0107675 3300049822 Bacteria 2444
1337 Ga0501035_0157956 3300049822 Bacteria 1964
1338 Ga0501035_0188241 3300049822 Bacteria 1775
1339 Ga0501035_0229760 3300049822 Bacteria 1581
1340 Ga0501044_0000435 3300049823 Bacteria 51516
1341 Ga0501044_0003448 3300049823 Bacteria 17811
1342 Ga0501044_0009354 3300049823 Bacteria 10685
1343 Ga0501044_0027340 3300049823 Bacteria 6029
1344 Ga0501044_0092087 3300049823 Bacteria 3057
1345 Ga0501044_0098202 3300049823 Bacteria 2948
1346 Ga0501044_0192816 3300049823 Bacteria 1999
1347 Ga0501044_0331463 3300049823 Bacteria 1444
1348 Ga0501044_0409435 3300049823 Bacteria 1267
1349 Ga0501045_0022522 3300049824 Bacteria 4512
1350 Ga0501045_0105366 3300049824 Bacteria 2089
1351 nmdc:mga03683_102651_c1 3300050489 Bacteria 1258
1352 nmdc:mga03683_1027_c1 3300050489 Bacteria 5061
1353 nmdc:mga03n38_221414_c1 3300050490 Bacteria 988
1354 nmdc:mga00v17_39463_c1 3300050491 Bacteria 2828
1355 nmdc:mga0yw44_17750_c1 3300050492 Bacteria 3881
1356 nmdc:mga0yw44_53571_c1 3300050492 Bacteria 2451
1357 nmdc:mga0k408_275726_c1 3300050493 Bacteria 1004
1358 nmdc:mga0k408_92347_c1 3300050493 Bacteria 1779
1359 nmdc:mga06z11_23054_c1 3300050494 Bacteria 2918
1360 nmdc:mga06z11_76330_c1 3300050494 Bacteria 1787
1361 nmdc:mga07m45_193093_c1 3300050496 Bacteria 1184
1362 nmdc:mga07m45_41448_c1 3300050496 Bacteria 2578
1363 nmdc:mga07m45_47017_c1 3300050496 Bacteria 2425
1364 nmdc:mga07m45_81159_c1 3300050496 Bacteria 1852
1365 nmdc:mga05p37_147491_c1 3300050507 Bacteria 2879
1366 nmdc:mga09592_33785_c1 3300050508 Bacteria 4272
1367 nmdc:mga0qj67_379021_c1 3300050509 Bacteria 1142
1368 nmdc:mga06r32_14990_c1 3300050510 Bacteria 7035
1369 nmdc:mga08y16_102788_c1 3300050511 Bacteria 2975
1370 nmdc:mga08y16_1281_c1 3300050511 Bacteria 24959
1371 nmdc:mga08y16_3917_c1 3300050511 Bacteria 15500
1372 nmdc:mga08y16_52748_c1 3300050511 Bacteria 4254
1373 nmdc:mga08y16_88203_c1 3300050511 Bacteria 3233
1374 nmdc:mga0n895_1946_c1 3300050512 Bacteria 15855
1375 nmdc:mga0n895_466290_c1 3300050512 Bacteria 1274
1376 nmdc:mga0n895_96815_c1 3300050512 Bacteria 2956
1377 nmdc:mga0rr50_392375_c1 3300050513 Bacteria 1172
1378 nmdc:mga0a205_145113_c1 3300050515 Bacteria 2273
1379 nmdc:mga0a205_35242_c1 3300050515 Bacteria 4805
1380 nmdc:mga0sz30_1683_c1 3300050516 Bacteria 7854
1381 nmdc:mga0sz30_2375_c1 3300050516 Bacteria 6399
1382 nmdc:mga0sz30_56454_c1 3300050516 Bacteria 1672
1383 Ga0495601_0041381 3300053077 Bacteria 2888
1384 Ga0495601_0316854 3300053077 Bacteria 1015
1385 Ga0495612_0087829 3300053078 Bacteria 1313
1386 Ga0500635_0002566 3300053080 Bacteria 4515
1387 Ga0495595_0013058 3300053084 Bacteria 3504
1388 Ga0495595_0020049 3300053084 Bacteria 2907
1389 Ga0495595_0133880 3300053084 Bacteria 1213
1390 Ga0495619_0065962 3300053085 Bacteria 2416
1391 Ga0495619_0160747 3300053085 Bacteria 1551
1392 Ga0500578_0090848 3300053086 Bacteria 1938
1393 Ga0500644_0041888 3300053088 Bacteria 1524
1394 Ga0500644_0126294 3300053088 Bacteria 1002
1395 Ga0500644_0136268 3300053088 Bacteria 971
1396 Ga0500646_0007100 3300053090 Bacteria 2857
1397 Ga0500583_0001971 3300053092 Bacteria 6034
1398 Ga0500583_0044064 3300053092 Bacteria 2041
1399 Ga0500651_0000168 3300053093 Bacteria 42658
1400 Ga0500651_0025258 3300053093 Bacteria 3727
1401 Ga0500566_0010562 3300053094 Bacteria 5443
1402 Ga0500566_0216356 3300053094 Bacteria 956
1403 Ga0500648_136589 3300053097 Bacteria 1323
1404 Ga0500650_0020176 3300053098 Bacteria 2920
1405 Ga0500650_0113889 3300053098 Bacteria 1262
1406 Ga0500554_002814 3300053102 Bacteria 3475
1407 Ga0500555_016159 3300053103 Bacteria 2152
1408 Ga0500556_0000202 3300053104 Bacteria 48694
1409 Ga0500562_072212 3300053108 Bacteria 931
1410 Ga0500569_000323 3300053109 Bacteria 7662
1411 Ga0500572_001030 3300053111 Bacteria 8351
1412 Ga0500592_000443 3300053116 Bacteria 6927
1413 Ga0500592_009763 3300053116 Bacteria 1527
1414 Ga0500595_002264 3300053119 Bacteria 9721
1415 Ga0500595_003563 3300053119 Bacteria 7231
1416 Ga0500595_009619 3300053119 Bacteria 3894
1417 Ga0500595_041410 3300053119 Bacteria 1480
1418 Ga0500607_017859 3300053121 Bacteria 4038
1419 Ga0500628_050004 3300053129 Bacteria 989
1420 Ga0500642_0000005 3300053130 Bacteria 422725
1421 Ga0500642_0036658 3300053130 Bacteria 2091
1422 Ga0500652_000717 3300053131 Bacteria 11264
1423 Ga0500652_003296 3300053131 Bacteria 4890
1424 Ga0500559_0000586 3300053136 Bacteria 24993
1425 Ga0500559_0007354 3300053136 Bacteria 4883
1426 Ga0500564_057478 3300053138 Bacteria 1770
1427 Ga0500568_0008225 3300053139 Bacteria 5049
1428 Ga0500568_0008455 3300053139 Bacteria 4954
1429 Ga0500568_0013761 3300053139 Bacteria 3677
1430 Ga0500568_0041141 3300053139 Bacteria 1858
1431 Ga0500577_0021304 3300053142 Bacteria 2134
1432 Ga0500577_0021539 3300053142 Bacteria 2125
1433 Ga0500577_0076548 3300053142 Bacteria 1325
1434 Ga0500586_001465 3300053145 Bacteria 4981
1435 Ga0500588_0049382 3300053146 Bacteria 1305
1436 Ga0500589_013888 3300053147 Bacteria 3559
1437 Ga0500604_0008586 3300053151 Bacteria 2710
1438 Ga0500616_0000166 3300053153 Bacteria 110141
1439 Ga0500616_0000180 3300053153 Bacteria 106053
1440 Ga0500616_0002218 3300053153 Bacteria 16615
1441 Ga0500616_0011766 3300053153 Bacteria 5149
1442 Ga0500622_0007484 3300053156 Bacteria 6198
1443 Ga0500622_0019560 3300053156 Bacteria 3596
1444 Ga0500622_0019647 3300053156 Bacteria 3587
1445 Ga0500622_0157550 3300053156 Bacteria 1068
1446 Ga0500634_0042288 3300053161 Bacteria 2472
1447 Ga0500636_0011317 3300053177 Bacteria 5222
1448 Ga0500636_0026335 3300053177 Bacteria 3437
1449 Ga0500637_0020687 3300053178 Bacteria 3567
1450 Ga0500645_007785 3300053730 Bacteria 3705
1451 Ga0500609_000821 3300053731 Bacteria 4665
1452 Ga0500609_007867 3300053731 Bacteria 1438
1453 Ga0501084_0024291 3300054114 Bacteria 5054
1454 Ga0501084_0031221 3300054114 Bacteria 4455
1455 Ga0501084_0182075 3300054114 Bacteria 1774
1456 Ga0501084_0188857 3300054114 Bacteria 1738
1457 Ga0501084_0222591 3300054114 Bacteria 1592
1458 Ga0501082_0006782 3300060353 Bacteria 9897
1459 Ga0501082_0010662 3300060353 Bacteria 7910
1460 Ga0501082_0035245 3300060353 Bacteria 4313
1461 Ga0501082_0477549 3300060353 Bacteria 1089
1462 Ga0466962_0001283 3300061719 Bacteria 11595
1463 Ga0530510_0070878 3300061734 Bacteria 2529
1464 Ga0530510_0517636 3300061734 Bacteria 905

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025907 Ga0207645_10288376 Ga0207645_102883762 249
2 3300005339 Ga0070660_100396392 Ga0070660_1003963921 251
3 3300037418 Ga0395900_0367860 Ga0395900_0367860_347_1150 251
4 3300038443 Ga0395901_0227851 Ga0395901_0227851_190_993 251
5 3300014326 Ga0157380_10002658 Ga0157380_100026584 252
6 3300013308 Ga0157375_10000001 Ga0157375_1000000167 253
7 3300037471 Ga0395905_0100628 Ga0395905_0100628_1940_2701 253
8 3300005330 Ga0070690_100206861 Ga0070690_1002068612 257
9 3300005334 Ga0068869_100038274 Ga0068869_1000382741 257
10 3300005364 Ga0070673_100097811 Ga0070673_1000978112 257
11 3300005367 Ga0070667_100203201 Ga0070667_1002032012 257
12 3300005548 Ga0070665_100142500 Ga0070665_1001425002 257
13 3300005618 Ga0068864_100163314 Ga0068864_1001633142 257
14 3300005840 Ga0068870_10058104 Ga0068870_100581041 257
15 3300005841 Ga0068863_100057565 Ga0068863_1000575652 257
16 3300006237 Ga0097621_100029889 Ga0097621_1000298892 257
17 3300006358 Ga0068871_100001292 Ga0068871_1000012929 257
18 3300006844 Ga0075428_100002030 Ga0075428_1000020308 257
19 3300006847 Ga0075431_100014541 Ga0075431_1000145416 257
20 3300006880 Ga0075429_100002394 Ga0075429_1000023944 257
21 3300025250 Ga0209026_1007300 Ga0209026_10073002 257
22 3300025926 Ga0207659_10137642 Ga0207659_101376422 257
23 3300025937 Ga0207669_10229945 Ga0207669_102299452 257
24 3300025941 Ga0207711_10301715 Ga0207711_103017152 257
25 3300025942 Ga0207689_10022903 Ga0207689_100229035 257
26 3300025960 Ga0207651_10071638 Ga0207651_100716382 257
27 3300026088 Ga0207641_10093622 Ga0207641_100936222 257
28 3300026089 Ga0207648_10129348 Ga0207648_101293483 257
29 3300026118 Ga0207675_100098698 Ga0207675_1000986983 257
30 3300027907 Ga0207428_10060402 Ga0207428_100604022 257
31 3300032004 Ga0307414_10000028 Ga0307414_1000002897 257
32 3300032004 Ga0307414_10048793 Ga0307414_100487932 257
33 3300035691 Ga0373931_0186725 Ga0373931_0186725_17_790 257
34 3300036647 Ga0316582_0026741 Ga0316582_0026741_687_1460 257
35 3300036712 Ga0316584_0011555 Ga0316584_0011555_4353_5126 257
36 3300044712 Ga0453684_0211122 Ga0453684_0211122_208_981 257
37 3300044712 Ga0453684_0230091 Ga0453684_0230091_1101_1874 257
38 3300045051 Ga0451576_0766263 Ga0451576_0766263_164_937 257
39 3300046514 Ga0495618_0380725 Ga0495618_0380725_19_792 257
40 3300046536 Ga0495587_0236491 Ga0495587_0236491_21_794 257
41 3300049569 Ga0501032_0295516 Ga0501032_0295516_11_784 257
42 3300046690 Ga0495624_0156857 Ga0495624_0156857_598_1374 258
43 3300053129 Ga0500628_050004 Ga0500628_050004_96_890 258
44 iso_pu_bacteria 2512047086 2512533564 260
45 iso_pu_bacteria 2513237087 2513589931 260
46 iso_pu_bacteria 2513237092 2513623404 260
47 iso_pu_bacteria 2513237094 2513637568 260
48 iso_pu_bacteria 2513237101 2513697363 260
49 iso_pu_bacteria 2513237102 2513700028 260
50 iso_pu_bacteria 2513237104 2513719227 260
51 iso_pu_bacteria 2517093001 2517100501 260
52 iso_pu_bacteria 2524023205 2524437361 260
53 iso_pu_bacteria 2528768022 2528849920 260
54 iso_pu_bacteria 2602042107 2603862656 260
55 iso_pu_bacteria 2617270741 2617377913 260
56 iso_pu_bacteria 2643221547 2643755222 260
57 iso_pu_bacteria 2643221604 2644035917 260
58 iso_pu_bacteria 2643221629 2644166267 260
59 iso_pu_bacteria 2643221651 2644287386 260
60 iso_pu_bacteria 2643221662 2644346727 260
61 iso_pu_bacteria 2643221733 2644732192 260
62 iso_pu_bacteria 2643221734 2644735008 260
63 iso_pu_bacteria 2721755755 2723843141 260
64 iso_pu_bacteria 2738541281 2738743884 260
65 iso_pu_bacteria 2738541284 2738763035 260
66 iso_pu_bacteria 2738543031 2739349020 260
67 iso_pu_bacteria 2738543032 2739353114 260
68 iso_pu_bacteria 2775506987 2776614667 260
69 iso_pu_bacteria 2791355199 2793079456 260
70 iso_pu_bacteria 2824600985 2824606153 260
71 iso_pu_bacteria 2824609381 2824616019 260
72 iso_pu_bacteria 2824617872 2824618942 260
73 iso_pu_bacteria 2824626560 2824627538 260
74 iso_pu_bacteria 2824635225 2824638863 260
75 iso_pu_bacteria 2824644064 2824647665 260
76 iso_pu_bacteria 2824653114 2824657318 260
77 iso_pu_bacteria 2824661429 2824668204 260
78 iso_pu_bacteria 2824704595 2824706532 260
79 iso_pu_bacteria 2824714736 2824716446 260
80 iso_pu_bacteria 2824723954 2824726392 260
81 iso_pu_bacteria 2824732956 2824736293 260
82 iso_pu_bacteria 2824746037 2824751935 260
83 iso_pu_bacteria 2824753945 2824756920 260
84 iso_pu_bacteria 2824763712 2824769716 260
85 iso_pu_bacteria 2839989709 2839991445 260
86 iso_pu_bacteria 2841911363 2841912928 260
87 iso_pu_bacteria 2841917233 2841918675 260
88 iso_pu_bacteria 2841957949 2841960303 260
89 iso_pu_bacteria 2842038055 2842042789 260
90 iso_pu_bacteria 2842045827 2842050831 260
91 iso_pu_bacteria 2852649853 2852653018 260
92 iso_pu_bacteria 2857524615 2857530006 260
93 iso_pu_bacteria 2861691609 2861693167 260
94 iso_pu_bacteria 2874604998 2874612530 260
95 iso_pu_bacteria 2874612657 2874615728 260
96 iso_pu_bacteria 2874620515 2874623516 260
97 iso_pu_bacteria 2874628541 2874630553 260
98 iso_pu_bacteria 2876808645 2876815418 260
99 iso_pu_bacteria 2879099564 2879102008 260
100 iso_pu_bacteria 2879110137 2879117972 260
101 iso_pu_bacteria 2881364244 2881370599 260
102 iso_pu_bacteria 2881665667 2881667362 260
103 iso_pu_bacteria 2881955468 2881956518 260
104 iso_pu_bacteria 2888419890 2888422023 260
105 iso_pu_bacteria 2889033259 2889033558 260
106 iso_pu_bacteria 2893066018 2893071071 260
107 iso_pu_bacteria 2903768456 2903773562 260
108 iso_pu_bacteria 2904666416 2904667680 260
109 iso_pu_bacteria 2904711408 2904719116 260
110 iso_pu_bacteria 2906643746 2906648273 260
111 iso_pu_bacteria 2908775508 2908782037 260
112 iso_pu_bacteria 2919450847 2919452419 260
113 iso_pu_bacteria 2922361189 2922366934 260
114 iso_pu_bacteria 2922368715 2922371297 260
115 iso_pu_bacteria 2922386360 2922390289 260
116 iso_pu_bacteria 2925326138 2925331094 260
117 iso_pu_bacteria 2929615660 2929619674 260
118 iso_pu_bacteria 2929624759 2929627855 260
119 iso_pu_bacteria 2929921140 2929923571 260
120 iso_pu_bacteria 2932784394 2932786006 260
121 iso_pu_bacteria 2932809354 2932817045 260
122 iso_pu_bacteria 2932818245 2932822464 260
123 iso_pu_bacteria 2932828146 2932831050 260
124 iso_pu_bacteria 2933577622 2933581593 260
125 iso_pu_bacteria 2935616580 2935624162 260
126 iso_pu_bacteria 2935638405 2935640192 260
127 iso_pu_bacteria 2935648319 2935654986 260
128 iso_pu_bacteria 2935656913 2935663866 260
129 iso_pu_bacteria 2935665750 2935666970 260
130 iso_pu_bacteria 2935675223 2935680390 260
131 iso_pu_bacteria 2935684952 2935690101 260
132 iso_pu_bacteria 2935694250 2935699817 260
133 iso_pu_bacteria 2935703347 2935704725 260
134 iso_pu_bacteria 2935713505 2935722187 260
135 iso_pu_bacteria 2935722832 2935731496 260
136 iso_pu_bacteria 2935732158 2935735416 260
137 iso_pu_bacteria 2935741537 2935745313 260
138 iso_pu_bacteria 2935750917 2935755112 260
139 iso_pu_bacteria 2935760218 2935762373 260
140 iso_pu_bacteria 2935801545 2935803872 260
141 iso_pu_bacteria 2935810662 2935811790 260
142 iso_pu_bacteria 2935827899 2935829675 260
143 iso_pu_bacteria 2935837841 2935842993 260
144 iso_pu_bacteria 2935855204 2935862338 260
145 iso_pu_bacteria 2935864058 2935870473 260
146 iso_pu_bacteria 2935873716 2935881055 260
147 iso_pu_bacteria 2935992306 2935993552 260
148 iso_pu_bacteria 2936002035 2936004448 260
149 iso_pu_bacteria 2936011229 2936018065 260
150 iso_pu_bacteria 2936019824 2936026525 260
151 iso_pu_bacteria 2936028420 2936035268 260
152 iso_pu_bacteria 2936037263 2936038373 260
153 iso_pu_bacteria 2936046547 2936053460 260
154 iso_pu_bacteria 2939573065 2939576224 260
155 iso_pu_bacteria 2940556831 2940561608 260
156 iso_pu_bacteria 2941538514 2941544217 260
157 iso_pu_bacteria 2987605356 2987608048 260
158 iso_pu_bacteria 8003151029 8003154437 260
159 iso_pu_bacteria 8005563573 8005567928 260
160 iso_pu_bacteria 8006926726 8006933173 260
161 iso_pu_bacteria 8006964411 8006971342 260
162 iso_pu_bacteria 8006984368 8006989294 260
163 iso_pu_bacteria 8006994254 8006997770 260
164 iso_pu_bacteria 8016511872 8016516330 260
165 iso_pu_bacteria 8017057580 8017060203 260
166 iso_pu_bacteria 8019576017 8019579721 260
167 iso_pu_bacteria 8019586578 8019587433 260
168 iso_pu_bacteria 8019597564 8019603911 260
169 iso_pu_bacteria 8019608314 8019614629 260
170 iso_pu_bacteria 8024479707 8024482929 260
171 iso_pu_bacteria 8055742211 8055749070 260
172 iso_pu_bacteria 8056673599 8056674809 260
173 iso_pu_bacteria 8056681323 8056682435 260
174 iso_pu_bacteria 8057304971 8057305043 260
175 3300014745 Ga0157377_10429198 Ga0157377_104291981 262
176 3300005535 Ga0070684_100094496 Ga0070684_1000944962 263
177 3300009098 Ga0105245_10287109 Ga0105245_102871092 263
178 3300013308 Ga0157375_10047205 Ga0157375_100472053 263
179 3300014325 Ga0163163_10254406 Ga0163163_102544062 263
180 3300025927 Ga0207687_10199626 Ga0207687_101996262 263
181 3300028381 Ga0268264_10787041 Ga0268264_107870412 263
182 3300028666 Ga0265336_10022562 Ga0265336_100225622 263
183 3300028794 Ga0307515_10043225 Ga0307515_100432256 263
184 3300028794 Ga0307515_10104231 Ga0307515_101042311 263
185 3300030522 Ga0307512_10011391 Ga0307512_100113916 263
186 3300030522 Ga0307512_10030839 Ga0307512_100308393 263
187 3300031456 Ga0307513_10009510 Ga0307513_1000951010 263
188 3300031616 Ga0307508_10025462 Ga0307508_100254623 263
189 3300031731 Ga0307405_10322622 Ga0307405_103226222 263
190 3300032133 Ga0316583_10023870 Ga0316583_100238702 263
191 3300033180 Ga0307510_10147399 Ga0307510_101473992 263
192 3300048928 Ga0496125_0003472 Ga0496125_0003472_14760_15617 263
193 3300049822 Ga0501035_0071552 Ga0501035_0071552_1160_1957 263
194 3300049823 Ga0501044_0192816 Ga0501044_0192816_328_1125 263
195 3300053142 Ga0500577_0076548 Ga0500577_0076548_323_1120 263
196 3300053156 Ga0500622_0157550 Ga0500622_0157550_193_990 263
197 2162886007 SwRhRL2b_contig_2388475 SwRhRL2b_0205.00005770 264
198 3300000549 LJQas_1004670 LJQas_10046702 264
199 3300001979 JGI24740J21852_10015371 JGI24740J21852_100153711 264
200 3300001979 JGI24740J21852_10025518 JGI24740J21852_100255183 264
201 3300002070 JGI24750J21931_1014577 JGI24750J21931_10145771 264
202 3300002738 JGI25154J39366_1000007 JGI25154J39366_1000007280 264
203 3300003187 JGI25151J46595_10000028 JGI25151J46595_1000002889 264
204 3300003203 JGI25406J46586_10000196 JGI25406J46586_100001969 264
205 3300003214 JGI25165J46597_1005748 JGI25165J46597_10057482 264
206 3300003215 JGI25153J46596_10000738 JGI25153J46596_100007384 264
207 3300003215 JGI25153J46596_10001748 JGI25153J46596_100017485 264
208 3300003323 rootH1_10034177 rootH1_100341773 264
209 3300003323 rootH1_10106887 rootH1_101068871 264
210 3300003354 JGI25160J50197_1012427 JGI25160J50197_10124272 264
211 3300003659 JGI25404J52841_10008621 JGI25404J52841_100086211 264
212 3300003752 Ga0055539_1007171 Ga0055539_10071712 264
213 3300003771 Ga0055526_1000938 Ga0055526_100093820 264
214 3300003771 Ga0055526_1005211 Ga0055526_10052119 264
215 3300003775 Ga0055524_1000020 Ga0055524_1000020167 264
216 3300003775 Ga0055524_1007655 Ga0055524_10076555 264
217 3300005262 Ga0065165_1002837 Ga0065165_100283711 264
218 3300005288 Ga0065714_10002655 Ga0065714_1000265510 264
219 3300005288 Ga0065714_10064924 Ga0065714_100649242 264
220 3300005288 Ga0065714_10105188 Ga0065714_101051881 264
221 3300005289 Ga0065704_10000422 Ga0065704_1000042220 264
222 3300005289 Ga0065704_10226758 Ga0065704_102267582 264
223 3300005293 Ga0065715_10165122 Ga0065715_101651222 264
224 3300005327 Ga0070658_10034361 Ga0070658_100343614 264
225 3300005327 Ga0070658_10094348 Ga0070658_100943482 264
226 3300005327 Ga0070658_10181622 Ga0070658_101816223 264
227 3300005327 Ga0070658_10295126 Ga0070658_102951262 264
228 3300005328 Ga0070676_10144069 Ga0070676_101440692 264
229 3300005329 Ga0070683_100002255 Ga0070683_1000022553 264
230 3300005329 Ga0070683_100017424 Ga0070683_1000174244 264
231 3300005329 Ga0070683_100046407 Ga0070683_1000464073 264
232 3300005329 Ga0070683_100053085 Ga0070683_1000530855 264
233 3300005330 Ga0070690_100013883 Ga0070690_1000138833 264
234 3300005330 Ga0070690_100167770 Ga0070690_1001677701 264
235 3300005331 Ga0070670_100097680 Ga0070670_1000976801 264
236 3300005331 Ga0070670_100132060 Ga0070670_1001320602 264
237 3300005335 Ga0070666_10214446 Ga0070666_102144462 264
238 3300005336 Ga0070680_100221804 Ga0070680_1002218042 264
239 3300005337 Ga0070682_100000014 Ga0070682_10000001442 264
240 3300005337 Ga0070682_100080195 Ga0070682_1000801952 264
241 3300005337 Ga0070682_100466373 Ga0070682_1004663731 264
242 3300005338 Ga0068868_100002673 Ga0068868_10000267314 264
243 3300005338 Ga0068868_100050231 Ga0068868_1000502313 264
244 3300005339 Ga0070660_100010424 Ga0070660_1000104247 264
245 3300005340 Ga0070689_100000488 Ga0070689_10000048823 264
246 3300005340 Ga0070689_100002204 Ga0070689_1000022043 264
247 3300005340 Ga0070689_100189445 Ga0070689_1001894452 264
248 3300005340 Ga0070689_100237511 Ga0070689_1002375112 264
249 3300005340 Ga0070689_100415257 Ga0070689_1004152572 264
250 3300005341 Ga0070691_10017425 Ga0070691_100174254 264
251 3300005341 Ga0070691_10018051 Ga0070691_100180513 264
252 3300005344 Ga0070661_100008367 Ga0070661_1000083674 264
253 3300005344 Ga0070661_100204853 Ga0070661_1002048531 264
254 3300005345 Ga0070692_10007686 Ga0070692_100076862 264
255 3300005345 Ga0070692_10014150 Ga0070692_100141502 264
256 3300005347 Ga0070668_100002031 Ga0070668_1000020315 264
257 3300005347 Ga0070668_100041237 Ga0070668_1000412371 264
258 3300005347 Ga0070668_100108937 Ga0070668_1001089373 264
259 3300005347 Ga0070668_100331079 Ga0070668_1003310792 264
260 3300005347 Ga0070668_100371797 Ga0070668_1003717972 264
261 3300005353 Ga0070669_100027197 Ga0070669_1000271975 264
262 3300005354 Ga0070675_100007206 Ga0070675_1000072066 264
263 3300005354 Ga0070675_100499022 Ga0070675_1004990221 264
264 3300005355 Ga0070671_100006436 Ga0070671_1000064366 264
265 3300005356 Ga0070674_100035143 Ga0070674_1000351432 264
266 3300005356 Ga0070674_100388937 Ga0070674_1003889372 264
267 3300005364 Ga0070673_100113737 Ga0070673_1001137372 264
268 3300005364 Ga0070673_100153375 Ga0070673_1001533752 264
269 3300005365 Ga0070688_100225593 Ga0070688_1002255932 264
270 3300005365 Ga0070688_100353997 Ga0070688_1003539971 264
271 3300005366 Ga0070659_100145758 Ga0070659_1001457582 264
272 3300005366 Ga0070659_100358993 Ga0070659_1003589931 264
273 3300005367 Ga0070667_100071427 Ga0070667_1000714272 264
274 3300005367 Ga0070667_100094555 Ga0070667_1000945553 264
275 3300005367 Ga0070667_100187955 Ga0070667_1001879552 264
276 3300005367 Ga0070667_100333620 Ga0070667_1003336202 264
277 3300005434 Ga0070709_10025330 Ga0070709_100253302 264
278 3300005434 Ga0070709_10025693 Ga0070709_100256932 264
279 3300005434 Ga0070709_10056857 Ga0070709_100568574 264
280 3300005435 Ga0070714_100002013 Ga0070714_10000201315 264
281 3300005435 Ga0070714_100038279 Ga0070714_1000382792 264
282 3300005435 Ga0070714_100041967 Ga0070714_1000419674 264
283 3300005435 Ga0070714_100134050 Ga0070714_1001340502 264
284 3300005435 Ga0070714_100168946 Ga0070714_1001689462 264
285 3300005435 Ga0070714_100240705 Ga0070714_1002407052 264
286 3300005435 Ga0070714_100253223 Ga0070714_1002532232 264
287 3300005436 Ga0070713_100000639 Ga0070713_1000006394 264
288 3300005436 Ga0070713_100162001 Ga0070713_1001620013 264
289 3300005437 Ga0070710_10000587 Ga0070710_100005877 264
290 3300005437 Ga0070710_10011649 Ga0070710_100116494 264
291 3300005439 Ga0070711_100002894 Ga0070711_1000028944 264
292 3300005439 Ga0070711_100010862 Ga0070711_1000108624 264
293 3300005439 Ga0070711_100092843 Ga0070711_1000928432 264
294 3300005439 Ga0070711_100135860 Ga0070711_1001358602 264
295 3300005439 Ga0070711_100208229 Ga0070711_1002082292 264
296 3300005440 Ga0070705_100001167 Ga0070705_1000011678 264
297 3300005440 Ga0070705_100143726 Ga0070705_1001437262 264
298 3300005441 Ga0070700_100003520 Ga0070700_1000035203 264
299 3300005441 Ga0070700_100062744 Ga0070700_1000627442 264
300 3300005441 Ga0070700_100150313 Ga0070700_1001503131 264
301 3300005444 Ga0070694_100009831 Ga0070694_1000098314 264
302 3300005455 Ga0070663_100047725 Ga0070663_1000477253 264
303 3300005455 Ga0070663_100074216 Ga0070663_1000742163 264
304 3300005455 Ga0070663_100136230 Ga0070663_1001362301 264
305 3300005455 Ga0070663_100174501 Ga0070663_1001745012 264
306 3300005456 Ga0070678_100007967 Ga0070678_1000079673 264
307 3300005456 Ga0070678_100035283 Ga0070678_1000352832 264
308 3300005456 Ga0070678_100039559 Ga0070678_1000395592 264
309 3300005456 Ga0070678_100066179 Ga0070678_1000661794 264
310 3300005456 Ga0070678_100091852 Ga0070678_1000918522 264
311 3300005456 Ga0070678_100182435 Ga0070678_1001824351 264
312 3300005457 Ga0070662_100050830 Ga0070662_1000508302 264
313 3300005458 Ga0070681_10069164 Ga0070681_100691644 264
314 3300005458 Ga0070681_10085157 Ga0070681_100851573 264
315 3300005459 Ga0068867_100165645 Ga0068867_1001656451 264
316 3300005466 Ga0070685_10000250 Ga0070685_1000025022 264
317 3300005466 Ga0070685_10073780 Ga0070685_100737802 264
318 3300005467 Ga0070706_100467803 Ga0070706_1004678032 264
319 3300005471 Ga0070698_100001623 Ga0070698_10000162310 264
320 3300005518 Ga0070699_100000147 Ga0070699_10000014730 264
321 3300005530 Ga0070679_100009879 Ga0070679_1000098795 264
322 3300005530 Ga0070679_100019162 Ga0070679_1000191624 264
323 3300005530 Ga0070679_100037593 Ga0070679_1000375934 264
324 3300005530 Ga0070679_100189878 Ga0070679_1001898783 264
325 3300005530 Ga0070679_100374925 Ga0070679_1003749252 264
326 3300005535 Ga0070684_100027286 Ga0070684_1000272865 264
327 3300005535 Ga0070684_100033649 Ga0070684_1000336494 264
328 3300005535 Ga0070684_100354154 Ga0070684_1003541542 264
329 3300005536 Ga0070697_100044081 Ga0070697_1000440813 264
330 3300005539 Ga0068853_100021436 Ga0068853_1000214364 264
331 3300005539 Ga0068853_100022775 Ga0068853_1000227754 264
332 3300005539 Ga0068853_100091534 Ga0068853_1000915342 264
333 3300005539 Ga0068853_100256421 Ga0068853_1002564212 264
334 3300005539 Ga0068853_100277868 Ga0068853_1002778682 264
335 3300005539 Ga0068853_100322378 Ga0068853_1003223781 264
336 3300005539 Ga0068853_100445302 Ga0068853_1004453021 264
337 3300005543 Ga0070672_100000746 Ga0070672_10000074611 264
338 3300005543 Ga0070672_100089558 Ga0070672_1000895582 264
339 3300005543 Ga0070672_100249753 Ga0070672_1002497531 264
340 3300005544 Ga0070686_100112425 Ga0070686_1001124252 264
341 3300005545 Ga0070695_100011698 Ga0070695_1000116984 264
342 3300005546 Ga0070696_100000503 Ga0070696_1000005039 264
343 3300005546 Ga0070696_100108170 Ga0070696_1001081702 264
344 3300005546 Ga0070696_100178163 Ga0070696_1001781632 264
345 3300005547 Ga0070693_100016097 Ga0070693_1000160972 264
346 3300005547 Ga0070693_100132752 Ga0070693_1001327522 264
347 3300005547 Ga0070693_100240139 Ga0070693_1002401392 264
348 3300005548 Ga0070665_100004481 Ga0070665_10000448113 264
349 3300005548 Ga0070665_100020950 Ga0070665_1000209505 264
350 3300005548 Ga0070665_100033592 Ga0070665_1000335923 264
351 3300005548 Ga0070665_100043567 Ga0070665_1000435674 264
352 3300005548 Ga0070665_100141030 Ga0070665_1001410302 264
353 3300005548 Ga0070665_100152095 Ga0070665_1001520953 264
354 3300005548 Ga0070665_100160316 Ga0070665_1001603162 264
355 3300005548 Ga0070665_100190871 Ga0070665_1001908712 264
356 3300005548 Ga0070665_100529821 Ga0070665_1005298211 264
357 3300005549 Ga0070704_100014566 Ga0070704_1000145664 264
358 3300005549 Ga0070704_100139027 Ga0070704_1001390272 264
359 3300005563 Ga0068855_100036490 Ga0068855_1000364903 264
360 3300005563 Ga0068855_100037992 Ga0068855_1000379923 264
361 3300005563 Ga0068855_100084586 Ga0068855_1000845862 264
362 3300005563 Ga0068855_100436150 Ga0068855_1004361502 264
363 3300005564 Ga0070664_100115042 Ga0070664_1001150422 264
364 3300005577 Ga0068857_100002373 Ga0068857_1000023739 264
365 3300005577 Ga0068857_100051526 Ga0068857_1000515263 264
366 3300005577 Ga0068857_100060313 Ga0068857_1000603133 264
367 3300005577 Ga0068857_100096949 Ga0068857_1000969493 264
368 3300005577 Ga0068857_100210098 Ga0068857_1002100982 264
369 3300005577 Ga0068857_100450862 Ga0068857_1004508621 264
370 3300005578 Ga0068854_100115871 Ga0068854_1001158713 264
371 3300005578 Ga0068854_100133269 Ga0068854_1001332692 264
372 3300005614 Ga0068856_100002538 Ga0068856_10000253820 264
373 3300005614 Ga0068856_100025782 Ga0068856_1000257827 264
374 3300005614 Ga0068856_100118188 Ga0068856_1001181882 264
375 3300005614 Ga0068856_100206953 Ga0068856_1002069531 264
376 3300005614 Ga0068856_100390813 Ga0068856_1003908132 264
377 3300005614 Ga0068856_100403938 Ga0068856_1004039381 264
378 3300005615 Ga0070702_100162301 Ga0070702_1001623012 264
379 3300005616 Ga0068852_100001168 Ga0068852_1000011686 264
380 3300005616 Ga0068852_100016778 Ga0068852_1000167782 264
381 3300005616 Ga0068852_100019720 Ga0068852_1000197203 264
382 3300005616 Ga0068852_100045654 Ga0068852_1000456543 264
383 3300005616 Ga0068852_100103442 Ga0068852_1001034424 264
384 3300005616 Ga0068852_100121441 Ga0068852_1001214412 264
385 3300005616 Ga0068852_100174247 Ga0068852_1001742472 264
386 3300005617 Ga0068859_100003136 Ga0068859_1000031369 264
387 3300005617 Ga0068859_100041987 Ga0068859_1000419876 264
388 3300005617 Ga0068859_100067475 Ga0068859_1000674752 264
389 3300005617 Ga0068859_100079191 Ga0068859_1000791913 264
390 3300005617 Ga0068859_100208224 Ga0068859_1002082242 264
391 3300005618 Ga0068864_100000097 Ga0068864_10000009760 264
392 3300005618 Ga0068864_100083220 Ga0068864_1000832202 264
393 3300005719 Ga0068861_100000391 Ga0068861_1000003913 264
394 3300005719 Ga0068861_100066467 Ga0068861_1000664672 264
395 3300005719 Ga0068861_100080561 Ga0068861_1000805612 264
396 3300005834 Ga0068851_10020777 Ga0068851_100207774 264
397 3300005834 Ga0068851_10023616 Ga0068851_100236163 264
398 3300005841 Ga0068863_100064453 Ga0068863_1000644532 264
399 3300005842 Ga0068858_100000243 Ga0068858_10000024323 264
400 3300005842 Ga0068858_100037282 Ga0068858_1000372824 264
401 3300005842 Ga0068858_100176044 Ga0068858_1001760442 264
402 3300005842 Ga0068858_100359903 Ga0068858_1003599032 264
403 3300005842 Ga0068858_100412713 Ga0068858_1004127132 264
404 3300005842 Ga0068858_100468617 Ga0068858_1004686172 264
405 3300005843 Ga0068860_100004632 Ga0068860_1000046327 264
406 3300005843 Ga0068860_100013122 Ga0068860_1000131223 264
407 3300005843 Ga0068860_100020886 Ga0068860_1000208864 264
408 3300005843 Ga0068860_100056526 Ga0068860_1000565265 264
409 3300005843 Ga0068860_100128258 Ga0068860_1001282584 264
410 3300005843 Ga0068860_100582969 Ga0068860_1005829691 264
411 3300005844 Ga0068862_100001552 Ga0068862_1000015528 264
412 3300005844 Ga0068862_100002918 Ga0068862_1000029188 264
413 3300005844 Ga0068862_100418100 Ga0068862_1004181002 264
414 3300005937 Ga0081455_10008277 Ga0081455_1000827712 264
415 3300005937 Ga0081455_10019690 Ga0081455_100196902 264
416 3300005937 Ga0081455_10067883 Ga0081455_100678832 264
417 3300005937 Ga0081455_10070603 Ga0081455_100706034 264
418 3300005981 Ga0081538_10017929 Ga0081538_100179295 264
419 3300005983 Ga0081540_1000996 Ga0081540_100099618 264
420 3300005983 Ga0081540_1008013 Ga0081540_10080133 264
421 3300005983 Ga0081540_1010852 Ga0081540_10108523 264
422 3300005983 Ga0081540_1028988 Ga0081540_10289884 264
423 3300005983 Ga0081540_1071022 Ga0081540_10710222 264
424 3300005985 Ga0081539_10000748 Ga0081539_1000074837 264
425 3300005985 Ga0081539_10030261 Ga0081539_100302611 264
426 3300006028 Ga0070717_10010072 Ga0070717_100100722 264
427 3300006028 Ga0070717_10014303 Ga0070717_100143036 264
428 3300006028 Ga0070717_10016137 Ga0070717_100161373 264
429 3300006028 Ga0070717_10128031 Ga0070717_101280313 264
430 3300006028 Ga0070717_10321136 Ga0070717_103211362 264
431 3300006038 Ga0075365_10067201 Ga0075365_100672011 264
432 3300006038 Ga0075365_10081134 Ga0075365_100811342 264
433 3300006038 Ga0075365_10192006 Ga0075365_101920061 264
434 3300006042 Ga0075368_10018880 Ga0075368_100188802 264
435 3300006042 Ga0075368_10069009 Ga0075368_100690091 264
436 3300006048 Ga0075363_100032234 Ga0075363_1000322342 264
437 3300006051 Ga0075364_10022187 Ga0075364_100221874 264
438 3300006051 Ga0075364_10044496 Ga0075364_100444962 264
439 3300006051 Ga0075364_10146731 Ga0075364_101467312 264
440 3300006051 Ga0075364_10213375 Ga0075364_102133753 264
441 3300006163 Ga0070715_10000260 Ga0070715_1000026010 264
442 3300006173 Ga0070716_100000213 Ga0070716_1000002138 264
443 3300006173 Ga0070716_100020768 Ga0070716_1000207683 264
444 3300006175 Ga0070712_100010117 Ga0070712_1000101177 264
445 3300006175 Ga0070712_100016528 Ga0070712_1000165284 264
446 3300006177 Ga0075362_10000655 Ga0075362_1000065513 264
447 3300006177 Ga0075362_10008950 Ga0075362_100089502 264
448 3300006178 Ga0075367_10038229 Ga0075367_100382292 264
449 3300006186 Ga0075369_10002063 Ga0075369_100020633 264
450 3300006186 Ga0075369_10011190 Ga0075369_100111904 264
451 3300006195 Ga0075366_10242998 Ga0075366_102429982 264
452 3300006237 Ga0097621_100041480 Ga0097621_1000414805 264
453 3300006237 Ga0097621_100146155 Ga0097621_1001461553 264
454 3300006237 Ga0097621_100185039 Ga0097621_1001850391 264
455 3300006353 Ga0075370_10042568 Ga0075370_100425682 264
456 3300006353 Ga0075370_10083703 Ga0075370_100837032 264
457 3300006353 Ga0075370_10087666 Ga0075370_100876662 264
458 3300006353 Ga0075370_10123414 Ga0075370_101234142 264
459 3300006358 Ga0068871_100058705 Ga0068871_1000587053 264
460 3300006358 Ga0068871_100107291 Ga0068871_1001072913 264
461 3300006844 Ga0075428_100003578 Ga0075428_10000357812 264
462 3300006844 Ga0075428_100013501 Ga0075428_1000135018 264
463 3300006844 Ga0075428_100068789 Ga0075428_1000687892 264
464 3300006852 Ga0075433_10023832 Ga0075433_100238326 264
465 3300006871 Ga0075434_100033264 Ga0075434_1000332643 264
466 3300006880 Ga0075429_100060260 Ga0075429_1000602603 264
467 3300006881 Ga0068865_100035745 Ga0068865_1000357453 264
468 3300006881 Ga0068865_100094453 Ga0068865_1000944532 264
469 3300006881 Ga0068865_100191024 Ga0068865_1001910242 264
470 3300006881 Ga0068865_100443697 Ga0068865_1004436971 264
471 3300006881 Ga0068865_100467125 Ga0068865_1004671251 264
472 3300006931 Ga0097620_100003136 Ga0097620_1000031369 264
473 3300006931 Ga0097620_100041987 Ga0097620_1000419876 264
474 3300006931 Ga0097620_100067486 Ga0097620_1000674862 264
475 3300006931 Ga0097620_100079191 Ga0097620_1000791913 264
476 3300006931 Ga0097620_100208232 Ga0097620_1002082322 264
477 3300006942 Ga0099824_1013210 Ga0099824_10132105 264
478 3300007076 Ga0075435_100073070 Ga0075435_1000730703 264
479 3300007076 Ga0075435_100570589 Ga0075435_1005705891 264
480 3300007076 Ga0075435_100595263 Ga0075435_1005952632 264
481 3300007265 Ga0099794_10047410 Ga0099794_100474102 264
482 3300007788 Ga0099795_10023637 Ga0099795_100236372 264
483 3300009093 Ga0105240_10000876 Ga0105240_1000087635 264
484 3300009093 Ga0105240_10000946 Ga0105240_1000094617 264
485 3300009093 Ga0105240_10023381 Ga0105240_100233817 264
486 3300009093 Ga0105240_10343595 Ga0105240_103435953 264
487 3300009094 Ga0111539_10002382 Ga0111539_100023828 264
488 3300009094 Ga0111539_10007116 Ga0111539_100071166 264
489 3300009094 Ga0111539_10012046 Ga0111539_100120468 264
490 3300009094 Ga0111539_10015447 Ga0111539_100154479 264
491 3300009094 Ga0111539_10089698 Ga0111539_100896982 264
492 3300009094 Ga0111539_10294080 Ga0111539_102940803 264
493 3300009094 Ga0111539_10461243 Ga0111539_104612432 264
494 3300009094 Ga0111539_11042298 Ga0111539_110422981 264
495 3300009098 Ga0105245_10000024 Ga0105245_10000024158 264
496 3300009098 Ga0105245_10002720 Ga0105245_1000272016 264
497 3300009098 Ga0105245_10003410 Ga0105245_1000341014 264
498 3300009098 Ga0105245_10005629 Ga0105245_100056294 264
499 3300009098 Ga0105245_10085154 Ga0105245_100851542 264
500 3300009098 Ga0105245_10118752 Ga0105245_101187522 264
501 3300009098 Ga0105245_10131020 Ga0105245_101310202 264
502 3300009098 Ga0105245_10217779 Ga0105245_102177793 264
503 3300009098 Ga0105245_10421353 Ga0105245_104213531 264
504 3300009101 Ga0105247_10041178 Ga0105247_100411782 264
505 3300009101 Ga0105247_10238139 Ga0105247_102381392 264
506 3300009101 Ga0105247_10346834 Ga0105247_103468342 264
507 3300009147 Ga0114129_10107850 Ga0114129_101078503 264
508 3300009147 Ga0114129_10118296 Ga0114129_101182962 264
509 3300009148 Ga0105243_10042437 Ga0105243_100424373 264
510 3300009148 Ga0105243_10075153 Ga0105243_100751532 264
511 3300009148 Ga0105243_10184710 Ga0105243_101847102 264
512 3300009148 Ga0105243_10660491 Ga0105243_106604912 264
513 3300009174 Ga0105241_10004477 Ga0105241_100044773 264
514 3300009174 Ga0105241_10075673 Ga0105241_100756731 264
515 3300009174 Ga0105241_10287200 Ga0105241_102872002 264
516 3300009176 Ga0105242_10132099 Ga0105242_101320992 264
517 3300009177 Ga0105248_10064938 Ga0105248_100649381 264
518 3300009177 Ga0105248_10121324 Ga0105248_101213243 264
519 3300009177 Ga0105248_10160474 Ga0105248_101604743 264
520 3300009177 Ga0105248_10186176 Ga0105248_101861762 264
521 3300009177 Ga0105248_10252582 Ga0105248_102525822 264
522 3300009177 Ga0105248_11004952 Ga0105248_110049521 264
523 3300009545 Ga0105237_10000233 Ga0105237_1000023332 264
524 3300009545 Ga0105237_10005728 Ga0105237_1000572812 264
525 3300009545 Ga0105237_10019359 Ga0105237_100193596 264
526 3300009545 Ga0105237_10022378 Ga0105237_100223788 264
527 3300009545 Ga0105237_10042957 Ga0105237_100429576 264
528 3300009545 Ga0105237_10094823 Ga0105237_100948232 264
529 3300009545 Ga0105237_10516181 Ga0105237_105161811 264
530 3300009551 Ga0105238_10004976 Ga0105238_100049765 264
531 3300009551 Ga0105238_10008040 Ga0105238_100080405 264
532 3300009551 Ga0105238_10215847 Ga0105238_102158472 264
533 3300009553 Ga0105249_10006733 Ga0105249_100067333 264
534 3300009553 Ga0105249_10110119 Ga0105249_101101192 264
535 3300009553 Ga0105249_10578157 Ga0105249_105781572 264
536 3300009553 Ga0105249_10812335 Ga0105249_108123352 264
537 3300010159 Ga0099796_10015265 Ga0099796_100152652 264
538 3300010375 Ga0105239_10000120 Ga0105239_1000012046 264
539 3300010375 Ga0105239_10001640 Ga0105239_1000164016 264
540 3300010375 Ga0105239_10013259 Ga0105239_100132593 264
541 3300010375 Ga0105239_10024893 Ga0105239_100248935 264
542 3300010375 Ga0105239_10091956 Ga0105239_100919562 264
543 3300010375 Ga0105239_10096136 Ga0105239_100961363 264
544 3300010375 Ga0105239_10242659 Ga0105239_102426593 264
545 3300010375 Ga0105239_10260202 Ga0105239_102602022 264
546 3300010375 Ga0105239_10408747 Ga0105239_104087472 264
547 3300010375 Ga0105239_10759717 Ga0105239_107597172 264
548 3300011119 Ga0105246_10024005 Ga0105246_100240052 264
549 3300012512 Ga0157327_1011436 Ga0157327_10114361 264
550 3300013100 Ga0157373_10002272 Ga0157373_1000227210 264
551 3300013102 Ga0157371_10003535 Ga0157371_100035354 264
552 3300013102 Ga0157371_10012477 Ga0157371_100124772 264
553 3300013102 Ga0157371_10014832 Ga0157371_100148326 264
554 3300013102 Ga0157371_10030480 Ga0157371_100304804 264
555 3300013104 Ga0157370_10018060 Ga0157370_100180608 264
556 3300013104 Ga0157370_10036890 Ga0157370_100368903 264
557 3300013104 Ga0157370_10096746 Ga0157370_100967462 264
558 3300013104 Ga0157370_10099723 Ga0157370_100997232 264
559 3300013104 Ga0157370_10310718 Ga0157370_103107181 264
560 3300013105 Ga0157369_10005591 Ga0157369_1000559112 264
561 3300013105 Ga0157369_10043505 Ga0157369_100435054 264
562 3300013105 Ga0157369_10457380 Ga0157369_104573802 264
563 3300013105 Ga0157369_10661123 Ga0157369_106611231 264
564 3300013296 Ga0157374_10061312 Ga0157374_100613124 264
565 3300013297 Ga0157378_10485051 Ga0157378_104850512 264
566 3300013306 Ga0163162_10055397 Ga0163162_100553973 264
567 3300013306 Ga0163162_10062679 Ga0163162_100626792 264
568 3300013306 Ga0163162_10081293 Ga0163162_100812934 264
569 3300013306 Ga0163162_10095526 Ga0163162_100955262 264
570 3300013307 Ga0157372_10001329 Ga0157372_1000132914 264
571 3300013307 Ga0157372_10004023 Ga0157372_100040238 264
572 3300013307 Ga0157372_10019917 Ga0157372_100199179 264
573 3300013307 Ga0157372_10046686 Ga0157372_100466864 264
574 3300013307 Ga0157372_10095853 Ga0157372_100958532 264
575 3300013307 Ga0157372_10463599 Ga0157372_104635992 264
576 3300013308 Ga0157375_10005472 Ga0157375_100054725 264
577 3300013308 Ga0157375_10015648 Ga0157375_100156483 264
578 3300013308 Ga0157375_10124879 Ga0157375_101248793 264
579 3300013308 Ga0157375_10264323 Ga0157375_102643232 264
580 3300013308 Ga0157375_10332404 Ga0157375_103324042 264
581 3300014325 Ga0163163_10070660 Ga0163163_100706602 264
582 3300014325 Ga0163163_10250536 Ga0163163_102505363 264
583 3300014325 Ga0163163_10740804 Ga0163163_107408041 264
584 3300014326 Ga0157380_10052545 Ga0157380_100525453 264
585 3300014497 Ga0182008_10000023 Ga0182008_10000023113 264
586 3300014497 Ga0182008_10118496 Ga0182008_101184962 264
587 3300014968 Ga0157379_10004846 Ga0157379_1000484611 264
588 3300014969 Ga0157376_10195673 Ga0157376_101956732 264
589 3300014969 Ga0157376_10429912 Ga0157376_104299122 264
590 3300014969 Ga0157376_10899430 Ga0157376_108994301 264
591 3300015261 Ga0182006_1003750 Ga0182006_10037508 264
592 3300015261 Ga0182006_1011496 Ga0182006_10114962 264
593 3300017792 Ga0163161_10027330 Ga0163161_100273303 264
594 3300020077 Ga0206351_10377797 Ga0206351_103777971 264
595 3300020081 Ga0206354_10242601 Ga0206354_102426011 264
596 3300020081 Ga0206354_11168486 Ga0206354_111684862 264
597 3300020082 Ga0206353_10210928 Ga0206353_102109282 264
598 3300021320 Ga0214544_1000026 Ga0214544_100002658 264
599 3300021321 Ga0214542_1000025 Ga0214542_1000025103 264
600 3300021324 Ga0214545_1000014 Ga0214545_100001475 264
601 3300021327 Ga0214543_1000034 Ga0214543_1000034102 264
602 3300021384 Ga0213876_10021664 Ga0213876_100216643 264
603 3300024227 Ga0228598_1002128 Ga0228598_10021287 264
604 3300025246 Ga0209646_1000002 Ga0209646_1000002886 264
605 3300025250 Ga0209026_1000086 Ga0209026_1000086150 264
606 3300025253 Ga0209677_100874 Ga0209677_10087412 264
607 3300025261 Ga0209233_1000766 Ga0209233_100076611 264
608 3300025261 Ga0209233_1004428 Ga0209233_10044285 264
609 3300025261 Ga0209233_1027131 Ga0209233_10271312 264
610 3300025271 Ga0207666_1013043 Ga0207666_10130431 264
611 3300025272 Ga0209455_1003984 Ga0209455_10039845 264
612 3300025272 Ga0209455_1006055 Ga0209455_10060552 264
613 3300025273 Ga0209673_1045515 Ga0209673_10455152 264
614 3300025291 Ga0209675_1000692 Ga0209675_10006924 264
615 3300025294 Ga0209025_1000008 Ga0209025_1000008822 264
616 3300025295 Ga0209564_1000049 Ga0209564_1000049290 264
617 3300025295 Ga0209564_1000065 Ga0209564_100006563 264
618 3300025295 Ga0209564_1000248 Ga0209564_100024819 264
619 3300025297 Ga0209758_1001510 Ga0209758_100151021 264
620 3300025297 Ga0209758_1004242 Ga0209758_10042424 264
621 3300025297 Ga0209758_1037278 Ga0209758_10372782 264
622 3300025299 Ga0209256_1000014 Ga0209256_1000014349 264
623 3300025299 Ga0209256_1000200 Ga0209256_100020042 264
624 3300025302 Ga0207426_1001097 Ga0207426_100109714 264
625 3300025302 Ga0207426_1029203 Ga0207426_10292032 264
626 3300025315 Ga0207697_10042990 Ga0207697_100429902 264
627 3300025315 Ga0207697_10067325 Ga0207697_100673251 264
628 3300025315 Ga0207697_10078409 Ga0207697_100784092 264
629 3300025321 Ga0207656_10021724 Ga0207656_100217244 264
630 3300025321 Ga0207656_10162837 Ga0207656_101628371 264
631 3300025885 Ga0207653_10000605 Ga0207653_1000060511 264
632 3300025898 Ga0207692_10000295 Ga0207692_100002957 264
633 3300025898 Ga0207692_10013187 Ga0207692_100131874 264
634 3300025900 Ga0207710_10048100 Ga0207710_100481002 264
635 3300025900 Ga0207710_10053962 Ga0207710_100539622 264
636 3300025903 Ga0207680_10104280 Ga0207680_101042802 264
637 3300025904 Ga0207647_10028419 Ga0207647_100284193 264
638 3300025905 Ga0207685_10115129 Ga0207685_101151291 264
639 3300025906 Ga0207699_10007555 Ga0207699_100075553 264
640 3300025906 Ga0207699_10023406 Ga0207699_100234062 264
641 3300025906 Ga0207699_10102766 Ga0207699_101027662 264
642 3300025907 Ga0207645_10080365 Ga0207645_100803652 264
643 3300025909 Ga0207705_10002850 Ga0207705_100028505 264
644 3300025909 Ga0207705_10020137 Ga0207705_100201374 264
645 3300025909 Ga0207705_10020562 Ga0207705_100205624 264
646 3300025909 Ga0207705_10033577 Ga0207705_100335773 264
647 3300025911 Ga0207654_10011026 Ga0207654_100110263 264
648 3300025911 Ga0207654_10040629 Ga0207654_100406293 264
649 3300025911 Ga0207654_10085782 Ga0207654_100857822 264
650 3300025911 Ga0207654_10135041 Ga0207654_101350412 264
651 3300025911 Ga0207654_10377771 Ga0207654_103777711 264
652 3300025912 Ga0207707_10000455 Ga0207707_1000045535 264
653 3300025912 Ga0207707_10008592 Ga0207707_1000859210 264
654 3300025912 Ga0207707_10039737 Ga0207707_100397371 264
655 3300025912 Ga0207707_10160761 Ga0207707_101607612 264
656 3300025912 Ga0207707_10220712 Ga0207707_102207123 264
657 3300025912 Ga0207707_10265207 Ga0207707_102652072 264
658 3300025913 Ga0207695_10000013 Ga0207695_10000013290 264
659 3300025913 Ga0207695_10000014 Ga0207695_10000014674 264
660 3300025913 Ga0207695_10001701 Ga0207695_1000170135 264
661 3300025913 Ga0207695_10126008 Ga0207695_101260084 264
662 3300025914 Ga0207671_10000663 Ga0207671_1000066332 264
663 3300025914 Ga0207671_10045318 Ga0207671_100453185 264
664 3300025914 Ga0207671_10046369 Ga0207671_100463695 264
665 3300025914 Ga0207671_10055028 Ga0207671_100550283 264
666 3300025915 Ga0207693_10000674 Ga0207693_1000067418 264
667 3300025915 Ga0207693_10001851 Ga0207693_100018516 264
668 3300025915 Ga0207693_10067664 Ga0207693_100676642 264
669 3300025915 Ga0207693_10071644 Ga0207693_100716443 264
670 3300025916 Ga0207663_10001588 Ga0207663_100015884 264
671 3300025916 Ga0207663_10180901 Ga0207663_101809011 264
672 3300025916 Ga0207663_10213684 Ga0207663_102136842 264
673 3300025917 Ga0207660_10049603 Ga0207660_100496033 264
674 3300025917 Ga0207660_10106305 Ga0207660_101063052 264
675 3300025917 Ga0207660_10108200 Ga0207660_101082002 264
676 3300025917 Ga0207660_10402205 Ga0207660_104022052 264
677 3300025919 Ga0207657_10001360 Ga0207657_100013604 264
678 3300025919 Ga0207657_10010706 Ga0207657_100107063 264
679 3300025919 Ga0207657_10022581 Ga0207657_100225815 264
680 3300025919 Ga0207657_10025657 Ga0207657_100256571 264
681 3300025919 Ga0207657_10103629 Ga0207657_101036292 264
682 3300025919 Ga0207657_10141242 Ga0207657_101412422 264
683 3300025919 Ga0207657_10268549 Ga0207657_102685492 264
684 3300025920 Ga0207649_10258166 Ga0207649_102581662 264
685 3300025921 Ga0207652_10001894 Ga0207652_1000189411 264
686 3300025921 Ga0207652_10011235 Ga0207652_100112354 264
687 3300025921 Ga0207652_10014967 Ga0207652_100149676 264
688 3300025921 Ga0207652_10049693 Ga0207652_100496931 264
689 3300025921 Ga0207652_10312129 Ga0207652_103121291 264
690 3300025921 Ga0207652_10499422 Ga0207652_104994222 264
691 3300025922 Ga0207646_10097938 Ga0207646_100979382 264
692 3300025924 Ga0207694_10010880 Ga0207694_100108804 264
693 3300025925 Ga0207650_10026446 Ga0207650_100264462 264
694 3300025925 Ga0207650_10049296 Ga0207650_100492962 264
695 3300025925 Ga0207650_10152134 Ga0207650_101521342 264
696 3300025925 Ga0207650_10381831 Ga0207650_103818311 264
697 3300025926 Ga0207659_10021567 Ga0207659_100215673 264
698 3300025926 Ga0207659_10118249 Ga0207659_101182493 264
699 3300025926 Ga0207659_10129623 Ga0207659_101296232 264
700 3300025927 Ga0207687_10000003 Ga0207687_10000003158 264
701 3300025927 Ga0207687_10003248 Ga0207687_100032484 264
702 3300025927 Ga0207687_10022444 Ga0207687_100224441 264
703 3300025927 Ga0207687_10052440 Ga0207687_100524403 264
704 3300025927 Ga0207687_10141134 Ga0207687_101411342 264
705 3300025927 Ga0207687_10233614 Ga0207687_102336142 264
706 3300025928 Ga0207700_10007259 Ga0207700_100072597 264
707 3300025928 Ga0207700_10074150 Ga0207700_100741503 264
708 3300025928 Ga0207700_10101643 Ga0207700_101016433 264
709 3300025929 Ga0207664_10037043 Ga0207664_100370434 264
710 3300025929 Ga0207664_10055294 Ga0207664_100552943 264
711 3300025929 Ga0207664_10211874 Ga0207664_102118742 264
712 3300025929 Ga0207664_10229713 Ga0207664_102297131 264
713 3300025931 Ga0207644_10010758 Ga0207644_100107584 264
714 3300025932 Ga0207690_10088745 Ga0207690_100887452 264
715 3300025932 Ga0207690_10458793 Ga0207690_104587931 264
716 3300025933 Ga0207706_10036474 Ga0207706_100364744 264
717 3300025933 Ga0207706_10069282 Ga0207706_100692822 264
718 3300025933 Ga0207706_10510997 Ga0207706_105109972 264
719 3300025934 Ga0207686_10156952 Ga0207686_101569522 264
720 3300025935 Ga0207709_10164127 Ga0207709_101641272 264
721 3300025936 Ga0207670_10001802 Ga0207670_100018029 264
722 3300025936 Ga0207670_10001926 Ga0207670_100019263 264
723 3300025937 Ga0207669_10018303 Ga0207669_100183032 264
724 3300025938 Ga0207704_10029068 Ga0207704_100290684 264
725 3300025938 Ga0207704_10030086 Ga0207704_100300863 264
726 3300025938 Ga0207704_10179751 Ga0207704_101797512 264
727 3300025938 Ga0207704_10468658 Ga0207704_104686581 264
728 3300025938 Ga0207704_10515052 Ga0207704_105150521 264
729 3300025939 Ga0207665_10000214 Ga0207665_1000021425 264
730 3300025939 Ga0207665_10033322 Ga0207665_100333223 264
731 3300025939 Ga0207665_10033533 Ga0207665_100335332 264
732 3300025940 Ga0207691_10003072 Ga0207691_100030723 264
733 3300025940 Ga0207691_10065199 Ga0207691_100651993 264
734 3300025941 Ga0207711_10040565 Ga0207711_100405652 264
735 3300025942 Ga0207689_10278977 Ga0207689_102789772 264
736 3300025944 Ga0207661_10016302 Ga0207661_100163026 264
737 3300025944 Ga0207661_10079882 Ga0207661_100798822 264
738 3300025944 Ga0207661_10156701 Ga0207661_101567013 264
739 3300025944 Ga0207661_10176576 Ga0207661_101765762 264
740 3300025944 Ga0207661_10224409 Ga0207661_102244091 264
741 3300025944 Ga0207661_10294037 Ga0207661_102940373 264
742 3300025945 Ga0207679_10284023 Ga0207679_102840231 264
743 3300025945 Ga0207679_10301114 Ga0207679_103011142 264
744 3300025949 Ga0207667_10003451 Ga0207667_100034515 264
745 3300025949 Ga0207667_10023687 Ga0207667_100236874 264
746 3300025949 Ga0207667_10026202 Ga0207667_100262024 264
747 3300025949 Ga0207667_10049551 Ga0207667_100495513 264
748 3300025949 Ga0207667_10131918 Ga0207667_101319182 264
749 3300025949 Ga0207667_10133252 Ga0207667_101332522 264
750 3300025949 Ga0207667_10318830 Ga0207667_103188302 264
751 3300025949 Ga0207667_10593511 Ga0207667_105935111 264
752 3300025949 Ga0207667_10692218 Ga0207667_106922181 264
753 3300025960 Ga0207651_10001255 Ga0207651_1000125512 264
754 3300025960 Ga0207651_10022078 Ga0207651_100220781 264
755 3300025960 Ga0207651_10113782 Ga0207651_101137822 264
756 3300025960 Ga0207651_10288804 Ga0207651_102888042 264
757 3300025961 Ga0207712_10004027 Ga0207712_100040278 264
758 3300025961 Ga0207712_10100054 Ga0207712_101000544 264
759 3300025961 Ga0207712_10234213 Ga0207712_102342132 264
760 3300025972 Ga0207668_10008276 Ga0207668_100082763 264
761 3300025972 Ga0207668_10044071 Ga0207668_100440714 264
762 3300025972 Ga0207668_10047201 Ga0207668_100472012 264
763 3300025972 Ga0207668_10330858 Ga0207668_103308582 264
764 3300025981 Ga0207640_10000958 Ga0207640_100009589 264
765 3300025986 Ga0207658_10086543 Ga0207658_100865432 264
766 3300025986 Ga0207658_10141078 Ga0207658_101410782 264
767 3300026023 Ga0207677_10000035 Ga0207677_1000003564 264
768 3300026023 Ga0207677_10058641 Ga0207677_100586412 264
769 3300026035 Ga0207703_10000046 Ga0207703_1000004681 264
770 3300026035 Ga0207703_10191991 Ga0207703_101919913 264
771 3300026041 Ga0207639_10010790 Ga0207639_100107901 264
772 3300026041 Ga0207639_10016673 Ga0207639_100166732 264
773 3300026041 Ga0207639_10457561 Ga0207639_104575612 264
774 3300026067 Ga0207678_10015383 Ga0207678_100153833 264
775 3300026067 Ga0207678_10029610 Ga0207678_100296102 264
776 3300026067 Ga0207678_10035630 Ga0207678_100356303 264
777 3300026067 Ga0207678_10051481 Ga0207678_100514814 264
778 3300026067 Ga0207678_10154120 Ga0207678_101541202 264
779 3300026075 Ga0207708_10000034 Ga0207708_1000003468 264
780 3300026075 Ga0207708_10002177 Ga0207708_1000217711 264
781 3300026075 Ga0207708_10019003 Ga0207708_100190032 264
782 3300026075 Ga0207708_10089051 Ga0207708_100890513 264
783 3300026078 Ga0207702_10000041 Ga0207702_1000004113 264
784 3300026078 Ga0207702_10041037 Ga0207702_100410375 264
785 3300026078 Ga0207702_10173471 Ga0207702_101734712 264
786 3300026088 Ga0207641_10100166 Ga0207641_101001663 264
787 3300026089 Ga0207648_10217306 Ga0207648_102173063 264
788 3300026089 Ga0207648_10311891 Ga0207648_103118911 264
789 3300026095 Ga0207676_10000013 Ga0207676_10000013283 264
790 3300026095 Ga0207676_10165996 Ga0207676_101659962 264
791 3300026095 Ga0207676_10277754 Ga0207676_102777541 264
792 3300026116 Ga0207674_10004439 Ga0207674_100044398 264
793 3300026116 Ga0207674_10006751 Ga0207674_100067515 264
794 3300026116 Ga0207674_10008394 Ga0207674_100083945 264
795 3300026116 Ga0207674_10024824 Ga0207674_100248244 264
796 3300026116 Ga0207674_10043139 Ga0207674_100431394 264
797 3300026116 Ga0207674_10054103 Ga0207674_100541033 264
798 3300026116 Ga0207674_10603900 Ga0207674_106039002 264
799 3300026118 Ga0207675_100000058 Ga0207675_1000000582 264
800 3300026118 Ga0207675_100015761 Ga0207675_1000157614 264
801 3300026118 Ga0207675_100099716 Ga0207675_1000997163 264
802 3300026118 Ga0207675_100112893 Ga0207675_1001128934 264
803 3300026118 Ga0207675_100224130 Ga0207675_1002241303 264
804 3300026121 Ga0207683_10037653 Ga0207683_100376534 264
805 3300026121 Ga0207683_10038663 Ga0207683_100386632 264
806 3300026121 Ga0207683_10060645 Ga0207683_100606452 264
807 3300026121 Ga0207683_10067429 Ga0207683_100674293 264
808 3300026142 Ga0207698_10000882 Ga0207698_100008822 264
809 3300026142 Ga0207698_10016150 Ga0207698_100161503 264
810 3300026142 Ga0207698_10024459 Ga0207698_100244592 264
811 3300026142 Ga0207698_10035640 Ga0207698_100356403 264
812 3300026142 Ga0207698_10097212 Ga0207698_100972123 264
813 3300026142 Ga0207698_10106270 Ga0207698_101062703 264
814 3300026142 Ga0207698_10355920 Ga0207698_103559202 264
815 3300027296 Ga0209389_1000023 Ga0209389_100002379 264
816 3300027357 Ga0209589_1000010 Ga0209589_100001080 264
817 3300027361 Ga0209489_100011 Ga0209489_100011156 264
818 3300027671 Ga0209588_1017474 Ga0209588_10174742 264
819 3300027866 Ga0209813_10006099 Ga0209813_100060993 264
820 3300027907 Ga0207428_10000061 Ga0207428_1000006113 264
821 3300027907 Ga0207428_10003490 Ga0207428_100034903 264
822 3300027907 Ga0207428_10064444 Ga0207428_100644442 264
823 3300028379 Ga0268266_10013121 Ga0268266_100131212 264
824 3300028379 Ga0268266_10016287 Ga0268266_100162873 264
825 3300028379 Ga0268266_10054094 Ga0268266_100540943 264
826 3300028379 Ga0268266_10385033 Ga0268266_103850331 264
827 3300028379 Ga0268266_10619450 Ga0268266_106194501 264
828 3300028380 Ga0268265_10000170 Ga0268265_1000017060 264
829 3300028380 Ga0268265_10002176 Ga0268265_100021768 264
830 3300028381 Ga0268264_10000093 Ga0268264_1000009312 264
831 3300028381 Ga0268264_10014852 Ga0268264_100148525 264
832 3300028381 Ga0268264_10112031 Ga0268264_101120311 264
833 3300028381 Ga0268264_10295862 Ga0268264_102958622 264
834 3300028563 Ga0265319_1095150 Ga0265319_10951501 264
835 3300028573 Ga0265334_10027999 Ga0265334_100279992 264
836 3300028653 Ga0265323_10003068 Ga0265323_100030683 264
837 3300028666 Ga0265336_10000859 Ga0265336_1000085914 264
838 3300028666 Ga0265336_10003744 Ga0265336_100037442 264
839 3300028786 Ga0307517_10000085 Ga0307517_1000008538 264
840 3300028786 Ga0307517_10070050 Ga0307517_100700503 264
841 3300028786 Ga0307517_10082837 Ga0307517_100828373 264
842 3300028786 Ga0307517_10212282 Ga0307517_102122822 264
843 3300028794 Ga0307515_10011214 Ga0307515_100112145 264
844 3300028794 Ga0307515_10116112 Ga0307515_101161122 264
845 3300028800 Ga0265338_10000013 Ga0265338_10000013371 264
846 3300028800 Ga0265338_10011715 Ga0265338_100117158 264
847 3300028800 Ga0265338_10020201 Ga0265338_100202013 264
848 3300029957 Ga0265324_10000030 Ga0265324_10000030125 264
849 3300029957 Ga0265324_10012333 Ga0265324_100123332 264
850 3300029957 Ga0265324_10118916 Ga0265324_101189161 264
851 3300030521 Ga0307511_10141145 Ga0307511_101411452 264
852 3300031235 Ga0265330_10006124 Ga0265330_100061244 264
853 3300031239 Ga0265328_10000120 Ga0265328_100001203 264
854 3300031239 Ga0265328_10056618 Ga0265328_100566182 264
855 3300031240 Ga0265320_10001892 Ga0265320_100018925 264
856 3300031241 Ga0265325_10000289 Ga0265325_1000028912 264
857 3300031241 Ga0265325_10004960 Ga0265325_1000496010 264
858 3300031241 Ga0265325_10016721 Ga0265325_100167214 264
859 3300031249 Ga0265339_10001605 Ga0265339_1000160511 264
860 3300031249 Ga0265339_10013486 Ga0265339_100134864 264
861 3300031249 Ga0265339_10019139 Ga0265339_100191394 264
862 3300031249 Ga0265339_10082151 Ga0265339_100821512 264
863 3300031249 Ga0265339_10197389 Ga0265339_101973892 264
864 3300031251 Ga0265327_10038302 Ga0265327_100383022 264
865 3300031251 Ga0265327_10070456 Ga0265327_100704562 264
866 3300031344 Ga0265316_10142157 Ga0265316_101421572 264
867 3300031456 Ga0307513_10028716 Ga0307513_100287164 264
868 3300031507 Ga0307509_10086802 Ga0307509_100868023 264
869 3300031548 Ga0307408_100000183 Ga0307408_10000018312 264
870 3300031548 Ga0307408_100546737 Ga0307408_1005467372 264
871 3300031548 Ga0307408_100557376 Ga0307408_1005573761 264
872 3300031595 Ga0265313_10000644 Ga0265313_1000064427 264
873 3300031595 Ga0265313_10002595 Ga0265313_1000259511 264
874 3300031595 Ga0265313_10011673 Ga0265313_100116736 264
875 3300031616 Ga0307508_10053920 Ga0307508_100539202 264
876 3300031616 Ga0307508_10056249 Ga0307508_100562491 264
877 3300031711 Ga0265314_10024736 Ga0265314_100247364 264
878 3300031711 Ga0265314_10034452 Ga0265314_100344523 264
879 3300031711 Ga0265314_10052431 Ga0265314_100524315 264
880 3300031712 Ga0265342_10005779 Ga0265342_100057791 264
881 3300031712 Ga0265342_10135373 Ga0265342_101353732 264
882 3300031727 Ga0316576_10052362 Ga0316576_100523621 264
883 3300031727 Ga0316576_10121529 Ga0316576_101215292 264
884 3300031728 Ga0316578_10006597 Ga0316578_100065975 264
885 3300031730 Ga0307516_10000683 Ga0307516_1000068321 264
886 3300031730 Ga0307516_10025519 Ga0307516_100255193 264
887 3300031730 Ga0307516_10025796 Ga0307516_100257962 264
888 3300031730 Ga0307516_10033423 Ga0307516_100334232 264
889 3300031730 Ga0307516_10119591 Ga0307516_101195914 264
890 3300031730 Ga0307516_10226214 Ga0307516_102262142 264
891 3300031730 Ga0307516_10357482 Ga0307516_103574822 264
892 3300031733 Ga0316577_10012248 Ga0316577_100122483 264
893 3300031852 Ga0307410_10124823 Ga0307410_101248231 264
894 3300031901 Ga0307406_10586094 Ga0307406_105860942 264
895 3300031901 Ga0307406_10605590 Ga0307406_106055901 264
896 3300031903 Ga0307407_10063330 Ga0307407_100633302 264
897 3300031911 Ga0307412_10000004 Ga0307412_10000004249 264
898 3300031911 Ga0307412_10043611 Ga0307412_100436112 264
899 3300031911 Ga0307412_10128262 Ga0307412_101282622 264
900 3300031995 Ga0307409_100034390 Ga0307409_1000343902 264
901 3300031995 Ga0307409_100226263 Ga0307409_1002262633 264
902 3300031995 Ga0307409_100381920 Ga0307409_1003819202 264
903 3300031995 Ga0307409_100877577 Ga0307409_1008775772 264
904 3300032002 Ga0307416_100104122 Ga0307416_1001041224 264
905 3300032002 Ga0307416_100379893 Ga0307416_1003798932 264
906 3300032004 Ga0307414_10000313 Ga0307414_1000031328 264
907 3300032004 Ga0307414_10213170 Ga0307414_102131702 264
908 3300032005 Ga0307411_10020733 Ga0307411_100207333 264
909 3300032005 Ga0307411_10075747 Ga0307411_100757473 264
910 3300032126 Ga0307415_100012029 Ga0307415_1000120296 264
911 3300032126 Ga0307415_100326991 Ga0307415_1003269911 264
912 3300033179 Ga0307507_10077207 Ga0307507_100772072 264
913 3300033180 Ga0307510_10009700 Ga0307510_100097007 264
914 3300033180 Ga0307510_10038953 Ga0307510_100389537 264
915 3300035084 Ga0373928_0023913 Ga0373928_0023913_406_1200 264
916 3300035085 Ga0373929_0016201 Ga0373929_0016201_643_1437 264
917 3300035086 Ga0373934_0092763 Ga0373934_0092763_398_1192 264
918 3300035090 Ga0373949_0057431 Ga0373949_0057431_39_833 264
919 3300035092 Ga0373952_0004006 Ga0373952_0004006_1109_1903 264
920 3300035113 Ga0373936_0119026 Ga0373936_0119026_112_1035 264
921 3300035114 Ga0373939_0042943 Ga0373939_0042943_90_884 264
922 3300035116 Ga0373945_0023726 Ga0373945_0023726_657_1580 264
923 3300035117 Ga0373953_0015389 Ga0373953_0015389_1608_2402 264
924 3300035118 Ga0373954_0046188 Ga0373954_0046188_398_1192 264
925 3300035119 Ga0373956_0166097 Ga0373956_0166097_96_890 264
926 3300035170 Ga0373943_0026562 Ga0373943_0026562_607_1530 264
927 3300035171 Ga0373946_0014317 Ga0373946_0014317_1644_2438 264
928 3300035171 Ga0373946_0092576 Ga0373946_0092576_222_1016 264
929 3300035172 Ga0373955_0011011 Ga0373955_0011011_2847_3641 264
930 3300035172 Ga0373955_0067511 Ga0373955_0067511_1131_1925 264
931 3300035172 Ga0373955_0363132 Ga0373955_0363132_15_809 264
932 3300035207 Ga0373942_0027692 Ga0373942_0027692_450_1244 264
933 3300035241 Ga0373961_0004146 Ga0373961_0004146_1085_1879 264
934 3300035241 Ga0373961_0038190 Ga0373961_0038190_143_937 264
935 3300035241 Ga0373961_0042104 Ga0373961_0042104_322_1116 264
936 3300035242 Ga0373962_0007004 Ga0373962_0007004_338_1132 264
937 3300035398 Ga0316574_0008438 Ga0316574_0008438_1226_2020 264
938 3300035398 Ga0316574_0074147 Ga0316574_0074147_749_1543 264
939 3300035398 Ga0316574_0240295 Ga0316574_0240295_252_1046 264
940 3300035410 Ga0373924_0033016 Ga0373924_0033016_442_1365 264
941 3300035410 Ga0373924_0041591 Ga0373924_0041591_793_1587 264
942 3300035691 Ga0373931_0000311 Ga0373931_0000311_3634_4428 264
943 3300035691 Ga0373931_0001895 Ga0373931_0001895_844_1638 264
944 3300035691 Ga0373931_0002367 Ga0373931_0002367_1219_2013 264
945 3300035691 Ga0373931_0015481 Ga0373931_0015481_2116_2910 264
946 3300035691 Ga0373931_0075912 Ga0373931_0075912_185_979 264
947 3300035692 Ga0373935_0003068 Ga0373935_0003068_8566_9489 264
948 3300035692 Ga0373935_0080381 Ga0373935_0080381_811_1605 264
949 3300035692 Ga0373935_0211476 Ga0373935_0211476_325_1119 264
950 3300035692 Ga0373935_0270836 Ga0373935_0270836_127_921 264
951 3300035695 Ga0373927_0004108 Ga0373927_0004108_3714_4637 264
952 3300035695 Ga0373927_0005360 Ga0373927_0005360_4851_5645 264
953 3300035695 Ga0373927_0052572 Ga0373927_0052572_578_1372 264
954 3300035724 Ga0373933_0000933 Ga0373933_0000933_8082_8876 264
955 3300035724 Ga0373933_0061032 Ga0373933_0061032_655_1449 264
956 3300035725 Ga0373947_0006080 Ga0373947_0006080_1838_2761 264
957 3300035725 Ga0373947_0008409 Ga0373947_0008409_3179_3973 264
958 3300036401 Ga0373937_0045613 Ga0373937_0045613_703_1626 264
959 3300036401 Ga0373937_0088430 Ga0373937_0088430_1708_2502 264
960 3300036401 Ga0373937_0121480 Ga0373937_0121480_1093_1887 264
961 3300036401 Ga0373937_0168020 Ga0373937_0168020_177_971 264
962 3300036712 Ga0316584_0091839 Ga0316584_0091839_571_1365 264
963 3300037068 Ga0373925_0028943 Ga0373925_0028943_320_1243 264
964 3300037068 Ga0373925_0068998 Ga0373925_0068998_163_957 264
965 3300037068 Ga0373925_0284042 Ga0373925_0284042_324_1118 264
966 3300037068 Ga0373925_0501794 Ga0373925_0501794_62_856 264
967 3300037068 Ga0373925_0549490 Ga0373925_0549490_39_833 264
968 3300037312 Ga0395899_0005004 Ga0395899_0005004_5870_6664 264
969 3300037418 Ga0395900_0000126 Ga0395900_0000126_59819_60613 264
970 3300037418 Ga0395900_0186497 Ga0395900_0186497_26_829 264
971 3300037418 Ga0395900_0255536 Ga0395900_0255536_640_1434 264
972 3300037466 Ga0395898_0031059 Ga0395898_0031059_3744_4538 264
973 3300037466 Ga0395898_0193692 Ga0395898_0193692_911_1705 264
974 3300037471 Ga0395905_0001098 Ga0395905_0001098_31627_32421 264
975 3300038443 Ga0395901_0000249 Ga0395901_0000249_59799_60593 264
976 3300038443 Ga0395901_0046475 Ga0395901_0046475_2370_3173 264
977 3300038443 Ga0395901_0068530 Ga0395901_0068530_1592_2386 264
978 3300038443 Ga0395901_0322404 Ga0395901_0322404_520_1314 264
979 3300038443 Ga0395901_0460761 Ga0395901_0460761_230_1024 264
980 3300039437 Ga0436365_0021051 Ga0436365_0021051_229_1023 264
981 3300039437 Ga0436365_0523062 Ga0436365_0523062_2989_3783 264
982 3300039437 Ga0436365_1782545 Ga0436365_1782545_2085_2879 264
983 3300039447 Ga0436361_0728889 Ga0436361_0728889_880_1698 264
984 3300039450 Ga0436363_0751650 Ga0436363_0751650_90_884 264
985 3300039453 Ga0436362_0128160 Ga0436362_0128160_4483_5277 264
986 3300041411 Ga0439466_0069963 Ga0439466_0069963_189_983 264
987 3300041413 Ga0439465_0088166 Ga0439465_0088166_91_885 264
988 3300041512 Ga0451853_2754853 Ga0451853_2754853_1851_2645 264
989 3300041999 Ga0439433_0009247 Ga0439433_0009247_456_1250 264
990 3300042011 Ga0439454_004785 Ga0439454_004785_149_1003 264
991 3300042156 Ga0439446_0107479 Ga0439446_0107479_71_865 264
992 3300042876 Ga0451577_0000339 Ga0451577_0000339_70108_70902 264
993 3300042876 Ga0451577_0002271 Ga0451577_0002271_11946_12740 264
994 3300044658 Ga0466972_0000185 Ga0466972_0000185_47518_48312 264
995 3300044658 Ga0466972_0134507 Ga0466972_0134507_89_883 264
996 3300044672 Ga0466982_0000003 Ga0466982_0000003_73742_74536 264
997 3300044673 Ga0453683_0006567 Ga0453683_0006567_6634_7428 264
998 3300044673 Ga0453683_0352300 Ga0453683_0352300_98_892 264
999 3300044684 Ga0466966_0003932 Ga0466966_0003932_6587_7381 264
1000 3300044684 Ga0466966_0072786 Ga0466966_0072786_769_1563 264
1001 3300044706 Ga0466964_0001690 Ga0466964_0001690_822_1616 264
1002 3300044712 Ga0453684_0000063 Ga0453684_0000063_8620_9414 264
1003 3300044712 Ga0453684_0000065 Ga0453684_0000065_201277_202071 264
1004 3300044712 Ga0453684_0000369 Ga0453684_0000369_166406_167200 264
1005 3300044712 Ga0453684_0000677 Ga0453684_0000677_94606_95400 264
1006 3300044712 Ga0453684_0000846 Ga0453684_0000846_22110_22904 264
1007 3300044712 Ga0453684_0001472 Ga0453684_0001472_62496_63290 264
1008 3300044712 Ga0453684_0008351 Ga0453684_0008351_15646_16440 264
1009 3300044712 Ga0453684_0056656 Ga0453684_0056656_1724_2584 264
1010 3300044712 Ga0453684_0300239 Ga0453684_0300239_577_1371 264
1011 3300044719 Ga0466971_0012312 Ga0466971_0012312_1137_1931 264
1012 3300044735 Ga0466968_0001743 Ga0466968_0001743_5493_6287 264
1013 3300044765 Ga0466970_0014536 Ga0466970_0014536_1374_2168 264
1014 3300045051 Ga0451576_0000175 Ga0451576_0000175_80861_81655 264
1015 3300045051 Ga0451576_0002720 Ga0451576_0002720_14985_15779 264
1016 3300045051 Ga0451576_0005625 Ga0451576_0005625_8061_8855 264
1017 3300045051 Ga0451576_0013554 Ga0451576_0013554_4834_5628 264
1018 3300045051 Ga0451576_0108803 Ga0451576_0108803_554_1348 264
1019 3300045976 Ga0466967_0781313 Ga0466967_0781313_59_853 264
1020 3300046454 Ga0495592_0006658 Ga0495592_0006658_1204_2127 264
1021 3300046455 Ga0495603_0000064 Ga0495603_0000064_9946_10869 264
1022 3300046455 Ga0495603_0023901 Ga0495603_0023901_609_1403 264
1023 3300046455 Ga0495603_0029475 Ga0495603_0029475_727_1521 264
1024 3300046459 Ga0495629_0001385 Ga0495629_0001385_8505_9428 264
1025 3300046459 Ga0495629_0056265 Ga0495629_0056265_308_1102 264
1026 3300046459 Ga0495629_0095759 Ga0495629_0095759_436_1230 264
1027 3300046459 Ga0495629_0139921 Ga0495629_0139921_149_943 264
1028 3300046459 Ga0495629_0381925 Ga0495629_0381925_137_931 264
1029 3300046460 Ga0495638_0007547 Ga0495638_0007547_5511_6305 264
1030 3300046460 Ga0495638_0021678 Ga0495638_0021678_3170_3964 264
1031 3300046460 Ga0495638_0086312 Ga0495638_0086312_231_1025 264
1032 3300046461 Ga0495641_0005307 Ga0495641_0005307_4553_5476 264
1033 3300046462 Ga0495651_0056086 Ga0495651_0056086_665_1459 264
1034 3300046463 Ga0495653_0332515 Ga0495653_0332515_28_822 264
1035 3300046471 Ga0495650_0063228 Ga0495650_0063228_21_815 264
1036 3300046472 Ga0495580_0006847 Ga0495580_0006847_991_1914 264
1037 3300046472 Ga0495580_0190002 Ga0495580_0190002_68_862 264
1038 3300046473 Ga0495582_0000173 Ga0495582_0000173_5990_6913 264
1039 3300046473 Ga0495582_0149179 Ga0495582_0149179_265_1059 264
1040 3300046475 Ga0495639_0000218 Ga0495639_0000218_3777_4700 264
1041 3300046475 Ga0495639_0085081 Ga0495639_0085081_242_1036 264
1042 3300046475 Ga0495639_0189848 Ga0495639_0189848_145_939 264
1043 3300046475 Ga0495639_0265184 Ga0495639_0265184_32_826 264
1044 3300046477 Ga0495664_0041556 Ga0495664_0041556_297_1091 264
1045 3300046477 Ga0495664_0045785 Ga0495664_0045785_1785_2579 264
1046 3300046477 Ga0495664_0078800 Ga0495664_0078800_904_1698 264
1047 3300046477 Ga0495664_0134197 Ga0495664_0134197_62_856 264
1048 3300046491 Ga0495584_0189261 Ga0495584_0189261_161_955 264
1049 3300046492 Ga0495585_0105649 Ga0495585_0105649_250_1044 264
1050 3300046499 Ga0495594_0000590 Ga0495594_0000590_8026_8949 264
1051 3300046506 Ga0495583_0138352 Ga0495583_0138352_189_983 264
1052 3300046507 Ga0495606_0000976 Ga0495606_0000976_23823_24617 264
1053 3300046507 Ga0495606_0040906 Ga0495606_0040906_102_896 264
1054 3300046507 Ga0495606_0084562 Ga0495606_0084562_1135_1929 264
1055 3300046507 Ga0495606_0189410 Ga0495606_0189410_153_947 264
1056 3300046513 Ga0495616_0152310 Ga0495616_0152310_104_898 264
1057 3300046516 Ga0495628_0020280 Ga0495628_0020280_4595_5389 264
1058 3300046516 Ga0495628_0123368 Ga0495628_0123368_822_1616 264
1059 3300046517 Ga0495630_0000613 Ga0495630_0000613_7965_8888 264
1060 3300046517 Ga0495630_0161775 Ga0495630_0161775_64_858 264
1061 3300046517 Ga0495630_0210794 Ga0495630_0210794_119_913 264
1062 3300046518 Ga0495631_0025561 Ga0495631_0025561_1689_2483 264
1063 3300046518 Ga0495631_0102424 Ga0495631_0102424_222_1016 264
1064 3300046519 Ga0495632_0061385 Ga0495632_0061385_379_1173 264
1065 3300046523 Ga0495644_0083683 Ga0495644_0083683_377_1171 264
1066 3300046524 Ga0495648_0003170 Ga0495648_0003170_6837_7631 264
1067 3300046524 Ga0495648_0006291 Ga0495648_0006291_6297_7091 264
1068 3300046524 Ga0495648_0010776 Ga0495648_0010776_544_1338 264
1069 3300046524 Ga0495648_0060459 Ga0495648_0060459_92_886 264
1070 3300046526 Ga0495666_0015057 Ga0495666_0015057_329_1123 264
1071 3300046528 Ga0495642_0086051 Ga0495642_0086051_52_846 264
1072 3300046529 Ga0495652_0050312 Ga0495652_0050312_517_1440 264
1073 3300046529 Ga0495652_0106248 Ga0495652_0106248_833_1627 264
1074 3300046529 Ga0495652_0200960 Ga0495652_0200960_58_852 264
1075 3300046530 Ga0495654_0068911 Ga0495654_0068911_363_1157 264
1076 3300046531 Ga0495665_0000531 Ga0495665_0000531_4028_4951 264
1077 3300046533 Ga0495640_0001572 Ga0495640_0001572_14289_15212 264
1078 3300046533 Ga0495640_0173760 Ga0495640_0173760_273_1067 264
1079 3300046533 Ga0495640_0266369 Ga0495640_0266369_177_971 264
1080 3300046536 Ga0495587_0089108 Ga0495587_0089108_654_1448 264
1081 3300046537 Ga0495598_0022585 Ga0495598_0022585_156_950 264
1082 3300046543 Ga0495645_0017708 Ga0495645_0017708_62_856 264
1083 3300046543 Ga0495645_0200435 Ga0495645_0200435_49_843 264
1084 3300046557 Ga0495622_0004472 Ga0495622_0004472_3915_4709 264
1085 3300046557 Ga0495622_0007156 Ga0495622_0007156_2983_3777 264
1086 3300046559 Ga0495667_0011222 Ga0495667_0011222_193_987 264
1087 3300046559 Ga0495667_0185640 Ga0495667_0185640_148_942 264
1088 3300046615 Ga0495656_0005268 Ga0495656_0005268_1206_2000 264
1089 3300046616 Ga0495668_0044002 Ga0495668_0044002_28_822 264
1090 3300046642 Ga0495634_0005581 Ga0495634_0005581_7893_8816 264
1091 3300046648 Ga0495611_0101743 Ga0495611_0101743_102_896 264
1092 3300046660 Ga0495625_0026116 Ga0495625_0026116_1325_2119 264
1093 3300046660 Ga0495625_0245479 Ga0495625_0245479_308_1102 264
1094 3300046660 Ga0495625_0292825 Ga0495625_0292825_195_989 264
1095 3300046663 Ga0495635_0125225 Ga0495635_0125225_853_1647 264
1096 3300046664 Ga0495659_0006815 Ga0495659_0006815_1478_2272 264
1097 3300046665 Ga0495661_0071445 Ga0495661_0071445_167_961 264
1098 3300046674 Ga0495588_0022423 Ga0495588_0022423_1889_2812 264
1099 3300046674 Ga0495588_0025243 Ga0495588_0025243_625_1419 264
1100 3300046674 Ga0495588_0043652 Ga0495588_0043652_494_1288 264
1101 3300046675 Ga0495657_0067110 Ga0495657_0067110_654_1448 264
1102 3300046678 Ga0495599_0091836 Ga0495599_0091836_163_957 264
1103 3300046679 Ga0495623_0005573 Ga0495623_0005573_3369_4163 264
1104 3300046679 Ga0495623_0015377 Ga0495623_0015377_1709_2503 264
1105 3300046679 Ga0495623_0039786 Ga0495623_0039786_1351_2145 264
1106 3300046679 Ga0495623_0127850 Ga0495623_0127850_291_1085 264
1107 3300046680 Ga0495646_0007737 Ga0495646_0007737_2283_3206 264
1108 3300046680 Ga0495646_0018063 Ga0495646_0018063_739_1533 264
1109 3300046680 Ga0495646_0177824 Ga0495646_0177824_178_972 264
1110 3300046681 Ga0495647_0001441 Ga0495647_0001441_2889_3812 264
1111 3300046681 Ga0495647_0189555 Ga0495647_0189555_79_873 264
1112 3300046683 Ga0495658_0001201 Ga0495658_0001201_4640_5563 264
1113 3300046683 Ga0495658_0121574 Ga0495658_0121574_248_1042 264
1114 3300046683 Ga0495658_0173644 Ga0495658_0173644_268_1062 264
1115 3300046683 Ga0495658_0194425 Ga0495658_0194425_440_1234 264
1116 3300046684 Ga0495669_0000675 Ga0495669_0000675_5860_6654 264
1117 3300046689 Ga0495613_0004213 Ga0495613_0004213_9204_10127 264
1118 3300046689 Ga0495613_0022119 Ga0495613_0022119_1162_1956 264
1119 3300046690 Ga0495624_0005853 Ga0495624_0005853_3319_4242 264
1120 3300046691 Ga0495670_0012092 Ga0495670_0012092_1338_2132 264
1121 3300046694 Ga0495649_0192146 Ga0495649_0192146_177_971 264
1122 3300046809 Ga0495600_0134287 Ga0495600_0134287_637_1431 264
1123 3300047315 Ga0495581_0000015 Ga0495581_0000015_49915_50838 264
1124 3300047317 Ga0495604_0007695 Ga0495604_0007695_438_1232 264
1125 3300047317 Ga0495604_0184641 Ga0495604_0184641_444_1238 264
1126 3300047319 Ga0495674_0023636 Ga0495674_0023636_608_1402 264
1127 3300047319 Ga0495674_0188042 Ga0495674_0188042_194_988 264
1128 3300047319 Ga0495674_0260327 Ga0495674_0260327_513_1307 264
1129 3300047320 Ga0495672_0029388 Ga0495672_0029388_1702_2496 264
1130 3300047320 Ga0495672_0030049 Ga0495672_0030049_2530_3324 264
1131 3300047320 Ga0495672_0078929 Ga0495672_0078929_443_1237 264
1132 3300047321 Ga0495676_0010028 Ga0495676_0010028_681_1604 264
1133 3300047321 Ga0495676_0068201 Ga0495676_0068201_740_1534 264
1134 3300047322 Ga0495680_0028809 Ga0495680_0028809_2927_3721 264
1135 3300047322 Ga0495680_0286456 Ga0495680_0286456_254_1048 264
1136 3300047443 Ga0495687_000014 Ga0495687_000014_164997_165791 264
1137 3300047444 Ga0495675_0184391 Ga0495675_0184391_65_859 264
1138 3300047445 Ga0495677_0050316 Ga0495677_0050316_262_1056 264
1139 3300047445 Ga0495677_0062158 Ga0495677_0062158_264_1058 264
1140 3300047469 Ga0495673_0011722 Ga0495673_0011722_2299_3093 264
1141 3300047469 Ga0495673_0122979 Ga0495673_0122979_127_921 264
1142 3300047471 Ga0495684_0020248 Ga0495684_0020248_1722_2645 264
1143 3300047471 Ga0495684_0107992 Ga0495684_0107992_1183_1977 264
1144 3300047471 Ga0495684_0142254 Ga0495684_0142254_614_1408 264
1145 3300047472 Ga0495686_0118536 Ga0495686_0118536_661_1455 264
1146 3300047673 Ga0495593_0000053 Ga0495593_0000053_9816_10739 264
1147 3300048088 Ga0495602_0028411 Ga0495602_0028411_641_1435 264
1148 3300048088 Ga0495602_0233166 Ga0495602_0233166_463_1257 264
1149 3300048088 Ga0495602_0517644 Ga0495602_0517644_11_805 264
1150 3300048089 Ga0495614_0013513 Ga0495614_0013513_467_1390 264
1151 3300048903 Ga0496100_0001613 Ga0496100_0001613_7497_8291 264
1152 3300048903 Ga0496100_0022737 Ga0496100_0022737_986_1888 264
1153 3300048903 Ga0496100_0103566 Ga0496100_0103566_959_1753 264
1154 3300048903 Ga0496100_0157079 Ga0496100_0157079_245_1039 264
1155 3300048903 Ga0496100_0163165 Ga0496100_0163165_536_1330 264
1156 3300048904 Ga0496101_0004421 Ga0496101_0004421_1965_2759 264
1157 3300048904 Ga0496101_0009601 Ga0496101_0009601_431_1234 264
1158 3300048904 Ga0496101_0016002 Ga0496101_0016002_2589_3383 264
1159 3300048904 Ga0496101_0051545 Ga0496101_0051545_1372_2166 264
1160 3300048904 Ga0496101_0194944 Ga0496101_0194944_747_1541 264
1161 3300048904 Ga0496101_0323504 Ga0496101_0323504_323_1117 264
1162 3300048905 Ga0496102_0002733 Ga0496102_0002733_10169_10963 264
1163 3300048905 Ga0496102_0004127 Ga0496102_0004127_11354_12148 264
1164 3300048905 Ga0496102_0010509 Ga0496102_0010509_95_889 264
1165 3300048905 Ga0496102_0012054 Ga0496102_0012054_306_1100 264
1166 3300048905 Ga0496102_0039048 Ga0496102_0039048_1939_2742 264
1167 3300048905 Ga0496102_0075894 Ga0496102_0075894_248_1042 264
1168 3300048905 Ga0496102_0374801 Ga0496102_0374801_141_935 264
1169 3300048905 Ga0496102_0466179 Ga0496102_0466179_114_908 264
1170 3300048906 Ga0496103_0018374 Ga0496103_0018374_2653_3447 264
1171 3300048906 Ga0496103_0024344 Ga0496103_0024344_1190_1984 264
1172 3300048906 Ga0496103_0028159 Ga0496103_0028159_1827_2621 264
1173 3300048906 Ga0496103_0060299 Ga0496103_0060299_600_1394 264
1174 3300048907 Ga0496104_0005875 Ga0496104_0005875_7795_8697 264
1175 3300048907 Ga0496104_0107198 Ga0496104_0107198_1717_2511 264
1176 3300048907 Ga0496104_0156129 Ga0496104_0156129_772_1566 264
1177 3300048907 Ga0496104_0241888 Ga0496104_0241888_248_1042 264
1178 3300048907 Ga0496104_0544724 Ga0496104_0544724_40_843 264
1179 3300048908 Ga0496105_0004722 Ga0496105_0004722_3753_4547 264
1180 3300048908 Ga0496105_0011342 Ga0496105_0011342_1762_2556 264
1181 3300048908 Ga0496105_0031311 Ga0496105_0031311_2692_3486 264
1182 3300048908 Ga0496105_0058692 Ga0496105_0058692_1633_2427 264
1183 3300048908 Ga0496105_0502404 Ga0496105_0502404_23_817 264
1184 3300048909 Ga0496106_0001015 Ga0496106_0001015_18218_19012 264
1185 3300048909 Ga0496106_0005543 Ga0496106_0005543_7393_8187 264
1186 3300048909 Ga0496106_0009070 Ga0496106_0009070_3835_4629 264
1187 3300048909 Ga0496106_0033461 Ga0496106_0033461_933_1736 264
1188 3300048909 Ga0496106_0040286 Ga0496106_0040286_947_1741 264
1189 3300048909 Ga0496106_0130287 Ga0496106_0130287_268_1062 264
1190 3300048910 Ga0496107_0004695 Ga0496107_0004695_3695_4597 264
1191 3300048910 Ga0496107_0004750 Ga0496107_0004750_3593_4387 264
1192 3300048910 Ga0496107_0010483 Ga0496107_0010483_722_1516 264
1193 3300048910 Ga0496107_0021151 Ga0496107_0021151_738_1532 264
1194 3300048910 Ga0496107_0025412 Ga0496107_0025412_1668_2462 264
1195 3300048910 Ga0496107_0040274 Ga0496107_0040274_1122_1925 264
1196 3300048910 Ga0496107_0135756 Ga0496107_0135756_660_1454 264
1197 3300048911 Ga0496108_0001846 Ga0496108_0001846_5543_6445 264
1198 3300048911 Ga0496108_0056123 Ga0496108_0056123_810_1604 264
1199 3300048911 Ga0496108_0059130 Ga0496108_0059130_152_946 264
1200 3300048911 Ga0496108_0067242 Ga0496108_0067242_1443_2237 264
1201 3300048911 Ga0496108_0068040 Ga0496108_0068040_1690_2484 264
1202 3300048911 Ga0496108_0134300 Ga0496108_0134300_172_966 264
1203 3300048911 Ga0496108_0144379 Ga0496108_0144379_832_1626 264
1204 3300048911 Ga0496108_0162530 Ga0496108_0162530_427_1221 264
1205 3300048911 Ga0496108_0195638 Ga0496108_0195638_560_1354 264
1206 3300048912 Ga0496109_0001905 Ga0496109_0001905_14780_15574 264
1207 3300048912 Ga0496109_0007688 Ga0496109_0007688_7397_8191 264
1208 3300048912 Ga0496109_0010512 Ga0496109_0010512_3939_4733 264
1209 3300048912 Ga0496109_0021929 Ga0496109_0021929_487_1281 264
1210 3300048912 Ga0496109_0090748 Ga0496109_0090748_1373_2167 264
1211 3300048912 Ga0496109_0135180 Ga0496109_0135180_403_1206 264
1212 3300048912 Ga0496109_0181768 Ga0496109_0181768_53_847 264
1213 3300048913 Ga0496110_0000747 Ga0496110_0000747_17925_18719 264
1214 3300048913 Ga0496110_0007695 Ga0496110_0007695_1126_1920 264
1215 3300048913 Ga0496110_0018621 Ga0496110_0018621_2025_2819 264
1216 3300048913 Ga0496110_0045963 Ga0496110_0045963_1350_2153 264
1217 3300048913 Ga0496110_0175184 Ga0496110_0175184_86_880 264
1218 3300048913 Ga0496110_0244693 Ga0496110_0244693_805_1599 264
1219 3300048914 Ga0496111_0002943 Ga0496111_0002943_5696_6490 264
1220 3300048914 Ga0496111_0003597 Ga0496111_0003597_4315_5109 264
1221 3300048914 Ga0496111_0060507 Ga0496111_0060507_1905_2699 264
1222 3300048914 Ga0496111_0082770 Ga0496111_0082770_903_1697 264
1223 3300048914 Ga0496111_0127639 Ga0496111_0127639_1035_1829 264
1224 3300048914 Ga0496111_0569807 Ga0496111_0569807_23_817 264
1225 3300048915 Ga0496112_0000008 Ga0496112_0000008_60721_61515 264
1226 3300048915 Ga0496112_0002552 Ga0496112_0002552_11081_11875 264
1227 3300048915 Ga0496112_0025326 Ga0496112_0025326_3862_4656 264
1228 3300048915 Ga0496112_0025430 Ga0496112_0025430_2439_3233 264
1229 3300048915 Ga0496112_0070372 Ga0496112_0070372_1461_2255 264
1230 3300048915 Ga0496112_0080021 Ga0496112_0080021_15_809 264
1231 3300048915 Ga0496112_0109901 Ga0496112_0109901_377_1171 264
1232 3300048915 Ga0496112_0128842 Ga0496112_0128842_1447_2250 264
1233 3300048915 Ga0496112_0181220 Ga0496112_0181220_1228_2022 264
1234 3300048916 Ga0496113_0005354 Ga0496113_0005354_774_1568 264
1235 3300048916 Ga0496113_0006480 Ga0496113_0006480_4766_5560 264
1236 3300048916 Ga0496113_0066360 Ga0496113_0066360_190_984 264
1237 3300048917 Ga0496114_0004664 Ga0496114_0004664_3447_4241 264
1238 3300048917 Ga0496114_0008103 Ga0496114_0008103_2550_3344 264
1239 3300048917 Ga0496114_0046088 Ga0496114_0046088_1935_2729 264
1240 3300048917 Ga0496114_0116474 Ga0496114_0116474_1459_2253 264
1241 3300048917 Ga0496114_0197004 Ga0496114_0197004_805_1599 264
1242 3300048918 Ga0496115_0005898 Ga0496115_0005898_2514_3308 264
1243 3300048918 Ga0496115_0018787 Ga0496115_0018787_716_1510 264
1244 3300048918 Ga0496115_0049876 Ga0496115_0049876_80_874 264
1245 3300048919 Ga0496116_0014758 Ga0496116_0014758_530_1324 264
1246 3300048919 Ga0496116_0024015 Ga0496116_0024015_1433_2227 264
1247 3300048920 Ga0496117_0034418 Ga0496117_0034418_1788_2612 264
1248 3300048920 Ga0496117_0134878 Ga0496117_0134878_66_860 264
1249 3300048920 Ga0496117_0149044 Ga0496117_0149044_217_1011 264
1250 3300048921 Ga0496118_0006042 Ga0496118_0006042_3479_4273 264
1251 3300048921 Ga0496118_0012813 Ga0496118_0012813_2440_3234 264
1252 3300048921 Ga0496118_0022887 Ga0496118_0022887_4633_5427 264
1253 3300048921 Ga0496118_0059237 Ga0496118_0059237_1823_2617 264
1254 3300048921 Ga0496118_0062556 Ga0496118_0062556_726_1520 264
1255 3300048921 Ga0496118_0134632 Ga0496118_0134632_373_1167 264
1256 3300048922 Ga0496119_0033029 Ga0496119_0033029_1053_1847 264
1257 3300048922 Ga0496119_0108770 Ga0496119_0108770_411_1205 264
1258 3300048923 Ga0496120_0040615 Ga0496120_0040615_1899_2693 264
1259 3300048923 Ga0496120_0052278 Ga0496120_0052278_192_986 264
1260 3300048923 Ga0496120_0074274 Ga0496120_0074274_16_810 264
1261 3300048924 Ga0496121_0000178 Ga0496121_0000178_41456_42250 264
1262 3300048924 Ga0496121_0000381 Ga0496121_0000381_12327_13121 264
1263 3300048924 Ga0496121_0000894 Ga0496121_0000894_33086_33880 264
1264 3300048924 Ga0496121_0019860 Ga0496121_0019860_349_1143 264
1265 3300048924 Ga0496121_0035897 Ga0496121_0035897_2050_2844 264
1266 3300048924 Ga0496121_0038473 Ga0496121_0038473_3365_4159 264
1267 3300048924 Ga0496121_0100972 Ga0496121_0100972_234_1028 264
1268 3300048924 Ga0496121_0117262 Ga0496121_0117262_1206_2000 264
1269 3300048924 Ga0496121_0393422 Ga0496121_0393422_33_827 264
1270 3300048925 Ga0496122_0000772 Ga0496122_0000772_24902_25696 264
1271 3300048925 Ga0496122_0048671 Ga0496122_0048671_1374_2168 264
1272 3300048925 Ga0496122_0064902 Ga0496122_0064902_437_1261 264
1273 3300048925 Ga0496122_0213233 Ga0496122_0213233_312_1106 264
1274 3300048926 Ga0496123_0000613 Ga0496123_0000613_27956_28750 264
1275 3300048927 Ga0496124_0000599 Ga0496124_0000599_5674_6468 264
1276 3300048928 Ga0496125_0000203 Ga0496125_0000203_109287_110081 264
1277 3300048928 Ga0496125_0009067 Ga0496125_0009067_4654_5448 264
1278 3300048928 Ga0496125_0021155 Ga0496125_0021155_3638_4432 264
1279 3300048928 Ga0496125_0060231 Ga0496125_0060231_2246_3040 264
1280 3300048928 Ga0496125_0076632 Ga0496125_0076632_620_1414 264
1281 3300048928 Ga0496125_0080380 Ga0496125_0080380_918_1712 264
1282 3300048928 Ga0496125_0089567 Ga0496125_0089567_1464_2258 264
1283 3300048928 Ga0496125_0111111 Ga0496125_0111111_706_1500 264
1284 3300048929 Ga0496126_0003737 Ga0496126_0003737_6953_7747 264
1285 3300048929 Ga0496126_0030746 Ga0496126_0030746_2306_3100 264
1286 3300048929 Ga0496126_0041962 Ga0496126_0041962_1284_2078 264
1287 3300048929 Ga0496126_0048684 Ga0496126_0048684_695_1639 264
1288 3300048929 Ga0496126_0051129 Ga0496126_0051129_1739_2533 264
1289 3300048929 Ga0496126_0051770 Ga0496126_0051770_2846_3640 264
1290 3300048929 Ga0496126_0183448 Ga0496126_0183448_339_1133 264
1291 3300048929 Ga0496126_0191388 Ga0496126_0191388_397_1191 264
1292 3300048929 Ga0496126_0320870 Ga0496126_0320870_47_841 264
1293 3300048929 Ga0496126_0359553 Ga0496126_0359553_207_1001 264
1294 3300048929 Ga0496126_0397270 Ga0496126_0397270_298_1092 264
1295 3300049568 Ga0501031_0000294 Ga0501031_0000294_3933_4727 264
1296 3300049568 Ga0501031_0000497 Ga0501031_0000497_3199_3993 264
1297 3300049568 Ga0501031_0006681 Ga0501031_0006681_6126_6920 264
1298 3300049568 Ga0501031_0312876 Ga0501031_0312876_165_959 264
1299 3300049569 Ga0501032_0000076 Ga0501032_0000076_73257_74051 264
1300 3300049569 Ga0501032_0000269 Ga0501032_0000269_13967_14761 264
1301 3300049569 Ga0501032_0011920 Ga0501032_0011920_2191_2985 264
1302 3300049569 Ga0501032_0019279 Ga0501032_0019279_3920_4714 264
1303 3300049569 Ga0501032_0030743 Ga0501032_0030743_2541_3335 264
1304 3300049569 Ga0501032_0071308 Ga0501032_0071308_47_841 264
1305 3300049569 Ga0501032_0074823 Ga0501032_0074823_850_1644 264
1306 3300049569 Ga0501032_0079297 Ga0501032_0079297_1230_2024 264
1307 3300049569 Ga0501032_0079410 Ga0501032_0079410_40_834 264
1308 3300049569 Ga0501032_0181351 Ga0501032_0181351_359_1273 264
1309 3300049570 Ga0501033_0000093 Ga0501033_0000093_11193_11987 264
1310 3300049570 Ga0501033_0000399 Ga0501033_0000399_18495_19289 264
1311 3300049570 Ga0501033_0003630 Ga0501033_0003630_8323_9117 264
1312 3300049570 Ga0501033_0017232 Ga0501033_0017232_2417_3211 264
1313 3300049570 Ga0501033_0040575 Ga0501033_0040575_2550_3344 264
1314 3300049571 Ga0501034_0000039 Ga0501034_0000039_24983_25777 264
1315 3300049571 Ga0501034_0001247 Ga0501034_0001247_32085_32879 264
1316 3300049571 Ga0501034_0005187 Ga0501034_0005187_1593_2387 264
1317 3300049571 Ga0501034_0025868 Ga0501034_0025868_2970_3764 264
1318 3300049571 Ga0501034_0156474 Ga0501034_0156474_673_1467 264
1319 3300049571 Ga0501034_0256405 Ga0501034_0256405_716_1510 264
1320 3300049571 Ga0501034_0767866 Ga0501034_0767866_16_810 264
1321 3300049572 Ga0501036_0000035 Ga0501036_0000035_14014_14808 264
1322 3300049572 Ga0501036_0000817 Ga0501036_0000817_14715_15509 264
1323 3300049572 Ga0501036_0006639 Ga0501036_0006639_6937_7731 264
1324 3300049572 Ga0501036_0017189 Ga0501036_0017189_4233_5027 264
1325 3300049572 Ga0501036_0044313 Ga0501036_0044313_245_1039 264
1326 3300049572 Ga0501036_0046764 Ga0501036_0046764_1035_1829 264
1327 3300049572 Ga0501036_0060679 Ga0501036_0060679_402_1196 264
1328 3300049572 Ga0501036_0085973 Ga0501036_0085973_864_1658 264
1329 3300049572 Ga0501036_0616106 Ga0501036_0616106_31_825 264
1330 3300049573 Ga0501037_0000026 Ga0501037_0000026_9798_10592 264
1331 3300049573 Ga0501037_0000279 Ga0501037_0000279_18293_19087 264
1332 3300049573 Ga0501037_0001130 Ga0501037_0001130_18584_19378 264
1333 3300049573 Ga0501037_0006086 Ga0501037_0006086_6349_7143 264
1334 3300049573 Ga0501037_0027335 Ga0501037_0027335_3388_4182 264
1335 3300049573 Ga0501037_0032508 Ga0501037_0032508_2927_3721 264
1336 3300049573 Ga0501037_0129863 Ga0501037_0129863_808_1602 264
1337 3300049573 Ga0501037_0204702 Ga0501037_0204702_184_978 264
1338 3300049573 Ga0501037_0227389 Ga0501037_0227389_386_1180 264
1339 3300049573 Ga0501037_0273383 Ga0501037_0273383_270_1064 264
1340 3300049574 Ga0501038_0000037 Ga0501038_0000037_73230_74024 264
1341 3300049574 Ga0501038_0000069 Ga0501038_0000069_83469_84263 264
1342 3300049574 Ga0501038_0000727 Ga0501038_0000727_607_1401 264
1343 3300049574 Ga0501038_0006733 Ga0501038_0006733_2255_3049 264
1344 3300049574 Ga0501038_0020364 Ga0501038_0020364_544_1338 264
1345 3300049574 Ga0501038_0138174 Ga0501038_0138174_835_1629 264
1346 3300049574 Ga0501038_0160890 Ga0501038_0160890_302_1096 264
1347 3300049574 Ga0501038_0385146 Ga0501038_0385146_108_902 264
1348 3300049574 Ga0501038_0392038 Ga0501038_0392038_116_910 264
1349 3300049575 Ga0501039_0000146 Ga0501039_0000146_37313_38107 264
1350 3300049575 Ga0501039_0000263 Ga0501039_0000263_35886_36680 264
1351 3300049575 Ga0501039_0010044 Ga0501039_0010044_5812_6606 264
1352 3300049575 Ga0501039_0026624 Ga0501039_0026624_3134_3928 264
1353 3300049575 Ga0501039_0212020 Ga0501039_0212020_271_1065 264
1354 3300049576 Ga0501040_0008550 Ga0501040_0008550_228_1022 264
1355 3300049576 Ga0501040_0066461 Ga0501040_0066461_690_1484 264
1356 3300049577 Ga0501041_0095772 Ga0501041_0095772_735_1529 264
1357 3300049577 Ga0501041_0198082 Ga0501041_0198082_418_1212 264
1358 3300049578 Ga0501042_0039183 Ga0501042_0039183_1295_2089 264
1359 3300049578 Ga0501042_0047957 Ga0501042_0047957_51_845 264
1360 3300049578 Ga0501042_0233669 Ga0501042_0233669_118_912 264
1361 3300049579 Ga0501043_0000115 Ga0501043_0000115_1635_2429 264
1362 3300049579 Ga0501043_0000257 Ga0501043_0000257_18421_19215 264
1363 3300049579 Ga0501043_0016842 Ga0501043_0016842_1832_2626 264
1364 3300049579 Ga0501043_0022318 Ga0501043_0022318_1386_2180 264
1365 3300049579 Ga0501043_0133135 Ga0501043_0133135_849_1643 264
1366 3300049579 Ga0501043_0220240 Ga0501043_0220240_132_926 264
1367 3300049580 Ga0501046_0000210 Ga0501046_0000210_1607_2401 264
1368 3300049580 Ga0501046_0001438 Ga0501046_0001438_10662_11456 264
1369 3300049580 Ga0501046_0036917 Ga0501046_0036917_182_976 264
1370 3300049580 Ga0501046_0050155 Ga0501046_0050155_1132_1926 264
1371 3300049580 Ga0501046_0422356 Ga0501046_0422356_65_859 264
1372 3300049581 Ga0501047_0000094 Ga0501047_0000094_50549_51343 264
1373 3300049581 Ga0501047_0000186 Ga0501047_0000186_7431_8225 264
1374 3300049581 Ga0501047_0000892 Ga0501047_0000892_25867_26661 264
1375 3300049581 Ga0501047_0010143 Ga0501047_0010143_7685_8479 264
1376 3300049581 Ga0501047_0014304 Ga0501047_0014304_2048_2842 264
1377 3300049581 Ga0501047_0032596 Ga0501047_0032596_3476_4270 264
1378 3300049581 Ga0501047_0043616 Ga0501047_0043616_606_1400 264
1379 3300049581 Ga0501047_0137786 Ga0501047_0137786_959_1753 264
1380 3300049581 Ga0501047_0286409 Ga0501047_0286409_634_1428 264
1381 3300049581 Ga0501047_0357158 Ga0501047_0357158_287_1081 264
1382 3300049582 Ga0501048_0000306 Ga0501048_0000306_1900_2694 264
1383 3300049582 Ga0501048_0000856 Ga0501048_0000856_15451_16245 264
1384 3300049582 Ga0501048_0002557 Ga0501048_0002557_10736_11530 264
1385 3300049582 Ga0501048_0009695 Ga0501048_0009695_4813_5607 264
1386 3300049582 Ga0501048_0132263 Ga0501048_0132263_106_900 264
1387 3300049583 Ga0501067_0000220 Ga0501067_0000220_16205_16999 264
1388 3300049583 Ga0501067_0010936 Ga0501067_0010936_1122_1925 264
1389 3300049583 Ga0501067_0013507 Ga0501067_0013507_1754_2548 264
1390 3300049583 Ga0501067_0073388 Ga0501067_0073388_501_1352 264
1391 3300049584 Ga0501068_0003939 Ga0501068_0003939_6098_6892 264
1392 3300049584 Ga0501068_0004373 Ga0501068_0004373_1634_2428 264
1393 3300049584 Ga0501068_0019306 Ga0501068_0019306_1850_2644 264
1394 3300049584 Ga0501068_0020312 Ga0501068_0020312_728_1522 264
1395 3300049584 Ga0501068_0043380 Ga0501068_0043380_904_1698 264
1396 3300049584 Ga0501068_0089412 Ga0501068_0089412_845_1639 264
1397 3300049584 Ga0501068_0169307 Ga0501068_0169307_306_1100 264
1398 3300049585 Ga0501069_0004135 Ga0501069_0004135_1342_2136 264
1399 3300049585 Ga0501069_0006557 Ga0501069_0006557_5252_6046 264
1400 3300049585 Ga0501069_0009362 Ga0501069_0009362_3787_4581 264
1401 3300049585 Ga0501069_0021290 Ga0501069_0021290_1889_2683 264
1402 3300049585 Ga0501069_0060565 Ga0501069_0060565_63_857 264
1403 3300049585 Ga0501069_0068487 Ga0501069_0068487_1012_1806 264
1404 3300049585 Ga0501069_0072286 Ga0501069_0072286_368_1162 264
1405 3300049586 Ga0501070_0000134 Ga0501070_0000134_50645_51439 264
1406 3300049586 Ga0501070_0013023 Ga0501070_0013023_4238_5032 264
1407 3300049586 Ga0501070_0013228 Ga0501070_0013228_2683_3477 264
1408 3300049586 Ga0501070_0024108 Ga0501070_0024108_1042_1836 264
1409 3300049586 Ga0501070_0040276 Ga0501070_0040276_3050_3844 264
1410 3300049586 Ga0501070_0047476 Ga0501070_0047476_685_1479 264
1411 3300049586 Ga0501070_0051850 Ga0501070_0051850_945_1739 264
1412 3300049586 Ga0501070_0081847 Ga0501070_0081847_1228_2022 264
1413 3300049586 Ga0501070_0090225 Ga0501070_0090225_106_900 264
1414 3300049586 Ga0501070_0210137 Ga0501070_0210137_729_1523 264
1415 3300049586 Ga0501070_0543874 Ga0501070_0543874_41_835 264
1416 3300049587 Ga0501071_0016014 Ga0501071_0016014_3463_4257 264
1417 3300049587 Ga0501071_0216956 Ga0501071_0216956_86_880 264
1418 3300049587 Ga0501071_0442318 Ga0501071_0442318_43_837 264
1419 3300049588 Ga0501072_0001542 Ga0501072_0001542_4263_5057 264
1420 3300049588 Ga0501072_0018872 Ga0501072_0018872_1976_2770 264
1421 3300049588 Ga0501072_0055128 Ga0501072_0055128_1363_2157 264
1422 3300049589 Ga0501073_0000131 Ga0501073_0000131_12443_13237 264
1423 3300049589 Ga0501073_0005409 Ga0501073_0005409_4027_4821 264
1424 3300049589 Ga0501073_0010210 Ga0501073_0010210_3750_4544 264
1425 3300049589 Ga0501073_0015631 Ga0501073_0015631_4287_5081 264
1426 3300049589 Ga0501073_0023953 Ga0501073_0023953_1411_2205 264
1427 3300049589 Ga0501073_0024458 Ga0501073_0024458_560_1354 264
1428 3300049590 Ga0501074_0000514 Ga0501074_0000514_10661_11455 264
1429 3300049590 Ga0501074_0006996 Ga0501074_0006996_4744_5538 264
1430 3300049590 Ga0501074_0013074 Ga0501074_0013074_3754_4548 264
1431 3300049590 Ga0501074_0016442 Ga0501074_0016442_1250_2044 264
1432 3300049590 Ga0501074_0033237 Ga0501074_0033237_853_1647 264
1433 3300049590 Ga0501074_0148952 Ga0501074_0148952_143_937 264
1434 3300049591 Ga0501075_0341702 Ga0501075_0341702_184_978 264
1435 3300049591 Ga0501075_0400381 Ga0501075_0400381_79_873 264
1436 3300049592 Ga0501076_0010682 Ga0501076_0010682_821_1615 264
1437 3300049592 Ga0501076_0098869 Ga0501076_0098869_310_1104 264
1438 3300049592 Ga0501076_0129214 Ga0501076_0129214_530_1324 264
1439 3300049741 Ga0501079_0003357 Ga0501079_0003357_6629_7423 264
1440 3300049741 Ga0501079_0003839 Ga0501079_0003839_7180_7974 264
1441 3300049741 Ga0501079_0051618 Ga0501079_0051618_684_1478 264
1442 3300049741 Ga0501079_0066832 Ga0501079_0066832_1509_2303 264
1443 3300049741 Ga0501079_0097009 Ga0501079_0097009_553_1347 264
1444 3300049741 Ga0501079_0298526 Ga0501079_0298526_296_1090 264
1445 3300049742 Ga0501080_0000299 Ga0501080_0000299_33519_34313 264
1446 3300049742 Ga0501080_0000387 Ga0501080_0000387_12773_13567 264
1447 3300049742 Ga0501080_0001809 Ga0501080_0001809_3277_4071 264
1448 3300049742 Ga0501080_0023167 Ga0501080_0023167_1169_1963 264
1449 3300049742 Ga0501080_0102012 Ga0501080_0102012_552_1346 264
1450 3300049742 Ga0501080_0162316 Ga0501080_0162316_666_1460 264
1451 3300049742 Ga0501080_0163965 Ga0501080_0163965_565_1359 264
1452 3300049742 Ga0501080_0196287 Ga0501080_0196287_685_1479 264
1453 3300049742 Ga0501080_0292258 Ga0501080_0292258_643_1437 264
1454 3300049742 Ga0501080_0329267 Ga0501080_0329267_109_903 264
1455 3300049742 Ga0501080_0372142 Ga0501080_0372142_258_1052 264
1456 3300049743 Ga0501081_0001664 Ga0501081_0001664_1998_2792 264
1457 3300049743 Ga0501081_0155934 Ga0501081_0155934_521_1315 264
1458 3300049744 Ga0501083_0000213 Ga0501083_0000213_16481_17275 264
1459 3300049744 Ga0501083_0000302 Ga0501083_0000302_9251_10045 264
1460 3300049744 Ga0501083_0013866 Ga0501083_0013866_3215_4009 264
1461 3300049744 Ga0501083_0211437 Ga0501083_0211437_206_1000 264
1462 3300049744 Ga0501083_0274611 Ga0501083_0274611_47_841 264
1463 3300049758 Ga0501241_005327 Ga0501241_005327_945_1739 264
1464 3300049822 Ga0501035_0000523 Ga0501035_0000523_31725_32519 264
1465 3300049822 Ga0501035_0000533 Ga0501035_0000533_1635_2429 264
1466 3300049822 Ga0501035_0009857 Ga0501035_0009857_5923_6717 264
1467 3300049822 Ga0501035_0015394 Ga0501035_0015394_112_906 264
1468 3300049822 Ga0501035_0021633 Ga0501035_0021633_2849_3643 264
1469 3300049822 Ga0501035_0052530 Ga0501035_0052530_269_1063 264
1470 3300049822 Ga0501035_0054995 Ga0501035_0054995_2741_3535 264
1471 3300049822 Ga0501035_0107675 Ga0501035_0107675_1244_2038 264
1472 3300049822 Ga0501035_0157956 Ga0501035_0157956_837_1631 264
1473 3300049822 Ga0501035_0188241 Ga0501035_0188241_776_1570 264
1474 3300049822 Ga0501035_0229760 Ga0501035_0229760_528_1322 264
1475 3300049823 Ga0501044_0000435 Ga0501044_0000435_39855_40649 264
1476 3300049823 Ga0501044_0003448 Ga0501044_0003448_16936_17730 264
1477 3300049823 Ga0501044_0009354 Ga0501044_0009354_7568_8362 264
1478 3300049823 Ga0501044_0027340 Ga0501044_0027340_1977_2771 264
1479 3300049823 Ga0501044_0092087 Ga0501044_0092087_1873_2667 264
1480 3300049823 Ga0501044_0098202 Ga0501044_0098202_1590_2384 264
1481 3300049823 Ga0501044_0331463 Ga0501044_0331463_120_914 264
1482 3300049823 Ga0501044_0409435 Ga0501044_0409435_286_1080 264
1483 3300049824 Ga0501045_0022522 Ga0501045_0022522_3254_4048 264
1484 3300049824 Ga0501045_0105366 Ga0501045_0105366_1178_1972 264
1485 3300050489 nmdc:mga03683_102651_c1 nmdc:mga03683_102651_c1_310_1104 264
1486 3300050489 nmdc:mga03683_1027_c1 nmdc:mga03683_1027_c1_97_891 264
1487 3300050490 nmdc:mga03n38_221414_c1 nmdc:mga03n38_221414_c1_178_972 264
1488 3300050491 nmdc:mga00v17_39463_c1 nmdc:mga00v17_39463_c1_538_1332 264
1489 3300050492 nmdc:mga0yw44_17750_c1 nmdc:mga0yw44_17750_c1_2771_3565 264
1490 3300050492 nmdc:mga0yw44_53571_c1 nmdc:mga0yw44_53571_c1_242_1036 264
1491 3300050493 nmdc:mga0k408_275726_c1 nmdc:mga0k408_275726_c1_37_831 264
1492 3300050493 nmdc:mga0k408_92347_c1 nmdc:mga0k408_92347_c1_402_1196 264
1493 3300050494 nmdc:mga06z11_23054_c1 nmdc:mga06z11_23054_c1_21_815 264
1494 3300050494 nmdc:mga06z11_76330_c1 nmdc:mga06z11_76330_c1_253_1047 264
1495 3300050496 nmdc:mga07m45_193093_c1 nmdc:mga07m45_193093_c1_227_1021 264
1496 3300050496 nmdc:mga07m45_41448_c1 nmdc:mga07m45_41448_c1_498_1292 264
1497 3300050496 nmdc:mga07m45_47017_c1 nmdc:mga07m45_47017_c1_1261_2055 264
1498 3300050496 nmdc:mga07m45_81159_c1 nmdc:mga07m45_81159_c1_737_1621 264
1499 3300050507 nmdc:mga05p37_147491_c1 nmdc:mga05p37_147491_c1_939_1733 264
1500 3300050508 nmdc:mga09592_33785_c1 nmdc:mga09592_33785_c1_3224_4018 264
1501 3300050509 nmdc:mga0qj67_379021_c1 nmdc:mga0qj67_379021_c1_295_1089 264
1502 3300050510 nmdc:mga06r32_14990_c1 nmdc:mga06r32_14990_c1_6071_6865 264
1503 3300050511 nmdc:mga08y16_102788_c1 nmdc:mga08y16_102788_c1_1948_2742 264
1504 3300050511 nmdc:mga08y16_1281_c1 nmdc:mga08y16_1281_c1_16187_16981 264
1505 3300050511 nmdc:mga08y16_3917_c1 nmdc:mga08y16_3917_c1_6724_7518 264
1506 3300050511 nmdc:mga08y16_52748_c1 nmdc:mga08y16_52748_c1_886_1680 264
1507 3300050511 nmdc:mga08y16_88203_c1 nmdc:mga08y16_88203_c1_2178_2972 264
1508 3300050512 nmdc:mga0n895_1946_c1 nmdc:mga0n895_1946_c1_14434_15228 264
1509 3300050512 nmdc:mga0n895_466290_c1 nmdc:mga0n895_466290_c1_101_895 264
1510 3300050512 nmdc:mga0n895_96815_c1 nmdc:mga0n895_96815_c1_2027_2821 264
1511 3300050513 nmdc:mga0rr50_392375_c1 nmdc:mga0rr50_392375_c1_203_997 264
1512 3300050515 nmdc:mga0a205_145113_c1 nmdc:mga0a205_145113_c1_1237_2031 264
1513 3300050515 nmdc:mga0a205_35242_c1 nmdc:mga0a205_35242_c1_262_1056 264
1514 3300050516 nmdc:mga0sz30_1683_c1 nmdc:mga0sz30_1683_c1_5178_5972 264
1515 3300050516 nmdc:mga0sz30_2375_c1 nmdc:mga0sz30_2375_c1_1983_2777 264
1516 3300050516 nmdc:mga0sz30_56454_c1 nmdc:mga0sz30_56454_c1_164_958 264
1517 3300053077 Ga0495601_0041381 Ga0495601_0041381_650_1444 264
1518 3300053077 Ga0495601_0316854 Ga0495601_0316854_178_972 264
1519 3300053078 Ga0495612_0087829 Ga0495612_0087829_269_1063 264
1520 3300053080 Ga0500635_0002566 Ga0500635_0002566_2213_3007 264
1521 3300053084 Ga0495595_0013058 Ga0495595_0013058_140_934 264
1522 3300053084 Ga0495595_0020049 Ga0495595_0020049_877_1671 264
1523 3300053084 Ga0495595_0133880 Ga0495595_0133880_241_1035 264
1524 3300053085 Ga0495619_0065962 Ga0495619_0065962_316_1110 264
1525 3300053085 Ga0495619_0160747 Ga0495619_0160747_467_1261 264
1526 3300053086 Ga0500578_0090848 Ga0500578_0090848_788_1582 264
1527 3300053088 Ga0500644_0041888 Ga0500644_0041888_235_1092 264
1528 3300053088 Ga0500644_0126294 Ga0500644_0126294_130_924 264
1529 3300053088 Ga0500644_0136268 Ga0500644_0136268_54_848 264
1530 3300053090 Ga0500646_0007100 Ga0500646_0007100_1097_1891 264
1531 3300053092 Ga0500583_0001971 Ga0500583_0001971_5034_5828 264
1532 3300053092 Ga0500583_0044064 Ga0500583_0044064_412_1206 264
1533 3300053093 Ga0500651_0000168 Ga0500651_0000168_6807_7601 264
1534 3300053093 Ga0500651_0025258 Ga0500651_0025258_2904_3698 264
1535 3300053094 Ga0500566_0010562 Ga0500566_0010562_3031_3825 264
1536 3300053094 Ga0500566_0216356 Ga0500566_0216356_40_834 264
1537 3300053097 Ga0500648_136589 Ga0500648_136589_278_1072 264
1538 3300053098 Ga0500650_0020176 Ga0500650_0020176_1438_2232 264
1539 3300053098 Ga0500650_0113889 Ga0500650_0113889_294_1088 264
1540 3300053102 Ga0500554_002814 Ga0500554_002814_1571_2365 264
1541 3300053103 Ga0500555_016159 Ga0500555_016159_26_820 264
1542 3300053104 Ga0500556_0000202 Ga0500556_0000202_42638_43432 264
1543 3300053108 Ga0500562_072212 Ga0500562_072212_34_828 264
1544 3300053109 Ga0500569_000323 Ga0500569_000323_1155_1949 264
1545 3300053111 Ga0500572_001030 Ga0500572_001030_1646_2440 264
1546 3300053116 Ga0500592_000443 Ga0500592_000443_4666_5460 264
1547 3300053116 Ga0500592_009763 Ga0500592_009763_658_1452 264
1548 3300053119 Ga0500595_002264 Ga0500595_002264_1784_2578 264
1549 3300053119 Ga0500595_003563 Ga0500595_003563_646_1440 264
1550 3300053119 Ga0500595_009619 Ga0500595_009619_2920_3714 264
1551 3300053119 Ga0500595_041410 Ga0500595_041410_511_1305 264
1552 3300053121 Ga0500607_017859 Ga0500607_017859_1242_2036 264
1553 3300053130 Ga0500642_0000005 Ga0500642_0000005_76770_77564 264
1554 3300053130 Ga0500642_0036658 Ga0500642_0036658_950_1744 264
1555 3300053131 Ga0500652_000717 Ga0500652_000717_4224_5018 264
1556 3300053131 Ga0500652_003296 Ga0500652_003296_1992_2786 264
1557 3300053136 Ga0500559_0000586 Ga0500559_0000586_6012_6806 264
1558 3300053136 Ga0500559_0007354 Ga0500559_0007354_1613_2407 264
1559 3300053138 Ga0500564_057478 Ga0500564_057478_454_1248 264
1560 3300053139 Ga0500568_0008225 Ga0500568_0008225_2857_3651 264
1561 3300053139 Ga0500568_0008455 Ga0500568_0008455_2800_3594 264
1562 3300053139 Ga0500568_0013761 Ga0500568_0013761_1978_2772 264
1563 3300053139 Ga0500568_0041141 Ga0500568_0041141_58_852 264
1564 3300053142 Ga0500577_0021304 Ga0500577_0021304_597_1391 264
1565 3300053142 Ga0500577_0021539 Ga0500577_0021539_1308_2102 264
1566 3300053145 Ga0500586_001465 Ga0500586_001465_3677_4471 264
1567 3300053146 Ga0500588_0049382 Ga0500588_0049382_132_926 264
1568 3300053147 Ga0500589_013888 Ga0500589_013888_392_1186 264
1569 3300053151 Ga0500604_0008586 Ga0500604_0008586_52_846 264
1570 3300053153 Ga0500616_0000166 Ga0500616_0000166_40694_41488 264
1571 3300053153 Ga0500616_0000180 Ga0500616_0000180_28730_29524 264
1572 3300053153 Ga0500616_0002218 Ga0500616_0002218_13533_14378 264
1573 3300053153 Ga0500616_0011766 Ga0500616_0011766_1407_2201 264
1574 3300053156 Ga0500622_0007484 Ga0500622_0007484_525_1319 264
1575 3300053156 Ga0500622_0019560 Ga0500622_0019560_2324_3118 264
1576 3300053156 Ga0500622_0019647 Ga0500622_0019647_394_1188 264
1577 3300053161 Ga0500634_0042288 Ga0500634_0042288_1483_2277 264
1578 3300053177 Ga0500636_0011317 Ga0500636_0011317_1967_2761 264
1579 3300053177 Ga0500636_0026335 Ga0500636_0026335_1146_1940 264
1580 3300053178 Ga0500637_0020687 Ga0500637_0020687_2646_3440 264
1581 3300053730 Ga0500645_007785 Ga0500645_007785_1733_2527 264
1582 3300053731 Ga0500609_000821 Ga0500609_000821_1698_2492 264
1583 3300053731 Ga0500609_007867 Ga0500609_007867_351_1145 264
1584 3300054114 Ga0501084_0024291 Ga0501084_0024291_312_1106 264
1585 3300054114 Ga0501084_0031221 Ga0501084_0031221_3451_4245 264
1586 3300054114 Ga0501084_0182075 Ga0501084_0182075_815_1609 264
1587 3300054114 Ga0501084_0188857 Ga0501084_0188857_355_1149 264
1588 3300054114 Ga0501084_0222591 Ga0501084_0222591_710_1504 264
1589 3300060353 Ga0501082_0006782 Ga0501082_0006782_1023_1817 264
1590 3300060353 Ga0501082_0010662 Ga0501082_0010662_37_831 264
1591 3300060353 Ga0501082_0035245 Ga0501082_0035245_2056_2850 264
1592 3300060353 Ga0501082_0477549 Ga0501082_0477549_53_847 264
1593 3300061719 Ga0466962_0001283 Ga0466962_0001283_9386_10180 264
1594 3300061734 Ga0530510_0070878 Ga0530510_0070878_735_1529 264
1595 3300061734 Ga0530510_0517636 Ga0530510_0517636_58_852 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00303

Thymidylat_synt

Thymidylate synthase

15

286

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3b5b-assembly1.cif.gz_B crystal structure of the thymidylate synthase k48q 0.9842 1 264
4fox-assembly2.cif.gz_D crystal structure of mtb thya in complex with dump and raltitrexed 0.9842 1 264
3bfi-assembly1.cif.gz_A-2 e. coli thymidylate synthase y209m mutant complexed with 5-nitro-dump 0.9837 3 264
4h0u-assembly1.cif.gz_B crystal structure of thymidylate synthase from corynebacterium glutamicum in complex with dump 0.9834 3 259
1fwm-assembly1.cif.gz_B crystal structure of the thymidylate synthase r166q mutant 0.9831 3 264
ID Description Score Start End Superfamily
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9768 2 264 3.30.572.10
3ix6B00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9734 2 250 3.30.572.10
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9695 2 264 3.30.572.10
6qyaC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9635 2 262 3.30.572.10
3dgaC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9585 2 259 3.30.572.10
ID Description Score Start End GO Terms
AF-A0A352HMS8-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9994 151 264 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A2E8YSB0-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9989 145 264 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A1J4YZP9-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9988 143 264 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A2H6J9D6-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9954 141 264 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A059X8V8-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9949 150 262 GO:0004799
GO:0005829
GO:0006231
GO:0016020
GO:0032259

Feature Viewer

pLDDT pTM Quality
93.55 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map