F494963
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1595 | 661 | 1464 | 265 |
Family's Representative Sequence
| Representative Sequence | 3300044712|Ga0453684_0056656|Ga0453684_0056656_1724_2584 |
| Length | 286 |
| Sequence | MARDYTFPVRPASMQPYLDLMRHVLAHGHSKSDRTGTGTRSVFGWQMRFDLAQGFPLLTTKKLHLRSIIHELLWFLQGDTNIGYLKHNGVRIWDEWADANGDLGPVYGHQWRHWPKPDGGEVDQITELIDGLKRNPDSRRHIVSAWNPGDVPRMQLPPCHALFQFYVAPAAATAADPRGRLSCQLYQRSADIFLGVPFNIASYALLTMMVAQVCDLVPGDFVHTLGDAHLYTNHVEQAQLQLARATRTLPTMHLNPAVKDIFGFRYEDFTLEGYDPHPHIAAPVAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 3 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 4 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 5 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 6 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 7 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 8 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 9 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 10 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 11 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 12 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 13 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 14 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 15 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 16 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 17 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 18 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 19 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 20 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 21 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 22 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 23 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 24 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 25 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 26 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 27 | 2791355199 | |||
| 28 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 29 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 30 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 31 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 32 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 33 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 34 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 35 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 36 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 37 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 38 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 39 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 40 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 41 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 42 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 43 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 44 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 45 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 46 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 47 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 48 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 49 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 50 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 51 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 52 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 53 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 54 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 55 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 56 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 57 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 58 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 59 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 60 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 61 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 62 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 63 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 64 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 65 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 66 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 67 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 68 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 69 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 70 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 71 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 72 | 2922368715 | |||
| 73 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 74 | 2925326138 | Paenibacillus hemerocallicola KCTC 33185 | Isolate | Unclassified |
| 75 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 76 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 77 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 78 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 79 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 80 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 81 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 82 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 83 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 84 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 85 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 86 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 87 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 88 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 89 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 90 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 91 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 92 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 93 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 94 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 95 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 96 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 97 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 98 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 99 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 100 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 101 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 102 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 103 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 104 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 105 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 106 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 107 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 108 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 109 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 110 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 111 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 112 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 113 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 114 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 115 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 116 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 117 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 118 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 119 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 120 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 121 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 122 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 123 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 124 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 125 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 126 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 127 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 128 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 129 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 130 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 131 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 132 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 133 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 134 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 137 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 138 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 140 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 142 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 143 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 144 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 146 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 147 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 149 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 156 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 159 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 161 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 162 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 165 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 166 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 170 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 171 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 172 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 173 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 174 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 176 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 177 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 178 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 179 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 181 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 182 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 185 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 186 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 187 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 189 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 190 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 191 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 193 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 194 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 195 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 196 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 197 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 198 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 199 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 200 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 201 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 202 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 203 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 204 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 205 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 206 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 208 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 209 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 210 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 211 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 212 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 213 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 214 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 215 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 216 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 217 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 218 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 220 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 221 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 222 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 223 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 224 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 225 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 226 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 227 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 229 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 230 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 231 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 232 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 235 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 239 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 242 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 243 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 244 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 245 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 246 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 247 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 248 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 252 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 253 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 254 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 255 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 256 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 257 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 258 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 259 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 260 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 261 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 262 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 263 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 264 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 265 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 266 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 267 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 268 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 269 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 270 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 271 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 272 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 273 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 274 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 275 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 276 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 277 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 278 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 280 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 281 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 282 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 283 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 284 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 285 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 286 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 287 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 349 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 350 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 351 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 353 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 354 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 358 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 359 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 360 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 361 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 362 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 363 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 364 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 365 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 366 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 367 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 368 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 369 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 370 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 371 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 372 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 373 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 374 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 375 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 376 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 377 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 378 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 379 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 380 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 381 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 382 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 383 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 384 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 385 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 386 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 387 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 388 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 389 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 390 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 391 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 392 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 393 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 394 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 395 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 396 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 397 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 398 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 399 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 400 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 401 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 402 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 403 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 404 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 405 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 406 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 407 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 408 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 409 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 410 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 411 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 412 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 413 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 414 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 415 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 416 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 417 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 418 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 419 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 420 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 421 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 422 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 423 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 424 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 425 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 426 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 427 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 428 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 429 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 430 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 431 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 432 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 433 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 434 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 435 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 436 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 437 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 438 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 439 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 440 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 441 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 442 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 443 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 444 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 445 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 446 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 447 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 448 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 449 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 450 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 451 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 452 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 453 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 526 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 527 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 528 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 529 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 530 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 531 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 532 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 533 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 534 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 535 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 536 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 537 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 538 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 539 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 540 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 541 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 542 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 543 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 544 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 545 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 546 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 547 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 548 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 549 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 550 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 551 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 552 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 553 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 554 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 555 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 556 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 557 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 558 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 559 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 560 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 561 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 562 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 563 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 564 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 565 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 566 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 567 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 568 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 569 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 570 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 571 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 572 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 573 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 574 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 575 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 576 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 577 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 578 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 579 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 580 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 581 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 582 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 583 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 584 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 585 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 586 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 587 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 588 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 589 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 590 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 591 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 592 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 593 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 594 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 595 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 596 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 597 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 598 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 599 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 600 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 601 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 604 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 607 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 608 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 609 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 610 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 611 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 612 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 613 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 614 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 615 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 616 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 617 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 618 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 619 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 620 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 621 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 622 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 623 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 624 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 625 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 626 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 627 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 628 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 629 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 630 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 631 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 632 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 633 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 634 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 635 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 636 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 637 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 638 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 639 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 640 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 641 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 642 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 643 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 644 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 645 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 646 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 647 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 648 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 649 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 650 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 651 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 652 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 653 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 654 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 655 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 656 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 657 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 658 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 659 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 660 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 661 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.65 |
| Metatranscriptomes | 0.25 |
| Isolates | 8.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.15 |
| Nodule | 5.14 |
| Rhizoplane | 5.96 |
| Rhizosphere | 71.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2388475 | 2162886007 | Bacteria | 3464 |
| 2 | LJQas_1004670 | 3300000549 | Bacteria | 1773 |
| 3 | JGI24740J21852_10015371 | 3300001979 | Bacteria | 2797 |
| 4 | JGI24740J21852_10025518 | 3300001979 | Bacteria | 1991 |
| 5 | JGI24750J21931_1014577 | 3300002070 | Bacteria | 1058 |
| 6 | JGI25154J39366_1000007 | 3300002738 | Bacteria | 335932 |
| 7 | JGI25151J46595_10000028 | 3300003187 | Bacteria | 208373 |
| 8 | JGI25406J46586_10000196 | 3300003203 | Bacteria | 26875 |
| 9 | JGI25165J46597_1005748 | 3300003214 | Bacteria | 2324 |
| 10 | JGI25153J46596_10000738 | 3300003215 | Bacteria | 20026 |
| 11 | JGI25153J46596_10001748 | 3300003215 | Bacteria | 12881 |
| 12 | rootH1_10034177 | 3300003323 | Bacteria | 5322 |
| 13 | rootH1_10106887 | 3300003323 | Bacteria | 2486 |
| 14 | JGI25160J50197_1012427 | 3300003354 | Bacteria | 2956 |
| 15 | JGI25404J52841_10008621 | 3300003659 | Bacteria | 2175 |
| 16 | Ga0055539_1007171 | 3300003752 | Bacteria | 1413 |
| 17 | Ga0055526_1000938 | 3300003771 | Bacteria | 21601 |
| 18 | Ga0055526_1005211 | 3300003771 | Bacteria | 7549 |
| 19 | Ga0055524_1000020 | 3300003775 | Bacteria | 227971 |
| 20 | Ga0055524_1007655 | 3300003775 | Bacteria | 4564 |
| 21 | Ga0065165_1002837 | 3300005262 | Bacteria | 13516 |
| 22 | Ga0065714_10002655 | 3300005288 | Bacteria | 18426 |
| 23 | Ga0065714_10064924 | 3300005288 | Bacteria | 15372 |
| 24 | Ga0065714_10105188 | 3300005288 | Bacteria | 1549 |
| 25 | Ga0065704_10000422 | 3300005289 | Bacteria | 22124 |
| 26 | Ga0065704_10226758 | 3300005289 | Bacteria | 1056 |
| 27 | Ga0065715_10165122 | 3300005293 | Bacteria | 1593 |
| 28 | Ga0070658_10034361 | 3300005327 | Bacteria | 4080 |
| 29 | Ga0070658_10094348 | 3300005327 | Bacteria | 2469 |
| 30 | Ga0070658_10181622 | 3300005327 | Bacteria | 1770 |
| 31 | Ga0070658_10295126 | 3300005327 | Bacteria | 1382 |
| 32 | Ga0070676_10144069 | 3300005328 | Bacteria | 1519 |
| 33 | Ga0070683_100002255 | 3300005329 | Bacteria | 15294 |
| 34 | Ga0070683_100017424 | 3300005329 | Bacteria | 6350 |
| 35 | Ga0070683_100046407 | 3300005329 | Bacteria | 4013 |
| 36 | Ga0070683_100053085 | 3300005329 | Bacteria | 3756 |
| 37 | Ga0070690_100013883 | 3300005330 | Bacteria | 4774 |
| 38 | Ga0070690_100167770 | 3300005330 | Bacteria | 1509 |
| 39 | Ga0070690_100206861 | 3300005330 | Bacteria | 1368 |
| 40 | Ga0070670_100097680 | 3300005331 | Bacteria | 2527 |
| 41 | Ga0070670_100132060 | 3300005331 | Bacteria | 2157 |
| 42 | Ga0068869_100038274 | 3300005334 | Bacteria | 3417 |
| 43 | Ga0070666_10214446 | 3300005335 | Bacteria | 1357 |
| 44 | Ga0070680_100221804 | 3300005336 | Bacteria | 1596 |
| 45 | Ga0070682_100000014 | 3300005337 | Bacteria | 249552 |
| 46 | Ga0070682_100080195 | 3300005337 | Bacteria | 2110 |
| 47 | Ga0070682_100466373 | 3300005337 | Bacteria | 971 |
| 48 | Ga0068868_100002673 | 3300005338 | Bacteria | 12360 |
| 49 | Ga0068868_100050231 | 3300005338 | Bacteria | 3274 |
| 50 | Ga0070660_100010424 | 3300005339 | Bacteria | 6568 |
| 51 | Ga0070660_100396392 | 3300005339 | Bacteria | 1141 |
| 52 | Ga0070689_100000488 | 3300005340 | Bacteria | 23423 |
| 53 | Ga0070689_100002204 | 3300005340 | Bacteria | 12627 |
| 54 | Ga0070689_100189445 | 3300005340 | Bacteria | 1674 |
| 55 | Ga0070689_100237511 | 3300005340 | Bacteria | 1500 |
| 56 | Ga0070689_100415257 | 3300005340 | Bacteria | 1140 |
| 57 | Ga0070691_10017425 | 3300005341 | Bacteria | 3305 |
| 58 | Ga0070691_10018051 | 3300005341 | Bacteria | 3249 |
| 59 | Ga0070661_100008367 | 3300005344 | Bacteria | 7147 |
| 60 | Ga0070661_100204853 | 3300005344 | Bacteria | 1508 |
| 61 | Ga0070692_10007686 | 3300005345 | Bacteria | 4766 |
| 62 | Ga0070692_10014150 | 3300005345 | Bacteria | 3737 |
| 63 | Ga0070668_100002031 | 3300005347 | Bacteria | 14798 |
| 64 | Ga0070668_100041237 | 3300005347 | Bacteria | 3536 |
| 65 | Ga0070668_100108937 | 3300005347 | Bacteria | 2203 |
| 66 | Ga0070668_100331079 | 3300005347 | Bacteria | 1284 |
| 67 | Ga0070668_100371797 | 3300005347 | Bacteria | 1214 |
| 68 | Ga0070669_100027197 | 3300005353 | Bacteria | 4117 |
| 69 | Ga0070675_100007206 | 3300005354 | Bacteria | 8573 |
| 70 | Ga0070675_100499022 | 3300005354 | Bacteria | 1096 |
| 71 | Ga0070671_100006436 | 3300005355 | Bacteria | 9384 |
| 72 | Ga0070674_100035143 | 3300005356 | Bacteria | 3354 |
| 73 | Ga0070674_100388937 | 3300005356 | Bacteria | 1136 |
| 74 | Ga0070673_100097811 | 3300005364 | Bacteria | 2411 |
| 75 | Ga0070673_100113737 | 3300005364 | Bacteria | 2248 |
| 76 | Ga0070673_100153375 | 3300005364 | Bacteria | 1953 |
| 77 | Ga0070688_100225593 | 3300005365 | Bacteria | 1323 |
| 78 | Ga0070688_100353997 | 3300005365 | Bacteria | 1076 |
| 79 | Ga0070659_100145758 | 3300005366 | Bacteria | 1929 |
| 80 | Ga0070659_100358993 | 3300005366 | Bacteria | 1224 |
| 81 | Ga0070667_100071427 | 3300005367 | Bacteria | 2956 |
| 82 | Ga0070667_100094555 | 3300005367 | Bacteria | 2575 |
| 83 | Ga0070667_100187955 | 3300005367 | Bacteria | 1829 |
| 84 | Ga0070667_100203201 | 3300005367 | Bacteria | 1758 |
| 85 | Ga0070667_100333620 | 3300005367 | Bacteria | 1370 |
| 86 | Ga0070709_10025330 | 3300005434 | Bacteria | 3503 |
| 87 | Ga0070709_10025693 | 3300005434 | Bacteria | 3482 |
| 88 | Ga0070709_10056857 | 3300005434 | Bacteria | 2476 |
| 89 | Ga0070714_100002013 | 3300005435 | Bacteria | 14875 |
| 90 | Ga0070714_100038279 | 3300005435 | Bacteria | 4032 |
| 91 | Ga0070714_100041967 | 3300005435 | Bacteria | 3863 |
| 92 | Ga0070714_100134050 | 3300005435 | Bacteria | 2216 |
| 93 | Ga0070714_100168946 | 3300005435 | Bacteria | 1984 |
| 94 | Ga0070714_100240705 | 3300005435 | Bacteria | 1670 |
| 95 | Ga0070714_100253223 | 3300005435 | Bacteria | 1629 |
| 96 | Ga0070713_100000639 | 3300005436 | Bacteria | 22363 |
| 97 | Ga0070713_100162001 | 3300005436 | Bacteria | 1998 |
| 98 | Ga0070710_10000587 | 3300005437 | Bacteria | 17296 |
| 99 | Ga0070710_10011649 | 3300005437 | Bacteria | 4349 |
| 100 | Ga0070711_100002894 | 3300005439 | Bacteria | 9893 |
| 101 | Ga0070711_100010862 | 3300005439 | Bacteria | 5645 |
| 102 | Ga0070711_100092843 | 3300005439 | Bacteria | 2179 |
| 103 | Ga0070711_100135860 | 3300005439 | Bacteria | 1838 |
| 104 | Ga0070711_100208229 | 3300005439 | Bacteria | 1513 |
| 105 | Ga0070705_100001167 | 3300005440 | Bacteria | 14363 |
| 106 | Ga0070705_100143726 | 3300005440 | Bacteria | 1574 |
| 107 | Ga0070700_100003520 | 3300005441 | Bacteria | 8075 |
| 108 | Ga0070700_100062744 | 3300005441 | Bacteria | 2349 |
| 109 | Ga0070700_100150313 | 3300005441 | Bacteria | 1592 |
| 110 | Ga0070694_100009831 | 3300005444 | Bacteria | 5878 |
| 111 | Ga0070663_100047725 | 3300005455 | Bacteria | 3033 |
| 112 | Ga0070663_100074216 | 3300005455 | Bacteria | 2483 |
| 113 | Ga0070663_100136230 | 3300005455 | Bacteria | 1870 |
| 114 | Ga0070663_100174501 | 3300005455 | Bacteria | 1663 |
| 115 | Ga0070678_100007967 | 3300005456 | Bacteria | 6315 |
| 116 | Ga0070678_100035283 | 3300005456 | Bacteria | 3490 |
| 117 | Ga0070678_100039559 | 3300005456 | Bacteria | 3328 |
| 118 | Ga0070678_100066179 | 3300005456 | Bacteria | 2686 |
| 119 | Ga0070678_100091852 | 3300005456 | Bacteria | 2331 |
| 120 | Ga0070678_100182435 | 3300005456 | Bacteria | 1719 |
| 121 | Ga0070662_100050830 | 3300005457 | Bacteria | 2991 |
| 122 | Ga0070681_10069164 | 3300005458 | Bacteria | 3497 |
| 123 | Ga0070681_10085157 | 3300005458 | Bacteria | 3113 |
| 124 | Ga0068867_100165645 | 3300005459 | Bacteria | 1746 |
| 125 | Ga0070685_10000250 | 3300005466 | Bacteria | 35267 |
| 126 | Ga0070685_10073780 | 3300005466 | Bacteria | 2029 |
| 127 | Ga0070706_100467803 | 3300005467 | Bacteria | 1173 |
| 128 | Ga0070698_100001623 | 3300005471 | Bacteria | 25049 |
| 129 | Ga0070699_100000147 | 3300005518 | Bacteria | 66774 |
| 130 | Ga0070679_100009879 | 3300005530 | Bacteria | 9027 |
| 131 | Ga0070679_100019162 | 3300005530 | Bacteria | 6648 |
| 132 | Ga0070679_100037593 | 3300005530 | Bacteria | 4810 |
| 133 | Ga0070679_100189878 | 3300005530 | Bacteria | 2024 |
| 134 | Ga0070679_100374925 | 3300005530 | Bacteria | 1370 |
| 135 | Ga0070684_100027286 | 3300005535 | Bacteria | 4817 |
| 136 | Ga0070684_100033649 | 3300005535 | Bacteria | 4377 |
| 137 | Ga0070684_100094496 | 3300005535 | Bacteria | 2663 |
| 138 | Ga0070684_100354154 | 3300005535 | Bacteria | 1350 |
| 139 | Ga0070697_100044081 | 3300005536 | Bacteria | 3613 |
| 140 | Ga0068853_100021436 | 3300005539 | Bacteria | 5388 |
| 141 | Ga0068853_100022775 | 3300005539 | Bacteria | 5236 |
| 142 | Ga0068853_100091534 | 3300005539 | Bacteria | 2675 |
| 143 | Ga0068853_100256421 | 3300005539 | Bacteria | 1607 |
| 144 | Ga0068853_100277868 | 3300005539 | Bacteria | 1543 |
| 145 | Ga0068853_100322378 | 3300005539 | Bacteria | 1432 |
| 146 | Ga0068853_100445302 | 3300005539 | Bacteria | 1218 |
| 147 | Ga0070672_100000746 | 3300005543 | Bacteria | 19295 |
| 148 | Ga0070672_100089558 | 3300005543 | Bacteria | 2480 |
| 149 | Ga0070672_100249753 | 3300005543 | Bacteria | 1494 |
| 150 | Ga0070686_100112425 | 3300005544 | Bacteria | 1857 |
| 151 | Ga0070695_100011698 | 3300005545 | Bacteria | 5252 |
| 152 | Ga0070696_100000503 | 3300005546 | Bacteria | 24690 |
| 153 | Ga0070696_100108170 | 3300005546 | Bacteria | 2000 |
| 154 | Ga0070696_100178163 | 3300005546 | Bacteria | 1575 |
| 155 | Ga0070693_100016097 | 3300005547 | Bacteria | 3864 |
| 156 | Ga0070693_100132752 | 3300005547 | Bacteria | 1559 |
| 157 | Ga0070693_100240139 | 3300005547 | Bacteria | 1196 |
| 158 | Ga0070665_100004481 | 3300005548 | Bacteria | 14668 |
| 159 | Ga0070665_100020950 | 3300005548 | Bacteria | 6570 |
| 160 | Ga0070665_100033592 | 3300005548 | Bacteria | 5162 |
| 161 | Ga0070665_100043567 | 3300005548 | Bacteria | 4510 |
| 162 | Ga0070665_100141030 | 3300005548 | Bacteria | 2413 |
| 163 | Ga0070665_100142500 | 3300005548 | Bacteria | 2400 |
| 164 | Ga0070665_100152095 | 3300005548 | Bacteria | 2317 |
| 165 | Ga0070665_100160316 | 3300005548 | Bacteria | 2251 |
| 166 | Ga0070665_100190871 | 3300005548 | Bacteria | 2049 |
| 167 | Ga0070665_100529821 | 3300005548 | Bacteria | 1190 |
| 168 | Ga0070704_100014566 | 3300005549 | Bacteria | 4914 |
| 169 | Ga0070704_100139027 | 3300005549 | Bacteria | 1894 |
| 170 | Ga0068855_100036490 | 3300005563 | Bacteria | 5850 |
| 171 | Ga0068855_100037992 | 3300005563 | Bacteria | 5723 |
| 172 | Ga0068855_100084586 | 3300005563 | Bacteria | 3672 |
| 173 | Ga0068855_100436150 | 3300005563 | Bacteria | 1431 |
| 174 | Ga0070664_100115042 | 3300005564 | Bacteria | 2351 |
| 175 | Ga0068857_100002373 | 3300005577 | Bacteria | 15346 |
| 176 | Ga0068857_100051526 | 3300005577 | Bacteria | 3652 |
| 177 | Ga0068857_100060313 | 3300005577 | Bacteria | 3370 |
| 178 | Ga0068857_100096949 | 3300005577 | Bacteria | 2643 |
| 179 | Ga0068857_100210098 | 3300005577 | Bacteria | 1776 |
| 180 | Ga0068857_100450862 | 3300005577 | Bacteria | 1203 |
| 181 | Ga0068854_100115871 | 3300005578 | Bacteria | 2027 |
| 182 | Ga0068854_100133269 | 3300005578 | Bacteria | 1899 |
| 183 | Ga0068856_100002538 | 3300005614 | Bacteria | 18824 |
| 184 | Ga0068856_100025782 | 3300005614 | Bacteria | 5732 |
| 185 | Ga0068856_100118188 | 3300005614 | Bacteria | 2652 |
| 186 | Ga0068856_100206953 | 3300005614 | Bacteria | 1976 |
| 187 | Ga0068856_100390813 | 3300005614 | Bacteria | 1411 |
| 188 | Ga0068856_100403938 | 3300005614 | Bacteria | 1386 |
| 189 | Ga0070702_100162301 | 3300005615 | Bacteria | 1446 |
| 190 | Ga0068852_100001168 | 3300005616 | Bacteria | 17390 |
| 191 | Ga0068852_100016778 | 3300005616 | Bacteria | 5723 |
| 192 | Ga0068852_100019720 | 3300005616 | Bacteria | 5345 |
| 193 | Ga0068852_100045654 | 3300005616 | Bacteria | 3728 |
| 194 | Ga0068852_100103442 | 3300005616 | Bacteria | 2576 |
| 195 | Ga0068852_100121441 | 3300005616 | Bacteria | 2393 |
| 196 | Ga0068852_100174247 | 3300005616 | Bacteria | 2019 |
| 197 | Ga0068859_100003136 | 3300005617 | Bacteria | 16805 |
| 198 | Ga0068859_100041987 | 3300005617 | Bacteria | 4594 |
| 199 | Ga0068859_100067475 | 3300005617 | Bacteria | 3611 |
| 200 | Ga0068859_100079191 | 3300005617 | Bacteria | 3325 |
| 201 | Ga0068859_100208224 | 3300005617 | Bacteria | 2041 |
| 202 | Ga0068864_100000097 | 3300005618 | Bacteria | 85717 |
| 203 | Ga0068864_100083220 | 3300005618 | Bacteria | 2810 |
| 204 | Ga0068864_100163314 | 3300005618 | Bacteria | 2026 |
| 205 | Ga0068861_100000391 | 3300005719 | Bacteria | 25251 |
| 206 | Ga0068861_100066467 | 3300005719 | Bacteria | 2779 |
| 207 | Ga0068861_100080561 | 3300005719 | Bacteria | 2547 |
| 208 | Ga0068851_10020777 | 3300005834 | Bacteria | 3183 |
| 209 | Ga0068851_10023616 | 3300005834 | Bacteria | 3007 |
| 210 | Ga0068870_10058104 | 3300005840 | Bacteria | 2070 |
| 211 | Ga0068863_100057565 | 3300005841 | Bacteria | 3679 |
| 212 | Ga0068863_100064453 | 3300005841 | Bacteria | 3465 |
| 213 | Ga0068858_100000243 | 3300005842 | Bacteria | 58808 |
| 214 | Ga0068858_100037282 | 3300005842 | Bacteria | 4508 |
| 215 | Ga0068858_100176044 | 3300005842 | Bacteria | 2019 |
| 216 | Ga0068858_100359903 | 3300005842 | Bacteria | 1395 |
| 217 | Ga0068858_100412713 | 3300005842 | Bacteria | 1298 |
| 218 | Ga0068858_100468617 | 3300005842 | Bacteria | 1215 |
| 219 | Ga0068860_100004632 | 3300005843 | Bacteria | 14042 |
| 220 | Ga0068860_100013122 | 3300005843 | Bacteria | 8131 |
| 221 | Ga0068860_100020886 | 3300005843 | Bacteria | 6344 |
| 222 | Ga0068860_100056526 | 3300005843 | Bacteria | 3730 |
| 223 | Ga0068860_100128258 | 3300005843 | Bacteria | 2432 |
| 224 | Ga0068860_100582969 | 3300005843 | Bacteria | 1123 |
| 225 | Ga0068862_100001552 | 3300005844 | Bacteria | 21005 |
| 226 | Ga0068862_100002918 | 3300005844 | Bacteria | 14944 |
| 227 | Ga0068862_100418100 | 3300005844 | Bacteria | 1257 |
| 228 | Ga0081455_10008277 | 3300005937 | Bacteria | 10837 |
| 229 | Ga0081455_10019690 | 3300005937 | Bacteria | 6374 |
| 230 | Ga0081455_10067883 | 3300005937 | Bacteria | 2970 |
| 231 | Ga0081455_10070603 | 3300005937 | Bacteria | 2899 |
| 232 | Ga0081538_10017929 | 3300005981 | Bacteria | 5346 |
| 233 | Ga0081540_1000996 | 3300005983 | Bacteria | 25476 |
| 234 | Ga0081540_1008013 | 3300005983 | Bacteria | 7435 |
| 235 | Ga0081540_1010852 | 3300005983 | Bacteria | 6123 |
| 236 | Ga0081540_1028988 | 3300005983 | Bacteria | 3094 |
| 237 | Ga0081540_1071022 | 3300005983 | Bacteria | 1610 |
| 238 | Ga0081539_10000748 | 3300005985 | Bacteria | 64594 |
| 239 | Ga0081539_10030261 | 3300005985 | Bacteria | 3365 |
| 240 | Ga0070717_10010072 | 3300006028 | Bacteria | 7119 |
| 241 | Ga0070717_10014303 | 3300006028 | Bacteria | 6103 |
| 242 | Ga0070717_10016137 | 3300006028 | Bacteria | 5786 |
| 243 | Ga0070717_10128031 | 3300006028 | Bacteria | 2181 |
| 244 | Ga0070717_10321136 | 3300006028 | Bacteria | 1379 |
| 245 | Ga0075365_10067201 | 3300006038 | Bacteria | 2406 |
| 246 | Ga0075365_10081134 | 3300006038 | Bacteria | 2197 |
| 247 | Ga0075365_10192006 | 3300006038 | Bacteria | 1429 |
| 248 | Ga0075368_10018880 | 3300006042 | Bacteria | 2598 |
| 249 | Ga0075368_10069009 | 3300006042 | Bacteria | 1425 |
| 250 | Ga0075363_100032234 | 3300006048 | Bacteria | 2720 |
| 251 | Ga0075364_10022187 | 3300006051 | Bacteria | 4007 |
| 252 | Ga0075364_10044496 | 3300006051 | Bacteria | 2887 |
| 253 | Ga0075364_10146731 | 3300006051 | Bacteria | 1589 |
| 254 | Ga0075364_10213375 | 3300006051 | Bacteria | 1309 |
| 255 | Ga0070715_10000260 | 3300006163 | Bacteria | 12808 |
| 256 | Ga0070716_100000213 | 3300006173 | Bacteria | 23132 |
| 257 | Ga0070716_100020768 | 3300006173 | Bacteria | 3452 |
| 258 | Ga0070712_100010117 | 3300006175 | Bacteria | 5945 |
| 259 | Ga0070712_100016528 | 3300006175 | Bacteria | 4768 |
| 260 | Ga0075362_10000655 | 3300006177 | Bacteria | 10192 |
| 261 | Ga0075362_10008950 | 3300006177 | Bacteria | 3850 |
| 262 | Ga0075367_10038229 | 3300006178 | Bacteria | 2793 |
| 263 | Ga0075369_10002063 | 3300006186 | Bacteria | 7088 |
| 264 | Ga0075369_10011190 | 3300006186 | Bacteria | 3524 |
| 265 | Ga0075366_10242998 | 3300006195 | Bacteria | 1097 |
| 266 | Ga0097621_100029889 | 3300006237 | Bacteria | 4307 |
| 267 | Ga0097621_100041480 | 3300006237 | Bacteria | 3705 |
| 268 | Ga0097621_100146155 | 3300006237 | Bacteria | 2024 |
| 269 | Ga0097621_100185039 | 3300006237 | Bacteria | 1801 |
| 270 | Ga0075370_10042568 | 3300006353 | Bacteria | 2565 |
| 271 | Ga0075370_10083703 | 3300006353 | Bacteria | 1835 |
| 272 | Ga0075370_10087666 | 3300006353 | Bacteria | 1793 |
| 273 | Ga0075370_10123414 | 3300006353 | Bacteria | 1508 |
| 274 | Ga0068871_100001292 | 3300006358 | Bacteria | 16740 |
| 275 | Ga0068871_100058705 | 3300006358 | Bacteria | 3133 |
| 276 | Ga0068871_100107291 | 3300006358 | Bacteria | 2345 |
| 277 | Ga0075428_100002030 | 3300006844 | Bacteria | 21820 |
| 278 | Ga0075428_100003578 | 3300006844 | Bacteria | 17023 |
| 279 | Ga0075428_100013501 | 3300006844 | Bacteria | 9091 |
| 280 | Ga0075428_100068789 | 3300006844 | Bacteria | 3873 |
| 281 | Ga0075431_100014541 | 3300006847 | Bacteria | 7962 |
| 282 | Ga0075433_10023832 | 3300006852 | Bacteria | 5156 |
| 283 | Ga0075434_100033264 | 3300006871 | Bacteria | 5087 |
| 284 | Ga0075429_100002394 | 3300006880 | Bacteria | 15806 |
| 285 | Ga0075429_100060260 | 3300006880 | Bacteria | 3306 |
| 286 | Ga0068865_100035745 | 3300006881 | Bacteria | 3344 |
| 287 | Ga0068865_100094453 | 3300006881 | Bacteria | 2176 |
| 288 | Ga0068865_100191024 | 3300006881 | Bacteria | 1584 |
| 289 | Ga0068865_100443697 | 3300006881 | Bacteria | 1071 |
| 290 | Ga0068865_100467125 | 3300006881 | Bacteria | 1046 |
| 291 | Ga0097620_100003136 | 3300006931 | Bacteria | 16805 |
| 292 | Ga0097620_100041987 | 3300006931 | Bacteria | 4594 |
| 293 | Ga0097620_100067486 | 3300006931 | Bacteria | 3611 |
| 294 | Ga0097620_100079191 | 3300006931 | Bacteria | 3325 |
| 295 | Ga0097620_100208232 | 3300006931 | Bacteria | 2041 |
| 296 | Ga0099824_1013210 | 3300006942 | Bacteria | 8667 |
| 297 | Ga0075435_100073070 | 3300007076 | Bacteria | 2803 |
| 298 | Ga0075435_100570589 | 3300007076 | Bacteria | 980 |
| 299 | Ga0075435_100595263 | 3300007076 | Bacteria | 959 |
| 300 | Ga0099794_10047410 | 3300007265 | Bacteria | 2060 |
| 301 | Ga0099795_10023637 | 3300007788 | Bacteria | 2041 |
| 302 | Ga0105240_10000876 | 3300009093 | Bacteria | 54171 |
| 303 | Ga0105240_10000946 | 3300009093 | Bacteria | 51674 |
| 304 | Ga0105240_10023381 | 3300009093 | Bacteria | 8174 |
| 305 | Ga0105240_10343595 | 3300009093 | Bacteria | 1695 |
| 306 | Ga0111539_10002382 | 3300009094 | Bacteria | 24956 |
| 307 | Ga0111539_10007116 | 3300009094 | Bacteria | 14343 |
| 308 | Ga0111539_10012046 | 3300009094 | Bacteria | 10846 |
| 309 | Ga0111539_10015447 | 3300009094 | Bacteria | 9497 |
| 310 | Ga0111539_10089698 | 3300009094 | Bacteria | 3613 |
| 311 | Ga0111539_10294080 | 3300009094 | Bacteria | 1890 |
| 312 | Ga0111539_10461243 | 3300009094 | Bacteria | 1480 |
| 313 | Ga0111539_11042298 | 3300009094 | Bacteria | 951 |
| 314 | Ga0105245_10000024 | 3300009098 | Bacteria | 178565 |
| 315 | Ga0105245_10002720 | 3300009098 | Bacteria | 15913 |
| 316 | Ga0105245_10003410 | 3300009098 | Bacteria | 14233 |
| 317 | Ga0105245_10005629 | 3300009098 | Bacteria | 11010 |
| 318 | Ga0105245_10085154 | 3300009098 | Bacteria | 2897 |
| 319 | Ga0105245_10118752 | 3300009098 | Bacteria | 2468 |
| 320 | Ga0105245_10131020 | 3300009098 | Bacteria | 2352 |
| 321 | Ga0105245_10217779 | 3300009098 | Bacteria | 1841 |
| 322 | Ga0105245_10287109 | 3300009098 | Bacteria | 1610 |
| 323 | Ga0105245_10421353 | 3300009098 | Bacteria | 1338 |
| 324 | Ga0105247_10041178 | 3300009101 | Bacteria | 2826 |
| 325 | Ga0105247_10238139 | 3300009101 | Bacteria | 1239 |
| 326 | Ga0105247_10346834 | 3300009101 | Bacteria | 1043 |
| 327 | Ga0114129_10107850 | 3300009147 | Bacteria | 3845 |
| 328 | Ga0114129_10118296 | 3300009147 | Bacteria | 3650 |
| 329 | Ga0105243_10042437 | 3300009148 | Bacteria | 3561 |
| 330 | Ga0105243_10075153 | 3300009148 | Bacteria | 2742 |
| 331 | Ga0105243_10184710 | 3300009148 | Bacteria | 1816 |
| 332 | Ga0105243_10660491 | 3300009148 | Bacteria | 1014 |
| 333 | Ga0105241_10004477 | 3300009174 | Bacteria | 10333 |
| 334 | Ga0105241_10075673 | 3300009174 | Bacteria | 2623 |
| 335 | Ga0105241_10287200 | 3300009174 | Bacteria | 1407 |
| 336 | Ga0105242_10132099 | 3300009176 | Bacteria | 2156 |
| 337 | Ga0105248_10064938 | 3300009177 | Bacteria | 4097 |
| 338 | Ga0105248_10121324 | 3300009177 | Bacteria | 2949 |
| 339 | Ga0105248_10160474 | 3300009177 | Bacteria | 2536 |
| 340 | Ga0105248_10186176 | 3300009177 | Bacteria | 2339 |
| 341 | Ga0105248_10252582 | 3300009177 | Bacteria | 1984 |
| 342 | Ga0105248_11004952 | 3300009177 | Bacteria | 942 |
| 343 | Ga0105237_10000233 | 3300009545 | Bacteria | 79346 |
| 344 | Ga0105237_10005728 | 3300009545 | Bacteria | 13958 |
| 345 | Ga0105237_10019359 | 3300009545 | Bacteria | 7030 |
| 346 | Ga0105237_10022378 | 3300009545 | Bacteria | 6485 |
| 347 | Ga0105237_10042957 | 3300009545 | Bacteria | 4556 |
| 348 | Ga0105237_10094823 | 3300009545 | Bacteria | 2973 |
| 349 | Ga0105237_10516181 | 3300009545 | Bacteria | 1201 |
| 350 | Ga0105238_10004976 | 3300009551 | Bacteria | 13140 |
| 351 | Ga0105238_10008040 | 3300009551 | Bacteria | 10550 |
| 352 | Ga0105238_10215847 | 3300009551 | Bacteria | 1894 |
| 353 | Ga0105249_10006733 | 3300009553 | Bacteria | 10011 |
| 354 | Ga0105249_10110119 | 3300009553 | Bacteria | 2602 |
| 355 | Ga0105249_10578157 | 3300009553 | Bacteria | 1176 |
| 356 | Ga0105249_10812335 | 3300009553 | Bacteria | 999 |
| 357 | Ga0099796_10015265 | 3300010159 | Bacteria | 2242 |
| 358 | Ga0105239_10000120 | 3300010375 | Bacteria | 110003 |
| 359 | Ga0105239_10001640 | 3300010375 | Bacteria | 29511 |
| 360 | Ga0105239_10013259 | 3300010375 | Bacteria | 9160 |
| 361 | Ga0105239_10024893 | 3300010375 | Bacteria | 6592 |
| 362 | Ga0105239_10091956 | 3300010375 | Bacteria | 3348 |
| 363 | Ga0105239_10096136 | 3300010375 | Bacteria | 3273 |
| 364 | Ga0105239_10242659 | 3300010375 | Bacteria | 2022 |
| 365 | Ga0105239_10260202 | 3300010375 | Bacteria | 1950 |
| 366 | Ga0105239_10408747 | 3300010375 | Bacteria | 1537 |
| 367 | Ga0105239_10759717 | 3300010375 | Bacteria | 1110 |
| 368 | Ga0105246_10024005 | 3300011119 | Bacteria | 3954 |
| 369 | Ga0157327_1011436 | 3300012512 | Bacteria | 857 |
| 370 | Ga0157373_10002272 | 3300013100 | Bacteria | 14563 |
| 371 | Ga0157371_10003535 | 3300013102 | Bacteria | 14102 |
| 372 | Ga0157371_10012477 | 3300013102 | Bacteria | 6493 |
| 373 | Ga0157371_10014832 | 3300013102 | Bacteria | 5867 |
| 374 | Ga0157371_10030480 | 3300013102 | Bacteria | 3892 |
| 375 | Ga0157370_10018060 | 3300013104 | Bacteria | 7099 |
| 376 | Ga0157370_10036890 | 3300013104 | Bacteria | 4742 |
| 377 | Ga0157370_10096746 | 3300013104 | Bacteria | 2769 |
| 378 | Ga0157370_10099723 | 3300013104 | Bacteria | 2722 |
| 379 | Ga0157370_10310718 | 3300013104 | Bacteria | 1455 |
| 380 | Ga0157369_10005591 | 3300013105 | Bacteria | 14600 |
| 381 | Ga0157369_10043505 | 3300013105 | Bacteria | 4895 |
| 382 | Ga0157369_10457380 | 3300013105 | Bacteria | 1322 |
| 383 | Ga0157369_10661123 | 3300013105 | Bacteria | 1077 |
| 384 | Ga0157374_10061312 | 3300013296 | Bacteria | 3522 |
| 385 | Ga0157378_10485051 | 3300013297 | Bacteria | 1232 |
| 386 | Ga0163162_10055397 | 3300013306 | Bacteria | 3992 |
| 387 | Ga0163162_10062679 | 3300013306 | Bacteria | 3759 |
| 388 | Ga0163162_10081293 | 3300013306 | Bacteria | 3311 |
| 389 | Ga0163162_10095526 | 3300013306 | Bacteria | 3059 |
| 390 | Ga0157372_10001329 | 3300013307 | Bacteria | 26726 |
| 391 | Ga0157372_10004023 | 3300013307 | Bacteria | 15768 |
| 392 | Ga0157372_10019917 | 3300013307 | Bacteria | 7232 |
| 393 | Ga0157372_10046686 | 3300013307 | Bacteria | 4808 |
| 394 | Ga0157372_10095853 | 3300013307 | Bacteria | 3381 |
| 395 | Ga0157372_10463599 | 3300013307 | Bacteria | 1477 |
| 396 | Ga0157375_10000001 | 3300013308 | Bacteria | 696576 |
| 397 | Ga0157375_10005472 | 3300013308 | Bacteria | 11043 |
| 398 | Ga0157375_10015648 | 3300013308 | Bacteria | 6795 |
| 399 | Ga0157375_10047205 | 3300013308 | Bacteria | 4204 |
| 400 | Ga0157375_10124879 | 3300013308 | Bacteria | 2687 |
| 401 | Ga0157375_10264323 | 3300013308 | Bacteria | 1882 |
| 402 | Ga0157375_10332404 | 3300013308 | Bacteria | 1684 |
| 403 | Ga0163163_10070660 | 3300014325 | Bacteria | 3477 |
| 404 | Ga0163163_10250536 | 3300014325 | Bacteria | 1821 |
| 405 | Ga0163163_10254406 | 3300014325 | Bacteria | 1807 |
| 406 | Ga0163163_10740804 | 3300014325 | Bacteria | 1046 |
| 407 | Ga0157380_10002658 | 3300014326 | Bacteria | 12115 |
| 408 | Ga0157380_10052545 | 3300014326 | Bacteria | 3227 |
| 409 | Ga0182008_10000023 | 3300014497 | Bacteria | 201526 |
| 410 | Ga0182008_10118496 | 3300014497 | Bacteria | 1315 |
| 411 | Ga0157377_10429198 | 3300014745 | Bacteria | 907 |
| 412 | Ga0157379_10004846 | 3300014968 | Bacteria | 11553 |
| 413 | Ga0157376_10195673 | 3300014969 | Bacteria | 1857 |
| 414 | Ga0157376_10429912 | 3300014969 | Bacteria | 1283 |
| 415 | Ga0157376_10899430 | 3300014969 | Bacteria | 903 |
| 416 | Ga0182006_1003750 | 3300015261 | Bacteria | 7668 |
| 417 | Ga0182006_1011496 | 3300015261 | Bacteria | 3893 |
| 418 | Ga0163161_10027330 | 3300017792 | Bacteria | 4047 |
| 419 | Ga0206351_10377797 | 3300020077 | Bacteria | 887 |
| 420 | Ga0206354_10242601 | 3300020081 | Bacteria | 1341 |
| 421 | Ga0206354_11168486 | 3300020081 | Bacteria | 5368 |
| 422 | Ga0206353_10210928 | 3300020082 | Bacteria | 3561 |
| 423 | Ga0214544_1000026 | 3300021320 | Bacteria | 161530 |
| 424 | Ga0214542_1000025 | 3300021321 | Bacteria | 183588 |
| 425 | Ga0214545_1000014 | 3300021324 | Bacteria | 183588 |
| 426 | Ga0214543_1000034 | 3300021327 | Bacteria | 183712 |
| 427 | Ga0213876_10021664 | 3300021384 | Bacteria | 3398 |
| 428 | Ga0228598_1002128 | 3300024227 | Bacteria | 4335 |
| 429 | Ga0209646_1000002 | 3300025246 | Bacteria | 1425781 |
| 430 | Ga0209026_1000086 | 3300025250 | Bacteria | 185551 |
| 431 | Ga0209026_1007300 | 3300025250 | Bacteria | 2519 |
| 432 | Ga0209677_100874 | 3300025253 | Bacteria | 14845 |
| 433 | Ga0209233_1000766 | 3300025261 | Bacteria | 14467 |
| 434 | Ga0209233_1004428 | 3300025261 | Bacteria | 4778 |
| 435 | Ga0209233_1027131 | 3300025261 | Bacteria | 1392 |
| 436 | Ga0207666_1013043 | 3300025271 | Bacteria | 1164 |
| 437 | Ga0209455_1003984 | 3300025272 | Bacteria | 5009 |
| 438 | Ga0209455_1006055 | 3300025272 | Bacteria | 3635 |
| 439 | Ga0209673_1045515 | 3300025273 | Bacteria | 1205 |
| 440 | Ga0209675_1000692 | 3300025291 | Bacteria | 23450 |
| 441 | Ga0209025_1000008 | 3300025294 | Bacteria | 1130876 |
| 442 | Ga0209564_1000049 | 3300025295 | Bacteria | 362075 |
| 443 | Ga0209564_1000065 | 3300025295 | Bacteria | 315205 |
| 444 | Ga0209564_1000248 | 3300025295 | Bacteria | 116617 |
| 445 | Ga0209758_1001510 | 3300025297 | Bacteria | 27007 |
| 446 | Ga0209758_1004242 | 3300025297 | Bacteria | 12127 |
| 447 | Ga0209758_1037278 | 3300025297 | Bacteria | 1881 |
| 448 | Ga0209256_1000014 | 3300025299 | Bacteria | 687409 |
| 449 | Ga0209256_1000200 | 3300025299 | Bacteria | 112931 |
| 450 | Ga0207426_1001097 | 3300025302 | Bacteria | 24936 |
| 451 | Ga0207426_1029203 | 3300025302 | Bacteria | 1821 |
| 452 | Ga0207697_10042990 | 3300025315 | Bacteria | 1858 |
| 453 | Ga0207697_10067325 | 3300025315 | Bacteria | 1497 |
| 454 | Ga0207697_10078409 | 3300025315 | Bacteria | 1390 |
| 455 | Ga0207656_10021724 | 3300025321 | Bacteria | 2567 |
| 456 | Ga0207656_10162837 | 3300025321 | Bacteria | 1062 |
| 457 | Ga0207653_10000605 | 3300025885 | Bacteria | 12539 |
| 458 | Ga0207692_10000295 | 3300025898 | Bacteria | 17307 |
| 459 | Ga0207692_10013187 | 3300025898 | Bacteria | 3578 |
| 460 | Ga0207710_10048100 | 3300025900 | Bacteria | 1908 |
| 461 | Ga0207710_10053962 | 3300025900 | Bacteria | 1809 |
| 462 | Ga0207680_10104280 | 3300025903 | Bacteria | 1827 |
| 463 | Ga0207647_10028419 | 3300025904 | Bacteria | 3632 |
| 464 | Ga0207685_10115129 | 3300025905 | Bacteria | 1172 |
| 465 | Ga0207699_10007555 | 3300025906 | Bacteria | 5320 |
| 466 | Ga0207699_10023406 | 3300025906 | Bacteria | 3362 |
| 467 | Ga0207699_10102766 | 3300025906 | Bacteria | 1817 |
| 468 | Ga0207645_10080365 | 3300025907 | Bacteria | 2090 |
| 469 | Ga0207645_10288376 | 3300025907 | Bacteria | 1091 |
| 470 | Ga0207705_10002850 | 3300025909 | Bacteria | 13226 |
| 471 | Ga0207705_10020137 | 3300025909 | Bacteria | 4772 |
| 472 | Ga0207705_10020562 | 3300025909 | Bacteria | 4713 |
| 473 | Ga0207705_10033577 | 3300025909 | Bacteria | 3666 |
| 474 | Ga0207654_10011026 | 3300025911 | Bacteria | 4600 |
| 475 | Ga0207654_10040629 | 3300025911 | Bacteria | 2622 |
| 476 | Ga0207654_10085782 | 3300025911 | Bacteria | 1907 |
| 477 | Ga0207654_10135041 | 3300025911 | Bacteria | 1566 |
| 478 | Ga0207654_10377771 | 3300025911 | Bacteria | 981 |
| 479 | Ga0207707_10000455 | 3300025912 | Bacteria | 42610 |
| 480 | Ga0207707_10008592 | 3300025912 | Bacteria | 8854 |
| 481 | Ga0207707_10039737 | 3300025912 | Bacteria | 4112 |
| 482 | Ga0207707_10160761 | 3300025912 | Bacteria | 1964 |
| 483 | Ga0207707_10220712 | 3300025912 | Bacteria | 1650 |
| 484 | Ga0207707_10265207 | 3300025912 | Bacteria | 1489 |
| 485 | Ga0207695_10000013 | 3300025913 | Bacteria | 821265 |
| 486 | Ga0207695_10000014 | 3300025913 | Bacteria | 812599 |
| 487 | Ga0207695_10001701 | 3300025913 | Bacteria | 35229 |
| 488 | Ga0207695_10126008 | 3300025913 | Bacteria | 2523 |
| 489 | Ga0207671_10000663 | 3300025914 | Bacteria | 44922 |
| 490 | Ga0207671_10045318 | 3300025914 | Bacteria | 3252 |
| 491 | Ga0207671_10046369 | 3300025914 | Bacteria | 3215 |
| 492 | Ga0207671_10055028 | 3300025914 | Bacteria | 2948 |
| 493 | Ga0207693_10000674 | 3300025915 | Bacteria | 30670 |
| 494 | Ga0207693_10001851 | 3300025915 | Bacteria | 18534 |
| 495 | Ga0207693_10067664 | 3300025915 | Bacteria | 2797 |
| 496 | Ga0207693_10071644 | 3300025915 | Bacteria | 2713 |
| 497 | Ga0207663_10001588 | 3300025916 | Bacteria | 10673 |
| 498 | Ga0207663_10180901 | 3300025916 | Bacteria | 1506 |
| 499 | Ga0207663_10213684 | 3300025916 | Bacteria | 1399 |
| 500 | Ga0207660_10049603 | 3300025917 | Bacteria | 2977 |
| 501 | Ga0207660_10106305 | 3300025917 | Bacteria | 2104 |
| 502 | Ga0207660_10108200 | 3300025917 | Bacteria | 2087 |
| 503 | Ga0207660_10402205 | 3300025917 | Bacteria | 1103 |
| 504 | Ga0207657_10001360 | 3300025919 | Bacteria | 26055 |
| 505 | Ga0207657_10010706 | 3300025919 | Bacteria | 9132 |
| 506 | Ga0207657_10022581 | 3300025919 | Bacteria | 5883 |
| 507 | Ga0207657_10025657 | 3300025919 | Bacteria | 5430 |
| 508 | Ga0207657_10103629 | 3300025919 | Bacteria | 2358 |
| 509 | Ga0207657_10141242 | 3300025919 | Bacteria | 1967 |
| 510 | Ga0207657_10268549 | 3300025919 | Bacteria | 1356 |
| 511 | Ga0207649_10258166 | 3300025920 | Bacteria | 1258 |
| 512 | Ga0207652_10001894 | 3300025921 | Bacteria | 18100 |
| 513 | Ga0207652_10011235 | 3300025921 | Bacteria | 7213 |
| 514 | Ga0207652_10014967 | 3300025921 | Bacteria | 6292 |
| 515 | Ga0207652_10049693 | 3300025921 | Bacteria | 3591 |
| 516 | Ga0207652_10312129 | 3300025921 | Bacteria | 1419 |
| 517 | Ga0207652_10499422 | 3300025921 | Bacteria | 1095 |
| 518 | Ga0207646_10097938 | 3300025922 | Bacteria | 2628 |
| 519 | Ga0207694_10010880 | 3300025924 | Bacteria | 6869 |
| 520 | Ga0207650_10026446 | 3300025925 | Bacteria | 4139 |
| 521 | Ga0207650_10049296 | 3300025925 | Bacteria | 3109 |
| 522 | Ga0207650_10152134 | 3300025925 | Bacteria | 1827 |
| 523 | Ga0207650_10381831 | 3300025925 | Bacteria | 1163 |
| 524 | Ga0207659_10021567 | 3300025926 | Bacteria | 4278 |
| 525 | Ga0207659_10118249 | 3300025926 | Bacteria | 2027 |
| 526 | Ga0207659_10129623 | 3300025926 | Bacteria | 1945 |
| 527 | Ga0207659_10137642 | 3300025926 | Bacteria | 1892 |
| 528 | Ga0207687_10000003 | 3300025927 | Bacteria | 875159 |
| 529 | Ga0207687_10003248 | 3300025927 | Bacteria | 11011 |
| 530 | Ga0207687_10022444 | 3300025927 | Bacteria | 4201 |
| 531 | Ga0207687_10052440 | 3300025927 | Bacteria | 2847 |
| 532 | Ga0207687_10141134 | 3300025927 | Bacteria | 1828 |
| 533 | Ga0207687_10199626 | 3300025927 | Bacteria | 1562 |
| 534 | Ga0207687_10233614 | 3300025927 | Bacteria | 1454 |
| 535 | Ga0207700_10007259 | 3300025928 | Bacteria | 6760 |
| 536 | Ga0207700_10074150 | 3300025928 | Bacteria | 2631 |
| 537 | Ga0207700_10101643 | 3300025928 | Bacteria | 2294 |
| 538 | Ga0207664_10037043 | 3300025929 | Bacteria | 3772 |
| 539 | Ga0207664_10055294 | 3300025929 | Bacteria | 3149 |
| 540 | Ga0207664_10211874 | 3300025929 | Bacteria | 1677 |
| 541 | Ga0207664_10229713 | 3300025929 | Bacteria | 1612 |
| 542 | Ga0207644_10010758 | 3300025931 | Bacteria | 6035 |
| 543 | Ga0207690_10088745 | 3300025932 | Bacteria | 2179 |
| 544 | Ga0207690_10458793 | 3300025932 | Bacteria | 1025 |
| 545 | Ga0207706_10036474 | 3300025933 | Bacteria | 4367 |
| 546 | Ga0207706_10069282 | 3300025933 | Bacteria | 3103 |
| 547 | Ga0207706_10510997 | 3300025933 | Bacteria | 1036 |
| 548 | Ga0207686_10156952 | 3300025934 | Bacteria | 1591 |
| 549 | Ga0207709_10164127 | 3300025935 | Bacteria | 1552 |
| 550 | Ga0207670_10001802 | 3300025936 | Bacteria | 11198 |
| 551 | Ga0207670_10001926 | 3300025936 | Bacteria | 10864 |
| 552 | Ga0207669_10018303 | 3300025937 | Bacteria | 3618 |
| 553 | Ga0207669_10229945 | 3300025937 | Bacteria | 1367 |
| 554 | Ga0207704_10029068 | 3300025938 | Bacteria | 3076 |
| 555 | Ga0207704_10030086 | 3300025938 | Bacteria | 3040 |
| 556 | Ga0207704_10179751 | 3300025938 | Bacteria | 1527 |
| 557 | Ga0207704_10468658 | 3300025938 | Bacteria | 1009 |
| 558 | Ga0207704_10515052 | 3300025938 | Bacteria | 966 |
| 559 | Ga0207665_10000214 | 3300025939 | Bacteria | 39213 |
| 560 | Ga0207665_10033322 | 3300025939 | Bacteria | 3413 |
| 561 | Ga0207665_10033533 | 3300025939 | Bacteria | 3404 |
| 562 | Ga0207691_10003072 | 3300025940 | Bacteria | 16287 |
| 563 | Ga0207691_10065199 | 3300025940 | Bacteria | 3298 |
| 564 | Ga0207711_10040565 | 3300025941 | Bacteria | 3961 |
| 565 | Ga0207711_10301715 | 3300025941 | Bacteria | 1477 |
| 566 | Ga0207689_10022903 | 3300025942 | Bacteria | 5247 |
| 567 | Ga0207689_10278977 | 3300025942 | Bacteria | 1384 |
| 568 | Ga0207661_10016302 | 3300025944 | Bacteria | 5482 |
| 569 | Ga0207661_10079882 | 3300025944 | Bacteria | 2697 |
| 570 | Ga0207661_10156701 | 3300025944 | Bacteria | 1973 |
| 571 | Ga0207661_10176576 | 3300025944 | Bacteria | 1863 |
| 572 | Ga0207661_10224409 | 3300025944 | Bacteria | 1661 |
| 573 | Ga0207661_10294037 | 3300025944 | Bacteria | 1454 |
| 574 | Ga0207679_10284023 | 3300025945 | Bacteria | 1420 |
| 575 | Ga0207679_10301114 | 3300025945 | Bacteria | 1382 |
| 576 | Ga0207667_10003451 | 3300025949 | Bacteria | 19512 |
| 577 | Ga0207667_10023687 | 3300025949 | Bacteria | 6758 |
| 578 | Ga0207667_10026202 | 3300025949 | Bacteria | 6373 |
| 579 | Ga0207667_10049551 | 3300025949 | Bacteria | 4435 |
| 580 | Ga0207667_10131918 | 3300025949 | Bacteria | 2573 |
| 581 | Ga0207667_10133252 | 3300025949 | Bacteria | 2560 |
| 582 | Ga0207667_10318830 | 3300025949 | Bacteria | 1587 |
| 583 | Ga0207667_10593511 | 3300025949 | Bacteria | 1117 |
| 584 | Ga0207667_10692218 | 3300025949 | Bacteria | 1022 |
| 585 | Ga0207651_10001255 | 3300025960 | Bacteria | 11421 |
| 586 | Ga0207651_10022078 | 3300025960 | Bacteria | 3883 |
| 587 | Ga0207651_10071638 | 3300025960 | Bacteria | 2458 |
| 588 | Ga0207651_10113782 | 3300025960 | Bacteria | 2037 |
| 589 | Ga0207651_10288804 | 3300025960 | Bacteria | 1359 |
| 590 | Ga0207712_10004027 | 3300025961 | Bacteria | 9282 |
| 591 | Ga0207712_10100054 | 3300025961 | Bacteria | 2154 |
| 592 | Ga0207712_10234213 | 3300025961 | Bacteria | 1476 |
| 593 | Ga0207668_10008276 | 3300025972 | Bacteria | 6197 |
| 594 | Ga0207668_10044071 | 3300025972 | Bacteria | 3032 |
| 595 | Ga0207668_10047201 | 3300025972 | Bacteria | 2947 |
| 596 | Ga0207668_10330858 | 3300025972 | Bacteria | 1267 |
| 597 | Ga0207640_10000958 | 3300025981 | Bacteria | 16038 |
| 598 | Ga0207658_10086543 | 3300025986 | Bacteria | 2417 |
| 599 | Ga0207658_10141078 | 3300025986 | Bacteria | 1950 |
| 600 | Ga0207677_10000035 | 3300026023 | Bacteria | 117469 |
| 601 | Ga0207677_10058641 | 3300026023 | Bacteria | 2652 |
| 602 | Ga0207703_10000046 | 3300026035 | Bacteria | 154474 |
| 603 | Ga0207703_10191991 | 3300026035 | Bacteria | 1809 |
| 604 | Ga0207639_10010790 | 3300026041 | Bacteria | 6333 |
| 605 | Ga0207639_10016673 | 3300026041 | Bacteria | 5203 |
| 606 | Ga0207639_10457561 | 3300026041 | Bacteria | 1159 |
| 607 | Ga0207678_10015383 | 3300026067 | Bacteria | 6728 |
| 608 | Ga0207678_10029610 | 3300026067 | Bacteria | 4780 |
| 609 | Ga0207678_10035630 | 3300026067 | Bacteria | 4332 |
| 610 | Ga0207678_10051481 | 3300026067 | Bacteria | 3555 |
| 611 | Ga0207678_10154120 | 3300026067 | Bacteria | 1962 |
| 612 | Ga0207708_10000034 | 3300026075 | Bacteria | 144931 |
| 613 | Ga0207708_10002177 | 3300026075 | Bacteria | 14456 |
| 614 | Ga0207708_10019003 | 3300026075 | Bacteria | 5175 |
| 615 | Ga0207708_10089051 | 3300026075 | Bacteria | 2378 |
| 616 | Ga0207702_10000041 | 3300026078 | Bacteria | 150754 |
| 617 | Ga0207702_10041037 | 3300026078 | Bacteria | 3879 |
| 618 | Ga0207702_10173471 | 3300026078 | Bacteria | 1979 |
| 619 | Ga0207641_10093622 | 3300026088 | Bacteria | 2634 |
| 620 | Ga0207641_10100166 | 3300026088 | Bacteria | 2551 |
| 621 | Ga0207648_10129348 | 3300026089 | Bacteria | 2222 |
| 622 | Ga0207648_10217306 | 3300026089 | Bacteria | 1698 |
| 623 | Ga0207648_10311891 | 3300026089 | Bacteria | 1412 |
| 624 | Ga0207676_10000013 | 3300026095 | Bacteria | 343067 |
| 625 | Ga0207676_10165996 | 3300026095 | Bacteria | 1918 |
| 626 | Ga0207676_10277754 | 3300026095 | Bacteria | 1519 |
| 627 | Ga0207674_10004439 | 3300026116 | Bacteria | 16862 |
| 628 | Ga0207674_10006751 | 3300026116 | Bacteria | 13473 |
| 629 | Ga0207674_10008394 | 3300026116 | Bacteria | 11940 |
| 630 | Ga0207674_10024824 | 3300026116 | Bacteria | 6398 |
| 631 | Ga0207674_10043139 | 3300026116 | Bacteria | 4652 |
| 632 | Ga0207674_10054103 | 3300026116 | Bacteria | 4088 |
| 633 | Ga0207674_10603900 | 3300026116 | Bacteria | 1060 |
| 634 | Ga0207675_100000058 | 3300026118 | Bacteria | 81487 |
| 635 | Ga0207675_100015761 | 3300026118 | Bacteria | 7048 |
| 636 | Ga0207675_100098698 | 3300026118 | Bacteria | 2751 |
| 637 | Ga0207675_100099716 | 3300026118 | Bacteria | 2736 |
| 638 | Ga0207675_100112893 | 3300026118 | Bacteria | 2565 |
| 639 | Ga0207675_100224130 | 3300026118 | Bacteria | 1812 |
| 640 | Ga0207683_10037653 | 3300026121 | Bacteria | 4213 |
| 641 | Ga0207683_10038663 | 3300026121 | Bacteria | 4161 |
| 642 | Ga0207683_10060645 | 3300026121 | Bacteria | 3326 |
| 643 | Ga0207683_10067429 | 3300026121 | Bacteria | 3157 |
| 644 | Ga0207698_10000882 | 3300026142 | Bacteria | 17381 |
| 645 | Ga0207698_10016150 | 3300026142 | Bacteria | 5023 |
| 646 | Ga0207698_10024459 | 3300026142 | Bacteria | 4239 |
| 647 | Ga0207698_10035640 | 3300026142 | Bacteria | 3643 |
| 648 | Ga0207698_10097212 | 3300026142 | Bacteria | 2429 |
| 649 | Ga0207698_10106270 | 3300026142 | Bacteria | 2341 |
| 650 | Ga0207698_10355920 | 3300026142 | Bacteria | 1384 |
| 651 | Ga0209389_1000023 | 3300027296 | Bacteria | 150730 |
| 652 | Ga0209589_1000010 | 3300027357 | Bacteria | 237657 |
| 653 | Ga0209489_100011 | 3300027361 | Bacteria | 244710 |
| 654 | Ga0209588_1017474 | 3300027671 | Bacteria | 2224 |
| 655 | Ga0209813_10006099 | 3300027866 | Bacteria | 2962 |
| 656 | Ga0207428_10000061 | 3300027907 | Bacteria | 155152 |
| 657 | Ga0207428_10003490 | 3300027907 | Bacteria | 15246 |
| 658 | Ga0207428_10060402 | 3300027907 | Bacteria | 3004 |
| 659 | Ga0207428_10064444 | 3300027907 | Bacteria | 2893 |
| 660 | Ga0268266_10013121 | 3300028379 | Bacteria | 7144 |
| 661 | Ga0268266_10016287 | 3300028379 | Bacteria | 6355 |
| 662 | Ga0268266_10054094 | 3300028379 | Bacteria | 3450 |
| 663 | Ga0268266_10385033 | 3300028379 | Bacteria | 1323 |
| 664 | Ga0268266_10619450 | 3300028379 | Bacteria | 1040 |
| 665 | Ga0268265_10000170 | 3300028380 | Bacteria | 78404 |
| 666 | Ga0268265_10002176 | 3300028380 | Bacteria | 15162 |
| 667 | Ga0268264_10000093 | 3300028381 | Bacteria | 232057 |
| 668 | Ga0268264_10014852 | 3300028381 | Bacteria | 6396 |
| 669 | Ga0268264_10112031 | 3300028381 | Bacteria | 2392 |
| 670 | Ga0268264_10295862 | 3300028381 | Bacteria | 1522 |
| 671 | Ga0268264_10787041 | 3300028381 | Bacteria | 949 |
| 672 | Ga0265319_1095150 | 3300028563 | Bacteria | 938 |
| 673 | Ga0265334_10027999 | 3300028573 | Bacteria | 2267 |
| 674 | Ga0265323_10003068 | 3300028653 | Bacteria | 7438 |
| 675 | Ga0265336_10000859 | 3300028666 | Bacteria | 15784 |
| 676 | Ga0265336_10003744 | 3300028666 | Bacteria | 5884 |
| 677 | Ga0265336_10022562 | 3300028666 | Bacteria | 2003 |
| 678 | Ga0307517_10000085 | 3300028786 | Bacteria | 131200 |
| 679 | Ga0307517_10070050 | 3300028786 | Bacteria | 3166 |
| 680 | Ga0307517_10082837 | 3300028786 | Bacteria | 2719 |
| 681 | Ga0307517_10212282 | 3300028786 | Bacteria | 1190 |
| 682 | Ga0307515_10011214 | 3300028794 | Bacteria | 17023 |
| 683 | Ga0307515_10043225 | 3300028794 | Bacteria | 7014 |
| 684 | Ga0307515_10104231 | 3300028794 | Bacteria | 3390 |
| 685 | Ga0307515_10116112 | 3300028794 | Bacteria | 3076 |
| 686 | Ga0265338_10000013 | 3300028800 | Bacteria | 379065 |
| 687 | Ga0265338_10011715 | 3300028800 | Bacteria | 10095 |
| 688 | Ga0265338_10020201 | 3300028800 | Bacteria | 7018 |
| 689 | Ga0265324_10000030 | 3300029957 | Bacteria | 126471 |
| 690 | Ga0265324_10012333 | 3300029957 | Bacteria | 3225 |
| 691 | Ga0265324_10118916 | 3300029957 | Bacteria | 897 |
| 692 | Ga0307511_10141145 | 3300030521 | Bacteria | 1415 |
| 693 | Ga0307512_10011391 | 3300030522 | Bacteria | 8429 |
| 694 | Ga0307512_10030839 | 3300030522 | Bacteria | 4655 |
| 695 | Ga0265330_10006124 | 3300031235 | Bacteria | 5957 |
| 696 | Ga0265328_10000120 | 3300031239 | Bacteria | 37260 |
| 697 | Ga0265328_10056618 | 3300031239 | Bacteria | 1439 |
| 698 | Ga0265320_10001892 | 3300031240 | Bacteria | 14763 |
| 699 | Ga0265325_10000289 | 3300031241 | Bacteria | 35297 |
| 700 | Ga0265325_10004960 | 3300031241 | Bacteria | 8297 |
| 701 | Ga0265325_10016721 | 3300031241 | Bacteria | 4094 |
| 702 | Ga0265339_10001605 | 3300031249 | Bacteria | 16732 |
| 703 | Ga0265339_10013486 | 3300031249 | Bacteria | 4950 |
| 704 | Ga0265339_10019139 | 3300031249 | Bacteria | 4024 |
| 705 | Ga0265339_10082151 | 3300031249 | Bacteria | 1701 |
| 706 | Ga0265339_10197389 | 3300031249 | Bacteria | 994 |
| 707 | Ga0265327_10038302 | 3300031251 | Bacteria | 2617 |
| 708 | Ga0265327_10070456 | 3300031251 | Bacteria | 1752 |
| 709 | Ga0265316_10142157 | 3300031344 | Bacteria | 1802 |
| 710 | Ga0307513_10009510 | 3300031456 | Bacteria | 12293 |
| 711 | Ga0307513_10028716 | 3300031456 | Bacteria | 6354 |
| 712 | Ga0307509_10086802 | 3300031507 | Bacteria | 3216 |
| 713 | Ga0307408_100000183 | 3300031548 | Bacteria | 69517 |
| 714 | Ga0307408_100546737 | 3300031548 | Bacteria | 1021 |
| 715 | Ga0307408_100557376 | 3300031548 | Bacteria | 1012 |
| 716 | Ga0265313_10000644 | 3300031595 | Bacteria | 35985 |
| 717 | Ga0265313_10002595 | 3300031595 | Bacteria | 15390 |
| 718 | Ga0265313_10011673 | 3300031595 | Bacteria | 5442 |
| 719 | Ga0307508_10025462 | 3300031616 | Bacteria | 5364 |
| 720 | Ga0307508_10053920 | 3300031616 | Bacteria | 3566 |
| 721 | Ga0307508_10056249 | 3300031616 | Bacteria | 3484 |
| 722 | Ga0265314_10024736 | 3300031711 | Bacteria | 4546 |
| 723 | Ga0265314_10034452 | 3300031711 | Bacteria | 3701 |
| 724 | Ga0265314_10052431 | 3300031711 | Bacteria | 2836 |
| 725 | Ga0265342_10005779 | 3300031712 | Bacteria | 9351 |
| 726 | Ga0265342_10135373 | 3300031712 | Bacteria | 1377 |
| 727 | Ga0316576_10052362 | 3300031727 | Bacteria | 2973 |
| 728 | Ga0316576_10121529 | 3300031727 | Bacteria | 1961 |
| 729 | Ga0316578_10006597 | 3300031728 | Bacteria | 5746 |
| 730 | Ga0307516_10000683 | 3300031730 | Bacteria | 46007 |
| 731 | Ga0307516_10025519 | 3300031730 | Bacteria | 6017 |
| 732 | Ga0307516_10025796 | 3300031730 | Bacteria | 5978 |
| 733 | Ga0307516_10033423 | 3300031730 | Bacteria | 5174 |
| 734 | Ga0307516_10119591 | 3300031730 | Bacteria | 2427 |
| 735 | Ga0307516_10226214 | 3300031730 | Bacteria | 1577 |
| 736 | Ga0307516_10357482 | 3300031730 | Bacteria | 1125 |
| 737 | Ga0307405_10322622 | 3300031731 | Bacteria | 1180 |
| 738 | Ga0316577_10012248 | 3300031733 | Bacteria | 4671 |
| 739 | Ga0307410_10124823 | 3300031852 | Bacteria | 1883 |
| 740 | Ga0307406_10586094 | 3300031901 | Bacteria | 917 |
| 741 | Ga0307406_10605590 | 3300031901 | Bacteria | 904 |
| 742 | Ga0307407_10063330 | 3300031903 | Bacteria | 2169 |
| 743 | Ga0307412_10000004 | 3300031911 | Bacteria | 544053 |
| 744 | Ga0307412_10043611 | 3300031911 | Bacteria | 2922 |
| 745 | Ga0307412_10128262 | 3300031911 | Bacteria | 1838 |
| 746 | Ga0307409_100034390 | 3300031995 | Bacteria | 3700 |
| 747 | Ga0307409_100226263 | 3300031995 | Bacteria | 1692 |
| 748 | Ga0307409_100381920 | 3300031995 | Bacteria | 1339 |
| 749 | Ga0307409_100877577 | 3300031995 | Bacteria | 909 |
| 750 | Ga0307416_100104122 | 3300032002 | Bacteria | 2480 |
| 751 | Ga0307416_100379893 | 3300032002 | Bacteria | 1442 |
| 752 | Ga0307414_10000028 | 3300032004 | Bacteria | 192108 |
| 753 | Ga0307414_10000313 | 3300032004 | Bacteria | 28201 |
| 754 | Ga0307414_10048793 | 3300032004 | Bacteria | 2923 |
| 755 | Ga0307414_10213170 | 3300032004 | Bacteria | 1580 |
| 756 | Ga0307411_10020733 | 3300032005 | Bacteria | 3831 |
| 757 | Ga0307411_10075747 | 3300032005 | Bacteria | 2298 |
| 758 | Ga0307415_100012029 | 3300032126 | Bacteria | 4986 |
| 759 | Ga0307415_100326991 | 3300032126 | Bacteria | 1281 |
| 760 | Ga0316583_10023870 | 3300032133 | Bacteria | 2183 |
| 761 | Ga0307507_10077207 | 3300033179 | Bacteria | 2964 |
| 762 | Ga0307510_10009700 | 3300033180 | Bacteria | 11458 |
| 763 | Ga0307510_10038953 | 3300033180 | Bacteria | 5246 |
| 764 | Ga0307510_10147399 | 3300033180 | Bacteria | 1982 |
| 765 | Ga0373928_0023913 | 3300035084 | Bacteria | 1306 |
| 766 | Ga0373929_0016201 | 3300035085 | Bacteria | 1458 |
| 767 | Ga0373934_0092763 | 3300035086 | Bacteria | 1218 |
| 768 | Ga0373949_0057431 | 3300035090 | Bacteria | 994 |
| 769 | Ga0373952_0004006 | 3300035092 | Bacteria | 2662 |
| 770 | Ga0373936_0119026 | 3300035113 | Bacteria | 1126 |
| 771 | Ga0373939_0042943 | 3300035114 | Bacteria | 1369 |
| 772 | Ga0373945_0023726 | 3300035116 | Bacteria | 2121 |
| 773 | Ga0373953_0015389 | 3300035117 | Bacteria | 2771 |
| 774 | Ga0373954_0046188 | 3300035118 | Bacteria | 2035 |
| 775 | Ga0373956_0166097 | 3300035119 | Bacteria | 1041 |
| 776 | Ga0373943_0026562 | 3300035170 | Bacteria | 2713 |
| 777 | Ga0373946_0014317 | 3300035171 | Bacteria | 2990 |
| 778 | Ga0373946_0092576 | 3300035171 | Bacteria | 1342 |
| 779 | Ga0373955_0011011 | 3300035172 | Bacteria | 4294 |
| 780 | Ga0373955_0067511 | 3300035172 | Bacteria | 1991 |
| 781 | Ga0373955_0363132 | 3300035172 | Bacteria | 878 |
| 782 | Ga0373942_0027692 | 3300035207 | Bacteria | 1476 |
| 783 | Ga0373961_0004146 | 3300035241 | Bacteria | 3523 |
| 784 | Ga0373961_0038190 | 3300035241 | Bacteria | 1375 |
| 785 | Ga0373961_0042104 | 3300035241 | Bacteria | 1322 |
| 786 | Ga0373962_0007004 | 3300035242 | Bacteria | 2749 |
| 787 | Ga0316574_0008438 | 3300035398 | Bacteria | 5721 |
| 788 | Ga0316574_0074147 | 3300035398 | Bacteria | 2153 |
| 789 | Ga0316574_0240295 | 3300035398 | Bacteria | 1158 |
| 790 | Ga0373924_0033016 | 3300035410 | Bacteria | 2087 |
| 791 | Ga0373924_0041591 | 3300035410 | Bacteria | 1883 |
| 792 | Ga0373931_0000311 | 3300035691 | Bacteria | 20588 |
| 793 | Ga0373931_0001895 | 3300035691 | Bacteria | 9143 |
| 794 | Ga0373931_0002367 | 3300035691 | Bacteria | 8338 |
| 795 | Ga0373931_0015481 | 3300035691 | Bacteria | 3741 |
| 796 | Ga0373931_0075912 | 3300035691 | Bacteria | 1845 |
| 797 | Ga0373931_0186725 | 3300035691 | Bacteria | 1231 |
| 798 | Ga0373935_0003068 | 3300035692 | Bacteria | 9628 |
| 799 | Ga0373935_0080381 | 3300035692 | Bacteria | 2118 |
| 800 | Ga0373935_0211476 | 3300035692 | Bacteria | 1344 |
| 801 | Ga0373935_0270836 | 3300035692 | Bacteria | 1193 |
| 802 | Ga0373927_0004108 | 3300035695 | Bacteria | 10256 |
| 803 | Ga0373927_0005360 | 3300035695 | Bacteria | 8859 |
| 804 | Ga0373927_0052572 | 3300035695 | Bacteria | 2635 |
| 805 | Ga0373933_0000933 | 3300035724 | Bacteria | 17845 |
| 806 | Ga0373933_0061032 | 3300035724 | Bacteria | 2274 |
| 807 | Ga0373947_0006080 | 3300035725 | Bacteria | 7033 |
| 808 | Ga0373947_0008409 | 3300035725 | Bacteria | 5947 |
| 809 | Ga0373937_0045613 | 3300036401 | Bacteria | 4006 |
| 810 | Ga0373937_0088430 | 3300036401 | Bacteria | 2868 |
| 811 | Ga0373937_0121480 | 3300036401 | Bacteria | 2434 |
| 812 | Ga0373937_0168020 | 3300036401 | Bacteria | 2057 |
| 813 | Ga0316582_0026741 | 3300036647 | Bacteria | 3476 |
| 814 | Ga0316584_0011555 | 3300036712 | Bacteria | 6208 |
| 815 | Ga0316584_0091839 | 3300036712 | Bacteria | 2273 |
| 816 | Ga0373925_0028943 | 3300037068 | Bacteria | 4061 |
| 817 | Ga0373925_0068998 | 3300037068 | Bacteria | 2670 |
| 818 | Ga0373925_0284042 | 3300037068 | Bacteria | 1333 |
| 819 | Ga0373925_0501794 | 3300037068 | Bacteria | 996 |
| 820 | Ga0373925_0549490 | 3300037068 | Bacteria | 950 |
| 821 | Ga0395899_0005004 | 3300037312 | Bacteria | 10314 |
| 822 | Ga0395900_0000126 | 3300037418 | Bacteria | 127586 |
| 823 | Ga0395900_0186497 | 3300037418 | Bacteria | 2105 |
| 824 | Ga0395900_0255536 | 3300037418 | Bacteria | 1752 |
| 825 | Ga0395900_0367860 | 3300037418 | Bacteria | 1408 |
| 826 | Ga0395898_0031059 | 3300037466 | Bacteria | 5343 |
| 827 | Ga0395898_0193692 | 3300037466 | Bacteria | 1942 |
| 828 | Ga0395905_0001098 | 3300037471 | Bacteria | 34054 |
| 829 | Ga0395905_0100628 | 3300037471 | Bacteria | 2714 |
| 830 | Ga0395901_0000249 | 3300038443 | Bacteria | 66993 |
| 831 | Ga0395901_0046475 | 3300038443 | Bacteria | 4509 |
| 832 | Ga0395901_0068530 | 3300038443 | Bacteria | 3696 |
| 833 | Ga0395901_0227851 | 3300038443 | Bacteria | 1946 |
| 834 | Ga0395901_0322404 | 3300038443 | Bacteria | 1598 |
| 835 | Ga0395901_0460761 | 3300038443 | Bacteria | 1299 |
| 836 | Ga0436365_0021051 | 3300039437 | Bacteria | 1184 |
| 837 | Ga0436365_0523062 | 3300039437 | Bacteria | 9388 |
| 838 | Ga0436365_1782545 | 3300039437 | Bacteria | 4773 |
| 839 | Ga0436361_0728889 | 3300039447 | Bacteria | 3011 |
| 840 | Ga0436363_0751650 | 3300039450 | Bacteria | 972 |
| 841 | Ga0436362_0128160 | 3300039453 | Bacteria | 8388 |
| 842 | Ga0439466_0069963 | 3300041411 | Bacteria | 1119 |
| 843 | Ga0439465_0088166 | 3300041413 | Bacteria | 1059 |
| 844 | Ga0451853_2754853 | 3300041512 | Bacteria | 3184 |
| 845 | Ga0439433_0009247 | 3300041999 | Bacteria | 2145 |
| 846 | Ga0439454_004785 | 3300042011 | Bacteria | 1582 |
| 847 | Ga0439446_0107479 | 3300042156 | Bacteria | 887 |
| 848 | Ga0451577_0000339 | 3300042876 | Bacteria | 87540 |
| 849 | Ga0451577_0002271 | 3300042876 | Bacteria | 23248 |
| 850 | Ga0466972_0000185 | 3300044658 | Bacteria | 48335 |
| 851 | Ga0466972_0134507 | 3300044658 | Bacteria | 1164 |
| 852 | Ga0466982_0000003 | 3300044672 | Bacteria | 417243 |
| 853 | Ga0453683_0006567 | 3300044673 | Bacteria | 7969 |
| 854 | Ga0453683_0352300 | 3300044673 | Bacteria | 946 |
| 855 | Ga0466966_0003932 | 3300044684 | Bacteria | 9811 |
| 856 | Ga0466966_0072786 | 3300044684 | Bacteria | 2151 |
| 857 | Ga0466964_0001690 | 3300044706 | Bacteria | 7619 |
| 858 | Ga0453684_0000063 | 3300044712 | Bacteria | 486079 |
| 859 | Ga0453684_0000065 | 3300044712 | Bacteria | 468481 |
| 860 | Ga0453684_0000369 | 3300044712 | Bacteria | 184784 |
| 861 | Ga0453684_0000677 | 3300044712 | Bacteria | 122140 |
| 862 | Ga0453684_0000846 | 3300044712 | Bacteria | 103225 |
| 863 | Ga0453684_0001472 | 3300044712 | Bacteria | 66447 |
| 864 | Ga0453684_0008351 | 3300044712 | Bacteria | 18604 |
| 865 | Ga0453684_0056656 | 3300044712 | Bacteria | 5081 |
| 866 | Ga0453684_0211122 | 3300044712 | Bacteria | 2256 |
| 867 | Ga0453684_0230091 | 3300044712 | Bacteria | 2140 |
| 868 | Ga0453684_0300239 | 3300044712 | Bacteria | 1825 |
| 869 | Ga0466971_0012312 | 3300044719 | Bacteria | 3747 |
| 870 | Ga0466968_0001743 | 3300044735 | Bacteria | 7850 |
| 871 | Ga0466970_0014536 | 3300044765 | Bacteria | 4043 |
| 872 | Ga0451576_0000175 | 3300045051 | Bacteria | 161976 |
| 873 | Ga0451576_0002720 | 3300045051 | Bacteria | 25673 |
| 874 | Ga0451576_0005625 | 3300045051 | Bacteria | 15649 |
| 875 | Ga0451576_0013554 | 3300045051 | Bacteria | 9117 |
| 876 | Ga0451576_0108803 | 3300045051 | Bacteria | 2884 |
| 877 | Ga0451576_0766263 | 3300045051 | Bacteria | 1013 |
| 878 | Ga0466967_0781313 | 3300045976 | Bacteria | 948 |
| 879 | Ga0495592_0006658 | 3300046454 | Bacteria | 8614 |
| 880 | Ga0495603_0000064 | 3300046455 | Bacteria | 46716 |
| 881 | Ga0495603_0023901 | 3300046455 | Bacteria | 3697 |
| 882 | Ga0495603_0029475 | 3300046455 | Bacteria | 3308 |
| 883 | Ga0495629_0001385 | 3300046459 | Bacteria | 19116 |
| 884 | Ga0495629_0056265 | 3300046459 | Bacteria | 2751 |
| 885 | Ga0495629_0095759 | 3300046459 | Bacteria | 2071 |
| 886 | Ga0495629_0139921 | 3300046459 | Bacteria | 1684 |
| 887 | Ga0495629_0381925 | 3300046459 | Bacteria | 958 |
| 888 | Ga0495638_0007547 | 3300046460 | Bacteria | 7783 |
| 889 | Ga0495638_0021678 | 3300046460 | Bacteria | 4228 |
| 890 | Ga0495638_0086312 | 3300046460 | Bacteria | 1897 |
| 891 | Ga0495641_0005307 | 3300046461 | Bacteria | 8752 |
| 892 | Ga0495651_0056086 | 3300046462 | Bacteria | 3026 |
| 893 | Ga0495653_0332515 | 3300046463 | Bacteria | 981 |
| 894 | Ga0495650_0063228 | 3300046471 | Bacteria | 1477 |
| 895 | Ga0495580_0006847 | 3300046472 | Bacteria | 9227 |
| 896 | Ga0495580_0190002 | 3300046472 | Bacteria | 1417 |
| 897 | Ga0495582_0000173 | 3300046473 | Bacteria | 35208 |
| 898 | Ga0495582_0149179 | 3300046473 | Bacteria | 1327 |
| 899 | Ga0495639_0000218 | 3300046475 | Bacteria | 29492 |
| 900 | Ga0495639_0085081 | 3300046475 | Bacteria | 1478 |
| 901 | Ga0495639_0189848 | 3300046475 | Bacteria | 1003 |
| 902 | Ga0495639_0265184 | 3300046475 | Bacteria | 851 |
| 903 | Ga0495664_0041556 | 3300046477 | Bacteria | 2721 |
| 904 | Ga0495664_0045785 | 3300046477 | Bacteria | 2595 |
| 905 | Ga0495664_0078800 | 3300046477 | Bacteria | 1974 |
| 906 | Ga0495664_0134197 | 3300046477 | Bacteria | 1500 |
| 907 | Ga0495584_0189261 | 3300046491 | Bacteria | 1046 |
| 908 | Ga0495585_0105649 | 3300046492 | Bacteria | 1502 |
| 909 | Ga0495594_0000590 | 3300046499 | Bacteria | 18674 |
| 910 | Ga0495583_0138352 | 3300046506 | Bacteria | 1015 |
| 911 | Ga0495606_0000976 | 3300046507 | Bacteria | 41812 |
| 912 | Ga0495606_0040906 | 3300046507 | Bacteria | 3111 |
| 913 | Ga0495606_0084562 | 3300046507 | Bacteria | 1965 |
| 914 | Ga0495606_0189410 | 3300046507 | Bacteria | 1180 |
| 915 | Ga0495616_0152310 | 3300046513 | Bacteria | 1045 |
| 916 | Ga0495618_0380725 | 3300046514 | Bacteria | 866 |
| 917 | Ga0495628_0020280 | 3300046516 | Bacteria | 5487 |
| 918 | Ga0495628_0123368 | 3300046516 | Bacteria | 1985 |
| 919 | Ga0495630_0000613 | 3300046517 | Bacteria | 25849 |
| 920 | Ga0495630_0161775 | 3300046517 | Bacteria | 1704 |
| 921 | Ga0495630_0210794 | 3300046517 | Bacteria | 1483 |
| 922 | Ga0495631_0025561 | 3300046518 | Bacteria | 2718 |
| 923 | Ga0495631_0102424 | 3300046518 | Bacteria | 1232 |
| 924 | Ga0495632_0061385 | 3300046519 | Bacteria | 1824 |
| 925 | Ga0495644_0083683 | 3300046523 | Bacteria | 1203 |
| 926 | Ga0495648_0003170 | 3300046524 | Bacteria | 14641 |
| 927 | Ga0495648_0006291 | 3300046524 | Bacteria | 9710 |
| 928 | Ga0495648_0010776 | 3300046524 | Bacteria | 6942 |
| 929 | Ga0495648_0060459 | 3300046524 | Bacteria | 2254 |
| 930 | Ga0495666_0015057 | 3300046526 | Bacteria | 3849 |
| 931 | Ga0495642_0086051 | 3300046528 | Bacteria | 1327 |
| 932 | Ga0495652_0050312 | 3300046529 | Bacteria | 3563 |
| 933 | Ga0495652_0106248 | 3300046529 | Bacteria | 2267 |
| 934 | Ga0495652_0200960 | 3300046529 | Bacteria | 1512 |
| 935 | Ga0495654_0068911 | 3300046530 | Bacteria | 1680 |
| 936 | Ga0495665_0000531 | 3300046531 | Bacteria | 19287 |
| 937 | Ga0495640_0001572 | 3300046533 | Bacteria | 17991 |
| 938 | Ga0495640_0173760 | 3300046533 | Bacteria | 1376 |
| 939 | Ga0495640_0266369 | 3300046533 | Bacteria | 1069 |
| 940 | Ga0495587_0089108 | 3300046536 | Bacteria | 1783 |
| 941 | Ga0495587_0236491 | 3300046536 | Bacteria | 1028 |
| 942 | Ga0495598_0022585 | 3300046537 | Bacteria | 1685 |
| 943 | Ga0495645_0017708 | 3300046543 | Bacteria | 5108 |
| 944 | Ga0495645_0200435 | 3300046543 | Bacteria | 1354 |
| 945 | Ga0495622_0004472 | 3300046557 | Bacteria | 6485 |
| 946 | Ga0495622_0007156 | 3300046557 | Bacteria | 5185 |
| 947 | Ga0495667_0011222 | 3300046559 | Bacteria | 6068 |
| 948 | Ga0495667_0185640 | 3300046559 | Bacteria | 1333 |
| 949 | Ga0495656_0005268 | 3300046615 | Bacteria | 4455 |
| 950 | Ga0495668_0044002 | 3300046616 | Bacteria | 2481 |
| 951 | Ga0495634_0005581 | 3300046642 | Bacteria | 9654 |
| 952 | Ga0495611_0101743 | 3300046648 | Bacteria | 1335 |
| 953 | Ga0495625_0026116 | 3300046660 | Bacteria | 4416 |
| 954 | Ga0495625_0245479 | 3300046660 | Bacteria | 1164 |
| 955 | Ga0495625_0292825 | 3300046660 | Bacteria | 1044 |
| 956 | Ga0495635_0125225 | 3300046663 | Bacteria | 1752 |
| 957 | Ga0495659_0006815 | 3300046664 | Bacteria | 3610 |
| 958 | Ga0495661_0071445 | 3300046665 | Bacteria | 2028 |
| 959 | Ga0495588_0022423 | 3300046674 | Bacteria | 3121 |
| 960 | Ga0495588_0025243 | 3300046674 | Bacteria | 2959 |
| 961 | Ga0495588_0043652 | 3300046674 | Bacteria | 2295 |
| 962 | Ga0495657_0067110 | 3300046675 | Bacteria | 2355 |
| 963 | Ga0495599_0091836 | 3300046678 | Bacteria | 1894 |
| 964 | Ga0495623_0005573 | 3300046679 | Bacteria | 8220 |
| 965 | Ga0495623_0015377 | 3300046679 | Bacteria | 4945 |
| 966 | Ga0495623_0039786 | 3300046679 | Bacteria | 3003 |
| 967 | Ga0495623_0127850 | 3300046679 | Bacteria | 1524 |
| 968 | Ga0495646_0007737 | 3300046680 | Bacteria | 6829 |
| 969 | Ga0495646_0018063 | 3300046680 | Bacteria | 4466 |
| 970 | Ga0495646_0177824 | 3300046680 | Bacteria | 1169 |
| 971 | Ga0495647_0001441 | 3300046681 | Bacteria | 7369 |
| 972 | Ga0495647_0189555 | 3300046681 | Bacteria | 898 |
| 973 | Ga0495658_0001201 | 3300046683 | Bacteria | 13610 |
| 974 | Ga0495658_0121574 | 3300046683 | Bacteria | 1580 |
| 975 | Ga0495658_0173644 | 3300046683 | Bacteria | 1335 |
| 976 | Ga0495658_0194425 | 3300046683 | Bacteria | 1262 |
| 977 | Ga0495669_0000675 | 3300046684 | Bacteria | 14839 |
| 978 | Ga0495613_0004213 | 3300046689 | Bacteria | 10767 |
| 979 | Ga0495613_0022119 | 3300046689 | Bacteria | 4738 |
| 980 | Ga0495624_0005853 | 3300046690 | Bacteria | 8795 |
| 981 | Ga0495624_0156857 | 3300046690 | Bacteria | 1391 |
| 982 | Ga0495670_0012092 | 3300046691 | Bacteria | 4246 |
| 983 | Ga0495649_0192146 | 3300046694 | Bacteria | 1062 |
| 984 | Ga0495600_0134287 | 3300046809 | Bacteria | 1607 |
| 985 | Ga0495581_0000015 | 3300047315 | Bacteria | 59214 |
| 986 | Ga0495604_0007695 | 3300047317 | Bacteria | 8534 |
| 987 | Ga0495604_0184641 | 3300047317 | Bacteria | 1457 |
| 988 | Ga0495674_0023636 | 3300047319 | Bacteria | 5661 |
| 989 | Ga0495674_0188042 | 3300047319 | Bacteria | 1717 |
| 990 | Ga0495674_0260327 | 3300047319 | Bacteria | 1425 |
| 991 | Ga0495672_0029388 | 3300047320 | Bacteria | 3461 |
| 992 | Ga0495672_0030049 | 3300047320 | Bacteria | 3414 |
| 993 | Ga0495672_0078929 | 3300047320 | Bacteria | 1840 |
| 994 | Ga0495676_0010028 | 3300047321 | Bacteria | 8605 |
| 995 | Ga0495676_0068201 | 3300047321 | Bacteria | 2749 |
| 996 | Ga0495680_0028809 | 3300047322 | Bacteria | 4551 |
| 997 | Ga0495680_0286456 | 3300047322 | Bacteria | 1160 |
| 998 | Ga0495687_000014 | 3300047443 | Bacteria | 366896 |
| 999 | Ga0495675_0184391 | 3300047444 | Bacteria | 1276 |
| 1000 | Ga0495677_0050316 | 3300047445 | Bacteria | 1533 |
| 1001 | Ga0495677_0062158 | 3300047445 | Bacteria | 1386 |
| 1002 | Ga0495673_0011722 | 3300047469 | Bacteria | 4694 |
| 1003 | Ga0495673_0122979 | 3300047469 | Bacteria | 1026 |
| 1004 | Ga0495684_0020248 | 3300047471 | Bacteria | 5125 |
| 1005 | Ga0495684_0107992 | 3300047471 | Bacteria | 2102 |
| 1006 | Ga0495684_0142254 | 3300047471 | Bacteria | 1798 |
| 1007 | Ga0495686_0118536 | 3300047472 | Bacteria | 1580 |
| 1008 | Ga0495593_0000053 | 3300047673 | Bacteria | 47697 |
| 1009 | Ga0495602_0028411 | 3300048088 | Bacteria | 5352 |
| 1010 | Ga0495602_0233166 | 3300048088 | Bacteria | 1381 |
| 1011 | Ga0495602_0517644 | 3300048088 | Bacteria | 831 |
| 1012 | Ga0495614_0013513 | 3300048089 | Bacteria | 3580 |
| 1013 | Ga0496100_0001613 | 3300048903 | Bacteria | 11146 |
| 1014 | Ga0496100_0022737 | 3300048903 | Bacteria | 3798 |
| 1015 | Ga0496100_0103566 | 3300048903 | Bacteria | 1965 |
| 1016 | Ga0496100_0157079 | 3300048903 | Bacteria | 1627 |
| 1017 | Ga0496100_0163165 | 3300048903 | Bacteria | 1599 |
| 1018 | Ga0496101_0004421 | 3300048904 | Bacteria | 8844 |
| 1019 | Ga0496101_0009601 | 3300048904 | Bacteria | 6365 |
| 1020 | Ga0496101_0016002 | 3300048904 | Bacteria | 5062 |
| 1021 | Ga0496101_0051545 | 3300048904 | Bacteria | 2966 |
| 1022 | Ga0496101_0194944 | 3300048904 | Bacteria | 1564 |
| 1023 | Ga0496101_0323504 | 3300048904 | Bacteria | 1210 |
| 1024 | Ga0496102_0002733 | 3300048905 | Bacteria | 15037 |
| 1025 | Ga0496102_0004127 | 3300048905 | Bacteria | 12315 |
| 1026 | Ga0496102_0010509 | 3300048905 | Bacteria | 7970 |
| 1027 | Ga0496102_0012054 | 3300048905 | Bacteria | 7470 |
| 1028 | Ga0496102_0039048 | 3300048905 | Bacteria | 4287 |
| 1029 | Ga0496102_0075894 | 3300048905 | Bacteria | 3090 |
| 1030 | Ga0496102_0374801 | 3300048905 | Bacteria | 1339 |
| 1031 | Ga0496102_0466179 | 3300048905 | Bacteria | 1184 |
| 1032 | Ga0496103_0018374 | 3300048906 | Bacteria | 4193 |
| 1033 | Ga0496103_0024344 | 3300048906 | Bacteria | 3654 |
| 1034 | Ga0496103_0028159 | 3300048906 | Bacteria | 3408 |
| 1035 | Ga0496103_0060299 | 3300048906 | Bacteria | 2358 |
| 1036 | Ga0496104_0005875 | 3300048907 | Bacteria | 10748 |
| 1037 | Ga0496104_0107198 | 3300048907 | Bacteria | 2677 |
| 1038 | Ga0496104_0156129 | 3300048907 | Bacteria | 2189 |
| 1039 | Ga0496104_0241888 | 3300048907 | Bacteria | 1717 |
| 1040 | Ga0496104_0544724 | 3300048907 | Bacteria | 1071 |
| 1041 | Ga0496105_0004722 | 3300048908 | Bacteria | 10282 |
| 1042 | Ga0496105_0011342 | 3300048908 | Bacteria | 7039 |
| 1043 | Ga0496105_0031311 | 3300048908 | Bacteria | 4361 |
| 1044 | Ga0496105_0058692 | 3300048908 | Bacteria | 3175 |
| 1045 | Ga0496105_0502404 | 3300048908 | Bacteria | 952 |
| 1046 | Ga0496106_0001015 | 3300048909 | Bacteria | 20580 |
| 1047 | Ga0496106_0005543 | 3300048909 | Bacteria | 9342 |
| 1048 | Ga0496106_0009070 | 3300048909 | Bacteria | 7350 |
| 1049 | Ga0496106_0033461 | 3300048909 | Bacteria | 3835 |
| 1050 | Ga0496106_0040286 | 3300048909 | Bacteria | 3498 |
| 1051 | Ga0496106_0130287 | 3300048909 | Bacteria | 1972 |
| 1052 | Ga0496107_0004695 | 3300048910 | Bacteria | 9281 |
| 1053 | Ga0496107_0004750 | 3300048910 | Bacteria | 9230 |
| 1054 | Ga0496107_0010483 | 3300048910 | Bacteria | 6442 |
| 1055 | Ga0496107_0021151 | 3300048910 | Bacteria | 4598 |
| 1056 | Ga0496107_0025412 | 3300048910 | Bacteria | 4193 |
| 1057 | Ga0496107_0040274 | 3300048910 | Bacteria | 3353 |
| 1058 | Ga0496107_0135756 | 3300048910 | Bacteria | 1817 |
| 1059 | Ga0496108_0001846 | 3300048911 | Bacteria | 16935 |
| 1060 | Ga0496108_0056123 | 3300048911 | Bacteria | 3308 |
| 1061 | Ga0496108_0059130 | 3300048911 | Bacteria | 3223 |
| 1062 | Ga0496108_0067242 | 3300048911 | Bacteria | 3022 |
| 1063 | Ga0496108_0068040 | 3300048911 | Bacteria | 3004 |
| 1064 | Ga0496108_0134300 | 3300048911 | Bacteria | 2128 |
| 1065 | Ga0496108_0144379 | 3300048911 | Bacteria | 2051 |
| 1066 | Ga0496108_0162530 | 3300048911 | Bacteria | 1930 |
| 1067 | Ga0496108_0195638 | 3300048911 | Bacteria | 1753 |
| 1068 | Ga0496109_0001905 | 3300048912 | Bacteria | 17328 |
| 1069 | Ga0496109_0007688 | 3300048912 | Bacteria | 9135 |
| 1070 | Ga0496109_0010512 | 3300048912 | Bacteria | 7909 |
| 1071 | Ga0496109_0021929 | 3300048912 | Bacteria | 5654 |
| 1072 | Ga0496109_0090748 | 3300048912 | Bacteria | 2826 |
| 1073 | Ga0496109_0135180 | 3300048912 | Bacteria | 2303 |
| 1074 | Ga0496109_0181768 | 3300048912 | Bacteria | 1975 |
| 1075 | Ga0496110_0000747 | 3300048913 | Bacteria | 22458 |
| 1076 | Ga0496110_0007695 | 3300048913 | Bacteria | 8620 |
| 1077 | Ga0496110_0018621 | 3300048913 | Bacteria | 5824 |
| 1078 | Ga0496110_0045963 | 3300048913 | Bacteria | 3818 |
| 1079 | Ga0496110_0175184 | 3300048913 | Bacteria | 1947 |
| 1080 | Ga0496110_0244693 | 3300048913 | Bacteria | 1632 |
| 1081 | Ga0496111_0002943 | 3300048914 | Bacteria | 10415 |
| 1082 | Ga0496111_0003597 | 3300048914 | Bacteria | 9607 |
| 1083 | Ga0496111_0060507 | 3300048914 | Bacteria | 2745 |
| 1084 | Ga0496111_0082770 | 3300048914 | Bacteria | 2344 |
| 1085 | Ga0496111_0127639 | 3300048914 | Bacteria | 1881 |
| 1086 | Ga0496111_0569807 | 3300048914 | Bacteria | 830 |
| 1087 | Ga0496112_0000008 | 3300048915 | Bacteria | 310323 |
| 1088 | Ga0496112_0002552 | 3300048915 | Bacteria | 14709 |
| 1089 | Ga0496112_0025326 | 3300048915 | Bacteria | 5697 |
| 1090 | Ga0496112_0025430 | 3300048915 | Bacteria | 5685 |
| 1091 | Ga0496112_0070372 | 3300048915 | Bacteria | 3457 |
| 1092 | Ga0496112_0080021 | 3300048915 | Bacteria | 3232 |
| 1093 | Ga0496112_0109901 | 3300048915 | Bacteria | 2727 |
| 1094 | Ga0496112_0128842 | 3300048915 | Bacteria | 2501 |
| 1095 | Ga0496112_0181220 | 3300048915 | Bacteria | 2070 |
| 1096 | Ga0496113_0005354 | 3300048916 | Bacteria | 7996 |
| 1097 | Ga0496113_0006480 | 3300048916 | Bacteria | 7425 |
| 1098 | Ga0496113_0066360 | 3300048916 | Bacteria | 2733 |
| 1099 | Ga0496114_0004664 | 3300048917 | Bacteria | 10654 |
| 1100 | Ga0496114_0008103 | 3300048917 | Bacteria | 8322 |
| 1101 | Ga0496114_0046088 | 3300048917 | Bacteria | 3622 |
| 1102 | Ga0496114_0116474 | 3300048917 | Bacteria | 2294 |
| 1103 | Ga0496114_0197004 | 3300048917 | Bacteria | 1763 |
| 1104 | Ga0496115_0005898 | 3300048918 | Bacteria | 8932 |
| 1105 | Ga0496115_0018787 | 3300048918 | Bacteria | 5313 |
| 1106 | Ga0496115_0049876 | 3300048918 | Bacteria | 3352 |
| 1107 | Ga0496116_0014758 | 3300048919 | Bacteria | 6214 |
| 1108 | Ga0496116_0024015 | 3300048919 | Bacteria | 4521 |
| 1109 | Ga0496117_0034418 | 3300048920 | Bacteria | 3816 |
| 1110 | Ga0496117_0134878 | 3300048920 | Bacteria | 1489 |
| 1111 | Ga0496117_0149044 | 3300048920 | Bacteria | 1388 |
| 1112 | Ga0496118_0006042 | 3300048921 | Bacteria | 13485 |
| 1113 | Ga0496118_0012813 | 3300048921 | Bacteria | 8004 |
| 1114 | Ga0496118_0022887 | 3300048921 | Bacteria | 5446 |
| 1115 | Ga0496118_0059237 | 3300048921 | Bacteria | 2853 |
| 1116 | Ga0496118_0062556 | 3300048921 | Bacteria | 2746 |
| 1117 | Ga0496118_0134632 | 3300048921 | Bacteria | 1579 |
| 1118 | Ga0496119_0033029 | 3300048922 | Bacteria | 3440 |
| 1119 | Ga0496119_0108770 | 3300048922 | Bacteria | 1543 |
| 1120 | Ga0496120_0040615 | 3300048923 | Bacteria | 2732 |
| 1121 | Ga0496120_0052278 | 3300048923 | Bacteria | 2328 |
| 1122 | Ga0496120_0074274 | 3300048923 | Bacteria | 1858 |
| 1123 | Ga0496121_0000178 | 3300048924 | Bacteria | 141429 |
| 1124 | Ga0496121_0000381 | 3300048924 | Bacteria | 90593 |
| 1125 | Ga0496121_0000894 | 3300048924 | Bacteria | 53831 |
| 1126 | Ga0496121_0019860 | 3300048924 | Bacteria | 6691 |
| 1127 | Ga0496121_0035897 | 3300048924 | Bacteria | 4429 |
| 1128 | Ga0496121_0038473 | 3300048924 | Bacteria | 4235 |
| 1129 | Ga0496121_0100972 | 3300048924 | Bacteria | 2226 |
| 1130 | Ga0496121_0117262 | 3300048924 | Bacteria | 2017 |
| 1131 | Ga0496121_0393422 | 3300048924 | Bacteria | 910 |
| 1132 | Ga0496122_0000772 | 3300048925 | Bacteria | 61688 |
| 1133 | Ga0496122_0048671 | 3300048925 | Bacteria | 3255 |
| 1134 | Ga0496122_0064902 | 3300048925 | Bacteria | 2652 |
| 1135 | Ga0496122_0213233 | 3300048925 | Bacteria | 1116 |
| 1136 | Ga0496123_0000613 | 3300048926 | Bacteria | 59887 |
| 1137 | Ga0496124_0000599 | 3300048927 | Bacteria | 60657 |
| 1138 | Ga0496125_0000203 | 3300048928 | Bacteria | 125569 |
| 1139 | Ga0496125_0003472 | 3300048928 | Bacteria | 19083 |
| 1140 | Ga0496125_0009067 | 3300048928 | Bacteria | 10297 |
| 1141 | Ga0496125_0021155 | 3300048928 | Bacteria | 6078 |
| 1142 | Ga0496125_0060231 | 3300048928 | Bacteria | 3053 |
| 1143 | Ga0496125_0076632 | 3300048928 | Bacteria | 2581 |
| 1144 | Ga0496125_0080380 | 3300048928 | Bacteria | 2495 |
| 1145 | Ga0496125_0089567 | 3300048928 | Bacteria | 2314 |
| 1146 | Ga0496125_0111111 | 3300048928 | Bacteria | 1984 |
| 1147 | Ga0496126_0003737 | 3300048929 | Bacteria | 18962 |
| 1148 | Ga0496126_0030746 | 3300048929 | Bacteria | 5083 |
| 1149 | Ga0496126_0041962 | 3300048929 | Bacteria | 4230 |
| 1150 | Ga0496126_0048684 | 3300048929 | Bacteria | 3872 |
| 1151 | Ga0496126_0051129 | 3300048929 | Bacteria | 3763 |
| 1152 | Ga0496126_0051770 | 3300048929 | Bacteria | 3736 |
| 1153 | Ga0496126_0183448 | 3300048929 | Bacteria | 1776 |
| 1154 | Ga0496126_0191388 | 3300048929 | Bacteria | 1732 |
| 1155 | Ga0496126_0320870 | 3300048929 | Bacteria | 1273 |
| 1156 | Ga0496126_0359553 | 3300048929 | Bacteria | 1189 |
| 1157 | Ga0496126_0397270 | 3300048929 | Bacteria | 1119 |
| 1158 | Ga0501031_0000294 | 3300049568 | Bacteria | 28430 |
| 1159 | Ga0501031_0000497 | 3300049568 | Bacteria | 22970 |
| 1160 | Ga0501031_0006681 | 3300049568 | Bacteria | 7524 |
| 1161 | Ga0501031_0312876 | 3300049568 | Bacteria | 1017 |
| 1162 | Ga0501032_0000076 | 3300049569 | Bacteria | 83609 |
| 1163 | Ga0501032_0000269 | 3300049569 | Bacteria | 43721 |
| 1164 | Ga0501032_0011920 | 3300049569 | Bacteria | 6226 |
| 1165 | Ga0501032_0019279 | 3300049569 | Bacteria | 4772 |
| 1166 | Ga0501032_0030743 | 3300049569 | Bacteria | 3685 |
| 1167 | Ga0501032_0071308 | 3300049569 | Bacteria | 2315 |
| 1168 | Ga0501032_0074823 | 3300049569 | Bacteria | 2256 |
| 1169 | Ga0501032_0079297 | 3300049569 | Bacteria | 2186 |
| 1170 | Ga0501032_0079410 | 3300049569 | Bacteria | 2184 |
| 1171 | Ga0501032_0181351 | 3300049569 | Bacteria | 1378 |
| 1172 | Ga0501032_0295516 | 3300049569 | Bacteria | 1047 |
| 1173 | Ga0501033_0000093 | 3300049570 | Bacteria | 85243 |
| 1174 | Ga0501033_0000399 | 3300049570 | Bacteria | 41761 |
| 1175 | Ga0501033_0003630 | 3300049570 | Bacteria | 12586 |
| 1176 | Ga0501033_0017232 | 3300049570 | Bacteria | 5459 |
| 1177 | Ga0501033_0040575 | 3300049570 | Bacteria | 3474 |
| 1178 | Ga0501034_0000039 | 3300049571 | Bacteria | 237357 |
| 1179 | Ga0501034_0001247 | 3300049571 | Bacteria | 34598 |
| 1180 | Ga0501034_0005187 | 3300049571 | Bacteria | 14295 |
| 1181 | Ga0501034_0025868 | 3300049571 | Bacteria | 5977 |
| 1182 | Ga0501034_0156474 | 3300049571 | Bacteria | 2252 |
| 1183 | Ga0501034_0256405 | 3300049571 | Bacteria | 1693 |
| 1184 | Ga0501034_0767866 | 3300049571 | Bacteria | 858 |
| 1185 | Ga0501036_0000035 | 3300049572 | Bacteria | 88062 |
| 1186 | Ga0501036_0000817 | 3300049572 | Bacteria | 23119 |
| 1187 | Ga0501036_0006639 | 3300049572 | Bacteria | 9403 |
| 1188 | Ga0501036_0017189 | 3300049572 | Bacteria | 6046 |
| 1189 | Ga0501036_0044313 | 3300049572 | Bacteria | 3768 |
| 1190 | Ga0501036_0046764 | 3300049572 | Bacteria | 3664 |
| 1191 | Ga0501036_0060679 | 3300049572 | Bacteria | 3203 |
| 1192 | Ga0501036_0085973 | 3300049572 | Bacteria | 2658 |
| 1193 | Ga0501036_0616106 | 3300049572 | Bacteria | 900 |
| 1194 | Ga0501037_0000026 | 3300049573 | Bacteria | 142936 |
| 1195 | Ga0501037_0000279 | 3300049573 | Bacteria | 43594 |
| 1196 | Ga0501037_0001130 | 3300049573 | Bacteria | 19761 |
| 1197 | Ga0501037_0006086 | 3300049573 | Bacteria | 8818 |
| 1198 | Ga0501037_0027335 | 3300049573 | Bacteria | 4215 |
| 1199 | Ga0501037_0032508 | 3300049573 | Bacteria | 3852 |
| 1200 | Ga0501037_0129863 | 3300049573 | Bacteria | 1807 |
| 1201 | Ga0501037_0204702 | 3300049573 | Bacteria | 1393 |
| 1202 | Ga0501037_0227389 | 3300049573 | Bacteria | 1310 |
| 1203 | Ga0501037_0273383 | 3300049573 | Bacteria | 1178 |
| 1204 | Ga0501038_0000037 | 3300049574 | Bacteria | 124444 |
| 1205 | Ga0501038_0000069 | 3300049574 | Bacteria | 84666 |
| 1206 | Ga0501038_0000727 | 3300049574 | Bacteria | 29411 |
| 1207 | Ga0501038_0006733 | 3300049574 | Bacteria | 10616 |
| 1208 | Ga0501038_0020364 | 3300049574 | Bacteria | 5964 |
| 1209 | Ga0501038_0138174 | 3300049574 | Bacteria | 1995 |
| 1210 | Ga0501038_0160890 | 3300049574 | Bacteria | 1824 |
| 1211 | Ga0501038_0385146 | 3300049574 | Bacteria | 1087 |
| 1212 | Ga0501038_0392038 | 3300049574 | Bacteria | 1075 |
| 1213 | Ga0501039_0000146 | 3300049575 | Bacteria | 47895 |
| 1214 | Ga0501039_0000263 | 3300049575 | Bacteria | 38312 |
| 1215 | Ga0501039_0010044 | 3300049575 | Bacteria | 7218 |
| 1216 | Ga0501039_0026624 | 3300049575 | Bacteria | 4443 |
| 1217 | Ga0501039_0212020 | 3300049575 | Bacteria | 1523 |
| 1218 | Ga0501040_0008550 | 3300049576 | Bacteria | 6644 |
| 1219 | Ga0501040_0066461 | 3300049576 | Bacteria | 2484 |
| 1220 | Ga0501041_0095772 | 3300049577 | Bacteria | 1834 |
| 1221 | Ga0501041_0198082 | 3300049577 | Bacteria | 1259 |
| 1222 | Ga0501042_0039183 | 3300049578 | Bacteria | 3366 |
| 1223 | Ga0501042_0047957 | 3300049578 | Bacteria | 3045 |
| 1224 | Ga0501042_0233669 | 3300049578 | Bacteria | 1326 |
| 1225 | Ga0501043_0000115 | 3300049579 | Bacteria | 75659 |
| 1226 | Ga0501043_0000257 | 3300049579 | Bacteria | 48196 |
| 1227 | Ga0501043_0016842 | 3300049579 | Bacteria | 5728 |
| 1228 | Ga0501043_0022318 | 3300049579 | Bacteria | 4966 |
| 1229 | Ga0501043_0133135 | 3300049579 | Bacteria | 1948 |
| 1230 | Ga0501043_0220240 | 3300049579 | Bacteria | 1468 |
| 1231 | Ga0501046_0000210 | 3300049580 | Bacteria | 60801 |
| 1232 | Ga0501046_0001438 | 3300049580 | Bacteria | 22913 |
| 1233 | Ga0501046_0036917 | 3300049580 | Bacteria | 3929 |
| 1234 | Ga0501046_0050155 | 3300049580 | Bacteria | 3298 |
| 1235 | Ga0501046_0422356 | 3300049580 | Bacteria | 961 |
| 1236 | Ga0501047_0000094 | 3300049581 | Bacteria | 109928 |
| 1237 | Ga0501047_0000186 | 3300049581 | Bacteria | 75102 |
| 1238 | Ga0501047_0000892 | 3300049581 | Bacteria | 30468 |
| 1239 | Ga0501047_0010143 | 3300049581 | Bacteria | 8909 |
| 1240 | Ga0501047_0014304 | 3300049581 | Bacteria | 7547 |
| 1241 | Ga0501047_0032596 | 3300049581 | Bacteria | 5030 |
| 1242 | Ga0501047_0043616 | 3300049581 | Bacteria | 4332 |
| 1243 | Ga0501047_0137786 | 3300049581 | Bacteria | 2320 |
| 1244 | Ga0501047_0286409 | 3300049581 | Bacteria | 1491 |
| 1245 | Ga0501047_0357158 | 3300049581 | Bacteria | 1297 |
| 1246 | Ga0501048_0000306 | 3300049582 | Bacteria | 33320 |
| 1247 | Ga0501048_0000856 | 3300049582 | Bacteria | 22438 |
| 1248 | Ga0501048_0002557 | 3300049582 | Bacteria | 13928 |
| 1249 | Ga0501048_0009695 | 3300049582 | Bacteria | 7226 |
| 1250 | Ga0501048_0132263 | 3300049582 | Bacteria | 1763 |
| 1251 | Ga0501067_0000220 | 3300049583 | Bacteria | 31959 |
| 1252 | Ga0501067_0010936 | 3300049583 | Bacteria | 5024 |
| 1253 | Ga0501067_0013507 | 3300049583 | Bacteria | 4524 |
| 1254 | Ga0501067_0073388 | 3300049583 | Bacteria | 1896 |
| 1255 | Ga0501068_0003939 | 3300049584 | Bacteria | 8077 |
| 1256 | Ga0501068_0004373 | 3300049584 | Bacteria | 7688 |
| 1257 | Ga0501068_0019306 | 3300049584 | Bacteria | 3956 |
| 1258 | Ga0501068_0020312 | 3300049584 | Bacteria | 3867 |
| 1259 | Ga0501068_0043380 | 3300049584 | Bacteria | 2705 |
| 1260 | Ga0501068_0089412 | 3300049584 | Bacteria | 1898 |
| 1261 | Ga0501068_0169307 | 3300049584 | Bacteria | 1378 |
| 1262 | Ga0501069_0004135 | 3300049585 | Bacteria | 7495 |
| 1263 | Ga0501069_0006557 | 3300049585 | Bacteria | 6086 |
| 1264 | Ga0501069_0009362 | 3300049585 | Bacteria | 5171 |
| 1265 | Ga0501069_0021290 | 3300049585 | Bacteria | 3518 |
| 1266 | Ga0501069_0060565 | 3300049585 | Bacteria | 2113 |
| 1267 | Ga0501069_0068487 | 3300049585 | Bacteria | 1986 |
| 1268 | Ga0501069_0072286 | 3300049585 | Bacteria | 1934 |
| 1269 | Ga0501070_0000134 | 3300049586 | Bacteria | 66993 |
| 1270 | Ga0501070_0013023 | 3300049586 | Bacteria | 7009 |
| 1271 | Ga0501070_0013228 | 3300049586 | Bacteria | 6956 |
| 1272 | Ga0501070_0024108 | 3300049586 | Bacteria | 5102 |
| 1273 | Ga0501070_0040276 | 3300049586 | Bacteria | 3896 |
| 1274 | Ga0501070_0047476 | 3300049586 | Bacteria | 3568 |
| 1275 | Ga0501070_0051850 | 3300049586 | Bacteria | 3404 |
| 1276 | Ga0501070_0081847 | 3300049586 | Bacteria | 2671 |
| 1277 | Ga0501070_0090225 | 3300049586 | Bacteria | 2536 |
| 1278 | Ga0501070_0210137 | 3300049586 | Bacteria | 1597 |
| 1279 | Ga0501070_0543874 | 3300049586 | Bacteria | 930 |
| 1280 | Ga0501071_0016014 | 3300049587 | Bacteria | 5151 |
| 1281 | Ga0501071_0216956 | 3300049587 | Bacteria | 1439 |
| 1282 | Ga0501071_0442318 | 3300049587 | Bacteria | 995 |
| 1283 | Ga0501072_0001542 | 3300049588 | Bacteria | 17220 |
| 1284 | Ga0501072_0018872 | 3300049588 | Bacteria | 5320 |
| 1285 | Ga0501072_0055128 | 3300049588 | Bacteria | 3133 |
| 1286 | Ga0501073_0000131 | 3300049589 | Bacteria | 48153 |
| 1287 | Ga0501073_0005409 | 3300049589 | Bacteria | 9564 |
| 1288 | Ga0501073_0010210 | 3300049589 | Bacteria | 6897 |
| 1289 | Ga0501073_0015631 | 3300049589 | Bacteria | 5506 |
| 1290 | Ga0501073_0023953 | 3300049589 | Bacteria | 4383 |
| 1291 | Ga0501073_0024458 | 3300049589 | Bacteria | 4337 |
| 1292 | Ga0501074_0000514 | 3300049590 | Bacteria | 23769 |
| 1293 | Ga0501074_0006996 | 3300049590 | Bacteria | 8148 |
| 1294 | Ga0501074_0013074 | 3300049590 | Bacteria | 6034 |
| 1295 | Ga0501074_0016442 | 3300049590 | Bacteria | 5372 |
| 1296 | Ga0501074_0033237 | 3300049590 | Bacteria | 3737 |
| 1297 | Ga0501074_0148952 | 3300049590 | Bacteria | 1673 |
| 1298 | Ga0501075_0341702 | 3300049591 | Bacteria | 1141 |
| 1299 | Ga0501075_0400381 | 3300049591 | Bacteria | 1046 |
| 1300 | Ga0501076_0010682 | 3300049592 | Bacteria | 6822 |
| 1301 | Ga0501076_0098869 | 3300049592 | Bacteria | 2351 |
| 1302 | Ga0501076_0129214 | 3300049592 | Bacteria | 2049 |
| 1303 | Ga0501079_0003357 | 3300049741 | Bacteria | 11739 |
| 1304 | Ga0501079_0003839 | 3300049741 | Bacteria | 11093 |
| 1305 | Ga0501079_0051618 | 3300049741 | Bacteria | 3175 |
| 1306 | Ga0501079_0066832 | 3300049741 | Bacteria | 2774 |
| 1307 | Ga0501079_0097009 | 3300049741 | Bacteria | 2285 |
| 1308 | Ga0501079_0298526 | 3300049741 | Bacteria | 1260 |
| 1309 | Ga0501080_0000299 | 3300049742 | Bacteria | 37707 |
| 1310 | Ga0501080_0000387 | 3300049742 | Bacteria | 33900 |
| 1311 | Ga0501080_0001809 | 3300049742 | Bacteria | 18336 |
| 1312 | Ga0501080_0023167 | 3300049742 | Bacteria | 5757 |
| 1313 | Ga0501080_0102012 | 3300049742 | Bacteria | 2662 |
| 1314 | Ga0501080_0162316 | 3300049742 | Bacteria | 2063 |
| 1315 | Ga0501080_0163965 | 3300049742 | Bacteria | 2051 |
| 1316 | Ga0501080_0196287 | 3300049742 | Bacteria | 1854 |
| 1317 | Ga0501080_0292258 | 3300049742 | Bacteria | 1479 |
| 1318 | Ga0501080_0329267 | 3300049742 | Bacteria | 1381 |
| 1319 | Ga0501080_0372142 | 3300049742 | Bacteria | 1288 |
| 1320 | Ga0501081_0001664 | 3300049743 | Bacteria | 13747 |
| 1321 | Ga0501081_0155934 | 3300049743 | Bacteria | 1643 |
| 1322 | Ga0501083_0000213 | 3300049744 | Bacteria | 37485 |
| 1323 | Ga0501083_0000302 | 3300049744 | Bacteria | 31114 |
| 1324 | Ga0501083_0013866 | 3300049744 | Bacteria | 5635 |
| 1325 | Ga0501083_0211437 | 3300049744 | Bacteria | 1264 |
| 1326 | Ga0501083_0274611 | 3300049744 | Bacteria | 1096 |
| 1327 | Ga0501241_005327 | 3300049758 | Bacteria | 2402 |
| 1328 | Ga0501035_0000523 | 3300049822 | Bacteria | 43259 |
| 1329 | Ga0501035_0000533 | 3300049822 | Bacteria | 42510 |
| 1330 | Ga0501035_0009857 | 3300049822 | Bacteria | 8871 |
| 1331 | Ga0501035_0015394 | 3300049822 | Bacteria | 7056 |
| 1332 | Ga0501035_0021633 | 3300049822 | Bacteria | 5914 |
| 1333 | Ga0501035_0052530 | 3300049822 | Bacteria | 3646 |
| 1334 | Ga0501035_0054995 | 3300049822 | Bacteria | 3554 |
| 1335 | Ga0501035_0071552 | 3300049822 | Bacteria | 3070 |
| 1336 | Ga0501035_0107675 | 3300049822 | Bacteria | 2444 |
| 1337 | Ga0501035_0157956 | 3300049822 | Bacteria | 1964 |
| 1338 | Ga0501035_0188241 | 3300049822 | Bacteria | 1775 |
| 1339 | Ga0501035_0229760 | 3300049822 | Bacteria | 1581 |
| 1340 | Ga0501044_0000435 | 3300049823 | Bacteria | 51516 |
| 1341 | Ga0501044_0003448 | 3300049823 | Bacteria | 17811 |
| 1342 | Ga0501044_0009354 | 3300049823 | Bacteria | 10685 |
| 1343 | Ga0501044_0027340 | 3300049823 | Bacteria | 6029 |
| 1344 | Ga0501044_0092087 | 3300049823 | Bacteria | 3057 |
| 1345 | Ga0501044_0098202 | 3300049823 | Bacteria | 2948 |
| 1346 | Ga0501044_0192816 | 3300049823 | Bacteria | 1999 |
| 1347 | Ga0501044_0331463 | 3300049823 | Bacteria | 1444 |
| 1348 | Ga0501044_0409435 | 3300049823 | Bacteria | 1267 |
| 1349 | Ga0501045_0022522 | 3300049824 | Bacteria | 4512 |
| 1350 | Ga0501045_0105366 | 3300049824 | Bacteria | 2089 |
| 1351 | nmdc:mga03683_102651_c1 | 3300050489 | Bacteria | 1258 |
| 1352 | nmdc:mga03683_1027_c1 | 3300050489 | Bacteria | 5061 |
| 1353 | nmdc:mga03n38_221414_c1 | 3300050490 | Bacteria | 988 |
| 1354 | nmdc:mga00v17_39463_c1 | 3300050491 | Bacteria | 2828 |
| 1355 | nmdc:mga0yw44_17750_c1 | 3300050492 | Bacteria | 3881 |
| 1356 | nmdc:mga0yw44_53571_c1 | 3300050492 | Bacteria | 2451 |
| 1357 | nmdc:mga0k408_275726_c1 | 3300050493 | Bacteria | 1004 |
| 1358 | nmdc:mga0k408_92347_c1 | 3300050493 | Bacteria | 1779 |
| 1359 | nmdc:mga06z11_23054_c1 | 3300050494 | Bacteria | 2918 |
| 1360 | nmdc:mga06z11_76330_c1 | 3300050494 | Bacteria | 1787 |
| 1361 | nmdc:mga07m45_193093_c1 | 3300050496 | Bacteria | 1184 |
| 1362 | nmdc:mga07m45_41448_c1 | 3300050496 | Bacteria | 2578 |
| 1363 | nmdc:mga07m45_47017_c1 | 3300050496 | Bacteria | 2425 |
| 1364 | nmdc:mga07m45_81159_c1 | 3300050496 | Bacteria | 1852 |
| 1365 | nmdc:mga05p37_147491_c1 | 3300050507 | Bacteria | 2879 |
| 1366 | nmdc:mga09592_33785_c1 | 3300050508 | Bacteria | 4272 |
| 1367 | nmdc:mga0qj67_379021_c1 | 3300050509 | Bacteria | 1142 |
| 1368 | nmdc:mga06r32_14990_c1 | 3300050510 | Bacteria | 7035 |
| 1369 | nmdc:mga08y16_102788_c1 | 3300050511 | Bacteria | 2975 |
| 1370 | nmdc:mga08y16_1281_c1 | 3300050511 | Bacteria | 24959 |
| 1371 | nmdc:mga08y16_3917_c1 | 3300050511 | Bacteria | 15500 |
| 1372 | nmdc:mga08y16_52748_c1 | 3300050511 | Bacteria | 4254 |
| 1373 | nmdc:mga08y16_88203_c1 | 3300050511 | Bacteria | 3233 |
| 1374 | nmdc:mga0n895_1946_c1 | 3300050512 | Bacteria | 15855 |
| 1375 | nmdc:mga0n895_466290_c1 | 3300050512 | Bacteria | 1274 |
| 1376 | nmdc:mga0n895_96815_c1 | 3300050512 | Bacteria | 2956 |
| 1377 | nmdc:mga0rr50_392375_c1 | 3300050513 | Bacteria | 1172 |
| 1378 | nmdc:mga0a205_145113_c1 | 3300050515 | Bacteria | 2273 |
| 1379 | nmdc:mga0a205_35242_c1 | 3300050515 | Bacteria | 4805 |
| 1380 | nmdc:mga0sz30_1683_c1 | 3300050516 | Bacteria | 7854 |
| 1381 | nmdc:mga0sz30_2375_c1 | 3300050516 | Bacteria | 6399 |
| 1382 | nmdc:mga0sz30_56454_c1 | 3300050516 | Bacteria | 1672 |
| 1383 | Ga0495601_0041381 | 3300053077 | Bacteria | 2888 |
| 1384 | Ga0495601_0316854 | 3300053077 | Bacteria | 1015 |
| 1385 | Ga0495612_0087829 | 3300053078 | Bacteria | 1313 |
| 1386 | Ga0500635_0002566 | 3300053080 | Bacteria | 4515 |
| 1387 | Ga0495595_0013058 | 3300053084 | Bacteria | 3504 |
| 1388 | Ga0495595_0020049 | 3300053084 | Bacteria | 2907 |
| 1389 | Ga0495595_0133880 | 3300053084 | Bacteria | 1213 |
| 1390 | Ga0495619_0065962 | 3300053085 | Bacteria | 2416 |
| 1391 | Ga0495619_0160747 | 3300053085 | Bacteria | 1551 |
| 1392 | Ga0500578_0090848 | 3300053086 | Bacteria | 1938 |
| 1393 | Ga0500644_0041888 | 3300053088 | Bacteria | 1524 |
| 1394 | Ga0500644_0126294 | 3300053088 | Bacteria | 1002 |
| 1395 | Ga0500644_0136268 | 3300053088 | Bacteria | 971 |
| 1396 | Ga0500646_0007100 | 3300053090 | Bacteria | 2857 |
| 1397 | Ga0500583_0001971 | 3300053092 | Bacteria | 6034 |
| 1398 | Ga0500583_0044064 | 3300053092 | Bacteria | 2041 |
| 1399 | Ga0500651_0000168 | 3300053093 | Bacteria | 42658 |
| 1400 | Ga0500651_0025258 | 3300053093 | Bacteria | 3727 |
| 1401 | Ga0500566_0010562 | 3300053094 | Bacteria | 5443 |
| 1402 | Ga0500566_0216356 | 3300053094 | Bacteria | 956 |
| 1403 | Ga0500648_136589 | 3300053097 | Bacteria | 1323 |
| 1404 | Ga0500650_0020176 | 3300053098 | Bacteria | 2920 |
| 1405 | Ga0500650_0113889 | 3300053098 | Bacteria | 1262 |
| 1406 | Ga0500554_002814 | 3300053102 | Bacteria | 3475 |
| 1407 | Ga0500555_016159 | 3300053103 | Bacteria | 2152 |
| 1408 | Ga0500556_0000202 | 3300053104 | Bacteria | 48694 |
| 1409 | Ga0500562_072212 | 3300053108 | Bacteria | 931 |
| 1410 | Ga0500569_000323 | 3300053109 | Bacteria | 7662 |
| 1411 | Ga0500572_001030 | 3300053111 | Bacteria | 8351 |
| 1412 | Ga0500592_000443 | 3300053116 | Bacteria | 6927 |
| 1413 | Ga0500592_009763 | 3300053116 | Bacteria | 1527 |
| 1414 | Ga0500595_002264 | 3300053119 | Bacteria | 9721 |
| 1415 | Ga0500595_003563 | 3300053119 | Bacteria | 7231 |
| 1416 | Ga0500595_009619 | 3300053119 | Bacteria | 3894 |
| 1417 | Ga0500595_041410 | 3300053119 | Bacteria | 1480 |
| 1418 | Ga0500607_017859 | 3300053121 | Bacteria | 4038 |
| 1419 | Ga0500628_050004 | 3300053129 | Bacteria | 989 |
| 1420 | Ga0500642_0000005 | 3300053130 | Bacteria | 422725 |
| 1421 | Ga0500642_0036658 | 3300053130 | Bacteria | 2091 |
| 1422 | Ga0500652_000717 | 3300053131 | Bacteria | 11264 |
| 1423 | Ga0500652_003296 | 3300053131 | Bacteria | 4890 |
| 1424 | Ga0500559_0000586 | 3300053136 | Bacteria | 24993 |
| 1425 | Ga0500559_0007354 | 3300053136 | Bacteria | 4883 |
| 1426 | Ga0500564_057478 | 3300053138 | Bacteria | 1770 |
| 1427 | Ga0500568_0008225 | 3300053139 | Bacteria | 5049 |
| 1428 | Ga0500568_0008455 | 3300053139 | Bacteria | 4954 |
| 1429 | Ga0500568_0013761 | 3300053139 | Bacteria | 3677 |
| 1430 | Ga0500568_0041141 | 3300053139 | Bacteria | 1858 |
| 1431 | Ga0500577_0021304 | 3300053142 | Bacteria | 2134 |
| 1432 | Ga0500577_0021539 | 3300053142 | Bacteria | 2125 |
| 1433 | Ga0500577_0076548 | 3300053142 | Bacteria | 1325 |
| 1434 | Ga0500586_001465 | 3300053145 | Bacteria | 4981 |
| 1435 | Ga0500588_0049382 | 3300053146 | Bacteria | 1305 |
| 1436 | Ga0500589_013888 | 3300053147 | Bacteria | 3559 |
| 1437 | Ga0500604_0008586 | 3300053151 | Bacteria | 2710 |
| 1438 | Ga0500616_0000166 | 3300053153 | Bacteria | 110141 |
| 1439 | Ga0500616_0000180 | 3300053153 | Bacteria | 106053 |
| 1440 | Ga0500616_0002218 | 3300053153 | Bacteria | 16615 |
| 1441 | Ga0500616_0011766 | 3300053153 | Bacteria | 5149 |
| 1442 | Ga0500622_0007484 | 3300053156 | Bacteria | 6198 |
| 1443 | Ga0500622_0019560 | 3300053156 | Bacteria | 3596 |
| 1444 | Ga0500622_0019647 | 3300053156 | Bacteria | 3587 |
| 1445 | Ga0500622_0157550 | 3300053156 | Bacteria | 1068 |
| 1446 | Ga0500634_0042288 | 3300053161 | Bacteria | 2472 |
| 1447 | Ga0500636_0011317 | 3300053177 | Bacteria | 5222 |
| 1448 | Ga0500636_0026335 | 3300053177 | Bacteria | 3437 |
| 1449 | Ga0500637_0020687 | 3300053178 | Bacteria | 3567 |
| 1450 | Ga0500645_007785 | 3300053730 | Bacteria | 3705 |
| 1451 | Ga0500609_000821 | 3300053731 | Bacteria | 4665 |
| 1452 | Ga0500609_007867 | 3300053731 | Bacteria | 1438 |
| 1453 | Ga0501084_0024291 | 3300054114 | Bacteria | 5054 |
| 1454 | Ga0501084_0031221 | 3300054114 | Bacteria | 4455 |
| 1455 | Ga0501084_0182075 | 3300054114 | Bacteria | 1774 |
| 1456 | Ga0501084_0188857 | 3300054114 | Bacteria | 1738 |
| 1457 | Ga0501084_0222591 | 3300054114 | Bacteria | 1592 |
| 1458 | Ga0501082_0006782 | 3300060353 | Bacteria | 9897 |
| 1459 | Ga0501082_0010662 | 3300060353 | Bacteria | 7910 |
| 1460 | Ga0501082_0035245 | 3300060353 | Bacteria | 4313 |
| 1461 | Ga0501082_0477549 | 3300060353 | Bacteria | 1089 |
| 1462 | Ga0466962_0001283 | 3300061719 | Bacteria | 11595 |
| 1463 | Ga0530510_0070878 | 3300061734 | Bacteria | 2529 |
| 1464 | Ga0530510_0517636 | 3300061734 | Bacteria | 905 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025907 | Ga0207645_10288376 | Ga0207645_102883762 | 249 |
| 2 | 3300005339 | Ga0070660_100396392 | Ga0070660_1003963921 | 251 |
| 3 | 3300037418 | Ga0395900_0367860 | Ga0395900_0367860_347_1150 | 251 |
| 4 | 3300038443 | Ga0395901_0227851 | Ga0395901_0227851_190_993 | 251 |
| 5 | 3300014326 | Ga0157380_10002658 | Ga0157380_100026584 | 252 |
| 6 | 3300013308 | Ga0157375_10000001 | Ga0157375_1000000167 | 253 |
| 7 | 3300037471 | Ga0395905_0100628 | Ga0395905_0100628_1940_2701 | 253 |
| 8 | 3300005330 | Ga0070690_100206861 | Ga0070690_1002068612 | 257 |
| 9 | 3300005334 | Ga0068869_100038274 | Ga0068869_1000382741 | 257 |
| 10 | 3300005364 | Ga0070673_100097811 | Ga0070673_1000978112 | 257 |
| 11 | 3300005367 | Ga0070667_100203201 | Ga0070667_1002032012 | 257 |
| 12 | 3300005548 | Ga0070665_100142500 | Ga0070665_1001425002 | 257 |
| 13 | 3300005618 | Ga0068864_100163314 | Ga0068864_1001633142 | 257 |
| 14 | 3300005840 | Ga0068870_10058104 | Ga0068870_100581041 | 257 |
| 15 | 3300005841 | Ga0068863_100057565 | Ga0068863_1000575652 | 257 |
| 16 | 3300006237 | Ga0097621_100029889 | Ga0097621_1000298892 | 257 |
| 17 | 3300006358 | Ga0068871_100001292 | Ga0068871_1000012929 | 257 |
| 18 | 3300006844 | Ga0075428_100002030 | Ga0075428_1000020308 | 257 |
| 19 | 3300006847 | Ga0075431_100014541 | Ga0075431_1000145416 | 257 |
| 20 | 3300006880 | Ga0075429_100002394 | Ga0075429_1000023944 | 257 |
| 21 | 3300025250 | Ga0209026_1007300 | Ga0209026_10073002 | 257 |
| 22 | 3300025926 | Ga0207659_10137642 | Ga0207659_101376422 | 257 |
| 23 | 3300025937 | Ga0207669_10229945 | Ga0207669_102299452 | 257 |
| 24 | 3300025941 | Ga0207711_10301715 | Ga0207711_103017152 | 257 |
| 25 | 3300025942 | Ga0207689_10022903 | Ga0207689_100229035 | 257 |
| 26 | 3300025960 | Ga0207651_10071638 | Ga0207651_100716382 | 257 |
| 27 | 3300026088 | Ga0207641_10093622 | Ga0207641_100936222 | 257 |
| 28 | 3300026089 | Ga0207648_10129348 | Ga0207648_101293483 | 257 |
| 29 | 3300026118 | Ga0207675_100098698 | Ga0207675_1000986983 | 257 |
| 30 | 3300027907 | Ga0207428_10060402 | Ga0207428_100604022 | 257 |
| 31 | 3300032004 | Ga0307414_10000028 | Ga0307414_1000002897 | 257 |
| 32 | 3300032004 | Ga0307414_10048793 | Ga0307414_100487932 | 257 |
| 33 | 3300035691 | Ga0373931_0186725 | Ga0373931_0186725_17_790 | 257 |
| 34 | 3300036647 | Ga0316582_0026741 | Ga0316582_0026741_687_1460 | 257 |
| 35 | 3300036712 | Ga0316584_0011555 | Ga0316584_0011555_4353_5126 | 257 |
| 36 | 3300044712 | Ga0453684_0211122 | Ga0453684_0211122_208_981 | 257 |
| 37 | 3300044712 | Ga0453684_0230091 | Ga0453684_0230091_1101_1874 | 257 |
| 38 | 3300045051 | Ga0451576_0766263 | Ga0451576_0766263_164_937 | 257 |
| 39 | 3300046514 | Ga0495618_0380725 | Ga0495618_0380725_19_792 | 257 |
| 40 | 3300046536 | Ga0495587_0236491 | Ga0495587_0236491_21_794 | 257 |
| 41 | 3300049569 | Ga0501032_0295516 | Ga0501032_0295516_11_784 | 257 |
| 42 | 3300046690 | Ga0495624_0156857 | Ga0495624_0156857_598_1374 | 258 |
| 43 | 3300053129 | Ga0500628_050004 | Ga0500628_050004_96_890 | 258 |
| 44 | iso_pu_bacteria | 2512047086 | 2512533564 | 260 |
| 45 | iso_pu_bacteria | 2513237087 | 2513589931 | 260 |
| 46 | iso_pu_bacteria | 2513237092 | 2513623404 | 260 |
| 47 | iso_pu_bacteria | 2513237094 | 2513637568 | 260 |
| 48 | iso_pu_bacteria | 2513237101 | 2513697363 | 260 |
| 49 | iso_pu_bacteria | 2513237102 | 2513700028 | 260 |
| 50 | iso_pu_bacteria | 2513237104 | 2513719227 | 260 |
| 51 | iso_pu_bacteria | 2517093001 | 2517100501 | 260 |
| 52 | iso_pu_bacteria | 2524023205 | 2524437361 | 260 |
| 53 | iso_pu_bacteria | 2528768022 | 2528849920 | 260 |
| 54 | iso_pu_bacteria | 2602042107 | 2603862656 | 260 |
| 55 | iso_pu_bacteria | 2617270741 | 2617377913 | 260 |
| 56 | iso_pu_bacteria | 2643221547 | 2643755222 | 260 |
| 57 | iso_pu_bacteria | 2643221604 | 2644035917 | 260 |
| 58 | iso_pu_bacteria | 2643221629 | 2644166267 | 260 |
| 59 | iso_pu_bacteria | 2643221651 | 2644287386 | 260 |
| 60 | iso_pu_bacteria | 2643221662 | 2644346727 | 260 |
| 61 | iso_pu_bacteria | 2643221733 | 2644732192 | 260 |
| 62 | iso_pu_bacteria | 2643221734 | 2644735008 | 260 |
| 63 | iso_pu_bacteria | 2721755755 | 2723843141 | 260 |
| 64 | iso_pu_bacteria | 2738541281 | 2738743884 | 260 |
| 65 | iso_pu_bacteria | 2738541284 | 2738763035 | 260 |
| 66 | iso_pu_bacteria | 2738543031 | 2739349020 | 260 |
| 67 | iso_pu_bacteria | 2738543032 | 2739353114 | 260 |
| 68 | iso_pu_bacteria | 2775506987 | 2776614667 | 260 |
| 69 | iso_pu_bacteria | 2791355199 | 2793079456 | 260 |
| 70 | iso_pu_bacteria | 2824600985 | 2824606153 | 260 |
| 71 | iso_pu_bacteria | 2824609381 | 2824616019 | 260 |
| 72 | iso_pu_bacteria | 2824617872 | 2824618942 | 260 |
| 73 | iso_pu_bacteria | 2824626560 | 2824627538 | 260 |
| 74 | iso_pu_bacteria | 2824635225 | 2824638863 | 260 |
| 75 | iso_pu_bacteria | 2824644064 | 2824647665 | 260 |
| 76 | iso_pu_bacteria | 2824653114 | 2824657318 | 260 |
| 77 | iso_pu_bacteria | 2824661429 | 2824668204 | 260 |
| 78 | iso_pu_bacteria | 2824704595 | 2824706532 | 260 |
| 79 | iso_pu_bacteria | 2824714736 | 2824716446 | 260 |
| 80 | iso_pu_bacteria | 2824723954 | 2824726392 | 260 |
| 81 | iso_pu_bacteria | 2824732956 | 2824736293 | 260 |
| 82 | iso_pu_bacteria | 2824746037 | 2824751935 | 260 |
| 83 | iso_pu_bacteria | 2824753945 | 2824756920 | 260 |
| 84 | iso_pu_bacteria | 2824763712 | 2824769716 | 260 |
| 85 | iso_pu_bacteria | 2839989709 | 2839991445 | 260 |
| 86 | iso_pu_bacteria | 2841911363 | 2841912928 | 260 |
| 87 | iso_pu_bacteria | 2841917233 | 2841918675 | 260 |
| 88 | iso_pu_bacteria | 2841957949 | 2841960303 | 260 |
| 89 | iso_pu_bacteria | 2842038055 | 2842042789 | 260 |
| 90 | iso_pu_bacteria | 2842045827 | 2842050831 | 260 |
| 91 | iso_pu_bacteria | 2852649853 | 2852653018 | 260 |
| 92 | iso_pu_bacteria | 2857524615 | 2857530006 | 260 |
| 93 | iso_pu_bacteria | 2861691609 | 2861693167 | 260 |
| 94 | iso_pu_bacteria | 2874604998 | 2874612530 | 260 |
| 95 | iso_pu_bacteria | 2874612657 | 2874615728 | 260 |
| 96 | iso_pu_bacteria | 2874620515 | 2874623516 | 260 |
| 97 | iso_pu_bacteria | 2874628541 | 2874630553 | 260 |
| 98 | iso_pu_bacteria | 2876808645 | 2876815418 | 260 |
| 99 | iso_pu_bacteria | 2879099564 | 2879102008 | 260 |
| 100 | iso_pu_bacteria | 2879110137 | 2879117972 | 260 |
| 101 | iso_pu_bacteria | 2881364244 | 2881370599 | 260 |
| 102 | iso_pu_bacteria | 2881665667 | 2881667362 | 260 |
| 103 | iso_pu_bacteria | 2881955468 | 2881956518 | 260 |
| 104 | iso_pu_bacteria | 2888419890 | 2888422023 | 260 |
| 105 | iso_pu_bacteria | 2889033259 | 2889033558 | 260 |
| 106 | iso_pu_bacteria | 2893066018 | 2893071071 | 260 |
| 107 | iso_pu_bacteria | 2903768456 | 2903773562 | 260 |
| 108 | iso_pu_bacteria | 2904666416 | 2904667680 | 260 |
| 109 | iso_pu_bacteria | 2904711408 | 2904719116 | 260 |
| 110 | iso_pu_bacteria | 2906643746 | 2906648273 | 260 |
| 111 | iso_pu_bacteria | 2908775508 | 2908782037 | 260 |
| 112 | iso_pu_bacteria | 2919450847 | 2919452419 | 260 |
| 113 | iso_pu_bacteria | 2922361189 | 2922366934 | 260 |
| 114 | iso_pu_bacteria | 2922368715 | 2922371297 | 260 |
| 115 | iso_pu_bacteria | 2922386360 | 2922390289 | 260 |
| 116 | iso_pu_bacteria | 2925326138 | 2925331094 | 260 |
| 117 | iso_pu_bacteria | 2929615660 | 2929619674 | 260 |
| 118 | iso_pu_bacteria | 2929624759 | 2929627855 | 260 |
| 119 | iso_pu_bacteria | 2929921140 | 2929923571 | 260 |
| 120 | iso_pu_bacteria | 2932784394 | 2932786006 | 260 |
| 121 | iso_pu_bacteria | 2932809354 | 2932817045 | 260 |
| 122 | iso_pu_bacteria | 2932818245 | 2932822464 | 260 |
| 123 | iso_pu_bacteria | 2932828146 | 2932831050 | 260 |
| 124 | iso_pu_bacteria | 2933577622 | 2933581593 | 260 |
| 125 | iso_pu_bacteria | 2935616580 | 2935624162 | 260 |
| 126 | iso_pu_bacteria | 2935638405 | 2935640192 | 260 |
| 127 | iso_pu_bacteria | 2935648319 | 2935654986 | 260 |
| 128 | iso_pu_bacteria | 2935656913 | 2935663866 | 260 |
| 129 | iso_pu_bacteria | 2935665750 | 2935666970 | 260 |
| 130 | iso_pu_bacteria | 2935675223 | 2935680390 | 260 |
| 131 | iso_pu_bacteria | 2935684952 | 2935690101 | 260 |
| 132 | iso_pu_bacteria | 2935694250 | 2935699817 | 260 |
| 133 | iso_pu_bacteria | 2935703347 | 2935704725 | 260 |
| 134 | iso_pu_bacteria | 2935713505 | 2935722187 | 260 |
| 135 | iso_pu_bacteria | 2935722832 | 2935731496 | 260 |
| 136 | iso_pu_bacteria | 2935732158 | 2935735416 | 260 |
| 137 | iso_pu_bacteria | 2935741537 | 2935745313 | 260 |
| 138 | iso_pu_bacteria | 2935750917 | 2935755112 | 260 |
| 139 | iso_pu_bacteria | 2935760218 | 2935762373 | 260 |
| 140 | iso_pu_bacteria | 2935801545 | 2935803872 | 260 |
| 141 | iso_pu_bacteria | 2935810662 | 2935811790 | 260 |
| 142 | iso_pu_bacteria | 2935827899 | 2935829675 | 260 |
| 143 | iso_pu_bacteria | 2935837841 | 2935842993 | 260 |
| 144 | iso_pu_bacteria | 2935855204 | 2935862338 | 260 |
| 145 | iso_pu_bacteria | 2935864058 | 2935870473 | 260 |
| 146 | iso_pu_bacteria | 2935873716 | 2935881055 | 260 |
| 147 | iso_pu_bacteria | 2935992306 | 2935993552 | 260 |
| 148 | iso_pu_bacteria | 2936002035 | 2936004448 | 260 |
| 149 | iso_pu_bacteria | 2936011229 | 2936018065 | 260 |
| 150 | iso_pu_bacteria | 2936019824 | 2936026525 | 260 |
| 151 | iso_pu_bacteria | 2936028420 | 2936035268 | 260 |
| 152 | iso_pu_bacteria | 2936037263 | 2936038373 | 260 |
| 153 | iso_pu_bacteria | 2936046547 | 2936053460 | 260 |
| 154 | iso_pu_bacteria | 2939573065 | 2939576224 | 260 |
| 155 | iso_pu_bacteria | 2940556831 | 2940561608 | 260 |
| 156 | iso_pu_bacteria | 2941538514 | 2941544217 | 260 |
| 157 | iso_pu_bacteria | 2987605356 | 2987608048 | 260 |
| 158 | iso_pu_bacteria | 8003151029 | 8003154437 | 260 |
| 159 | iso_pu_bacteria | 8005563573 | 8005567928 | 260 |
| 160 | iso_pu_bacteria | 8006926726 | 8006933173 | 260 |
| 161 | iso_pu_bacteria | 8006964411 | 8006971342 | 260 |
| 162 | iso_pu_bacteria | 8006984368 | 8006989294 | 260 |
| 163 | iso_pu_bacteria | 8006994254 | 8006997770 | 260 |
| 164 | iso_pu_bacteria | 8016511872 | 8016516330 | 260 |
| 165 | iso_pu_bacteria | 8017057580 | 8017060203 | 260 |
| 166 | iso_pu_bacteria | 8019576017 | 8019579721 | 260 |
| 167 | iso_pu_bacteria | 8019586578 | 8019587433 | 260 |
| 168 | iso_pu_bacteria | 8019597564 | 8019603911 | 260 |
| 169 | iso_pu_bacteria | 8019608314 | 8019614629 | 260 |
| 170 | iso_pu_bacteria | 8024479707 | 8024482929 | 260 |
| 171 | iso_pu_bacteria | 8055742211 | 8055749070 | 260 |
| 172 | iso_pu_bacteria | 8056673599 | 8056674809 | 260 |
| 173 | iso_pu_bacteria | 8056681323 | 8056682435 | 260 |
| 174 | iso_pu_bacteria | 8057304971 | 8057305043 | 260 |
| 175 | 3300014745 | Ga0157377_10429198 | Ga0157377_104291981 | 262 |
| 176 | 3300005535 | Ga0070684_100094496 | Ga0070684_1000944962 | 263 |
| 177 | 3300009098 | Ga0105245_10287109 | Ga0105245_102871092 | 263 |
| 178 | 3300013308 | Ga0157375_10047205 | Ga0157375_100472053 | 263 |
| 179 | 3300014325 | Ga0163163_10254406 | Ga0163163_102544062 | 263 |
| 180 | 3300025927 | Ga0207687_10199626 | Ga0207687_101996262 | 263 |
| 181 | 3300028381 | Ga0268264_10787041 | Ga0268264_107870412 | 263 |
| 182 | 3300028666 | Ga0265336_10022562 | Ga0265336_100225622 | 263 |
| 183 | 3300028794 | Ga0307515_10043225 | Ga0307515_100432256 | 263 |
| 184 | 3300028794 | Ga0307515_10104231 | Ga0307515_101042311 | 263 |
| 185 | 3300030522 | Ga0307512_10011391 | Ga0307512_100113916 | 263 |
| 186 | 3300030522 | Ga0307512_10030839 | Ga0307512_100308393 | 263 |
| 187 | 3300031456 | Ga0307513_10009510 | Ga0307513_1000951010 | 263 |
| 188 | 3300031616 | Ga0307508_10025462 | Ga0307508_100254623 | 263 |
| 189 | 3300031731 | Ga0307405_10322622 | Ga0307405_103226222 | 263 |
| 190 | 3300032133 | Ga0316583_10023870 | Ga0316583_100238702 | 263 |
| 191 | 3300033180 | Ga0307510_10147399 | Ga0307510_101473992 | 263 |
| 192 | 3300048928 | Ga0496125_0003472 | Ga0496125_0003472_14760_15617 | 263 |
| 193 | 3300049822 | Ga0501035_0071552 | Ga0501035_0071552_1160_1957 | 263 |
| 194 | 3300049823 | Ga0501044_0192816 | Ga0501044_0192816_328_1125 | 263 |
| 195 | 3300053142 | Ga0500577_0076548 | Ga0500577_0076548_323_1120 | 263 |
| 196 | 3300053156 | Ga0500622_0157550 | Ga0500622_0157550_193_990 | 263 |
| 197 | 2162886007 | SwRhRL2b_contig_2388475 | SwRhRL2b_0205.00005770 | 264 |
| 198 | 3300000549 | LJQas_1004670 | LJQas_10046702 | 264 |
| 199 | 3300001979 | JGI24740J21852_10015371 | JGI24740J21852_100153711 | 264 |
| 200 | 3300001979 | JGI24740J21852_10025518 | JGI24740J21852_100255183 | 264 |
| 201 | 3300002070 | JGI24750J21931_1014577 | JGI24750J21931_10145771 | 264 |
| 202 | 3300002738 | JGI25154J39366_1000007 | JGI25154J39366_1000007280 | 264 |
| 203 | 3300003187 | JGI25151J46595_10000028 | JGI25151J46595_1000002889 | 264 |
| 204 | 3300003203 | JGI25406J46586_10000196 | JGI25406J46586_100001969 | 264 |
| 205 | 3300003214 | JGI25165J46597_1005748 | JGI25165J46597_10057482 | 264 |
| 206 | 3300003215 | JGI25153J46596_10000738 | JGI25153J46596_100007384 | 264 |
| 207 | 3300003215 | JGI25153J46596_10001748 | JGI25153J46596_100017485 | 264 |
| 208 | 3300003323 | rootH1_10034177 | rootH1_100341773 | 264 |
| 209 | 3300003323 | rootH1_10106887 | rootH1_101068871 | 264 |
| 210 | 3300003354 | JGI25160J50197_1012427 | JGI25160J50197_10124272 | 264 |
| 211 | 3300003659 | JGI25404J52841_10008621 | JGI25404J52841_100086211 | 264 |
| 212 | 3300003752 | Ga0055539_1007171 | Ga0055539_10071712 | 264 |
| 213 | 3300003771 | Ga0055526_1000938 | Ga0055526_100093820 | 264 |
| 214 | 3300003771 | Ga0055526_1005211 | Ga0055526_10052119 | 264 |
| 215 | 3300003775 | Ga0055524_1000020 | Ga0055524_1000020167 | 264 |
| 216 | 3300003775 | Ga0055524_1007655 | Ga0055524_10076555 | 264 |
| 217 | 3300005262 | Ga0065165_1002837 | Ga0065165_100283711 | 264 |
| 218 | 3300005288 | Ga0065714_10002655 | Ga0065714_1000265510 | 264 |
| 219 | 3300005288 | Ga0065714_10064924 | Ga0065714_100649242 | 264 |
| 220 | 3300005288 | Ga0065714_10105188 | Ga0065714_101051881 | 264 |
| 221 | 3300005289 | Ga0065704_10000422 | Ga0065704_1000042220 | 264 |
| 222 | 3300005289 | Ga0065704_10226758 | Ga0065704_102267582 | 264 |
| 223 | 3300005293 | Ga0065715_10165122 | Ga0065715_101651222 | 264 |
| 224 | 3300005327 | Ga0070658_10034361 | Ga0070658_100343614 | 264 |
| 225 | 3300005327 | Ga0070658_10094348 | Ga0070658_100943482 | 264 |
| 226 | 3300005327 | Ga0070658_10181622 | Ga0070658_101816223 | 264 |
| 227 | 3300005327 | Ga0070658_10295126 | Ga0070658_102951262 | 264 |
| 228 | 3300005328 | Ga0070676_10144069 | Ga0070676_101440692 | 264 |
| 229 | 3300005329 | Ga0070683_100002255 | Ga0070683_1000022553 | 264 |
| 230 | 3300005329 | Ga0070683_100017424 | Ga0070683_1000174244 | 264 |
| 231 | 3300005329 | Ga0070683_100046407 | Ga0070683_1000464073 | 264 |
| 232 | 3300005329 | Ga0070683_100053085 | Ga0070683_1000530855 | 264 |
| 233 | 3300005330 | Ga0070690_100013883 | Ga0070690_1000138833 | 264 |
| 234 | 3300005330 | Ga0070690_100167770 | Ga0070690_1001677701 | 264 |
| 235 | 3300005331 | Ga0070670_100097680 | Ga0070670_1000976801 | 264 |
| 236 | 3300005331 | Ga0070670_100132060 | Ga0070670_1001320602 | 264 |
| 237 | 3300005335 | Ga0070666_10214446 | Ga0070666_102144462 | 264 |
| 238 | 3300005336 | Ga0070680_100221804 | Ga0070680_1002218042 | 264 |
| 239 | 3300005337 | Ga0070682_100000014 | Ga0070682_10000001442 | 264 |
| 240 | 3300005337 | Ga0070682_100080195 | Ga0070682_1000801952 | 264 |
| 241 | 3300005337 | Ga0070682_100466373 | Ga0070682_1004663731 | 264 |
| 242 | 3300005338 | Ga0068868_100002673 | Ga0068868_10000267314 | 264 |
| 243 | 3300005338 | Ga0068868_100050231 | Ga0068868_1000502313 | 264 |
| 244 | 3300005339 | Ga0070660_100010424 | Ga0070660_1000104247 | 264 |
| 245 | 3300005340 | Ga0070689_100000488 | Ga0070689_10000048823 | 264 |
| 246 | 3300005340 | Ga0070689_100002204 | Ga0070689_1000022043 | 264 |
| 247 | 3300005340 | Ga0070689_100189445 | Ga0070689_1001894452 | 264 |
| 248 | 3300005340 | Ga0070689_100237511 | Ga0070689_1002375112 | 264 |
| 249 | 3300005340 | Ga0070689_100415257 | Ga0070689_1004152572 | 264 |
| 250 | 3300005341 | Ga0070691_10017425 | Ga0070691_100174254 | 264 |
| 251 | 3300005341 | Ga0070691_10018051 | Ga0070691_100180513 | 264 |
| 252 | 3300005344 | Ga0070661_100008367 | Ga0070661_1000083674 | 264 |
| 253 | 3300005344 | Ga0070661_100204853 | Ga0070661_1002048531 | 264 |
| 254 | 3300005345 | Ga0070692_10007686 | Ga0070692_100076862 | 264 |
| 255 | 3300005345 | Ga0070692_10014150 | Ga0070692_100141502 | 264 |
| 256 | 3300005347 | Ga0070668_100002031 | Ga0070668_1000020315 | 264 |
| 257 | 3300005347 | Ga0070668_100041237 | Ga0070668_1000412371 | 264 |
| 258 | 3300005347 | Ga0070668_100108937 | Ga0070668_1001089373 | 264 |
| 259 | 3300005347 | Ga0070668_100331079 | Ga0070668_1003310792 | 264 |
| 260 | 3300005347 | Ga0070668_100371797 | Ga0070668_1003717972 | 264 |
| 261 | 3300005353 | Ga0070669_100027197 | Ga0070669_1000271975 | 264 |
| 262 | 3300005354 | Ga0070675_100007206 | Ga0070675_1000072066 | 264 |
| 263 | 3300005354 | Ga0070675_100499022 | Ga0070675_1004990221 | 264 |
| 264 | 3300005355 | Ga0070671_100006436 | Ga0070671_1000064366 | 264 |
| 265 | 3300005356 | Ga0070674_100035143 | Ga0070674_1000351432 | 264 |
| 266 | 3300005356 | Ga0070674_100388937 | Ga0070674_1003889372 | 264 |
| 267 | 3300005364 | Ga0070673_100113737 | Ga0070673_1001137372 | 264 |
| 268 | 3300005364 | Ga0070673_100153375 | Ga0070673_1001533752 | 264 |
| 269 | 3300005365 | Ga0070688_100225593 | Ga0070688_1002255932 | 264 |
| 270 | 3300005365 | Ga0070688_100353997 | Ga0070688_1003539971 | 264 |
| 271 | 3300005366 | Ga0070659_100145758 | Ga0070659_1001457582 | 264 |
| 272 | 3300005366 | Ga0070659_100358993 | Ga0070659_1003589931 | 264 |
| 273 | 3300005367 | Ga0070667_100071427 | Ga0070667_1000714272 | 264 |
| 274 | 3300005367 | Ga0070667_100094555 | Ga0070667_1000945553 | 264 |
| 275 | 3300005367 | Ga0070667_100187955 | Ga0070667_1001879552 | 264 |
| 276 | 3300005367 | Ga0070667_100333620 | Ga0070667_1003336202 | 264 |
| 277 | 3300005434 | Ga0070709_10025330 | Ga0070709_100253302 | 264 |
| 278 | 3300005434 | Ga0070709_10025693 | Ga0070709_100256932 | 264 |
| 279 | 3300005434 | Ga0070709_10056857 | Ga0070709_100568574 | 264 |
| 280 | 3300005435 | Ga0070714_100002013 | Ga0070714_10000201315 | 264 |
| 281 | 3300005435 | Ga0070714_100038279 | Ga0070714_1000382792 | 264 |
| 282 | 3300005435 | Ga0070714_100041967 | Ga0070714_1000419674 | 264 |
| 283 | 3300005435 | Ga0070714_100134050 | Ga0070714_1001340502 | 264 |
| 284 | 3300005435 | Ga0070714_100168946 | Ga0070714_1001689462 | 264 |
| 285 | 3300005435 | Ga0070714_100240705 | Ga0070714_1002407052 | 264 |
| 286 | 3300005435 | Ga0070714_100253223 | Ga0070714_1002532232 | 264 |
| 287 | 3300005436 | Ga0070713_100000639 | Ga0070713_1000006394 | 264 |
| 288 | 3300005436 | Ga0070713_100162001 | Ga0070713_1001620013 | 264 |
| 289 | 3300005437 | Ga0070710_10000587 | Ga0070710_100005877 | 264 |
| 290 | 3300005437 | Ga0070710_10011649 | Ga0070710_100116494 | 264 |
| 291 | 3300005439 | Ga0070711_100002894 | Ga0070711_1000028944 | 264 |
| 292 | 3300005439 | Ga0070711_100010862 | Ga0070711_1000108624 | 264 |
| 293 | 3300005439 | Ga0070711_100092843 | Ga0070711_1000928432 | 264 |
| 294 | 3300005439 | Ga0070711_100135860 | Ga0070711_1001358602 | 264 |
| 295 | 3300005439 | Ga0070711_100208229 | Ga0070711_1002082292 | 264 |
| 296 | 3300005440 | Ga0070705_100001167 | Ga0070705_1000011678 | 264 |
| 297 | 3300005440 | Ga0070705_100143726 | Ga0070705_1001437262 | 264 |
| 298 | 3300005441 | Ga0070700_100003520 | Ga0070700_1000035203 | 264 |
| 299 | 3300005441 | Ga0070700_100062744 | Ga0070700_1000627442 | 264 |
| 300 | 3300005441 | Ga0070700_100150313 | Ga0070700_1001503131 | 264 |
| 301 | 3300005444 | Ga0070694_100009831 | Ga0070694_1000098314 | 264 |
| 302 | 3300005455 | Ga0070663_100047725 | Ga0070663_1000477253 | 264 |
| 303 | 3300005455 | Ga0070663_100074216 | Ga0070663_1000742163 | 264 |
| 304 | 3300005455 | Ga0070663_100136230 | Ga0070663_1001362301 | 264 |
| 305 | 3300005455 | Ga0070663_100174501 | Ga0070663_1001745012 | 264 |
| 306 | 3300005456 | Ga0070678_100007967 | Ga0070678_1000079673 | 264 |
| 307 | 3300005456 | Ga0070678_100035283 | Ga0070678_1000352832 | 264 |
| 308 | 3300005456 | Ga0070678_100039559 | Ga0070678_1000395592 | 264 |
| 309 | 3300005456 | Ga0070678_100066179 | Ga0070678_1000661794 | 264 |
| 310 | 3300005456 | Ga0070678_100091852 | Ga0070678_1000918522 | 264 |
| 311 | 3300005456 | Ga0070678_100182435 | Ga0070678_1001824351 | 264 |
| 312 | 3300005457 | Ga0070662_100050830 | Ga0070662_1000508302 | 264 |
| 313 | 3300005458 | Ga0070681_10069164 | Ga0070681_100691644 | 264 |
| 314 | 3300005458 | Ga0070681_10085157 | Ga0070681_100851573 | 264 |
| 315 | 3300005459 | Ga0068867_100165645 | Ga0068867_1001656451 | 264 |
| 316 | 3300005466 | Ga0070685_10000250 | Ga0070685_1000025022 | 264 |
| 317 | 3300005466 | Ga0070685_10073780 | Ga0070685_100737802 | 264 |
| 318 | 3300005467 | Ga0070706_100467803 | Ga0070706_1004678032 | 264 |
| 319 | 3300005471 | Ga0070698_100001623 | Ga0070698_10000162310 | 264 |
| 320 | 3300005518 | Ga0070699_100000147 | Ga0070699_10000014730 | 264 |
| 321 | 3300005530 | Ga0070679_100009879 | Ga0070679_1000098795 | 264 |
| 322 | 3300005530 | Ga0070679_100019162 | Ga0070679_1000191624 | 264 |
| 323 | 3300005530 | Ga0070679_100037593 | Ga0070679_1000375934 | 264 |
| 324 | 3300005530 | Ga0070679_100189878 | Ga0070679_1001898783 | 264 |
| 325 | 3300005530 | Ga0070679_100374925 | Ga0070679_1003749252 | 264 |
| 326 | 3300005535 | Ga0070684_100027286 | Ga0070684_1000272865 | 264 |
| 327 | 3300005535 | Ga0070684_100033649 | Ga0070684_1000336494 | 264 |
| 328 | 3300005535 | Ga0070684_100354154 | Ga0070684_1003541542 | 264 |
| 329 | 3300005536 | Ga0070697_100044081 | Ga0070697_1000440813 | 264 |
| 330 | 3300005539 | Ga0068853_100021436 | Ga0068853_1000214364 | 264 |
| 331 | 3300005539 | Ga0068853_100022775 | Ga0068853_1000227754 | 264 |
| 332 | 3300005539 | Ga0068853_100091534 | Ga0068853_1000915342 | 264 |
| 333 | 3300005539 | Ga0068853_100256421 | Ga0068853_1002564212 | 264 |
| 334 | 3300005539 | Ga0068853_100277868 | Ga0068853_1002778682 | 264 |
| 335 | 3300005539 | Ga0068853_100322378 | Ga0068853_1003223781 | 264 |
| 336 | 3300005539 | Ga0068853_100445302 | Ga0068853_1004453021 | 264 |
| 337 | 3300005543 | Ga0070672_100000746 | Ga0070672_10000074611 | 264 |
| 338 | 3300005543 | Ga0070672_100089558 | Ga0070672_1000895582 | 264 |
| 339 | 3300005543 | Ga0070672_100249753 | Ga0070672_1002497531 | 264 |
| 340 | 3300005544 | Ga0070686_100112425 | Ga0070686_1001124252 | 264 |
| 341 | 3300005545 | Ga0070695_100011698 | Ga0070695_1000116984 | 264 |
| 342 | 3300005546 | Ga0070696_100000503 | Ga0070696_1000005039 | 264 |
| 343 | 3300005546 | Ga0070696_100108170 | Ga0070696_1001081702 | 264 |
| 344 | 3300005546 | Ga0070696_100178163 | Ga0070696_1001781632 | 264 |
| 345 | 3300005547 | Ga0070693_100016097 | Ga0070693_1000160972 | 264 |
| 346 | 3300005547 | Ga0070693_100132752 | Ga0070693_1001327522 | 264 |
| 347 | 3300005547 | Ga0070693_100240139 | Ga0070693_1002401392 | 264 |
| 348 | 3300005548 | Ga0070665_100004481 | Ga0070665_10000448113 | 264 |
| 349 | 3300005548 | Ga0070665_100020950 | Ga0070665_1000209505 | 264 |
| 350 | 3300005548 | Ga0070665_100033592 | Ga0070665_1000335923 | 264 |
| 351 | 3300005548 | Ga0070665_100043567 | Ga0070665_1000435674 | 264 |
| 352 | 3300005548 | Ga0070665_100141030 | Ga0070665_1001410302 | 264 |
| 353 | 3300005548 | Ga0070665_100152095 | Ga0070665_1001520953 | 264 |
| 354 | 3300005548 | Ga0070665_100160316 | Ga0070665_1001603162 | 264 |
| 355 | 3300005548 | Ga0070665_100190871 | Ga0070665_1001908712 | 264 |
| 356 | 3300005548 | Ga0070665_100529821 | Ga0070665_1005298211 | 264 |
| 357 | 3300005549 | Ga0070704_100014566 | Ga0070704_1000145664 | 264 |
| 358 | 3300005549 | Ga0070704_100139027 | Ga0070704_1001390272 | 264 |
| 359 | 3300005563 | Ga0068855_100036490 | Ga0068855_1000364903 | 264 |
| 360 | 3300005563 | Ga0068855_100037992 | Ga0068855_1000379923 | 264 |
| 361 | 3300005563 | Ga0068855_100084586 | Ga0068855_1000845862 | 264 |
| 362 | 3300005563 | Ga0068855_100436150 | Ga0068855_1004361502 | 264 |
| 363 | 3300005564 | Ga0070664_100115042 | Ga0070664_1001150422 | 264 |
| 364 | 3300005577 | Ga0068857_100002373 | Ga0068857_1000023739 | 264 |
| 365 | 3300005577 | Ga0068857_100051526 | Ga0068857_1000515263 | 264 |
| 366 | 3300005577 | Ga0068857_100060313 | Ga0068857_1000603133 | 264 |
| 367 | 3300005577 | Ga0068857_100096949 | Ga0068857_1000969493 | 264 |
| 368 | 3300005577 | Ga0068857_100210098 | Ga0068857_1002100982 | 264 |
| 369 | 3300005577 | Ga0068857_100450862 | Ga0068857_1004508621 | 264 |
| 370 | 3300005578 | Ga0068854_100115871 | Ga0068854_1001158713 | 264 |
| 371 | 3300005578 | Ga0068854_100133269 | Ga0068854_1001332692 | 264 |
| 372 | 3300005614 | Ga0068856_100002538 | Ga0068856_10000253820 | 264 |
| 373 | 3300005614 | Ga0068856_100025782 | Ga0068856_1000257827 | 264 |
| 374 | 3300005614 | Ga0068856_100118188 | Ga0068856_1001181882 | 264 |
| 375 | 3300005614 | Ga0068856_100206953 | Ga0068856_1002069531 | 264 |
| 376 | 3300005614 | Ga0068856_100390813 | Ga0068856_1003908132 | 264 |
| 377 | 3300005614 | Ga0068856_100403938 | Ga0068856_1004039381 | 264 |
| 378 | 3300005615 | Ga0070702_100162301 | Ga0070702_1001623012 | 264 |
| 379 | 3300005616 | Ga0068852_100001168 | Ga0068852_1000011686 | 264 |
| 380 | 3300005616 | Ga0068852_100016778 | Ga0068852_1000167782 | 264 |
| 381 | 3300005616 | Ga0068852_100019720 | Ga0068852_1000197203 | 264 |
| 382 | 3300005616 | Ga0068852_100045654 | Ga0068852_1000456543 | 264 |
| 383 | 3300005616 | Ga0068852_100103442 | Ga0068852_1001034424 | 264 |
| 384 | 3300005616 | Ga0068852_100121441 | Ga0068852_1001214412 | 264 |
| 385 | 3300005616 | Ga0068852_100174247 | Ga0068852_1001742472 | 264 |
| 386 | 3300005617 | Ga0068859_100003136 | Ga0068859_1000031369 | 264 |
| 387 | 3300005617 | Ga0068859_100041987 | Ga0068859_1000419876 | 264 |
| 388 | 3300005617 | Ga0068859_100067475 | Ga0068859_1000674752 | 264 |
| 389 | 3300005617 | Ga0068859_100079191 | Ga0068859_1000791913 | 264 |
| 390 | 3300005617 | Ga0068859_100208224 | Ga0068859_1002082242 | 264 |
| 391 | 3300005618 | Ga0068864_100000097 | Ga0068864_10000009760 | 264 |
| 392 | 3300005618 | Ga0068864_100083220 | Ga0068864_1000832202 | 264 |
| 393 | 3300005719 | Ga0068861_100000391 | Ga0068861_1000003913 | 264 |
| 394 | 3300005719 | Ga0068861_100066467 | Ga0068861_1000664672 | 264 |
| 395 | 3300005719 | Ga0068861_100080561 | Ga0068861_1000805612 | 264 |
| 396 | 3300005834 | Ga0068851_10020777 | Ga0068851_100207774 | 264 |
| 397 | 3300005834 | Ga0068851_10023616 | Ga0068851_100236163 | 264 |
| 398 | 3300005841 | Ga0068863_100064453 | Ga0068863_1000644532 | 264 |
| 399 | 3300005842 | Ga0068858_100000243 | Ga0068858_10000024323 | 264 |
| 400 | 3300005842 | Ga0068858_100037282 | Ga0068858_1000372824 | 264 |
| 401 | 3300005842 | Ga0068858_100176044 | Ga0068858_1001760442 | 264 |
| 402 | 3300005842 | Ga0068858_100359903 | Ga0068858_1003599032 | 264 |
| 403 | 3300005842 | Ga0068858_100412713 | Ga0068858_1004127132 | 264 |
| 404 | 3300005842 | Ga0068858_100468617 | Ga0068858_1004686172 | 264 |
| 405 | 3300005843 | Ga0068860_100004632 | Ga0068860_1000046327 | 264 |
| 406 | 3300005843 | Ga0068860_100013122 | Ga0068860_1000131223 | 264 |
| 407 | 3300005843 | Ga0068860_100020886 | Ga0068860_1000208864 | 264 |
| 408 | 3300005843 | Ga0068860_100056526 | Ga0068860_1000565265 | 264 |
| 409 | 3300005843 | Ga0068860_100128258 | Ga0068860_1001282584 | 264 |
| 410 | 3300005843 | Ga0068860_100582969 | Ga0068860_1005829691 | 264 |
| 411 | 3300005844 | Ga0068862_100001552 | Ga0068862_1000015528 | 264 |
| 412 | 3300005844 | Ga0068862_100002918 | Ga0068862_1000029188 | 264 |
| 413 | 3300005844 | Ga0068862_100418100 | Ga0068862_1004181002 | 264 |
| 414 | 3300005937 | Ga0081455_10008277 | Ga0081455_1000827712 | 264 |
| 415 | 3300005937 | Ga0081455_10019690 | Ga0081455_100196902 | 264 |
| 416 | 3300005937 | Ga0081455_10067883 | Ga0081455_100678832 | 264 |
| 417 | 3300005937 | Ga0081455_10070603 | Ga0081455_100706034 | 264 |
| 418 | 3300005981 | Ga0081538_10017929 | Ga0081538_100179295 | 264 |
| 419 | 3300005983 | Ga0081540_1000996 | Ga0081540_100099618 | 264 |
| 420 | 3300005983 | Ga0081540_1008013 | Ga0081540_10080133 | 264 |
| 421 | 3300005983 | Ga0081540_1010852 | Ga0081540_10108523 | 264 |
| 422 | 3300005983 | Ga0081540_1028988 | Ga0081540_10289884 | 264 |
| 423 | 3300005983 | Ga0081540_1071022 | Ga0081540_10710222 | 264 |
| 424 | 3300005985 | Ga0081539_10000748 | Ga0081539_1000074837 | 264 |
| 425 | 3300005985 | Ga0081539_10030261 | Ga0081539_100302611 | 264 |
| 426 | 3300006028 | Ga0070717_10010072 | Ga0070717_100100722 | 264 |
| 427 | 3300006028 | Ga0070717_10014303 | Ga0070717_100143036 | 264 |
| 428 | 3300006028 | Ga0070717_10016137 | Ga0070717_100161373 | 264 |
| 429 | 3300006028 | Ga0070717_10128031 | Ga0070717_101280313 | 264 |
| 430 | 3300006028 | Ga0070717_10321136 | Ga0070717_103211362 | 264 |
| 431 | 3300006038 | Ga0075365_10067201 | Ga0075365_100672011 | 264 |
| 432 | 3300006038 | Ga0075365_10081134 | Ga0075365_100811342 | 264 |
| 433 | 3300006038 | Ga0075365_10192006 | Ga0075365_101920061 | 264 |
| 434 | 3300006042 | Ga0075368_10018880 | Ga0075368_100188802 | 264 |
| 435 | 3300006042 | Ga0075368_10069009 | Ga0075368_100690091 | 264 |
| 436 | 3300006048 | Ga0075363_100032234 | Ga0075363_1000322342 | 264 |
| 437 | 3300006051 | Ga0075364_10022187 | Ga0075364_100221874 | 264 |
| 438 | 3300006051 | Ga0075364_10044496 | Ga0075364_100444962 | 264 |
| 439 | 3300006051 | Ga0075364_10146731 | Ga0075364_101467312 | 264 |
| 440 | 3300006051 | Ga0075364_10213375 | Ga0075364_102133753 | 264 |
| 441 | 3300006163 | Ga0070715_10000260 | Ga0070715_1000026010 | 264 |
| 442 | 3300006173 | Ga0070716_100000213 | Ga0070716_1000002138 | 264 |
| 443 | 3300006173 | Ga0070716_100020768 | Ga0070716_1000207683 | 264 |
| 444 | 3300006175 | Ga0070712_100010117 | Ga0070712_1000101177 | 264 |
| 445 | 3300006175 | Ga0070712_100016528 | Ga0070712_1000165284 | 264 |
| 446 | 3300006177 | Ga0075362_10000655 | Ga0075362_1000065513 | 264 |
| 447 | 3300006177 | Ga0075362_10008950 | Ga0075362_100089502 | 264 |
| 448 | 3300006178 | Ga0075367_10038229 | Ga0075367_100382292 | 264 |
| 449 | 3300006186 | Ga0075369_10002063 | Ga0075369_100020633 | 264 |
| 450 | 3300006186 | Ga0075369_10011190 | Ga0075369_100111904 | 264 |
| 451 | 3300006195 | Ga0075366_10242998 | Ga0075366_102429982 | 264 |
| 452 | 3300006237 | Ga0097621_100041480 | Ga0097621_1000414805 | 264 |
| 453 | 3300006237 | Ga0097621_100146155 | Ga0097621_1001461553 | 264 |
| 454 | 3300006237 | Ga0097621_100185039 | Ga0097621_1001850391 | 264 |
| 455 | 3300006353 | Ga0075370_10042568 | Ga0075370_100425682 | 264 |
| 456 | 3300006353 | Ga0075370_10083703 | Ga0075370_100837032 | 264 |
| 457 | 3300006353 | Ga0075370_10087666 | Ga0075370_100876662 | 264 |
| 458 | 3300006353 | Ga0075370_10123414 | Ga0075370_101234142 | 264 |
| 459 | 3300006358 | Ga0068871_100058705 | Ga0068871_1000587053 | 264 |
| 460 | 3300006358 | Ga0068871_100107291 | Ga0068871_1001072913 | 264 |
| 461 | 3300006844 | Ga0075428_100003578 | Ga0075428_10000357812 | 264 |
| 462 | 3300006844 | Ga0075428_100013501 | Ga0075428_1000135018 | 264 |
| 463 | 3300006844 | Ga0075428_100068789 | Ga0075428_1000687892 | 264 |
| 464 | 3300006852 | Ga0075433_10023832 | Ga0075433_100238326 | 264 |
| 465 | 3300006871 | Ga0075434_100033264 | Ga0075434_1000332643 | 264 |
| 466 | 3300006880 | Ga0075429_100060260 | Ga0075429_1000602603 | 264 |
| 467 | 3300006881 | Ga0068865_100035745 | Ga0068865_1000357453 | 264 |
| 468 | 3300006881 | Ga0068865_100094453 | Ga0068865_1000944532 | 264 |
| 469 | 3300006881 | Ga0068865_100191024 | Ga0068865_1001910242 | 264 |
| 470 | 3300006881 | Ga0068865_100443697 | Ga0068865_1004436971 | 264 |
| 471 | 3300006881 | Ga0068865_100467125 | Ga0068865_1004671251 | 264 |
| 472 | 3300006931 | Ga0097620_100003136 | Ga0097620_1000031369 | 264 |
| 473 | 3300006931 | Ga0097620_100041987 | Ga0097620_1000419876 | 264 |
| 474 | 3300006931 | Ga0097620_100067486 | Ga0097620_1000674862 | 264 |
| 475 | 3300006931 | Ga0097620_100079191 | Ga0097620_1000791913 | 264 |
| 476 | 3300006931 | Ga0097620_100208232 | Ga0097620_1002082322 | 264 |
| 477 | 3300006942 | Ga0099824_1013210 | Ga0099824_10132105 | 264 |
| 478 | 3300007076 | Ga0075435_100073070 | Ga0075435_1000730703 | 264 |
| 479 | 3300007076 | Ga0075435_100570589 | Ga0075435_1005705891 | 264 |
| 480 | 3300007076 | Ga0075435_100595263 | Ga0075435_1005952632 | 264 |
| 481 | 3300007265 | Ga0099794_10047410 | Ga0099794_100474102 | 264 |
| 482 | 3300007788 | Ga0099795_10023637 | Ga0099795_100236372 | 264 |
| 483 | 3300009093 | Ga0105240_10000876 | Ga0105240_1000087635 | 264 |
| 484 | 3300009093 | Ga0105240_10000946 | Ga0105240_1000094617 | 264 |
| 485 | 3300009093 | Ga0105240_10023381 | Ga0105240_100233817 | 264 |
| 486 | 3300009093 | Ga0105240_10343595 | Ga0105240_103435953 | 264 |
| 487 | 3300009094 | Ga0111539_10002382 | Ga0111539_100023828 | 264 |
| 488 | 3300009094 | Ga0111539_10007116 | Ga0111539_100071166 | 264 |
| 489 | 3300009094 | Ga0111539_10012046 | Ga0111539_100120468 | 264 |
| 490 | 3300009094 | Ga0111539_10015447 | Ga0111539_100154479 | 264 |
| 491 | 3300009094 | Ga0111539_10089698 | Ga0111539_100896982 | 264 |
| 492 | 3300009094 | Ga0111539_10294080 | Ga0111539_102940803 | 264 |
| 493 | 3300009094 | Ga0111539_10461243 | Ga0111539_104612432 | 264 |
| 494 | 3300009094 | Ga0111539_11042298 | Ga0111539_110422981 | 264 |
| 495 | 3300009098 | Ga0105245_10000024 | Ga0105245_10000024158 | 264 |
| 496 | 3300009098 | Ga0105245_10002720 | Ga0105245_1000272016 | 264 |
| 497 | 3300009098 | Ga0105245_10003410 | Ga0105245_1000341014 | 264 |
| 498 | 3300009098 | Ga0105245_10005629 | Ga0105245_100056294 | 264 |
| 499 | 3300009098 | Ga0105245_10085154 | Ga0105245_100851542 | 264 |
| 500 | 3300009098 | Ga0105245_10118752 | Ga0105245_101187522 | 264 |
| 501 | 3300009098 | Ga0105245_10131020 | Ga0105245_101310202 | 264 |
| 502 | 3300009098 | Ga0105245_10217779 | Ga0105245_102177793 | 264 |
| 503 | 3300009098 | Ga0105245_10421353 | Ga0105245_104213531 | 264 |
| 504 | 3300009101 | Ga0105247_10041178 | Ga0105247_100411782 | 264 |
| 505 | 3300009101 | Ga0105247_10238139 | Ga0105247_102381392 | 264 |
| 506 | 3300009101 | Ga0105247_10346834 | Ga0105247_103468342 | 264 |
| 507 | 3300009147 | Ga0114129_10107850 | Ga0114129_101078503 | 264 |
| 508 | 3300009147 | Ga0114129_10118296 | Ga0114129_101182962 | 264 |
| 509 | 3300009148 | Ga0105243_10042437 | Ga0105243_100424373 | 264 |
| 510 | 3300009148 | Ga0105243_10075153 | Ga0105243_100751532 | 264 |
| 511 | 3300009148 | Ga0105243_10184710 | Ga0105243_101847102 | 264 |
| 512 | 3300009148 | Ga0105243_10660491 | Ga0105243_106604912 | 264 |
| 513 | 3300009174 | Ga0105241_10004477 | Ga0105241_100044773 | 264 |
| 514 | 3300009174 | Ga0105241_10075673 | Ga0105241_100756731 | 264 |
| 515 | 3300009174 | Ga0105241_10287200 | Ga0105241_102872002 | 264 |
| 516 | 3300009176 | Ga0105242_10132099 | Ga0105242_101320992 | 264 |
| 517 | 3300009177 | Ga0105248_10064938 | Ga0105248_100649381 | 264 |
| 518 | 3300009177 | Ga0105248_10121324 | Ga0105248_101213243 | 264 |
| 519 | 3300009177 | Ga0105248_10160474 | Ga0105248_101604743 | 264 |
| 520 | 3300009177 | Ga0105248_10186176 | Ga0105248_101861762 | 264 |
| 521 | 3300009177 | Ga0105248_10252582 | Ga0105248_102525822 | 264 |
| 522 | 3300009177 | Ga0105248_11004952 | Ga0105248_110049521 | 264 |
| 523 | 3300009545 | Ga0105237_10000233 | Ga0105237_1000023332 | 264 |
| 524 | 3300009545 | Ga0105237_10005728 | Ga0105237_1000572812 | 264 |
| 525 | 3300009545 | Ga0105237_10019359 | Ga0105237_100193596 | 264 |
| 526 | 3300009545 | Ga0105237_10022378 | Ga0105237_100223788 | 264 |
| 527 | 3300009545 | Ga0105237_10042957 | Ga0105237_100429576 | 264 |
| 528 | 3300009545 | Ga0105237_10094823 | Ga0105237_100948232 | 264 |
| 529 | 3300009545 | Ga0105237_10516181 | Ga0105237_105161811 | 264 |
| 530 | 3300009551 | Ga0105238_10004976 | Ga0105238_100049765 | 264 |
| 531 | 3300009551 | Ga0105238_10008040 | Ga0105238_100080405 | 264 |
| 532 | 3300009551 | Ga0105238_10215847 | Ga0105238_102158472 | 264 |
| 533 | 3300009553 | Ga0105249_10006733 | Ga0105249_100067333 | 264 |
| 534 | 3300009553 | Ga0105249_10110119 | Ga0105249_101101192 | 264 |
| 535 | 3300009553 | Ga0105249_10578157 | Ga0105249_105781572 | 264 |
| 536 | 3300009553 | Ga0105249_10812335 | Ga0105249_108123352 | 264 |
| 537 | 3300010159 | Ga0099796_10015265 | Ga0099796_100152652 | 264 |
| 538 | 3300010375 | Ga0105239_10000120 | Ga0105239_1000012046 | 264 |
| 539 | 3300010375 | Ga0105239_10001640 | Ga0105239_1000164016 | 264 |
| 540 | 3300010375 | Ga0105239_10013259 | Ga0105239_100132593 | 264 |
| 541 | 3300010375 | Ga0105239_10024893 | Ga0105239_100248935 | 264 |
| 542 | 3300010375 | Ga0105239_10091956 | Ga0105239_100919562 | 264 |
| 543 | 3300010375 | Ga0105239_10096136 | Ga0105239_100961363 | 264 |
| 544 | 3300010375 | Ga0105239_10242659 | Ga0105239_102426593 | 264 |
| 545 | 3300010375 | Ga0105239_10260202 | Ga0105239_102602022 | 264 |
| 546 | 3300010375 | Ga0105239_10408747 | Ga0105239_104087472 | 264 |
| 547 | 3300010375 | Ga0105239_10759717 | Ga0105239_107597172 | 264 |
| 548 | 3300011119 | Ga0105246_10024005 | Ga0105246_100240052 | 264 |
| 549 | 3300012512 | Ga0157327_1011436 | Ga0157327_10114361 | 264 |
| 550 | 3300013100 | Ga0157373_10002272 | Ga0157373_1000227210 | 264 |
| 551 | 3300013102 | Ga0157371_10003535 | Ga0157371_100035354 | 264 |
| 552 | 3300013102 | Ga0157371_10012477 | Ga0157371_100124772 | 264 |
| 553 | 3300013102 | Ga0157371_10014832 | Ga0157371_100148326 | 264 |
| 554 | 3300013102 | Ga0157371_10030480 | Ga0157371_100304804 | 264 |
| 555 | 3300013104 | Ga0157370_10018060 | Ga0157370_100180608 | 264 |
| 556 | 3300013104 | Ga0157370_10036890 | Ga0157370_100368903 | 264 |
| 557 | 3300013104 | Ga0157370_10096746 | Ga0157370_100967462 | 264 |
| 558 | 3300013104 | Ga0157370_10099723 | Ga0157370_100997232 | 264 |
| 559 | 3300013104 | Ga0157370_10310718 | Ga0157370_103107181 | 264 |
| 560 | 3300013105 | Ga0157369_10005591 | Ga0157369_1000559112 | 264 |
| 561 | 3300013105 | Ga0157369_10043505 | Ga0157369_100435054 | 264 |
| 562 | 3300013105 | Ga0157369_10457380 | Ga0157369_104573802 | 264 |
| 563 | 3300013105 | Ga0157369_10661123 | Ga0157369_106611231 | 264 |
| 564 | 3300013296 | Ga0157374_10061312 | Ga0157374_100613124 | 264 |
| 565 | 3300013297 | Ga0157378_10485051 | Ga0157378_104850512 | 264 |
| 566 | 3300013306 | Ga0163162_10055397 | Ga0163162_100553973 | 264 |
| 567 | 3300013306 | Ga0163162_10062679 | Ga0163162_100626792 | 264 |
| 568 | 3300013306 | Ga0163162_10081293 | Ga0163162_100812934 | 264 |
| 569 | 3300013306 | Ga0163162_10095526 | Ga0163162_100955262 | 264 |
| 570 | 3300013307 | Ga0157372_10001329 | Ga0157372_1000132914 | 264 |
| 571 | 3300013307 | Ga0157372_10004023 | Ga0157372_100040238 | 264 |
| 572 | 3300013307 | Ga0157372_10019917 | Ga0157372_100199179 | 264 |
| 573 | 3300013307 | Ga0157372_10046686 | Ga0157372_100466864 | 264 |
| 574 | 3300013307 | Ga0157372_10095853 | Ga0157372_100958532 | 264 |
| 575 | 3300013307 | Ga0157372_10463599 | Ga0157372_104635992 | 264 |
| 576 | 3300013308 | Ga0157375_10005472 | Ga0157375_100054725 | 264 |
| 577 | 3300013308 | Ga0157375_10015648 | Ga0157375_100156483 | 264 |
| 578 | 3300013308 | Ga0157375_10124879 | Ga0157375_101248793 | 264 |
| 579 | 3300013308 | Ga0157375_10264323 | Ga0157375_102643232 | 264 |
| 580 | 3300013308 | Ga0157375_10332404 | Ga0157375_103324042 | 264 |
| 581 | 3300014325 | Ga0163163_10070660 | Ga0163163_100706602 | 264 |
| 582 | 3300014325 | Ga0163163_10250536 | Ga0163163_102505363 | 264 |
| 583 | 3300014325 | Ga0163163_10740804 | Ga0163163_107408041 | 264 |
| 584 | 3300014326 | Ga0157380_10052545 | Ga0157380_100525453 | 264 |
| 585 | 3300014497 | Ga0182008_10000023 | Ga0182008_10000023113 | 264 |
| 586 | 3300014497 | Ga0182008_10118496 | Ga0182008_101184962 | 264 |
| 587 | 3300014968 | Ga0157379_10004846 | Ga0157379_1000484611 | 264 |
| 588 | 3300014969 | Ga0157376_10195673 | Ga0157376_101956732 | 264 |
| 589 | 3300014969 | Ga0157376_10429912 | Ga0157376_104299122 | 264 |
| 590 | 3300014969 | Ga0157376_10899430 | Ga0157376_108994301 | 264 |
| 591 | 3300015261 | Ga0182006_1003750 | Ga0182006_10037508 | 264 |
| 592 | 3300015261 | Ga0182006_1011496 | Ga0182006_10114962 | 264 |
| 593 | 3300017792 | Ga0163161_10027330 | Ga0163161_100273303 | 264 |
| 594 | 3300020077 | Ga0206351_10377797 | Ga0206351_103777971 | 264 |
| 595 | 3300020081 | Ga0206354_10242601 | Ga0206354_102426011 | 264 |
| 596 | 3300020081 | Ga0206354_11168486 | Ga0206354_111684862 | 264 |
| 597 | 3300020082 | Ga0206353_10210928 | Ga0206353_102109282 | 264 |
| 598 | 3300021320 | Ga0214544_1000026 | Ga0214544_100002658 | 264 |
| 599 | 3300021321 | Ga0214542_1000025 | Ga0214542_1000025103 | 264 |
| 600 | 3300021324 | Ga0214545_1000014 | Ga0214545_100001475 | 264 |
| 601 | 3300021327 | Ga0214543_1000034 | Ga0214543_1000034102 | 264 |
| 602 | 3300021384 | Ga0213876_10021664 | Ga0213876_100216643 | 264 |
| 603 | 3300024227 | Ga0228598_1002128 | Ga0228598_10021287 | 264 |
| 604 | 3300025246 | Ga0209646_1000002 | Ga0209646_1000002886 | 264 |
| 605 | 3300025250 | Ga0209026_1000086 | Ga0209026_1000086150 | 264 |
| 606 | 3300025253 | Ga0209677_100874 | Ga0209677_10087412 | 264 |
| 607 | 3300025261 | Ga0209233_1000766 | Ga0209233_100076611 | 264 |
| 608 | 3300025261 | Ga0209233_1004428 | Ga0209233_10044285 | 264 |
| 609 | 3300025261 | Ga0209233_1027131 | Ga0209233_10271312 | 264 |
| 610 | 3300025271 | Ga0207666_1013043 | Ga0207666_10130431 | 264 |
| 611 | 3300025272 | Ga0209455_1003984 | Ga0209455_10039845 | 264 |
| 612 | 3300025272 | Ga0209455_1006055 | Ga0209455_10060552 | 264 |
| 613 | 3300025273 | Ga0209673_1045515 | Ga0209673_10455152 | 264 |
| 614 | 3300025291 | Ga0209675_1000692 | Ga0209675_10006924 | 264 |
| 615 | 3300025294 | Ga0209025_1000008 | Ga0209025_1000008822 | 264 |
| 616 | 3300025295 | Ga0209564_1000049 | Ga0209564_1000049290 | 264 |
| 617 | 3300025295 | Ga0209564_1000065 | Ga0209564_100006563 | 264 |
| 618 | 3300025295 | Ga0209564_1000248 | Ga0209564_100024819 | 264 |
| 619 | 3300025297 | Ga0209758_1001510 | Ga0209758_100151021 | 264 |
| 620 | 3300025297 | Ga0209758_1004242 | Ga0209758_10042424 | 264 |
| 621 | 3300025297 | Ga0209758_1037278 | Ga0209758_10372782 | 264 |
| 622 | 3300025299 | Ga0209256_1000014 | Ga0209256_1000014349 | 264 |
| 623 | 3300025299 | Ga0209256_1000200 | Ga0209256_100020042 | 264 |
| 624 | 3300025302 | Ga0207426_1001097 | Ga0207426_100109714 | 264 |
| 625 | 3300025302 | Ga0207426_1029203 | Ga0207426_10292032 | 264 |
| 626 | 3300025315 | Ga0207697_10042990 | Ga0207697_100429902 | 264 |
| 627 | 3300025315 | Ga0207697_10067325 | Ga0207697_100673251 | 264 |
| 628 | 3300025315 | Ga0207697_10078409 | Ga0207697_100784092 | 264 |
| 629 | 3300025321 | Ga0207656_10021724 | Ga0207656_100217244 | 264 |
| 630 | 3300025321 | Ga0207656_10162837 | Ga0207656_101628371 | 264 |
| 631 | 3300025885 | Ga0207653_10000605 | Ga0207653_1000060511 | 264 |
| 632 | 3300025898 | Ga0207692_10000295 | Ga0207692_100002957 | 264 |
| 633 | 3300025898 | Ga0207692_10013187 | Ga0207692_100131874 | 264 |
| 634 | 3300025900 | Ga0207710_10048100 | Ga0207710_100481002 | 264 |
| 635 | 3300025900 | Ga0207710_10053962 | Ga0207710_100539622 | 264 |
| 636 | 3300025903 | Ga0207680_10104280 | Ga0207680_101042802 | 264 |
| 637 | 3300025904 | Ga0207647_10028419 | Ga0207647_100284193 | 264 |
| 638 | 3300025905 | Ga0207685_10115129 | Ga0207685_101151291 | 264 |
| 639 | 3300025906 | Ga0207699_10007555 | Ga0207699_100075553 | 264 |
| 640 | 3300025906 | Ga0207699_10023406 | Ga0207699_100234062 | 264 |
| 641 | 3300025906 | Ga0207699_10102766 | Ga0207699_101027662 | 264 |
| 642 | 3300025907 | Ga0207645_10080365 | Ga0207645_100803652 | 264 |
| 643 | 3300025909 | Ga0207705_10002850 | Ga0207705_100028505 | 264 |
| 644 | 3300025909 | Ga0207705_10020137 | Ga0207705_100201374 | 264 |
| 645 | 3300025909 | Ga0207705_10020562 | Ga0207705_100205624 | 264 |
| 646 | 3300025909 | Ga0207705_10033577 | Ga0207705_100335773 | 264 |
| 647 | 3300025911 | Ga0207654_10011026 | Ga0207654_100110263 | 264 |
| 648 | 3300025911 | Ga0207654_10040629 | Ga0207654_100406293 | 264 |
| 649 | 3300025911 | Ga0207654_10085782 | Ga0207654_100857822 | 264 |
| 650 | 3300025911 | Ga0207654_10135041 | Ga0207654_101350412 | 264 |
| 651 | 3300025911 | Ga0207654_10377771 | Ga0207654_103777711 | 264 |
| 652 | 3300025912 | Ga0207707_10000455 | Ga0207707_1000045535 | 264 |
| 653 | 3300025912 | Ga0207707_10008592 | Ga0207707_1000859210 | 264 |
| 654 | 3300025912 | Ga0207707_10039737 | Ga0207707_100397371 | 264 |
| 655 | 3300025912 | Ga0207707_10160761 | Ga0207707_101607612 | 264 |
| 656 | 3300025912 | Ga0207707_10220712 | Ga0207707_102207123 | 264 |
| 657 | 3300025912 | Ga0207707_10265207 | Ga0207707_102652072 | 264 |
| 658 | 3300025913 | Ga0207695_10000013 | Ga0207695_10000013290 | 264 |
| 659 | 3300025913 | Ga0207695_10000014 | Ga0207695_10000014674 | 264 |
| 660 | 3300025913 | Ga0207695_10001701 | Ga0207695_1000170135 | 264 |
| 661 | 3300025913 | Ga0207695_10126008 | Ga0207695_101260084 | 264 |
| 662 | 3300025914 | Ga0207671_10000663 | Ga0207671_1000066332 | 264 |
| 663 | 3300025914 | Ga0207671_10045318 | Ga0207671_100453185 | 264 |
| 664 | 3300025914 | Ga0207671_10046369 | Ga0207671_100463695 | 264 |
| 665 | 3300025914 | Ga0207671_10055028 | Ga0207671_100550283 | 264 |
| 666 | 3300025915 | Ga0207693_10000674 | Ga0207693_1000067418 | 264 |
| 667 | 3300025915 | Ga0207693_10001851 | Ga0207693_100018516 | 264 |
| 668 | 3300025915 | Ga0207693_10067664 | Ga0207693_100676642 | 264 |
| 669 | 3300025915 | Ga0207693_10071644 | Ga0207693_100716443 | 264 |
| 670 | 3300025916 | Ga0207663_10001588 | Ga0207663_100015884 | 264 |
| 671 | 3300025916 | Ga0207663_10180901 | Ga0207663_101809011 | 264 |
| 672 | 3300025916 | Ga0207663_10213684 | Ga0207663_102136842 | 264 |
| 673 | 3300025917 | Ga0207660_10049603 | Ga0207660_100496033 | 264 |
| 674 | 3300025917 | Ga0207660_10106305 | Ga0207660_101063052 | 264 |
| 675 | 3300025917 | Ga0207660_10108200 | Ga0207660_101082002 | 264 |
| 676 | 3300025917 | Ga0207660_10402205 | Ga0207660_104022052 | 264 |
| 677 | 3300025919 | Ga0207657_10001360 | Ga0207657_100013604 | 264 |
| 678 | 3300025919 | Ga0207657_10010706 | Ga0207657_100107063 | 264 |
| 679 | 3300025919 | Ga0207657_10022581 | Ga0207657_100225815 | 264 |
| 680 | 3300025919 | Ga0207657_10025657 | Ga0207657_100256571 | 264 |
| 681 | 3300025919 | Ga0207657_10103629 | Ga0207657_101036292 | 264 |
| 682 | 3300025919 | Ga0207657_10141242 | Ga0207657_101412422 | 264 |
| 683 | 3300025919 | Ga0207657_10268549 | Ga0207657_102685492 | 264 |
| 684 | 3300025920 | Ga0207649_10258166 | Ga0207649_102581662 | 264 |
| 685 | 3300025921 | Ga0207652_10001894 | Ga0207652_1000189411 | 264 |
| 686 | 3300025921 | Ga0207652_10011235 | Ga0207652_100112354 | 264 |
| 687 | 3300025921 | Ga0207652_10014967 | Ga0207652_100149676 | 264 |
| 688 | 3300025921 | Ga0207652_10049693 | Ga0207652_100496931 | 264 |
| 689 | 3300025921 | Ga0207652_10312129 | Ga0207652_103121291 | 264 |
| 690 | 3300025921 | Ga0207652_10499422 | Ga0207652_104994222 | 264 |
| 691 | 3300025922 | Ga0207646_10097938 | Ga0207646_100979382 | 264 |
| 692 | 3300025924 | Ga0207694_10010880 | Ga0207694_100108804 | 264 |
| 693 | 3300025925 | Ga0207650_10026446 | Ga0207650_100264462 | 264 |
| 694 | 3300025925 | Ga0207650_10049296 | Ga0207650_100492962 | 264 |
| 695 | 3300025925 | Ga0207650_10152134 | Ga0207650_101521342 | 264 |
| 696 | 3300025925 | Ga0207650_10381831 | Ga0207650_103818311 | 264 |
| 697 | 3300025926 | Ga0207659_10021567 | Ga0207659_100215673 | 264 |
| 698 | 3300025926 | Ga0207659_10118249 | Ga0207659_101182493 | 264 |
| 699 | 3300025926 | Ga0207659_10129623 | Ga0207659_101296232 | 264 |
| 700 | 3300025927 | Ga0207687_10000003 | Ga0207687_10000003158 | 264 |
| 701 | 3300025927 | Ga0207687_10003248 | Ga0207687_100032484 | 264 |
| 702 | 3300025927 | Ga0207687_10022444 | Ga0207687_100224441 | 264 |
| 703 | 3300025927 | Ga0207687_10052440 | Ga0207687_100524403 | 264 |
| 704 | 3300025927 | Ga0207687_10141134 | Ga0207687_101411342 | 264 |
| 705 | 3300025927 | Ga0207687_10233614 | Ga0207687_102336142 | 264 |
| 706 | 3300025928 | Ga0207700_10007259 | Ga0207700_100072597 | 264 |
| 707 | 3300025928 | Ga0207700_10074150 | Ga0207700_100741503 | 264 |
| 708 | 3300025928 | Ga0207700_10101643 | Ga0207700_101016433 | 264 |
| 709 | 3300025929 | Ga0207664_10037043 | Ga0207664_100370434 | 264 |
| 710 | 3300025929 | Ga0207664_10055294 | Ga0207664_100552943 | 264 |
| 711 | 3300025929 | Ga0207664_10211874 | Ga0207664_102118742 | 264 |
| 712 | 3300025929 | Ga0207664_10229713 | Ga0207664_102297131 | 264 |
| 713 | 3300025931 | Ga0207644_10010758 | Ga0207644_100107584 | 264 |
| 714 | 3300025932 | Ga0207690_10088745 | Ga0207690_100887452 | 264 |
| 715 | 3300025932 | Ga0207690_10458793 | Ga0207690_104587931 | 264 |
| 716 | 3300025933 | Ga0207706_10036474 | Ga0207706_100364744 | 264 |
| 717 | 3300025933 | Ga0207706_10069282 | Ga0207706_100692822 | 264 |
| 718 | 3300025933 | Ga0207706_10510997 | Ga0207706_105109972 | 264 |
| 719 | 3300025934 | Ga0207686_10156952 | Ga0207686_101569522 | 264 |
| 720 | 3300025935 | Ga0207709_10164127 | Ga0207709_101641272 | 264 |
| 721 | 3300025936 | Ga0207670_10001802 | Ga0207670_100018029 | 264 |
| 722 | 3300025936 | Ga0207670_10001926 | Ga0207670_100019263 | 264 |
| 723 | 3300025937 | Ga0207669_10018303 | Ga0207669_100183032 | 264 |
| 724 | 3300025938 | Ga0207704_10029068 | Ga0207704_100290684 | 264 |
| 725 | 3300025938 | Ga0207704_10030086 | Ga0207704_100300863 | 264 |
| 726 | 3300025938 | Ga0207704_10179751 | Ga0207704_101797512 | 264 |
| 727 | 3300025938 | Ga0207704_10468658 | Ga0207704_104686581 | 264 |
| 728 | 3300025938 | Ga0207704_10515052 | Ga0207704_105150521 | 264 |
| 729 | 3300025939 | Ga0207665_10000214 | Ga0207665_1000021425 | 264 |
| 730 | 3300025939 | Ga0207665_10033322 | Ga0207665_100333223 | 264 |
| 731 | 3300025939 | Ga0207665_10033533 | Ga0207665_100335332 | 264 |
| 732 | 3300025940 | Ga0207691_10003072 | Ga0207691_100030723 | 264 |
| 733 | 3300025940 | Ga0207691_10065199 | Ga0207691_100651993 | 264 |
| 734 | 3300025941 | Ga0207711_10040565 | Ga0207711_100405652 | 264 |
| 735 | 3300025942 | Ga0207689_10278977 | Ga0207689_102789772 | 264 |
| 736 | 3300025944 | Ga0207661_10016302 | Ga0207661_100163026 | 264 |
| 737 | 3300025944 | Ga0207661_10079882 | Ga0207661_100798822 | 264 |
| 738 | 3300025944 | Ga0207661_10156701 | Ga0207661_101567013 | 264 |
| 739 | 3300025944 | Ga0207661_10176576 | Ga0207661_101765762 | 264 |
| 740 | 3300025944 | Ga0207661_10224409 | Ga0207661_102244091 | 264 |
| 741 | 3300025944 | Ga0207661_10294037 | Ga0207661_102940373 | 264 |
| 742 | 3300025945 | Ga0207679_10284023 | Ga0207679_102840231 | 264 |
| 743 | 3300025945 | Ga0207679_10301114 | Ga0207679_103011142 | 264 |
| 744 | 3300025949 | Ga0207667_10003451 | Ga0207667_100034515 | 264 |
| 745 | 3300025949 | Ga0207667_10023687 | Ga0207667_100236874 | 264 |
| 746 | 3300025949 | Ga0207667_10026202 | Ga0207667_100262024 | 264 |
| 747 | 3300025949 | Ga0207667_10049551 | Ga0207667_100495513 | 264 |
| 748 | 3300025949 | Ga0207667_10131918 | Ga0207667_101319182 | 264 |
| 749 | 3300025949 | Ga0207667_10133252 | Ga0207667_101332522 | 264 |
| 750 | 3300025949 | Ga0207667_10318830 | Ga0207667_103188302 | 264 |
| 751 | 3300025949 | Ga0207667_10593511 | Ga0207667_105935111 | 264 |
| 752 | 3300025949 | Ga0207667_10692218 | Ga0207667_106922181 | 264 |
| 753 | 3300025960 | Ga0207651_10001255 | Ga0207651_1000125512 | 264 |
| 754 | 3300025960 | Ga0207651_10022078 | Ga0207651_100220781 | 264 |
| 755 | 3300025960 | Ga0207651_10113782 | Ga0207651_101137822 | 264 |
| 756 | 3300025960 | Ga0207651_10288804 | Ga0207651_102888042 | 264 |
| 757 | 3300025961 | Ga0207712_10004027 | Ga0207712_100040278 | 264 |
| 758 | 3300025961 | Ga0207712_10100054 | Ga0207712_101000544 | 264 |
| 759 | 3300025961 | Ga0207712_10234213 | Ga0207712_102342132 | 264 |
| 760 | 3300025972 | Ga0207668_10008276 | Ga0207668_100082763 | 264 |
| 761 | 3300025972 | Ga0207668_10044071 | Ga0207668_100440714 | 264 |
| 762 | 3300025972 | Ga0207668_10047201 | Ga0207668_100472012 | 264 |
| 763 | 3300025972 | Ga0207668_10330858 | Ga0207668_103308582 | 264 |
| 764 | 3300025981 | Ga0207640_10000958 | Ga0207640_100009589 | 264 |
| 765 | 3300025986 | Ga0207658_10086543 | Ga0207658_100865432 | 264 |
| 766 | 3300025986 | Ga0207658_10141078 | Ga0207658_101410782 | 264 |
| 767 | 3300026023 | Ga0207677_10000035 | Ga0207677_1000003564 | 264 |
| 768 | 3300026023 | Ga0207677_10058641 | Ga0207677_100586412 | 264 |
| 769 | 3300026035 | Ga0207703_10000046 | Ga0207703_1000004681 | 264 |
| 770 | 3300026035 | Ga0207703_10191991 | Ga0207703_101919913 | 264 |
| 771 | 3300026041 | Ga0207639_10010790 | Ga0207639_100107901 | 264 |
| 772 | 3300026041 | Ga0207639_10016673 | Ga0207639_100166732 | 264 |
| 773 | 3300026041 | Ga0207639_10457561 | Ga0207639_104575612 | 264 |
| 774 | 3300026067 | Ga0207678_10015383 | Ga0207678_100153833 | 264 |
| 775 | 3300026067 | Ga0207678_10029610 | Ga0207678_100296102 | 264 |
| 776 | 3300026067 | Ga0207678_10035630 | Ga0207678_100356303 | 264 |
| 777 | 3300026067 | Ga0207678_10051481 | Ga0207678_100514814 | 264 |
| 778 | 3300026067 | Ga0207678_10154120 | Ga0207678_101541202 | 264 |
| 779 | 3300026075 | Ga0207708_10000034 | Ga0207708_1000003468 | 264 |
| 780 | 3300026075 | Ga0207708_10002177 | Ga0207708_1000217711 | 264 |
| 781 | 3300026075 | Ga0207708_10019003 | Ga0207708_100190032 | 264 |
| 782 | 3300026075 | Ga0207708_10089051 | Ga0207708_100890513 | 264 |
| 783 | 3300026078 | Ga0207702_10000041 | Ga0207702_1000004113 | 264 |
| 784 | 3300026078 | Ga0207702_10041037 | Ga0207702_100410375 | 264 |
| 785 | 3300026078 | Ga0207702_10173471 | Ga0207702_101734712 | 264 |
| 786 | 3300026088 | Ga0207641_10100166 | Ga0207641_101001663 | 264 |
| 787 | 3300026089 | Ga0207648_10217306 | Ga0207648_102173063 | 264 |
| 788 | 3300026089 | Ga0207648_10311891 | Ga0207648_103118911 | 264 |
| 789 | 3300026095 | Ga0207676_10000013 | Ga0207676_10000013283 | 264 |
| 790 | 3300026095 | Ga0207676_10165996 | Ga0207676_101659962 | 264 |
| 791 | 3300026095 | Ga0207676_10277754 | Ga0207676_102777541 | 264 |
| 792 | 3300026116 | Ga0207674_10004439 | Ga0207674_100044398 | 264 |
| 793 | 3300026116 | Ga0207674_10006751 | Ga0207674_100067515 | 264 |
| 794 | 3300026116 | Ga0207674_10008394 | Ga0207674_100083945 | 264 |
| 795 | 3300026116 | Ga0207674_10024824 | Ga0207674_100248244 | 264 |
| 796 | 3300026116 | Ga0207674_10043139 | Ga0207674_100431394 | 264 |
| 797 | 3300026116 | Ga0207674_10054103 | Ga0207674_100541033 | 264 |
| 798 | 3300026116 | Ga0207674_10603900 | Ga0207674_106039002 | 264 |
| 799 | 3300026118 | Ga0207675_100000058 | Ga0207675_1000000582 | 264 |
| 800 | 3300026118 | Ga0207675_100015761 | Ga0207675_1000157614 | 264 |
| 801 | 3300026118 | Ga0207675_100099716 | Ga0207675_1000997163 | 264 |
| 802 | 3300026118 | Ga0207675_100112893 | Ga0207675_1001128934 | 264 |
| 803 | 3300026118 | Ga0207675_100224130 | Ga0207675_1002241303 | 264 |
| 804 | 3300026121 | Ga0207683_10037653 | Ga0207683_100376534 | 264 |
| 805 | 3300026121 | Ga0207683_10038663 | Ga0207683_100386632 | 264 |
| 806 | 3300026121 | Ga0207683_10060645 | Ga0207683_100606452 | 264 |
| 807 | 3300026121 | Ga0207683_10067429 | Ga0207683_100674293 | 264 |
| 808 | 3300026142 | Ga0207698_10000882 | Ga0207698_100008822 | 264 |
| 809 | 3300026142 | Ga0207698_10016150 | Ga0207698_100161503 | 264 |
| 810 | 3300026142 | Ga0207698_10024459 | Ga0207698_100244592 | 264 |
| 811 | 3300026142 | Ga0207698_10035640 | Ga0207698_100356403 | 264 |
| 812 | 3300026142 | Ga0207698_10097212 | Ga0207698_100972123 | 264 |
| 813 | 3300026142 | Ga0207698_10106270 | Ga0207698_101062703 | 264 |
| 814 | 3300026142 | Ga0207698_10355920 | Ga0207698_103559202 | 264 |
| 815 | 3300027296 | Ga0209389_1000023 | Ga0209389_100002379 | 264 |
| 816 | 3300027357 | Ga0209589_1000010 | Ga0209589_100001080 | 264 |
| 817 | 3300027361 | Ga0209489_100011 | Ga0209489_100011156 | 264 |
| 818 | 3300027671 | Ga0209588_1017474 | Ga0209588_10174742 | 264 |
| 819 | 3300027866 | Ga0209813_10006099 | Ga0209813_100060993 | 264 |
| 820 | 3300027907 | Ga0207428_10000061 | Ga0207428_1000006113 | 264 |
| 821 | 3300027907 | Ga0207428_10003490 | Ga0207428_100034903 | 264 |
| 822 | 3300027907 | Ga0207428_10064444 | Ga0207428_100644442 | 264 |
| 823 | 3300028379 | Ga0268266_10013121 | Ga0268266_100131212 | 264 |
| 824 | 3300028379 | Ga0268266_10016287 | Ga0268266_100162873 | 264 |
| 825 | 3300028379 | Ga0268266_10054094 | Ga0268266_100540943 | 264 |
| 826 | 3300028379 | Ga0268266_10385033 | Ga0268266_103850331 | 264 |
| 827 | 3300028379 | Ga0268266_10619450 | Ga0268266_106194501 | 264 |
| 828 | 3300028380 | Ga0268265_10000170 | Ga0268265_1000017060 | 264 |
| 829 | 3300028380 | Ga0268265_10002176 | Ga0268265_100021768 | 264 |
| 830 | 3300028381 | Ga0268264_10000093 | Ga0268264_1000009312 | 264 |
| 831 | 3300028381 | Ga0268264_10014852 | Ga0268264_100148525 | 264 |
| 832 | 3300028381 | Ga0268264_10112031 | Ga0268264_101120311 | 264 |
| 833 | 3300028381 | Ga0268264_10295862 | Ga0268264_102958622 | 264 |
| 834 | 3300028563 | Ga0265319_1095150 | Ga0265319_10951501 | 264 |
| 835 | 3300028573 | Ga0265334_10027999 | Ga0265334_100279992 | 264 |
| 836 | 3300028653 | Ga0265323_10003068 | Ga0265323_100030683 | 264 |
| 837 | 3300028666 | Ga0265336_10000859 | Ga0265336_1000085914 | 264 |
| 838 | 3300028666 | Ga0265336_10003744 | Ga0265336_100037442 | 264 |
| 839 | 3300028786 | Ga0307517_10000085 | Ga0307517_1000008538 | 264 |
| 840 | 3300028786 | Ga0307517_10070050 | Ga0307517_100700503 | 264 |
| 841 | 3300028786 | Ga0307517_10082837 | Ga0307517_100828373 | 264 |
| 842 | 3300028786 | Ga0307517_10212282 | Ga0307517_102122822 | 264 |
| 843 | 3300028794 | Ga0307515_10011214 | Ga0307515_100112145 | 264 |
| 844 | 3300028794 | Ga0307515_10116112 | Ga0307515_101161122 | 264 |
| 845 | 3300028800 | Ga0265338_10000013 | Ga0265338_10000013371 | 264 |
| 846 | 3300028800 | Ga0265338_10011715 | Ga0265338_100117158 | 264 |
| 847 | 3300028800 | Ga0265338_10020201 | Ga0265338_100202013 | 264 |
| 848 | 3300029957 | Ga0265324_10000030 | Ga0265324_10000030125 | 264 |
| 849 | 3300029957 | Ga0265324_10012333 | Ga0265324_100123332 | 264 |
| 850 | 3300029957 | Ga0265324_10118916 | Ga0265324_101189161 | 264 |
| 851 | 3300030521 | Ga0307511_10141145 | Ga0307511_101411452 | 264 |
| 852 | 3300031235 | Ga0265330_10006124 | Ga0265330_100061244 | 264 |
| 853 | 3300031239 | Ga0265328_10000120 | Ga0265328_100001203 | 264 |
| 854 | 3300031239 | Ga0265328_10056618 | Ga0265328_100566182 | 264 |
| 855 | 3300031240 | Ga0265320_10001892 | Ga0265320_100018925 | 264 |
| 856 | 3300031241 | Ga0265325_10000289 | Ga0265325_1000028912 | 264 |
| 857 | 3300031241 | Ga0265325_10004960 | Ga0265325_1000496010 | 264 |
| 858 | 3300031241 | Ga0265325_10016721 | Ga0265325_100167214 | 264 |
| 859 | 3300031249 | Ga0265339_10001605 | Ga0265339_1000160511 | 264 |
| 860 | 3300031249 | Ga0265339_10013486 | Ga0265339_100134864 | 264 |
| 861 | 3300031249 | Ga0265339_10019139 | Ga0265339_100191394 | 264 |
| 862 | 3300031249 | Ga0265339_10082151 | Ga0265339_100821512 | 264 |
| 863 | 3300031249 | Ga0265339_10197389 | Ga0265339_101973892 | 264 |
| 864 | 3300031251 | Ga0265327_10038302 | Ga0265327_100383022 | 264 |
| 865 | 3300031251 | Ga0265327_10070456 | Ga0265327_100704562 | 264 |
| 866 | 3300031344 | Ga0265316_10142157 | Ga0265316_101421572 | 264 |
| 867 | 3300031456 | Ga0307513_10028716 | Ga0307513_100287164 | 264 |
| 868 | 3300031507 | Ga0307509_10086802 | Ga0307509_100868023 | 264 |
| 869 | 3300031548 | Ga0307408_100000183 | Ga0307408_10000018312 | 264 |
| 870 | 3300031548 | Ga0307408_100546737 | Ga0307408_1005467372 | 264 |
| 871 | 3300031548 | Ga0307408_100557376 | Ga0307408_1005573761 | 264 |
| 872 | 3300031595 | Ga0265313_10000644 | Ga0265313_1000064427 | 264 |
| 873 | 3300031595 | Ga0265313_10002595 | Ga0265313_1000259511 | 264 |
| 874 | 3300031595 | Ga0265313_10011673 | Ga0265313_100116736 | 264 |
| 875 | 3300031616 | Ga0307508_10053920 | Ga0307508_100539202 | 264 |
| 876 | 3300031616 | Ga0307508_10056249 | Ga0307508_100562491 | 264 |
| 877 | 3300031711 | Ga0265314_10024736 | Ga0265314_100247364 | 264 |
| 878 | 3300031711 | Ga0265314_10034452 | Ga0265314_100344523 | 264 |
| 879 | 3300031711 | Ga0265314_10052431 | Ga0265314_100524315 | 264 |
| 880 | 3300031712 | Ga0265342_10005779 | Ga0265342_100057791 | 264 |
| 881 | 3300031712 | Ga0265342_10135373 | Ga0265342_101353732 | 264 |
| 882 | 3300031727 | Ga0316576_10052362 | Ga0316576_100523621 | 264 |
| 883 | 3300031727 | Ga0316576_10121529 | Ga0316576_101215292 | 264 |
| 884 | 3300031728 | Ga0316578_10006597 | Ga0316578_100065975 | 264 |
| 885 | 3300031730 | Ga0307516_10000683 | Ga0307516_1000068321 | 264 |
| 886 | 3300031730 | Ga0307516_10025519 | Ga0307516_100255193 | 264 |
| 887 | 3300031730 | Ga0307516_10025796 | Ga0307516_100257962 | 264 |
| 888 | 3300031730 | Ga0307516_10033423 | Ga0307516_100334232 | 264 |
| 889 | 3300031730 | Ga0307516_10119591 | Ga0307516_101195914 | 264 |
| 890 | 3300031730 | Ga0307516_10226214 | Ga0307516_102262142 | 264 |
| 891 | 3300031730 | Ga0307516_10357482 | Ga0307516_103574822 | 264 |
| 892 | 3300031733 | Ga0316577_10012248 | Ga0316577_100122483 | 264 |
| 893 | 3300031852 | Ga0307410_10124823 | Ga0307410_101248231 | 264 |
| 894 | 3300031901 | Ga0307406_10586094 | Ga0307406_105860942 | 264 |
| 895 | 3300031901 | Ga0307406_10605590 | Ga0307406_106055901 | 264 |
| 896 | 3300031903 | Ga0307407_10063330 | Ga0307407_100633302 | 264 |
| 897 | 3300031911 | Ga0307412_10000004 | Ga0307412_10000004249 | 264 |
| 898 | 3300031911 | Ga0307412_10043611 | Ga0307412_100436112 | 264 |
| 899 | 3300031911 | Ga0307412_10128262 | Ga0307412_101282622 | 264 |
| 900 | 3300031995 | Ga0307409_100034390 | Ga0307409_1000343902 | 264 |
| 901 | 3300031995 | Ga0307409_100226263 | Ga0307409_1002262633 | 264 |
| 902 | 3300031995 | Ga0307409_100381920 | Ga0307409_1003819202 | 264 |
| 903 | 3300031995 | Ga0307409_100877577 | Ga0307409_1008775772 | 264 |
| 904 | 3300032002 | Ga0307416_100104122 | Ga0307416_1001041224 | 264 |
| 905 | 3300032002 | Ga0307416_100379893 | Ga0307416_1003798932 | 264 |
| 906 | 3300032004 | Ga0307414_10000313 | Ga0307414_1000031328 | 264 |
| 907 | 3300032004 | Ga0307414_10213170 | Ga0307414_102131702 | 264 |
| 908 | 3300032005 | Ga0307411_10020733 | Ga0307411_100207333 | 264 |
| 909 | 3300032005 | Ga0307411_10075747 | Ga0307411_100757473 | 264 |
| 910 | 3300032126 | Ga0307415_100012029 | Ga0307415_1000120296 | 264 |
| 911 | 3300032126 | Ga0307415_100326991 | Ga0307415_1003269911 | 264 |
| 912 | 3300033179 | Ga0307507_10077207 | Ga0307507_100772072 | 264 |
| 913 | 3300033180 | Ga0307510_10009700 | Ga0307510_100097007 | 264 |
| 914 | 3300033180 | Ga0307510_10038953 | Ga0307510_100389537 | 264 |
| 915 | 3300035084 | Ga0373928_0023913 | Ga0373928_0023913_406_1200 | 264 |
| 916 | 3300035085 | Ga0373929_0016201 | Ga0373929_0016201_643_1437 | 264 |
| 917 | 3300035086 | Ga0373934_0092763 | Ga0373934_0092763_398_1192 | 264 |
| 918 | 3300035090 | Ga0373949_0057431 | Ga0373949_0057431_39_833 | 264 |
| 919 | 3300035092 | Ga0373952_0004006 | Ga0373952_0004006_1109_1903 | 264 |
| 920 | 3300035113 | Ga0373936_0119026 | Ga0373936_0119026_112_1035 | 264 |
| 921 | 3300035114 | Ga0373939_0042943 | Ga0373939_0042943_90_884 | 264 |
| 922 | 3300035116 | Ga0373945_0023726 | Ga0373945_0023726_657_1580 | 264 |
| 923 | 3300035117 | Ga0373953_0015389 | Ga0373953_0015389_1608_2402 | 264 |
| 924 | 3300035118 | Ga0373954_0046188 | Ga0373954_0046188_398_1192 | 264 |
| 925 | 3300035119 | Ga0373956_0166097 | Ga0373956_0166097_96_890 | 264 |
| 926 | 3300035170 | Ga0373943_0026562 | Ga0373943_0026562_607_1530 | 264 |
| 927 | 3300035171 | Ga0373946_0014317 | Ga0373946_0014317_1644_2438 | 264 |
| 928 | 3300035171 | Ga0373946_0092576 | Ga0373946_0092576_222_1016 | 264 |
| 929 | 3300035172 | Ga0373955_0011011 | Ga0373955_0011011_2847_3641 | 264 |
| 930 | 3300035172 | Ga0373955_0067511 | Ga0373955_0067511_1131_1925 | 264 |
| 931 | 3300035172 | Ga0373955_0363132 | Ga0373955_0363132_15_809 | 264 |
| 932 | 3300035207 | Ga0373942_0027692 | Ga0373942_0027692_450_1244 | 264 |
| 933 | 3300035241 | Ga0373961_0004146 | Ga0373961_0004146_1085_1879 | 264 |
| 934 | 3300035241 | Ga0373961_0038190 | Ga0373961_0038190_143_937 | 264 |
| 935 | 3300035241 | Ga0373961_0042104 | Ga0373961_0042104_322_1116 | 264 |
| 936 | 3300035242 | Ga0373962_0007004 | Ga0373962_0007004_338_1132 | 264 |
| 937 | 3300035398 | Ga0316574_0008438 | Ga0316574_0008438_1226_2020 | 264 |
| 938 | 3300035398 | Ga0316574_0074147 | Ga0316574_0074147_749_1543 | 264 |
| 939 | 3300035398 | Ga0316574_0240295 | Ga0316574_0240295_252_1046 | 264 |
| 940 | 3300035410 | Ga0373924_0033016 | Ga0373924_0033016_442_1365 | 264 |
| 941 | 3300035410 | Ga0373924_0041591 | Ga0373924_0041591_793_1587 | 264 |
| 942 | 3300035691 | Ga0373931_0000311 | Ga0373931_0000311_3634_4428 | 264 |
| 943 | 3300035691 | Ga0373931_0001895 | Ga0373931_0001895_844_1638 | 264 |
| 944 | 3300035691 | Ga0373931_0002367 | Ga0373931_0002367_1219_2013 | 264 |
| 945 | 3300035691 | Ga0373931_0015481 | Ga0373931_0015481_2116_2910 | 264 |
| 946 | 3300035691 | Ga0373931_0075912 | Ga0373931_0075912_185_979 | 264 |
| 947 | 3300035692 | Ga0373935_0003068 | Ga0373935_0003068_8566_9489 | 264 |
| 948 | 3300035692 | Ga0373935_0080381 | Ga0373935_0080381_811_1605 | 264 |
| 949 | 3300035692 | Ga0373935_0211476 | Ga0373935_0211476_325_1119 | 264 |
| 950 | 3300035692 | Ga0373935_0270836 | Ga0373935_0270836_127_921 | 264 |
| 951 | 3300035695 | Ga0373927_0004108 | Ga0373927_0004108_3714_4637 | 264 |
| 952 | 3300035695 | Ga0373927_0005360 | Ga0373927_0005360_4851_5645 | 264 |
| 953 | 3300035695 | Ga0373927_0052572 | Ga0373927_0052572_578_1372 | 264 |
| 954 | 3300035724 | Ga0373933_0000933 | Ga0373933_0000933_8082_8876 | 264 |
| 955 | 3300035724 | Ga0373933_0061032 | Ga0373933_0061032_655_1449 | 264 |
| 956 | 3300035725 | Ga0373947_0006080 | Ga0373947_0006080_1838_2761 | 264 |
| 957 | 3300035725 | Ga0373947_0008409 | Ga0373947_0008409_3179_3973 | 264 |
| 958 | 3300036401 | Ga0373937_0045613 | Ga0373937_0045613_703_1626 | 264 |
| 959 | 3300036401 | Ga0373937_0088430 | Ga0373937_0088430_1708_2502 | 264 |
| 960 | 3300036401 | Ga0373937_0121480 | Ga0373937_0121480_1093_1887 | 264 |
| 961 | 3300036401 | Ga0373937_0168020 | Ga0373937_0168020_177_971 | 264 |
| 962 | 3300036712 | Ga0316584_0091839 | Ga0316584_0091839_571_1365 | 264 |
| 963 | 3300037068 | Ga0373925_0028943 | Ga0373925_0028943_320_1243 | 264 |
| 964 | 3300037068 | Ga0373925_0068998 | Ga0373925_0068998_163_957 | 264 |
| 965 | 3300037068 | Ga0373925_0284042 | Ga0373925_0284042_324_1118 | 264 |
| 966 | 3300037068 | Ga0373925_0501794 | Ga0373925_0501794_62_856 | 264 |
| 967 | 3300037068 | Ga0373925_0549490 | Ga0373925_0549490_39_833 | 264 |
| 968 | 3300037312 | Ga0395899_0005004 | Ga0395899_0005004_5870_6664 | 264 |
| 969 | 3300037418 | Ga0395900_0000126 | Ga0395900_0000126_59819_60613 | 264 |
| 970 | 3300037418 | Ga0395900_0186497 | Ga0395900_0186497_26_829 | 264 |
| 971 | 3300037418 | Ga0395900_0255536 | Ga0395900_0255536_640_1434 | 264 |
| 972 | 3300037466 | Ga0395898_0031059 | Ga0395898_0031059_3744_4538 | 264 |
| 973 | 3300037466 | Ga0395898_0193692 | Ga0395898_0193692_911_1705 | 264 |
| 974 | 3300037471 | Ga0395905_0001098 | Ga0395905_0001098_31627_32421 | 264 |
| 975 | 3300038443 | Ga0395901_0000249 | Ga0395901_0000249_59799_60593 | 264 |
| 976 | 3300038443 | Ga0395901_0046475 | Ga0395901_0046475_2370_3173 | 264 |
| 977 | 3300038443 | Ga0395901_0068530 | Ga0395901_0068530_1592_2386 | 264 |
| 978 | 3300038443 | Ga0395901_0322404 | Ga0395901_0322404_520_1314 | 264 |
| 979 | 3300038443 | Ga0395901_0460761 | Ga0395901_0460761_230_1024 | 264 |
| 980 | 3300039437 | Ga0436365_0021051 | Ga0436365_0021051_229_1023 | 264 |
| 981 | 3300039437 | Ga0436365_0523062 | Ga0436365_0523062_2989_3783 | 264 |
| 982 | 3300039437 | Ga0436365_1782545 | Ga0436365_1782545_2085_2879 | 264 |
| 983 | 3300039447 | Ga0436361_0728889 | Ga0436361_0728889_880_1698 | 264 |
| 984 | 3300039450 | Ga0436363_0751650 | Ga0436363_0751650_90_884 | 264 |
| 985 | 3300039453 | Ga0436362_0128160 | Ga0436362_0128160_4483_5277 | 264 |
| 986 | 3300041411 | Ga0439466_0069963 | Ga0439466_0069963_189_983 | 264 |
| 987 | 3300041413 | Ga0439465_0088166 | Ga0439465_0088166_91_885 | 264 |
| 988 | 3300041512 | Ga0451853_2754853 | Ga0451853_2754853_1851_2645 | 264 |
| 989 | 3300041999 | Ga0439433_0009247 | Ga0439433_0009247_456_1250 | 264 |
| 990 | 3300042011 | Ga0439454_004785 | Ga0439454_004785_149_1003 | 264 |
| 991 | 3300042156 | Ga0439446_0107479 | Ga0439446_0107479_71_865 | 264 |
| 992 | 3300042876 | Ga0451577_0000339 | Ga0451577_0000339_70108_70902 | 264 |
| 993 | 3300042876 | Ga0451577_0002271 | Ga0451577_0002271_11946_12740 | 264 |
| 994 | 3300044658 | Ga0466972_0000185 | Ga0466972_0000185_47518_48312 | 264 |
| 995 | 3300044658 | Ga0466972_0134507 | Ga0466972_0134507_89_883 | 264 |
| 996 | 3300044672 | Ga0466982_0000003 | Ga0466982_0000003_73742_74536 | 264 |
| 997 | 3300044673 | Ga0453683_0006567 | Ga0453683_0006567_6634_7428 | 264 |
| 998 | 3300044673 | Ga0453683_0352300 | Ga0453683_0352300_98_892 | 264 |
| 999 | 3300044684 | Ga0466966_0003932 | Ga0466966_0003932_6587_7381 | 264 |
| 1000 | 3300044684 | Ga0466966_0072786 | Ga0466966_0072786_769_1563 | 264 |
| 1001 | 3300044706 | Ga0466964_0001690 | Ga0466964_0001690_822_1616 | 264 |
| 1002 | 3300044712 | Ga0453684_0000063 | Ga0453684_0000063_8620_9414 | 264 |
| 1003 | 3300044712 | Ga0453684_0000065 | Ga0453684_0000065_201277_202071 | 264 |
| 1004 | 3300044712 | Ga0453684_0000369 | Ga0453684_0000369_166406_167200 | 264 |
| 1005 | 3300044712 | Ga0453684_0000677 | Ga0453684_0000677_94606_95400 | 264 |
| 1006 | 3300044712 | Ga0453684_0000846 | Ga0453684_0000846_22110_22904 | 264 |
| 1007 | 3300044712 | Ga0453684_0001472 | Ga0453684_0001472_62496_63290 | 264 |
| 1008 | 3300044712 | Ga0453684_0008351 | Ga0453684_0008351_15646_16440 | 264 |
| 1009 | 3300044712 | Ga0453684_0056656 | Ga0453684_0056656_1724_2584 | 264 |
| 1010 | 3300044712 | Ga0453684_0300239 | Ga0453684_0300239_577_1371 | 264 |
| 1011 | 3300044719 | Ga0466971_0012312 | Ga0466971_0012312_1137_1931 | 264 |
| 1012 | 3300044735 | Ga0466968_0001743 | Ga0466968_0001743_5493_6287 | 264 |
| 1013 | 3300044765 | Ga0466970_0014536 | Ga0466970_0014536_1374_2168 | 264 |
| 1014 | 3300045051 | Ga0451576_0000175 | Ga0451576_0000175_80861_81655 | 264 |
| 1015 | 3300045051 | Ga0451576_0002720 | Ga0451576_0002720_14985_15779 | 264 |
| 1016 | 3300045051 | Ga0451576_0005625 | Ga0451576_0005625_8061_8855 | 264 |
| 1017 | 3300045051 | Ga0451576_0013554 | Ga0451576_0013554_4834_5628 | 264 |
| 1018 | 3300045051 | Ga0451576_0108803 | Ga0451576_0108803_554_1348 | 264 |
| 1019 | 3300045976 | Ga0466967_0781313 | Ga0466967_0781313_59_853 | 264 |
| 1020 | 3300046454 | Ga0495592_0006658 | Ga0495592_0006658_1204_2127 | 264 |
| 1021 | 3300046455 | Ga0495603_0000064 | Ga0495603_0000064_9946_10869 | 264 |
| 1022 | 3300046455 | Ga0495603_0023901 | Ga0495603_0023901_609_1403 | 264 |
| 1023 | 3300046455 | Ga0495603_0029475 | Ga0495603_0029475_727_1521 | 264 |
| 1024 | 3300046459 | Ga0495629_0001385 | Ga0495629_0001385_8505_9428 | 264 |
| 1025 | 3300046459 | Ga0495629_0056265 | Ga0495629_0056265_308_1102 | 264 |
| 1026 | 3300046459 | Ga0495629_0095759 | Ga0495629_0095759_436_1230 | 264 |
| 1027 | 3300046459 | Ga0495629_0139921 | Ga0495629_0139921_149_943 | 264 |
| 1028 | 3300046459 | Ga0495629_0381925 | Ga0495629_0381925_137_931 | 264 |
| 1029 | 3300046460 | Ga0495638_0007547 | Ga0495638_0007547_5511_6305 | 264 |
| 1030 | 3300046460 | Ga0495638_0021678 | Ga0495638_0021678_3170_3964 | 264 |
| 1031 | 3300046460 | Ga0495638_0086312 | Ga0495638_0086312_231_1025 | 264 |
| 1032 | 3300046461 | Ga0495641_0005307 | Ga0495641_0005307_4553_5476 | 264 |
| 1033 | 3300046462 | Ga0495651_0056086 | Ga0495651_0056086_665_1459 | 264 |
| 1034 | 3300046463 | Ga0495653_0332515 | Ga0495653_0332515_28_822 | 264 |
| 1035 | 3300046471 | Ga0495650_0063228 | Ga0495650_0063228_21_815 | 264 |
| 1036 | 3300046472 | Ga0495580_0006847 | Ga0495580_0006847_991_1914 | 264 |
| 1037 | 3300046472 | Ga0495580_0190002 | Ga0495580_0190002_68_862 | 264 |
| 1038 | 3300046473 | Ga0495582_0000173 | Ga0495582_0000173_5990_6913 | 264 |
| 1039 | 3300046473 | Ga0495582_0149179 | Ga0495582_0149179_265_1059 | 264 |
| 1040 | 3300046475 | Ga0495639_0000218 | Ga0495639_0000218_3777_4700 | 264 |
| 1041 | 3300046475 | Ga0495639_0085081 | Ga0495639_0085081_242_1036 | 264 |
| 1042 | 3300046475 | Ga0495639_0189848 | Ga0495639_0189848_145_939 | 264 |
| 1043 | 3300046475 | Ga0495639_0265184 | Ga0495639_0265184_32_826 | 264 |
| 1044 | 3300046477 | Ga0495664_0041556 | Ga0495664_0041556_297_1091 | 264 |
| 1045 | 3300046477 | Ga0495664_0045785 | Ga0495664_0045785_1785_2579 | 264 |
| 1046 | 3300046477 | Ga0495664_0078800 | Ga0495664_0078800_904_1698 | 264 |
| 1047 | 3300046477 | Ga0495664_0134197 | Ga0495664_0134197_62_856 | 264 |
| 1048 | 3300046491 | Ga0495584_0189261 | Ga0495584_0189261_161_955 | 264 |
| 1049 | 3300046492 | Ga0495585_0105649 | Ga0495585_0105649_250_1044 | 264 |
| 1050 | 3300046499 | Ga0495594_0000590 | Ga0495594_0000590_8026_8949 | 264 |
| 1051 | 3300046506 | Ga0495583_0138352 | Ga0495583_0138352_189_983 | 264 |
| 1052 | 3300046507 | Ga0495606_0000976 | Ga0495606_0000976_23823_24617 | 264 |
| 1053 | 3300046507 | Ga0495606_0040906 | Ga0495606_0040906_102_896 | 264 |
| 1054 | 3300046507 | Ga0495606_0084562 | Ga0495606_0084562_1135_1929 | 264 |
| 1055 | 3300046507 | Ga0495606_0189410 | Ga0495606_0189410_153_947 | 264 |
| 1056 | 3300046513 | Ga0495616_0152310 | Ga0495616_0152310_104_898 | 264 |
| 1057 | 3300046516 | Ga0495628_0020280 | Ga0495628_0020280_4595_5389 | 264 |
| 1058 | 3300046516 | Ga0495628_0123368 | Ga0495628_0123368_822_1616 | 264 |
| 1059 | 3300046517 | Ga0495630_0000613 | Ga0495630_0000613_7965_8888 | 264 |
| 1060 | 3300046517 | Ga0495630_0161775 | Ga0495630_0161775_64_858 | 264 |
| 1061 | 3300046517 | Ga0495630_0210794 | Ga0495630_0210794_119_913 | 264 |
| 1062 | 3300046518 | Ga0495631_0025561 | Ga0495631_0025561_1689_2483 | 264 |
| 1063 | 3300046518 | Ga0495631_0102424 | Ga0495631_0102424_222_1016 | 264 |
| 1064 | 3300046519 | Ga0495632_0061385 | Ga0495632_0061385_379_1173 | 264 |
| 1065 | 3300046523 | Ga0495644_0083683 | Ga0495644_0083683_377_1171 | 264 |
| 1066 | 3300046524 | Ga0495648_0003170 | Ga0495648_0003170_6837_7631 | 264 |
| 1067 | 3300046524 | Ga0495648_0006291 | Ga0495648_0006291_6297_7091 | 264 |
| 1068 | 3300046524 | Ga0495648_0010776 | Ga0495648_0010776_544_1338 | 264 |
| 1069 | 3300046524 | Ga0495648_0060459 | Ga0495648_0060459_92_886 | 264 |
| 1070 | 3300046526 | Ga0495666_0015057 | Ga0495666_0015057_329_1123 | 264 |
| 1071 | 3300046528 | Ga0495642_0086051 | Ga0495642_0086051_52_846 | 264 |
| 1072 | 3300046529 | Ga0495652_0050312 | Ga0495652_0050312_517_1440 | 264 |
| 1073 | 3300046529 | Ga0495652_0106248 | Ga0495652_0106248_833_1627 | 264 |
| 1074 | 3300046529 | Ga0495652_0200960 | Ga0495652_0200960_58_852 | 264 |
| 1075 | 3300046530 | Ga0495654_0068911 | Ga0495654_0068911_363_1157 | 264 |
| 1076 | 3300046531 | Ga0495665_0000531 | Ga0495665_0000531_4028_4951 | 264 |
| 1077 | 3300046533 | Ga0495640_0001572 | Ga0495640_0001572_14289_15212 | 264 |
| 1078 | 3300046533 | Ga0495640_0173760 | Ga0495640_0173760_273_1067 | 264 |
| 1079 | 3300046533 | Ga0495640_0266369 | Ga0495640_0266369_177_971 | 264 |
| 1080 | 3300046536 | Ga0495587_0089108 | Ga0495587_0089108_654_1448 | 264 |
| 1081 | 3300046537 | Ga0495598_0022585 | Ga0495598_0022585_156_950 | 264 |
| 1082 | 3300046543 | Ga0495645_0017708 | Ga0495645_0017708_62_856 | 264 |
| 1083 | 3300046543 | Ga0495645_0200435 | Ga0495645_0200435_49_843 | 264 |
| 1084 | 3300046557 | Ga0495622_0004472 | Ga0495622_0004472_3915_4709 | 264 |
| 1085 | 3300046557 | Ga0495622_0007156 | Ga0495622_0007156_2983_3777 | 264 |
| 1086 | 3300046559 | Ga0495667_0011222 | Ga0495667_0011222_193_987 | 264 |
| 1087 | 3300046559 | Ga0495667_0185640 | Ga0495667_0185640_148_942 | 264 |
| 1088 | 3300046615 | Ga0495656_0005268 | Ga0495656_0005268_1206_2000 | 264 |
| 1089 | 3300046616 | Ga0495668_0044002 | Ga0495668_0044002_28_822 | 264 |
| 1090 | 3300046642 | Ga0495634_0005581 | Ga0495634_0005581_7893_8816 | 264 |
| 1091 | 3300046648 | Ga0495611_0101743 | Ga0495611_0101743_102_896 | 264 |
| 1092 | 3300046660 | Ga0495625_0026116 | Ga0495625_0026116_1325_2119 | 264 |
| 1093 | 3300046660 | Ga0495625_0245479 | Ga0495625_0245479_308_1102 | 264 |
| 1094 | 3300046660 | Ga0495625_0292825 | Ga0495625_0292825_195_989 | 264 |
| 1095 | 3300046663 | Ga0495635_0125225 | Ga0495635_0125225_853_1647 | 264 |
| 1096 | 3300046664 | Ga0495659_0006815 | Ga0495659_0006815_1478_2272 | 264 |
| 1097 | 3300046665 | Ga0495661_0071445 | Ga0495661_0071445_167_961 | 264 |
| 1098 | 3300046674 | Ga0495588_0022423 | Ga0495588_0022423_1889_2812 | 264 |
| 1099 | 3300046674 | Ga0495588_0025243 | Ga0495588_0025243_625_1419 | 264 |
| 1100 | 3300046674 | Ga0495588_0043652 | Ga0495588_0043652_494_1288 | 264 |
| 1101 | 3300046675 | Ga0495657_0067110 | Ga0495657_0067110_654_1448 | 264 |
| 1102 | 3300046678 | Ga0495599_0091836 | Ga0495599_0091836_163_957 | 264 |
| 1103 | 3300046679 | Ga0495623_0005573 | Ga0495623_0005573_3369_4163 | 264 |
| 1104 | 3300046679 | Ga0495623_0015377 | Ga0495623_0015377_1709_2503 | 264 |
| 1105 | 3300046679 | Ga0495623_0039786 | Ga0495623_0039786_1351_2145 | 264 |
| 1106 | 3300046679 | Ga0495623_0127850 | Ga0495623_0127850_291_1085 | 264 |
| 1107 | 3300046680 | Ga0495646_0007737 | Ga0495646_0007737_2283_3206 | 264 |
| 1108 | 3300046680 | Ga0495646_0018063 | Ga0495646_0018063_739_1533 | 264 |
| 1109 | 3300046680 | Ga0495646_0177824 | Ga0495646_0177824_178_972 | 264 |
| 1110 | 3300046681 | Ga0495647_0001441 | Ga0495647_0001441_2889_3812 | 264 |
| 1111 | 3300046681 | Ga0495647_0189555 | Ga0495647_0189555_79_873 | 264 |
| 1112 | 3300046683 | Ga0495658_0001201 | Ga0495658_0001201_4640_5563 | 264 |
| 1113 | 3300046683 | Ga0495658_0121574 | Ga0495658_0121574_248_1042 | 264 |
| 1114 | 3300046683 | Ga0495658_0173644 | Ga0495658_0173644_268_1062 | 264 |
| 1115 | 3300046683 | Ga0495658_0194425 | Ga0495658_0194425_440_1234 | 264 |
| 1116 | 3300046684 | Ga0495669_0000675 | Ga0495669_0000675_5860_6654 | 264 |
| 1117 | 3300046689 | Ga0495613_0004213 | Ga0495613_0004213_9204_10127 | 264 |
| 1118 | 3300046689 | Ga0495613_0022119 | Ga0495613_0022119_1162_1956 | 264 |
| 1119 | 3300046690 | Ga0495624_0005853 | Ga0495624_0005853_3319_4242 | 264 |
| 1120 | 3300046691 | Ga0495670_0012092 | Ga0495670_0012092_1338_2132 | 264 |
| 1121 | 3300046694 | Ga0495649_0192146 | Ga0495649_0192146_177_971 | 264 |
| 1122 | 3300046809 | Ga0495600_0134287 | Ga0495600_0134287_637_1431 | 264 |
| 1123 | 3300047315 | Ga0495581_0000015 | Ga0495581_0000015_49915_50838 | 264 |
| 1124 | 3300047317 | Ga0495604_0007695 | Ga0495604_0007695_438_1232 | 264 |
| 1125 | 3300047317 | Ga0495604_0184641 | Ga0495604_0184641_444_1238 | 264 |
| 1126 | 3300047319 | Ga0495674_0023636 | Ga0495674_0023636_608_1402 | 264 |
| 1127 | 3300047319 | Ga0495674_0188042 | Ga0495674_0188042_194_988 | 264 |
| 1128 | 3300047319 | Ga0495674_0260327 | Ga0495674_0260327_513_1307 | 264 |
| 1129 | 3300047320 | Ga0495672_0029388 | Ga0495672_0029388_1702_2496 | 264 |
| 1130 | 3300047320 | Ga0495672_0030049 | Ga0495672_0030049_2530_3324 | 264 |
| 1131 | 3300047320 | Ga0495672_0078929 | Ga0495672_0078929_443_1237 | 264 |
| 1132 | 3300047321 | Ga0495676_0010028 | Ga0495676_0010028_681_1604 | 264 |
| 1133 | 3300047321 | Ga0495676_0068201 | Ga0495676_0068201_740_1534 | 264 |
| 1134 | 3300047322 | Ga0495680_0028809 | Ga0495680_0028809_2927_3721 | 264 |
| 1135 | 3300047322 | Ga0495680_0286456 | Ga0495680_0286456_254_1048 | 264 |
| 1136 | 3300047443 | Ga0495687_000014 | Ga0495687_000014_164997_165791 | 264 |
| 1137 | 3300047444 | Ga0495675_0184391 | Ga0495675_0184391_65_859 | 264 |
| 1138 | 3300047445 | Ga0495677_0050316 | Ga0495677_0050316_262_1056 | 264 |
| 1139 | 3300047445 | Ga0495677_0062158 | Ga0495677_0062158_264_1058 | 264 |
| 1140 | 3300047469 | Ga0495673_0011722 | Ga0495673_0011722_2299_3093 | 264 |
| 1141 | 3300047469 | Ga0495673_0122979 | Ga0495673_0122979_127_921 | 264 |
| 1142 | 3300047471 | Ga0495684_0020248 | Ga0495684_0020248_1722_2645 | 264 |
| 1143 | 3300047471 | Ga0495684_0107992 | Ga0495684_0107992_1183_1977 | 264 |
| 1144 | 3300047471 | Ga0495684_0142254 | Ga0495684_0142254_614_1408 | 264 |
| 1145 | 3300047472 | Ga0495686_0118536 | Ga0495686_0118536_661_1455 | 264 |
| 1146 | 3300047673 | Ga0495593_0000053 | Ga0495593_0000053_9816_10739 | 264 |
| 1147 | 3300048088 | Ga0495602_0028411 | Ga0495602_0028411_641_1435 | 264 |
| 1148 | 3300048088 | Ga0495602_0233166 | Ga0495602_0233166_463_1257 | 264 |
| 1149 | 3300048088 | Ga0495602_0517644 | Ga0495602_0517644_11_805 | 264 |
| 1150 | 3300048089 | Ga0495614_0013513 | Ga0495614_0013513_467_1390 | 264 |
| 1151 | 3300048903 | Ga0496100_0001613 | Ga0496100_0001613_7497_8291 | 264 |
| 1152 | 3300048903 | Ga0496100_0022737 | Ga0496100_0022737_986_1888 | 264 |
| 1153 | 3300048903 | Ga0496100_0103566 | Ga0496100_0103566_959_1753 | 264 |
| 1154 | 3300048903 | Ga0496100_0157079 | Ga0496100_0157079_245_1039 | 264 |
| 1155 | 3300048903 | Ga0496100_0163165 | Ga0496100_0163165_536_1330 | 264 |
| 1156 | 3300048904 | Ga0496101_0004421 | Ga0496101_0004421_1965_2759 | 264 |
| 1157 | 3300048904 | Ga0496101_0009601 | Ga0496101_0009601_431_1234 | 264 |
| 1158 | 3300048904 | Ga0496101_0016002 | Ga0496101_0016002_2589_3383 | 264 |
| 1159 | 3300048904 | Ga0496101_0051545 | Ga0496101_0051545_1372_2166 | 264 |
| 1160 | 3300048904 | Ga0496101_0194944 | Ga0496101_0194944_747_1541 | 264 |
| 1161 | 3300048904 | Ga0496101_0323504 | Ga0496101_0323504_323_1117 | 264 |
| 1162 | 3300048905 | Ga0496102_0002733 | Ga0496102_0002733_10169_10963 | 264 |
| 1163 | 3300048905 | Ga0496102_0004127 | Ga0496102_0004127_11354_12148 | 264 |
| 1164 | 3300048905 | Ga0496102_0010509 | Ga0496102_0010509_95_889 | 264 |
| 1165 | 3300048905 | Ga0496102_0012054 | Ga0496102_0012054_306_1100 | 264 |
| 1166 | 3300048905 | Ga0496102_0039048 | Ga0496102_0039048_1939_2742 | 264 |
| 1167 | 3300048905 | Ga0496102_0075894 | Ga0496102_0075894_248_1042 | 264 |
| 1168 | 3300048905 | Ga0496102_0374801 | Ga0496102_0374801_141_935 | 264 |
| 1169 | 3300048905 | Ga0496102_0466179 | Ga0496102_0466179_114_908 | 264 |
| 1170 | 3300048906 | Ga0496103_0018374 | Ga0496103_0018374_2653_3447 | 264 |
| 1171 | 3300048906 | Ga0496103_0024344 | Ga0496103_0024344_1190_1984 | 264 |
| 1172 | 3300048906 | Ga0496103_0028159 | Ga0496103_0028159_1827_2621 | 264 |
| 1173 | 3300048906 | Ga0496103_0060299 | Ga0496103_0060299_600_1394 | 264 |
| 1174 | 3300048907 | Ga0496104_0005875 | Ga0496104_0005875_7795_8697 | 264 |
| 1175 | 3300048907 | Ga0496104_0107198 | Ga0496104_0107198_1717_2511 | 264 |
| 1176 | 3300048907 | Ga0496104_0156129 | Ga0496104_0156129_772_1566 | 264 |
| 1177 | 3300048907 | Ga0496104_0241888 | Ga0496104_0241888_248_1042 | 264 |
| 1178 | 3300048907 | Ga0496104_0544724 | Ga0496104_0544724_40_843 | 264 |
| 1179 | 3300048908 | Ga0496105_0004722 | Ga0496105_0004722_3753_4547 | 264 |
| 1180 | 3300048908 | Ga0496105_0011342 | Ga0496105_0011342_1762_2556 | 264 |
| 1181 | 3300048908 | Ga0496105_0031311 | Ga0496105_0031311_2692_3486 | 264 |
| 1182 | 3300048908 | Ga0496105_0058692 | Ga0496105_0058692_1633_2427 | 264 |
| 1183 | 3300048908 | Ga0496105_0502404 | Ga0496105_0502404_23_817 | 264 |
| 1184 | 3300048909 | Ga0496106_0001015 | Ga0496106_0001015_18218_19012 | 264 |
| 1185 | 3300048909 | Ga0496106_0005543 | Ga0496106_0005543_7393_8187 | 264 |
| 1186 | 3300048909 | Ga0496106_0009070 | Ga0496106_0009070_3835_4629 | 264 |
| 1187 | 3300048909 | Ga0496106_0033461 | Ga0496106_0033461_933_1736 | 264 |
| 1188 | 3300048909 | Ga0496106_0040286 | Ga0496106_0040286_947_1741 | 264 |
| 1189 | 3300048909 | Ga0496106_0130287 | Ga0496106_0130287_268_1062 | 264 |
| 1190 | 3300048910 | Ga0496107_0004695 | Ga0496107_0004695_3695_4597 | 264 |
| 1191 | 3300048910 | Ga0496107_0004750 | Ga0496107_0004750_3593_4387 | 264 |
| 1192 | 3300048910 | Ga0496107_0010483 | Ga0496107_0010483_722_1516 | 264 |
| 1193 | 3300048910 | Ga0496107_0021151 | Ga0496107_0021151_738_1532 | 264 |
| 1194 | 3300048910 | Ga0496107_0025412 | Ga0496107_0025412_1668_2462 | 264 |
| 1195 | 3300048910 | Ga0496107_0040274 | Ga0496107_0040274_1122_1925 | 264 |
| 1196 | 3300048910 | Ga0496107_0135756 | Ga0496107_0135756_660_1454 | 264 |
| 1197 | 3300048911 | Ga0496108_0001846 | Ga0496108_0001846_5543_6445 | 264 |
| 1198 | 3300048911 | Ga0496108_0056123 | Ga0496108_0056123_810_1604 | 264 |
| 1199 | 3300048911 | Ga0496108_0059130 | Ga0496108_0059130_152_946 | 264 |
| 1200 | 3300048911 | Ga0496108_0067242 | Ga0496108_0067242_1443_2237 | 264 |
| 1201 | 3300048911 | Ga0496108_0068040 | Ga0496108_0068040_1690_2484 | 264 |
| 1202 | 3300048911 | Ga0496108_0134300 | Ga0496108_0134300_172_966 | 264 |
| 1203 | 3300048911 | Ga0496108_0144379 | Ga0496108_0144379_832_1626 | 264 |
| 1204 | 3300048911 | Ga0496108_0162530 | Ga0496108_0162530_427_1221 | 264 |
| 1205 | 3300048911 | Ga0496108_0195638 | Ga0496108_0195638_560_1354 | 264 |
| 1206 | 3300048912 | Ga0496109_0001905 | Ga0496109_0001905_14780_15574 | 264 |
| 1207 | 3300048912 | Ga0496109_0007688 | Ga0496109_0007688_7397_8191 | 264 |
| 1208 | 3300048912 | Ga0496109_0010512 | Ga0496109_0010512_3939_4733 | 264 |
| 1209 | 3300048912 | Ga0496109_0021929 | Ga0496109_0021929_487_1281 | 264 |
| 1210 | 3300048912 | Ga0496109_0090748 | Ga0496109_0090748_1373_2167 | 264 |
| 1211 | 3300048912 | Ga0496109_0135180 | Ga0496109_0135180_403_1206 | 264 |
| 1212 | 3300048912 | Ga0496109_0181768 | Ga0496109_0181768_53_847 | 264 |
| 1213 | 3300048913 | Ga0496110_0000747 | Ga0496110_0000747_17925_18719 | 264 |
| 1214 | 3300048913 | Ga0496110_0007695 | Ga0496110_0007695_1126_1920 | 264 |
| 1215 | 3300048913 | Ga0496110_0018621 | Ga0496110_0018621_2025_2819 | 264 |
| 1216 | 3300048913 | Ga0496110_0045963 | Ga0496110_0045963_1350_2153 | 264 |
| 1217 | 3300048913 | Ga0496110_0175184 | Ga0496110_0175184_86_880 | 264 |
| 1218 | 3300048913 | Ga0496110_0244693 | Ga0496110_0244693_805_1599 | 264 |
| 1219 | 3300048914 | Ga0496111_0002943 | Ga0496111_0002943_5696_6490 | 264 |
| 1220 | 3300048914 | Ga0496111_0003597 | Ga0496111_0003597_4315_5109 | 264 |
| 1221 | 3300048914 | Ga0496111_0060507 | Ga0496111_0060507_1905_2699 | 264 |
| 1222 | 3300048914 | Ga0496111_0082770 | Ga0496111_0082770_903_1697 | 264 |
| 1223 | 3300048914 | Ga0496111_0127639 | Ga0496111_0127639_1035_1829 | 264 |
| 1224 | 3300048914 | Ga0496111_0569807 | Ga0496111_0569807_23_817 | 264 |
| 1225 | 3300048915 | Ga0496112_0000008 | Ga0496112_0000008_60721_61515 | 264 |
| 1226 | 3300048915 | Ga0496112_0002552 | Ga0496112_0002552_11081_11875 | 264 |
| 1227 | 3300048915 | Ga0496112_0025326 | Ga0496112_0025326_3862_4656 | 264 |
| 1228 | 3300048915 | Ga0496112_0025430 | Ga0496112_0025430_2439_3233 | 264 |
| 1229 | 3300048915 | Ga0496112_0070372 | Ga0496112_0070372_1461_2255 | 264 |
| 1230 | 3300048915 | Ga0496112_0080021 | Ga0496112_0080021_15_809 | 264 |
| 1231 | 3300048915 | Ga0496112_0109901 | Ga0496112_0109901_377_1171 | 264 |
| 1232 | 3300048915 | Ga0496112_0128842 | Ga0496112_0128842_1447_2250 | 264 |
| 1233 | 3300048915 | Ga0496112_0181220 | Ga0496112_0181220_1228_2022 | 264 |
| 1234 | 3300048916 | Ga0496113_0005354 | Ga0496113_0005354_774_1568 | 264 |
| 1235 | 3300048916 | Ga0496113_0006480 | Ga0496113_0006480_4766_5560 | 264 |
| 1236 | 3300048916 | Ga0496113_0066360 | Ga0496113_0066360_190_984 | 264 |
| 1237 | 3300048917 | Ga0496114_0004664 | Ga0496114_0004664_3447_4241 | 264 |
| 1238 | 3300048917 | Ga0496114_0008103 | Ga0496114_0008103_2550_3344 | 264 |
| 1239 | 3300048917 | Ga0496114_0046088 | Ga0496114_0046088_1935_2729 | 264 |
| 1240 | 3300048917 | Ga0496114_0116474 | Ga0496114_0116474_1459_2253 | 264 |
| 1241 | 3300048917 | Ga0496114_0197004 | Ga0496114_0197004_805_1599 | 264 |
| 1242 | 3300048918 | Ga0496115_0005898 | Ga0496115_0005898_2514_3308 | 264 |
| 1243 | 3300048918 | Ga0496115_0018787 | Ga0496115_0018787_716_1510 | 264 |
| 1244 | 3300048918 | Ga0496115_0049876 | Ga0496115_0049876_80_874 | 264 |
| 1245 | 3300048919 | Ga0496116_0014758 | Ga0496116_0014758_530_1324 | 264 |
| 1246 | 3300048919 | Ga0496116_0024015 | Ga0496116_0024015_1433_2227 | 264 |
| 1247 | 3300048920 | Ga0496117_0034418 | Ga0496117_0034418_1788_2612 | 264 |
| 1248 | 3300048920 | Ga0496117_0134878 | Ga0496117_0134878_66_860 | 264 |
| 1249 | 3300048920 | Ga0496117_0149044 | Ga0496117_0149044_217_1011 | 264 |
| 1250 | 3300048921 | Ga0496118_0006042 | Ga0496118_0006042_3479_4273 | 264 |
| 1251 | 3300048921 | Ga0496118_0012813 | Ga0496118_0012813_2440_3234 | 264 |
| 1252 | 3300048921 | Ga0496118_0022887 | Ga0496118_0022887_4633_5427 | 264 |
| 1253 | 3300048921 | Ga0496118_0059237 | Ga0496118_0059237_1823_2617 | 264 |
| 1254 | 3300048921 | Ga0496118_0062556 | Ga0496118_0062556_726_1520 | 264 |
| 1255 | 3300048921 | Ga0496118_0134632 | Ga0496118_0134632_373_1167 | 264 |
| 1256 | 3300048922 | Ga0496119_0033029 | Ga0496119_0033029_1053_1847 | 264 |
| 1257 | 3300048922 | Ga0496119_0108770 | Ga0496119_0108770_411_1205 | 264 |
| 1258 | 3300048923 | Ga0496120_0040615 | Ga0496120_0040615_1899_2693 | 264 |
| 1259 | 3300048923 | Ga0496120_0052278 | Ga0496120_0052278_192_986 | 264 |
| 1260 | 3300048923 | Ga0496120_0074274 | Ga0496120_0074274_16_810 | 264 |
| 1261 | 3300048924 | Ga0496121_0000178 | Ga0496121_0000178_41456_42250 | 264 |
| 1262 | 3300048924 | Ga0496121_0000381 | Ga0496121_0000381_12327_13121 | 264 |
| 1263 | 3300048924 | Ga0496121_0000894 | Ga0496121_0000894_33086_33880 | 264 |
| 1264 | 3300048924 | Ga0496121_0019860 | Ga0496121_0019860_349_1143 | 264 |
| 1265 | 3300048924 | Ga0496121_0035897 | Ga0496121_0035897_2050_2844 | 264 |
| 1266 | 3300048924 | Ga0496121_0038473 | Ga0496121_0038473_3365_4159 | 264 |
| 1267 | 3300048924 | Ga0496121_0100972 | Ga0496121_0100972_234_1028 | 264 |
| 1268 | 3300048924 | Ga0496121_0117262 | Ga0496121_0117262_1206_2000 | 264 |
| 1269 | 3300048924 | Ga0496121_0393422 | Ga0496121_0393422_33_827 | 264 |
| 1270 | 3300048925 | Ga0496122_0000772 | Ga0496122_0000772_24902_25696 | 264 |
| 1271 | 3300048925 | Ga0496122_0048671 | Ga0496122_0048671_1374_2168 | 264 |
| 1272 | 3300048925 | Ga0496122_0064902 | Ga0496122_0064902_437_1261 | 264 |
| 1273 | 3300048925 | Ga0496122_0213233 | Ga0496122_0213233_312_1106 | 264 |
| 1274 | 3300048926 | Ga0496123_0000613 | Ga0496123_0000613_27956_28750 | 264 |
| 1275 | 3300048927 | Ga0496124_0000599 | Ga0496124_0000599_5674_6468 | 264 |
| 1276 | 3300048928 | Ga0496125_0000203 | Ga0496125_0000203_109287_110081 | 264 |
| 1277 | 3300048928 | Ga0496125_0009067 | Ga0496125_0009067_4654_5448 | 264 |
| 1278 | 3300048928 | Ga0496125_0021155 | Ga0496125_0021155_3638_4432 | 264 |
| 1279 | 3300048928 | Ga0496125_0060231 | Ga0496125_0060231_2246_3040 | 264 |
| 1280 | 3300048928 | Ga0496125_0076632 | Ga0496125_0076632_620_1414 | 264 |
| 1281 | 3300048928 | Ga0496125_0080380 | Ga0496125_0080380_918_1712 | 264 |
| 1282 | 3300048928 | Ga0496125_0089567 | Ga0496125_0089567_1464_2258 | 264 |
| 1283 | 3300048928 | Ga0496125_0111111 | Ga0496125_0111111_706_1500 | 264 |
| 1284 | 3300048929 | Ga0496126_0003737 | Ga0496126_0003737_6953_7747 | 264 |
| 1285 | 3300048929 | Ga0496126_0030746 | Ga0496126_0030746_2306_3100 | 264 |
| 1286 | 3300048929 | Ga0496126_0041962 | Ga0496126_0041962_1284_2078 | 264 |
| 1287 | 3300048929 | Ga0496126_0048684 | Ga0496126_0048684_695_1639 | 264 |
| 1288 | 3300048929 | Ga0496126_0051129 | Ga0496126_0051129_1739_2533 | 264 |
| 1289 | 3300048929 | Ga0496126_0051770 | Ga0496126_0051770_2846_3640 | 264 |
| 1290 | 3300048929 | Ga0496126_0183448 | Ga0496126_0183448_339_1133 | 264 |
| 1291 | 3300048929 | Ga0496126_0191388 | Ga0496126_0191388_397_1191 | 264 |
| 1292 | 3300048929 | Ga0496126_0320870 | Ga0496126_0320870_47_841 | 264 |
| 1293 | 3300048929 | Ga0496126_0359553 | Ga0496126_0359553_207_1001 | 264 |
| 1294 | 3300048929 | Ga0496126_0397270 | Ga0496126_0397270_298_1092 | 264 |
| 1295 | 3300049568 | Ga0501031_0000294 | Ga0501031_0000294_3933_4727 | 264 |
| 1296 | 3300049568 | Ga0501031_0000497 | Ga0501031_0000497_3199_3993 | 264 |
| 1297 | 3300049568 | Ga0501031_0006681 | Ga0501031_0006681_6126_6920 | 264 |
| 1298 | 3300049568 | Ga0501031_0312876 | Ga0501031_0312876_165_959 | 264 |
| 1299 | 3300049569 | Ga0501032_0000076 | Ga0501032_0000076_73257_74051 | 264 |
| 1300 | 3300049569 | Ga0501032_0000269 | Ga0501032_0000269_13967_14761 | 264 |
| 1301 | 3300049569 | Ga0501032_0011920 | Ga0501032_0011920_2191_2985 | 264 |
| 1302 | 3300049569 | Ga0501032_0019279 | Ga0501032_0019279_3920_4714 | 264 |
| 1303 | 3300049569 | Ga0501032_0030743 | Ga0501032_0030743_2541_3335 | 264 |
| 1304 | 3300049569 | Ga0501032_0071308 | Ga0501032_0071308_47_841 | 264 |
| 1305 | 3300049569 | Ga0501032_0074823 | Ga0501032_0074823_850_1644 | 264 |
| 1306 | 3300049569 | Ga0501032_0079297 | Ga0501032_0079297_1230_2024 | 264 |
| 1307 | 3300049569 | Ga0501032_0079410 | Ga0501032_0079410_40_834 | 264 |
| 1308 | 3300049569 | Ga0501032_0181351 | Ga0501032_0181351_359_1273 | 264 |
| 1309 | 3300049570 | Ga0501033_0000093 | Ga0501033_0000093_11193_11987 | 264 |
| 1310 | 3300049570 | Ga0501033_0000399 | Ga0501033_0000399_18495_19289 | 264 |
| 1311 | 3300049570 | Ga0501033_0003630 | Ga0501033_0003630_8323_9117 | 264 |
| 1312 | 3300049570 | Ga0501033_0017232 | Ga0501033_0017232_2417_3211 | 264 |
| 1313 | 3300049570 | Ga0501033_0040575 | Ga0501033_0040575_2550_3344 | 264 |
| 1314 | 3300049571 | Ga0501034_0000039 | Ga0501034_0000039_24983_25777 | 264 |
| 1315 | 3300049571 | Ga0501034_0001247 | Ga0501034_0001247_32085_32879 | 264 |
| 1316 | 3300049571 | Ga0501034_0005187 | Ga0501034_0005187_1593_2387 | 264 |
| 1317 | 3300049571 | Ga0501034_0025868 | Ga0501034_0025868_2970_3764 | 264 |
| 1318 | 3300049571 | Ga0501034_0156474 | Ga0501034_0156474_673_1467 | 264 |
| 1319 | 3300049571 | Ga0501034_0256405 | Ga0501034_0256405_716_1510 | 264 |
| 1320 | 3300049571 | Ga0501034_0767866 | Ga0501034_0767866_16_810 | 264 |
| 1321 | 3300049572 | Ga0501036_0000035 | Ga0501036_0000035_14014_14808 | 264 |
| 1322 | 3300049572 | Ga0501036_0000817 | Ga0501036_0000817_14715_15509 | 264 |
| 1323 | 3300049572 | Ga0501036_0006639 | Ga0501036_0006639_6937_7731 | 264 |
| 1324 | 3300049572 | Ga0501036_0017189 | Ga0501036_0017189_4233_5027 | 264 |
| 1325 | 3300049572 | Ga0501036_0044313 | Ga0501036_0044313_245_1039 | 264 |
| 1326 | 3300049572 | Ga0501036_0046764 | Ga0501036_0046764_1035_1829 | 264 |
| 1327 | 3300049572 | Ga0501036_0060679 | Ga0501036_0060679_402_1196 | 264 |
| 1328 | 3300049572 | Ga0501036_0085973 | Ga0501036_0085973_864_1658 | 264 |
| 1329 | 3300049572 | Ga0501036_0616106 | Ga0501036_0616106_31_825 | 264 |
| 1330 | 3300049573 | Ga0501037_0000026 | Ga0501037_0000026_9798_10592 | 264 |
| 1331 | 3300049573 | Ga0501037_0000279 | Ga0501037_0000279_18293_19087 | 264 |
| 1332 | 3300049573 | Ga0501037_0001130 | Ga0501037_0001130_18584_19378 | 264 |
| 1333 | 3300049573 | Ga0501037_0006086 | Ga0501037_0006086_6349_7143 | 264 |
| 1334 | 3300049573 | Ga0501037_0027335 | Ga0501037_0027335_3388_4182 | 264 |
| 1335 | 3300049573 | Ga0501037_0032508 | Ga0501037_0032508_2927_3721 | 264 |
| 1336 | 3300049573 | Ga0501037_0129863 | Ga0501037_0129863_808_1602 | 264 |
| 1337 | 3300049573 | Ga0501037_0204702 | Ga0501037_0204702_184_978 | 264 |
| 1338 | 3300049573 | Ga0501037_0227389 | Ga0501037_0227389_386_1180 | 264 |
| 1339 | 3300049573 | Ga0501037_0273383 | Ga0501037_0273383_270_1064 | 264 |
| 1340 | 3300049574 | Ga0501038_0000037 | Ga0501038_0000037_73230_74024 | 264 |
| 1341 | 3300049574 | Ga0501038_0000069 | Ga0501038_0000069_83469_84263 | 264 |
| 1342 | 3300049574 | Ga0501038_0000727 | Ga0501038_0000727_607_1401 | 264 |
| 1343 | 3300049574 | Ga0501038_0006733 | Ga0501038_0006733_2255_3049 | 264 |
| 1344 | 3300049574 | Ga0501038_0020364 | Ga0501038_0020364_544_1338 | 264 |
| 1345 | 3300049574 | Ga0501038_0138174 | Ga0501038_0138174_835_1629 | 264 |
| 1346 | 3300049574 | Ga0501038_0160890 | Ga0501038_0160890_302_1096 | 264 |
| 1347 | 3300049574 | Ga0501038_0385146 | Ga0501038_0385146_108_902 | 264 |
| 1348 | 3300049574 | Ga0501038_0392038 | Ga0501038_0392038_116_910 | 264 |
| 1349 | 3300049575 | Ga0501039_0000146 | Ga0501039_0000146_37313_38107 | 264 |
| 1350 | 3300049575 | Ga0501039_0000263 | Ga0501039_0000263_35886_36680 | 264 |
| 1351 | 3300049575 | Ga0501039_0010044 | Ga0501039_0010044_5812_6606 | 264 |
| 1352 | 3300049575 | Ga0501039_0026624 | Ga0501039_0026624_3134_3928 | 264 |
| 1353 | 3300049575 | Ga0501039_0212020 | Ga0501039_0212020_271_1065 | 264 |
| 1354 | 3300049576 | Ga0501040_0008550 | Ga0501040_0008550_228_1022 | 264 |
| 1355 | 3300049576 | Ga0501040_0066461 | Ga0501040_0066461_690_1484 | 264 |
| 1356 | 3300049577 | Ga0501041_0095772 | Ga0501041_0095772_735_1529 | 264 |
| 1357 | 3300049577 | Ga0501041_0198082 | Ga0501041_0198082_418_1212 | 264 |
| 1358 | 3300049578 | Ga0501042_0039183 | Ga0501042_0039183_1295_2089 | 264 |
| 1359 | 3300049578 | Ga0501042_0047957 | Ga0501042_0047957_51_845 | 264 |
| 1360 | 3300049578 | Ga0501042_0233669 | Ga0501042_0233669_118_912 | 264 |
| 1361 | 3300049579 | Ga0501043_0000115 | Ga0501043_0000115_1635_2429 | 264 |
| 1362 | 3300049579 | Ga0501043_0000257 | Ga0501043_0000257_18421_19215 | 264 |
| 1363 | 3300049579 | Ga0501043_0016842 | Ga0501043_0016842_1832_2626 | 264 |
| 1364 | 3300049579 | Ga0501043_0022318 | Ga0501043_0022318_1386_2180 | 264 |
| 1365 | 3300049579 | Ga0501043_0133135 | Ga0501043_0133135_849_1643 | 264 |
| 1366 | 3300049579 | Ga0501043_0220240 | Ga0501043_0220240_132_926 | 264 |
| 1367 | 3300049580 | Ga0501046_0000210 | Ga0501046_0000210_1607_2401 | 264 |
| 1368 | 3300049580 | Ga0501046_0001438 | Ga0501046_0001438_10662_11456 | 264 |
| 1369 | 3300049580 | Ga0501046_0036917 | Ga0501046_0036917_182_976 | 264 |
| 1370 | 3300049580 | Ga0501046_0050155 | Ga0501046_0050155_1132_1926 | 264 |
| 1371 | 3300049580 | Ga0501046_0422356 | Ga0501046_0422356_65_859 | 264 |
| 1372 | 3300049581 | Ga0501047_0000094 | Ga0501047_0000094_50549_51343 | 264 |
| 1373 | 3300049581 | Ga0501047_0000186 | Ga0501047_0000186_7431_8225 | 264 |
| 1374 | 3300049581 | Ga0501047_0000892 | Ga0501047_0000892_25867_26661 | 264 |
| 1375 | 3300049581 | Ga0501047_0010143 | Ga0501047_0010143_7685_8479 | 264 |
| 1376 | 3300049581 | Ga0501047_0014304 | Ga0501047_0014304_2048_2842 | 264 |
| 1377 | 3300049581 | Ga0501047_0032596 | Ga0501047_0032596_3476_4270 | 264 |
| 1378 | 3300049581 | Ga0501047_0043616 | Ga0501047_0043616_606_1400 | 264 |
| 1379 | 3300049581 | Ga0501047_0137786 | Ga0501047_0137786_959_1753 | 264 |
| 1380 | 3300049581 | Ga0501047_0286409 | Ga0501047_0286409_634_1428 | 264 |
| 1381 | 3300049581 | Ga0501047_0357158 | Ga0501047_0357158_287_1081 | 264 |
| 1382 | 3300049582 | Ga0501048_0000306 | Ga0501048_0000306_1900_2694 | 264 |
| 1383 | 3300049582 | Ga0501048_0000856 | Ga0501048_0000856_15451_16245 | 264 |
| 1384 | 3300049582 | Ga0501048_0002557 | Ga0501048_0002557_10736_11530 | 264 |
| 1385 | 3300049582 | Ga0501048_0009695 | Ga0501048_0009695_4813_5607 | 264 |
| 1386 | 3300049582 | Ga0501048_0132263 | Ga0501048_0132263_106_900 | 264 |
| 1387 | 3300049583 | Ga0501067_0000220 | Ga0501067_0000220_16205_16999 | 264 |
| 1388 | 3300049583 | Ga0501067_0010936 | Ga0501067_0010936_1122_1925 | 264 |
| 1389 | 3300049583 | Ga0501067_0013507 | Ga0501067_0013507_1754_2548 | 264 |
| 1390 | 3300049583 | Ga0501067_0073388 | Ga0501067_0073388_501_1352 | 264 |
| 1391 | 3300049584 | Ga0501068_0003939 | Ga0501068_0003939_6098_6892 | 264 |
| 1392 | 3300049584 | Ga0501068_0004373 | Ga0501068_0004373_1634_2428 | 264 |
| 1393 | 3300049584 | Ga0501068_0019306 | Ga0501068_0019306_1850_2644 | 264 |
| 1394 | 3300049584 | Ga0501068_0020312 | Ga0501068_0020312_728_1522 | 264 |
| 1395 | 3300049584 | Ga0501068_0043380 | Ga0501068_0043380_904_1698 | 264 |
| 1396 | 3300049584 | Ga0501068_0089412 | Ga0501068_0089412_845_1639 | 264 |
| 1397 | 3300049584 | Ga0501068_0169307 | Ga0501068_0169307_306_1100 | 264 |
| 1398 | 3300049585 | Ga0501069_0004135 | Ga0501069_0004135_1342_2136 | 264 |
| 1399 | 3300049585 | Ga0501069_0006557 | Ga0501069_0006557_5252_6046 | 264 |
| 1400 | 3300049585 | Ga0501069_0009362 | Ga0501069_0009362_3787_4581 | 264 |
| 1401 | 3300049585 | Ga0501069_0021290 | Ga0501069_0021290_1889_2683 | 264 |
| 1402 | 3300049585 | Ga0501069_0060565 | Ga0501069_0060565_63_857 | 264 |
| 1403 | 3300049585 | Ga0501069_0068487 | Ga0501069_0068487_1012_1806 | 264 |
| 1404 | 3300049585 | Ga0501069_0072286 | Ga0501069_0072286_368_1162 | 264 |
| 1405 | 3300049586 | Ga0501070_0000134 | Ga0501070_0000134_50645_51439 | 264 |
| 1406 | 3300049586 | Ga0501070_0013023 | Ga0501070_0013023_4238_5032 | 264 |
| 1407 | 3300049586 | Ga0501070_0013228 | Ga0501070_0013228_2683_3477 | 264 |
| 1408 | 3300049586 | Ga0501070_0024108 | Ga0501070_0024108_1042_1836 | 264 |
| 1409 | 3300049586 | Ga0501070_0040276 | Ga0501070_0040276_3050_3844 | 264 |
| 1410 | 3300049586 | Ga0501070_0047476 | Ga0501070_0047476_685_1479 | 264 |
| 1411 | 3300049586 | Ga0501070_0051850 | Ga0501070_0051850_945_1739 | 264 |
| 1412 | 3300049586 | Ga0501070_0081847 | Ga0501070_0081847_1228_2022 | 264 |
| 1413 | 3300049586 | Ga0501070_0090225 | Ga0501070_0090225_106_900 | 264 |
| 1414 | 3300049586 | Ga0501070_0210137 | Ga0501070_0210137_729_1523 | 264 |
| 1415 | 3300049586 | Ga0501070_0543874 | Ga0501070_0543874_41_835 | 264 |
| 1416 | 3300049587 | Ga0501071_0016014 | Ga0501071_0016014_3463_4257 | 264 |
| 1417 | 3300049587 | Ga0501071_0216956 | Ga0501071_0216956_86_880 | 264 |
| 1418 | 3300049587 | Ga0501071_0442318 | Ga0501071_0442318_43_837 | 264 |
| 1419 | 3300049588 | Ga0501072_0001542 | Ga0501072_0001542_4263_5057 | 264 |
| 1420 | 3300049588 | Ga0501072_0018872 | Ga0501072_0018872_1976_2770 | 264 |
| 1421 | 3300049588 | Ga0501072_0055128 | Ga0501072_0055128_1363_2157 | 264 |
| 1422 | 3300049589 | Ga0501073_0000131 | Ga0501073_0000131_12443_13237 | 264 |
| 1423 | 3300049589 | Ga0501073_0005409 | Ga0501073_0005409_4027_4821 | 264 |
| 1424 | 3300049589 | Ga0501073_0010210 | Ga0501073_0010210_3750_4544 | 264 |
| 1425 | 3300049589 | Ga0501073_0015631 | Ga0501073_0015631_4287_5081 | 264 |
| 1426 | 3300049589 | Ga0501073_0023953 | Ga0501073_0023953_1411_2205 | 264 |
| 1427 | 3300049589 | Ga0501073_0024458 | Ga0501073_0024458_560_1354 | 264 |
| 1428 | 3300049590 | Ga0501074_0000514 | Ga0501074_0000514_10661_11455 | 264 |
| 1429 | 3300049590 | Ga0501074_0006996 | Ga0501074_0006996_4744_5538 | 264 |
| 1430 | 3300049590 | Ga0501074_0013074 | Ga0501074_0013074_3754_4548 | 264 |
| 1431 | 3300049590 | Ga0501074_0016442 | Ga0501074_0016442_1250_2044 | 264 |
| 1432 | 3300049590 | Ga0501074_0033237 | Ga0501074_0033237_853_1647 | 264 |
| 1433 | 3300049590 | Ga0501074_0148952 | Ga0501074_0148952_143_937 | 264 |
| 1434 | 3300049591 | Ga0501075_0341702 | Ga0501075_0341702_184_978 | 264 |
| 1435 | 3300049591 | Ga0501075_0400381 | Ga0501075_0400381_79_873 | 264 |
| 1436 | 3300049592 | Ga0501076_0010682 | Ga0501076_0010682_821_1615 | 264 |
| 1437 | 3300049592 | Ga0501076_0098869 | Ga0501076_0098869_310_1104 | 264 |
| 1438 | 3300049592 | Ga0501076_0129214 | Ga0501076_0129214_530_1324 | 264 |
| 1439 | 3300049741 | Ga0501079_0003357 | Ga0501079_0003357_6629_7423 | 264 |
| 1440 | 3300049741 | Ga0501079_0003839 | Ga0501079_0003839_7180_7974 | 264 |
| 1441 | 3300049741 | Ga0501079_0051618 | Ga0501079_0051618_684_1478 | 264 |
| 1442 | 3300049741 | Ga0501079_0066832 | Ga0501079_0066832_1509_2303 | 264 |
| 1443 | 3300049741 | Ga0501079_0097009 | Ga0501079_0097009_553_1347 | 264 |
| 1444 | 3300049741 | Ga0501079_0298526 | Ga0501079_0298526_296_1090 | 264 |
| 1445 | 3300049742 | Ga0501080_0000299 | Ga0501080_0000299_33519_34313 | 264 |
| 1446 | 3300049742 | Ga0501080_0000387 | Ga0501080_0000387_12773_13567 | 264 |
| 1447 | 3300049742 | Ga0501080_0001809 | Ga0501080_0001809_3277_4071 | 264 |
| 1448 | 3300049742 | Ga0501080_0023167 | Ga0501080_0023167_1169_1963 | 264 |
| 1449 | 3300049742 | Ga0501080_0102012 | Ga0501080_0102012_552_1346 | 264 |
| 1450 | 3300049742 | Ga0501080_0162316 | Ga0501080_0162316_666_1460 | 264 |
| 1451 | 3300049742 | Ga0501080_0163965 | Ga0501080_0163965_565_1359 | 264 |
| 1452 | 3300049742 | Ga0501080_0196287 | Ga0501080_0196287_685_1479 | 264 |
| 1453 | 3300049742 | Ga0501080_0292258 | Ga0501080_0292258_643_1437 | 264 |
| 1454 | 3300049742 | Ga0501080_0329267 | Ga0501080_0329267_109_903 | 264 |
| 1455 | 3300049742 | Ga0501080_0372142 | Ga0501080_0372142_258_1052 | 264 |
| 1456 | 3300049743 | Ga0501081_0001664 | Ga0501081_0001664_1998_2792 | 264 |
| 1457 | 3300049743 | Ga0501081_0155934 | Ga0501081_0155934_521_1315 | 264 |
| 1458 | 3300049744 | Ga0501083_0000213 | Ga0501083_0000213_16481_17275 | 264 |
| 1459 | 3300049744 | Ga0501083_0000302 | Ga0501083_0000302_9251_10045 | 264 |
| 1460 | 3300049744 | Ga0501083_0013866 | Ga0501083_0013866_3215_4009 | 264 |
| 1461 | 3300049744 | Ga0501083_0211437 | Ga0501083_0211437_206_1000 | 264 |
| 1462 | 3300049744 | Ga0501083_0274611 | Ga0501083_0274611_47_841 | 264 |
| 1463 | 3300049758 | Ga0501241_005327 | Ga0501241_005327_945_1739 | 264 |
| 1464 | 3300049822 | Ga0501035_0000523 | Ga0501035_0000523_31725_32519 | 264 |
| 1465 | 3300049822 | Ga0501035_0000533 | Ga0501035_0000533_1635_2429 | 264 |
| 1466 | 3300049822 | Ga0501035_0009857 | Ga0501035_0009857_5923_6717 | 264 |
| 1467 | 3300049822 | Ga0501035_0015394 | Ga0501035_0015394_112_906 | 264 |
| 1468 | 3300049822 | Ga0501035_0021633 | Ga0501035_0021633_2849_3643 | 264 |
| 1469 | 3300049822 | Ga0501035_0052530 | Ga0501035_0052530_269_1063 | 264 |
| 1470 | 3300049822 | Ga0501035_0054995 | Ga0501035_0054995_2741_3535 | 264 |
| 1471 | 3300049822 | Ga0501035_0107675 | Ga0501035_0107675_1244_2038 | 264 |
| 1472 | 3300049822 | Ga0501035_0157956 | Ga0501035_0157956_837_1631 | 264 |
| 1473 | 3300049822 | Ga0501035_0188241 | Ga0501035_0188241_776_1570 | 264 |
| 1474 | 3300049822 | Ga0501035_0229760 | Ga0501035_0229760_528_1322 | 264 |
| 1475 | 3300049823 | Ga0501044_0000435 | Ga0501044_0000435_39855_40649 | 264 |
| 1476 | 3300049823 | Ga0501044_0003448 | Ga0501044_0003448_16936_17730 | 264 |
| 1477 | 3300049823 | Ga0501044_0009354 | Ga0501044_0009354_7568_8362 | 264 |
| 1478 | 3300049823 | Ga0501044_0027340 | Ga0501044_0027340_1977_2771 | 264 |
| 1479 | 3300049823 | Ga0501044_0092087 | Ga0501044_0092087_1873_2667 | 264 |
| 1480 | 3300049823 | Ga0501044_0098202 | Ga0501044_0098202_1590_2384 | 264 |
| 1481 | 3300049823 | Ga0501044_0331463 | Ga0501044_0331463_120_914 | 264 |
| 1482 | 3300049823 | Ga0501044_0409435 | Ga0501044_0409435_286_1080 | 264 |
| 1483 | 3300049824 | Ga0501045_0022522 | Ga0501045_0022522_3254_4048 | 264 |
| 1484 | 3300049824 | Ga0501045_0105366 | Ga0501045_0105366_1178_1972 | 264 |
| 1485 | 3300050489 | nmdc:mga03683_102651_c1 | nmdc:mga03683_102651_c1_310_1104 | 264 |
| 1486 | 3300050489 | nmdc:mga03683_1027_c1 | nmdc:mga03683_1027_c1_97_891 | 264 |
| 1487 | 3300050490 | nmdc:mga03n38_221414_c1 | nmdc:mga03n38_221414_c1_178_972 | 264 |
| 1488 | 3300050491 | nmdc:mga00v17_39463_c1 | nmdc:mga00v17_39463_c1_538_1332 | 264 |
| 1489 | 3300050492 | nmdc:mga0yw44_17750_c1 | nmdc:mga0yw44_17750_c1_2771_3565 | 264 |
| 1490 | 3300050492 | nmdc:mga0yw44_53571_c1 | nmdc:mga0yw44_53571_c1_242_1036 | 264 |
| 1491 | 3300050493 | nmdc:mga0k408_275726_c1 | nmdc:mga0k408_275726_c1_37_831 | 264 |
| 1492 | 3300050493 | nmdc:mga0k408_92347_c1 | nmdc:mga0k408_92347_c1_402_1196 | 264 |
| 1493 | 3300050494 | nmdc:mga06z11_23054_c1 | nmdc:mga06z11_23054_c1_21_815 | 264 |
| 1494 | 3300050494 | nmdc:mga06z11_76330_c1 | nmdc:mga06z11_76330_c1_253_1047 | 264 |
| 1495 | 3300050496 | nmdc:mga07m45_193093_c1 | nmdc:mga07m45_193093_c1_227_1021 | 264 |
| 1496 | 3300050496 | nmdc:mga07m45_41448_c1 | nmdc:mga07m45_41448_c1_498_1292 | 264 |
| 1497 | 3300050496 | nmdc:mga07m45_47017_c1 | nmdc:mga07m45_47017_c1_1261_2055 | 264 |
| 1498 | 3300050496 | nmdc:mga07m45_81159_c1 | nmdc:mga07m45_81159_c1_737_1621 | 264 |
| 1499 | 3300050507 | nmdc:mga05p37_147491_c1 | nmdc:mga05p37_147491_c1_939_1733 | 264 |
| 1500 | 3300050508 | nmdc:mga09592_33785_c1 | nmdc:mga09592_33785_c1_3224_4018 | 264 |
| 1501 | 3300050509 | nmdc:mga0qj67_379021_c1 | nmdc:mga0qj67_379021_c1_295_1089 | 264 |
| 1502 | 3300050510 | nmdc:mga06r32_14990_c1 | nmdc:mga06r32_14990_c1_6071_6865 | 264 |
| 1503 | 3300050511 | nmdc:mga08y16_102788_c1 | nmdc:mga08y16_102788_c1_1948_2742 | 264 |
| 1504 | 3300050511 | nmdc:mga08y16_1281_c1 | nmdc:mga08y16_1281_c1_16187_16981 | 264 |
| 1505 | 3300050511 | nmdc:mga08y16_3917_c1 | nmdc:mga08y16_3917_c1_6724_7518 | 264 |
| 1506 | 3300050511 | nmdc:mga08y16_52748_c1 | nmdc:mga08y16_52748_c1_886_1680 | 264 |
| 1507 | 3300050511 | nmdc:mga08y16_88203_c1 | nmdc:mga08y16_88203_c1_2178_2972 | 264 |
| 1508 | 3300050512 | nmdc:mga0n895_1946_c1 | nmdc:mga0n895_1946_c1_14434_15228 | 264 |
| 1509 | 3300050512 | nmdc:mga0n895_466290_c1 | nmdc:mga0n895_466290_c1_101_895 | 264 |
| 1510 | 3300050512 | nmdc:mga0n895_96815_c1 | nmdc:mga0n895_96815_c1_2027_2821 | 264 |
| 1511 | 3300050513 | nmdc:mga0rr50_392375_c1 | nmdc:mga0rr50_392375_c1_203_997 | 264 |
| 1512 | 3300050515 | nmdc:mga0a205_145113_c1 | nmdc:mga0a205_145113_c1_1237_2031 | 264 |
| 1513 | 3300050515 | nmdc:mga0a205_35242_c1 | nmdc:mga0a205_35242_c1_262_1056 | 264 |
| 1514 | 3300050516 | nmdc:mga0sz30_1683_c1 | nmdc:mga0sz30_1683_c1_5178_5972 | 264 |
| 1515 | 3300050516 | nmdc:mga0sz30_2375_c1 | nmdc:mga0sz30_2375_c1_1983_2777 | 264 |
| 1516 | 3300050516 | nmdc:mga0sz30_56454_c1 | nmdc:mga0sz30_56454_c1_164_958 | 264 |
| 1517 | 3300053077 | Ga0495601_0041381 | Ga0495601_0041381_650_1444 | 264 |
| 1518 | 3300053077 | Ga0495601_0316854 | Ga0495601_0316854_178_972 | 264 |
| 1519 | 3300053078 | Ga0495612_0087829 | Ga0495612_0087829_269_1063 | 264 |
| 1520 | 3300053080 | Ga0500635_0002566 | Ga0500635_0002566_2213_3007 | 264 |
| 1521 | 3300053084 | Ga0495595_0013058 | Ga0495595_0013058_140_934 | 264 |
| 1522 | 3300053084 | Ga0495595_0020049 | Ga0495595_0020049_877_1671 | 264 |
| 1523 | 3300053084 | Ga0495595_0133880 | Ga0495595_0133880_241_1035 | 264 |
| 1524 | 3300053085 | Ga0495619_0065962 | Ga0495619_0065962_316_1110 | 264 |
| 1525 | 3300053085 | Ga0495619_0160747 | Ga0495619_0160747_467_1261 | 264 |
| 1526 | 3300053086 | Ga0500578_0090848 | Ga0500578_0090848_788_1582 | 264 |
| 1527 | 3300053088 | Ga0500644_0041888 | Ga0500644_0041888_235_1092 | 264 |
| 1528 | 3300053088 | Ga0500644_0126294 | Ga0500644_0126294_130_924 | 264 |
| 1529 | 3300053088 | Ga0500644_0136268 | Ga0500644_0136268_54_848 | 264 |
| 1530 | 3300053090 | Ga0500646_0007100 | Ga0500646_0007100_1097_1891 | 264 |
| 1531 | 3300053092 | Ga0500583_0001971 | Ga0500583_0001971_5034_5828 | 264 |
| 1532 | 3300053092 | Ga0500583_0044064 | Ga0500583_0044064_412_1206 | 264 |
| 1533 | 3300053093 | Ga0500651_0000168 | Ga0500651_0000168_6807_7601 | 264 |
| 1534 | 3300053093 | Ga0500651_0025258 | Ga0500651_0025258_2904_3698 | 264 |
| 1535 | 3300053094 | Ga0500566_0010562 | Ga0500566_0010562_3031_3825 | 264 |
| 1536 | 3300053094 | Ga0500566_0216356 | Ga0500566_0216356_40_834 | 264 |
| 1537 | 3300053097 | Ga0500648_136589 | Ga0500648_136589_278_1072 | 264 |
| 1538 | 3300053098 | Ga0500650_0020176 | Ga0500650_0020176_1438_2232 | 264 |
| 1539 | 3300053098 | Ga0500650_0113889 | Ga0500650_0113889_294_1088 | 264 |
| 1540 | 3300053102 | Ga0500554_002814 | Ga0500554_002814_1571_2365 | 264 |
| 1541 | 3300053103 | Ga0500555_016159 | Ga0500555_016159_26_820 | 264 |
| 1542 | 3300053104 | Ga0500556_0000202 | Ga0500556_0000202_42638_43432 | 264 |
| 1543 | 3300053108 | Ga0500562_072212 | Ga0500562_072212_34_828 | 264 |
| 1544 | 3300053109 | Ga0500569_000323 | Ga0500569_000323_1155_1949 | 264 |
| 1545 | 3300053111 | Ga0500572_001030 | Ga0500572_001030_1646_2440 | 264 |
| 1546 | 3300053116 | Ga0500592_000443 | Ga0500592_000443_4666_5460 | 264 |
| 1547 | 3300053116 | Ga0500592_009763 | Ga0500592_009763_658_1452 | 264 |
| 1548 | 3300053119 | Ga0500595_002264 | Ga0500595_002264_1784_2578 | 264 |
| 1549 | 3300053119 | Ga0500595_003563 | Ga0500595_003563_646_1440 | 264 |
| 1550 | 3300053119 | Ga0500595_009619 | Ga0500595_009619_2920_3714 | 264 |
| 1551 | 3300053119 | Ga0500595_041410 | Ga0500595_041410_511_1305 | 264 |
| 1552 | 3300053121 | Ga0500607_017859 | Ga0500607_017859_1242_2036 | 264 |
| 1553 | 3300053130 | Ga0500642_0000005 | Ga0500642_0000005_76770_77564 | 264 |
| 1554 | 3300053130 | Ga0500642_0036658 | Ga0500642_0036658_950_1744 | 264 |
| 1555 | 3300053131 | Ga0500652_000717 | Ga0500652_000717_4224_5018 | 264 |
| 1556 | 3300053131 | Ga0500652_003296 | Ga0500652_003296_1992_2786 | 264 |
| 1557 | 3300053136 | Ga0500559_0000586 | Ga0500559_0000586_6012_6806 | 264 |
| 1558 | 3300053136 | Ga0500559_0007354 | Ga0500559_0007354_1613_2407 | 264 |
| 1559 | 3300053138 | Ga0500564_057478 | Ga0500564_057478_454_1248 | 264 |
| 1560 | 3300053139 | Ga0500568_0008225 | Ga0500568_0008225_2857_3651 | 264 |
| 1561 | 3300053139 | Ga0500568_0008455 | Ga0500568_0008455_2800_3594 | 264 |
| 1562 | 3300053139 | Ga0500568_0013761 | Ga0500568_0013761_1978_2772 | 264 |
| 1563 | 3300053139 | Ga0500568_0041141 | Ga0500568_0041141_58_852 | 264 |
| 1564 | 3300053142 | Ga0500577_0021304 | Ga0500577_0021304_597_1391 | 264 |
| 1565 | 3300053142 | Ga0500577_0021539 | Ga0500577_0021539_1308_2102 | 264 |
| 1566 | 3300053145 | Ga0500586_001465 | Ga0500586_001465_3677_4471 | 264 |
| 1567 | 3300053146 | Ga0500588_0049382 | Ga0500588_0049382_132_926 | 264 |
| 1568 | 3300053147 | Ga0500589_013888 | Ga0500589_013888_392_1186 | 264 |
| 1569 | 3300053151 | Ga0500604_0008586 | Ga0500604_0008586_52_846 | 264 |
| 1570 | 3300053153 | Ga0500616_0000166 | Ga0500616_0000166_40694_41488 | 264 |
| 1571 | 3300053153 | Ga0500616_0000180 | Ga0500616_0000180_28730_29524 | 264 |
| 1572 | 3300053153 | Ga0500616_0002218 | Ga0500616_0002218_13533_14378 | 264 |
| 1573 | 3300053153 | Ga0500616_0011766 | Ga0500616_0011766_1407_2201 | 264 |
| 1574 | 3300053156 | Ga0500622_0007484 | Ga0500622_0007484_525_1319 | 264 |
| 1575 | 3300053156 | Ga0500622_0019560 | Ga0500622_0019560_2324_3118 | 264 |
| 1576 | 3300053156 | Ga0500622_0019647 | Ga0500622_0019647_394_1188 | 264 |
| 1577 | 3300053161 | Ga0500634_0042288 | Ga0500634_0042288_1483_2277 | 264 |
| 1578 | 3300053177 | Ga0500636_0011317 | Ga0500636_0011317_1967_2761 | 264 |
| 1579 | 3300053177 | Ga0500636_0026335 | Ga0500636_0026335_1146_1940 | 264 |
| 1580 | 3300053178 | Ga0500637_0020687 | Ga0500637_0020687_2646_3440 | 264 |
| 1581 | 3300053730 | Ga0500645_007785 | Ga0500645_007785_1733_2527 | 264 |
| 1582 | 3300053731 | Ga0500609_000821 | Ga0500609_000821_1698_2492 | 264 |
| 1583 | 3300053731 | Ga0500609_007867 | Ga0500609_007867_351_1145 | 264 |
| 1584 | 3300054114 | Ga0501084_0024291 | Ga0501084_0024291_312_1106 | 264 |
| 1585 | 3300054114 | Ga0501084_0031221 | Ga0501084_0031221_3451_4245 | 264 |
| 1586 | 3300054114 | Ga0501084_0182075 | Ga0501084_0182075_815_1609 | 264 |
| 1587 | 3300054114 | Ga0501084_0188857 | Ga0501084_0188857_355_1149 | 264 |
| 1588 | 3300054114 | Ga0501084_0222591 | Ga0501084_0222591_710_1504 | 264 |
| 1589 | 3300060353 | Ga0501082_0006782 | Ga0501082_0006782_1023_1817 | 264 |
| 1590 | 3300060353 | Ga0501082_0010662 | Ga0501082_0010662_37_831 | 264 |
| 1591 | 3300060353 | Ga0501082_0035245 | Ga0501082_0035245_2056_2850 | 264 |
| 1592 | 3300060353 | Ga0501082_0477549 | Ga0501082_0477549_53_847 | 264 |
| 1593 | 3300061719 | Ga0466962_0001283 | Ga0466962_0001283_9386_10180 | 264 |
| 1594 | 3300061734 | Ga0530510_0070878 | Ga0530510_0070878_735_1529 | 264 |
| 1595 | 3300061734 | Ga0530510_0517636 | Ga0530510_0517636_58_852 | 264 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3b5b-assembly1.cif.gz_B | crystal structure of the thymidylate synthase k48q | 0.9842 | 1 | 264 |
| 4fox-assembly2.cif.gz_D | crystal structure of mtb thya in complex with dump and raltitrexed | 0.9842 | 1 | 264 |
| 3bfi-assembly1.cif.gz_A-2 | e. coli thymidylate synthase y209m mutant complexed with 5-nitro-dump | 0.9837 | 3 | 264 |
| 4h0u-assembly1.cif.gz_B | crystal structure of thymidylate synthase from corynebacterium glutamicum in complex with dump | 0.9834 | 3 | 259 |
| 1fwm-assembly1.cif.gz_B | crystal structure of the thymidylate synthase r166q mutant | 0.9831 | 3 | 264 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1bo7A00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9768 | 2 | 264 | 3.30.572.10 |
| 3ix6B00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9734 | 2 | 250 | 3.30.572.10 |
| 1bo7A00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9695 | 2 | 264 | 3.30.572.10 |
| 6qyaC00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9635 | 2 | 262 | 3.30.572.10 |
| 3dgaC00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9585 | 2 | 259 | 3.30.572.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A352HMS8-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9994 | 151 | 264 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A2E8YSB0-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9989 | 145 | 264 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A1J4YZP9-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9988 | 143 | 264 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A2H6J9D6-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9954 | 141 | 264 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A059X8V8-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9949 | 150 | 262 |
GO:0004799
GO:0005829 GO:0006231 GO:0016020 GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar