metagRoot

F494973

General Info

Members	Datasets	Scaffolds	Average Seq Length
1596	693	3192	245

Family's Representative Sequence

Representative Sequence	iso_pu_bacteria\|8057160832\|8057161894
Length	268
Sequence	RIQLGVNIDHIATLRQARGTRYPDPVQAALLAEEAGADGITLHLREDRRHIQERDVELIAAVLTTRMNLEMAVTEPMLALAERIVPRHVCLVPERREELTTEGGLDVAGQFDVIAAACRRLAAAGIDVSLFIDPDPEQIQKAFEAGAPTIELHTGAYADATGETARQAHARLTAAAEMASELGMTVNAGHGLHYHNVEAIAAIGGIHELNIGHAIIARALFVGLKEAVAEMKRLIISGQENGLMMALEEHDHEHGGGDDHDGCCHHDH

Samples

	Sample ID	Description	Type	Environment
1	2124908027	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1	Metagenome	Rhizosphere
2	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
3	2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1	Metagenome	Rhizosphere
4	3300001915	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7	Metagenome	Rhizosphere
5	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
6	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
7	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
8	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
9	3300003575	Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
10	3300003577	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
11	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
12	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
13	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
14	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
15	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
16	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
17	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
18	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
19	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
20	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
21	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
22	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
23	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
24	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
25	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
26	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
27	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
28	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
29	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
30	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
31	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
32	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
33	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
34	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
35	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
36	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
37	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
38	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
39	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
40	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
41	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
42	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
43	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
44	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
45	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
46	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
47	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
48	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
49	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
50	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
51	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
52	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
53	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
54	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
55	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
56	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
57	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
58	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
59	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
60	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
61	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
62	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
63	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
64	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
65	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
66	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
67	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
68	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
69	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
70	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
71	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
72	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
73	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
74	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
75	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
76	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
77	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
78	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
79	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
80	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
81	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
82	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
83	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
84	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
85	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
86	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
87	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
88	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
89	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
90	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
91	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
92	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
93	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
94	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
95	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
96	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
97	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
98	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
99	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
100	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
101	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
102	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
103	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
104	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
105	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
106	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
107	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
108	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
109	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
110	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
111	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
112	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
113	3300012498	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410	Metagenome	Rhizosphere
114	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
115	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
116	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
117	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
118	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
119	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
120	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
121	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
122	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
123	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
124	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
125	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
126	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
127	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
128	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
129	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
130	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
131	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
132	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
133	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
134	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
135	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
136	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
137	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
138	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
139	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
140	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
141	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
142	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
143	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
144	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
145	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
146	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
147	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
148	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
149	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
150	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
151	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
201	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
202	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
210	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
214	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
215	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
216	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
217	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
218	3300030735	Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4	Metagenome	Rhizosphere
219	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
220	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
221	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
222	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
223	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
224	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
225	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
226	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
227	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
228	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
229	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
230	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
231	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
232	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
233	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
234	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
235	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
236	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
237	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
238	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
239	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
240	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
241	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
242	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
243	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
244	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
245	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
246	3300036459	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
247	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
248	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
249	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
250	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
251	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
252	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
253	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
254	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
255	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
256	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
257	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
258	3300042000	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539	Metagenome	Rhizosphere
259	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
260	3300042009	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348	Metagenome	Rhizosphere
261	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
262	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
263	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
264	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
265	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
266	3300042121	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398	Metagenome	Rhizosphere
267	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
268	3300042124	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423	Metagenome	Rhizosphere
269	3300042126	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87	Metagenome	Rhizosphere
270	3300042127	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91	Metagenome	Rhizosphere
271	3300042129	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95	Metagenome	Rhizosphere
272	3300042136	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294	Metagenome	Rhizosphere
273	3300042137	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519	Metagenome	Rhizosphere
274	3300042138	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379	Metagenome	Rhizosphere
275	3300042139	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442	Metagenome	Rhizosphere
276	3300042142	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610	Metagenome	Rhizosphere
277	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
278	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
279	3300042147	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618	Metagenome	Rhizosphere
280	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
281	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
282	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
283	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
284	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
285	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
286	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
287	3300042530	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047	Metagenome	Rhizosphere
288	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
289	3300042533	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472	Metagenome	Rhizosphere
290	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
291	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
292	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
293	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
294	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
295	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
296	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
297	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
298	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
299	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
300	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
301	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
302	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
303	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
304	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
305	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
306	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
307	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
308	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
309	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
310	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
311	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
312	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
313	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
314	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
315	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
316	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
317	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
318	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
319	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
320	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
321	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
322	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
323	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
324	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
325	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
326	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
327	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
328	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
329	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
330	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
331	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
332	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
333	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
334	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
335	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
336	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
337	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
338	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
339	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
340	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
341	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
342	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
343	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
344	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
345	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
346	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
347	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
348	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
349	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
350	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
351	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
352	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
353	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
354	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
355	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
356	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
357	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
358	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
359	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
360	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
361	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
362	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
363	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
364	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
365	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
366	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
367	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
368	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
369	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
370	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
371	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
372	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
373	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
374	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
375	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
376	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
377	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
378	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
379	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
380	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
381	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
382	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
383	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
384	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
385	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
386	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
387	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
388	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
389	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
390	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
391	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
392	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
393	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
394	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
395	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
396	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
397	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
398	3300049519	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought	Metagenome	Rhizosphere
399	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
400	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
401	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
402	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
403	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
404	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
405	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
406	3300049652	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought	Metagenome	Rhizosphere
407	3300049668	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought	Metagenome	Rhizosphere
408	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
409	3300049672	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought	Metagenome	Rhizosphere
410	3300049675	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control	Metagenome	Rhizosphere
411	3300049676	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control	Metagenome	Rhizosphere
412	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
413	3300049708	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control	Metagenome	Rhizosphere
414	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
415	3300049759	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought	Metagenome	Rhizosphere
416	3300049765	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought	Metagenome	Rhizosphere
417	3300049767	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought	Metagenome	Rhizosphere
418	3300049770	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control	Metagenome	Rhizosphere
419	3300049771	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control	Metagenome	Rhizosphere
420	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
421	3300049851	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought	Metagenome	Rhizosphere
422	3300049853	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought	Metagenome	Rhizosphere
423	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
424	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
425	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
426	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
427	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
428	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
429	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
430	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
431	3300053135	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere	Metagenome	Endosphere
432	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
433	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
434	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
435	8057160832	Larsenimonas rhizosphaerae GH2-1	Isolate	Rhizosphere
436	2511231004	Pseudomonas sp. GM102	Isolate	Nodule
437	2511231006	Pseudomonas sp. GM17	Isolate	Nodule
438	2511231007	Pseudomonas sp. GM18	Isolate	Nodule
439	2511231008	Pseudomonas sp. GM21	Isolate	Nodule
440	2511231010	Pseudomonas sp. GM25	Isolate	Nodule
441	2511231011	Pseudomonas sp. GM30	Isolate	Nodule
442	2511231012	Pseudomonas sp. GM33	Isolate	Nodule
443	2511231014	Pseudomonas sp. GM48	Isolate	Nodule
444	2511231015	Pseudomonas sp. GM49	Isolate	Nodule
445	2511231016	Pseudomonas sp. GM50	Isolate	Nodule
446	2511231017	Pseudomonas sp. GM55	Isolate	Nodule
447	2511231018	Pseudomonas sp. GM60	Isolate	Nodule
448	2511231019	Pseudomonas sp. GM67	Isolate	Nodule
449	2511231020	Pseudomonas sp. GM74	Isolate	Nodule
450	2511231021	Pseudomonas sp. GM78	Isolate	Nodule
451	2511231022	Pseudomonas sp. GM79	Isolate	Nodule
452	2511231023	Pseudomonas sp. GM80	Isolate	Nodule
453	2511231024	Pseudomonas sp. GM84	Isolate	Nodule
454	2511231031	Pseudomonas sp. GM16	Isolate	Nodule
455	2511231156	Pseudomonas ogarae F113	Isolate	Rhizosphere
456	2512047018	Pseudomonas chlororaphis chlororaphis GP72	Isolate	Rhizosphere
457	2554235132	Pseudomonas aeruginosa PGPR2	Isolate	Unclassified
458	2554235231	Pseudomonas putida MTCC 5279	Isolate	Unclassified
459	2554235341	Pseudomonas protegens CHA0	Isolate	Rhizosphere
460	2582580891	Pseudomonas chlororaphis YL-1	Isolate	Unclassified
461	2597489887	Pseudomonas chlororaphis aureofaciens 30-84	Isolate	Rhizosphere
462	2597489888	Pseudomonas fluorescens SS101	Isolate	Rhizosphere
463	2597489889	Pseudomonas synxantha BG33R	Isolate	Rhizosphere
464	2599185155	Pseudomonas sp. NFACC10-1	Isolate	Rhizoplane
465	2599185160	Pseudomonas sp. NFPP25	Isolate	Rhizoplane
466	2599185161	Pseudomonas sp. NFPP09	Isolate	Rhizoplane
467	2599185162	Pseudomonas sp. NFPP10	Isolate	Rhizoplane
468	2599185163	Pseudomonas sp. NFPP12	Isolate	Rhizoplane
469	2599185164	Pseudomonas sp. NFPP13	Isolate	Rhizoplane
470	2599185165	Pseudomonas sp. NFPP18	Isolate	Rhizoplane
471	2599185166	Pseudomonas sp. NFPP08	Isolate	Rhizoplane
472	2599185167	Pseudomonas sp. NFPP28	Isolate	Rhizoplane
473	2599185168	Pseudomonas sp. NFPP05	Isolate	Rhizoplane
474	2599185179	Pseudomonas sp. NFR09	Isolate	Rhizoplane
475	2599185181	Pseudomonas sp. NFPP17	Isolate	Rhizoplane
476	2599185182	Pseudomonas sp. NFPP19	Isolate	Rhizoplane
477	2599185185	Pseudomonas sp. NFPP07	Isolate	Rhizoplane
478	2599185186	Pseudomonas sp. NFPP15	Isolate	Rhizoplane
479	2599185188	Pseudomonas sp. NFACC45	Isolate	Rhizoplane
480	2599185189	Pseudomonas sp. NFPP02	Isolate	Rhizoplane
481	2599185190	Pseudomonas sp. NFPP04	Isolate	Rhizoplane
482	2599185191	Pseudomonas sp. NFPP24	Isolate	Rhizoplane
483	2599185212	Pseudomonas sp. NFACC15-1	Isolate	Rhizoplane
484	2599185248	Pseudomonas sp. NFACC08-1	Isolate	Rhizoplane
485	2599185257	Pseudomonas sp. NFACC41-3	Isolate	Rhizoplane
486	2599185288	Pseudomonas sp. NFACC25	Isolate	Rhizoplane
487	2599185289	Pseudomonas sp. NFACC51	Isolate	Rhizoplane
488	2599185290	Pseudomonas sp. NFPP11	Isolate	Rhizoplane
489	2599185291	Pseudomonas sp. NFACC48-1	Isolate	Rhizoplane
490	2599185300	Pseudomonas sp. NFACC39-1	Isolate	Rhizoplane
491	2599185302	Pseudomonas sp. NFACC43	Isolate	Rhizoplane
492	2599185303	Pseudomonas sp. NFACC42-2	Isolate	Rhizoplane
493	2599185304	Pseudomonas sp. NFACC47-1	Isolate	Rhizoplane
494	2599185305	Pseudomonas sp. NFACC07-1	Isolate	Rhizoplane
495	2599185306	Pseudomonas sp. NFACC16-2	Isolate	Rhizoplane
496	2599185307	Pseudomonas sp. NFACC02	Isolate	Rhizoplane
497	2599185308	Pseudomonas sp. NFACC17-2	Isolate	Rhizoplane
498	2599185309	Pseudomonas sp. NFACC49-2	Isolate	Rhizoplane
499	2599185310	Pseudomonas sp. NFACC09-4	Isolate	Rhizoplane
500	2599185311	Pseudomonas sp. NFACC04-2	Isolate	Rhizoplane
501	2599185312	Pseudomonas sp. NFACC32-1	Isolate	Rhizoplane
502	2599185313	Pseudomonas sp. NFACC05-1	Isolate	Rhizoplane
503	2599185314	Pseudomonas sp. NFACC23-1	Isolate	Rhizoplane
504	2599185315	Pseudomonas sp. NFACC44-2	Isolate	Rhizoplane
505	2599185316	Pseudomonas sp. NFACC52	Isolate	Rhizoplane
506	2599185317	Pseudomonas sp. NFACC06-1	Isolate	Rhizoplane
507	2599185318	Pseudomonas sp. NFACC13-1	Isolate	Rhizoplane
508	2599185319	Pseudomonas sp. NFACC24-1	Isolate	Rhizoplane
509	2599185320	Pseudomonas sp. NFACC36	Isolate	Rhizoplane
510	2599185321	Pseudomonas sp. NFACC54	Isolate	Rhizoplane
511	2599185322	Pseudomonas sp. NFACC14	Isolate	Rhizoplane
512	2599185323	Pseudomonas sp. NFACC37-1	Isolate	Rhizoplane
513	2599185324	Pseudomonas sp. NFACC46-3	Isolate	Rhizoplane
514	2599185325	Pseudomonas sp. NFACC56-3	Isolate	Rhizoplane
515	2599185356	Pseudomonas sp. NFPP14	Isolate	Rhizoplane
516	2600254930	Pseudomonas sp. NFIX10	Isolate	Rhizoplane
517	2600254931	Pseudomonas sp. NFIX28	Isolate	Rhizoplane
518	2600254954	Pseudomonas sp. NFACC19-2	Isolate	Rhizoplane
519	2600255283	Pseudomonas sp. NFR16	Isolate	Rhizoplane
520	2600255296	Pseudomonas sp. NFR02	Isolate	Rhizoplane
521	2600255313	Pseudomonas sp. NFPP16	Isolate	Rhizoplane
522	2600255318	Pseudomonas putida NFIX47	Isolate	Rhizoplane
523	2600255389	Pseudomonas sp. NFPP33	Isolate	Rhizoplane
524	2603880185	Pseudomonas sp. NFIX46	Isolate	Rhizoplane
525	2603880199	Pseudomonas sp. NFIX49	Isolate	Rhizoplane
526	2606217733	Pseudomonas aeruginosa NFHH01	Isolate	Rhizoplane
527	2619619299	Pseudomonas veronii R4 Genome sequencing	Isolate	Unclassified
528	2623620443	Pseudomonas sp. DR 5-09	Isolate	Unclassified
529	2623620446	Pseudomonas sp. GR 6-02	Isolate	Unclassified
530	2643221565	Pseudomonas sp. Root562	Isolate	Unclassified
531	2643221571	Pseudomonas sp. Root569	Isolate	Unclassified
532	2643221589	Pseudomonas sp. Root68	Isolate	Unclassified
533	2643221602	Pseudomonas sp. Root71	Isolate	Unclassified
534	2643221633	Pseudomonas sp. Root329	Isolate	Unclassified
535	2643221650	Pseudomonas sp. Root401	Isolate	Unclassified
536	2643221713	Pseudomonas sp. Root9	Isolate	Unclassified
537	2651869719	Genome Sequence of Pseudomonas fluorescens UM270	Isolate	Rhizosphere
538	2667528170	Pseudomonas sp. NFACC50-1	Isolate	Rhizoplane
539	2667528171	Pseudomonas sp. NFPP22	Isolate	Rhizoplane
540	2667528176	Pseudomonas sp. NFACC11-2	Isolate	Rhizoplane
541	2671180172	Pseudomonas sp. NFIX51	Isolate	Rhizoplane
542	2675903420	Pseudomonas fluorescens Ps006	Isolate	Unclassified
543	2675903515	Pseudomonas thivervalensis DSM 13194	Isolate	Unclassified
544	2690315857	Rheinheimera sp. EpRS3	Isolate	Unclassified
545	2713897148	Pseudomonas fluorescens SF39a	Isolate	Rhizosphere
546	2713897149	Pseudomonas fluorescens SF4c	Isolate	Rhizosphere
547	2718217725	Pseudomonas fluorescens CREA-C16	Isolate	Rhizosphere
548	2721755607	Pseudomonas fluorescens Pt14	Isolate	Rhizosphere
549	2728369097	Stutzerimonas balearica st101	Isolate	Unclassified
550	2738541265	Pseudomonas sp. GV077	Isolate	Unclassified
551	2738541271	Pseudomonas sp. GV021	Isolate	Unclassified
552	2738541282	Pseudomonas sp. GV058	Isolate	Unclassified
553	2738541294	Pseudomonas sp. GV087	Isolate	Unclassified
554	2738541303	Pseudomonas sp. GV105	Isolate	Unclassified
555	2738541309	Pseudomonas sp. GV047	Isolate	Unclassified
556	2738543004	Pseudomonas sp. GV085	Isolate	Unclassified
557	2738543015	Pseudomonas sp. GV041	Isolate	Unclassified
558	2738543016	Pseudomonas sp. GV012	Isolate	Unclassified
559	2738543020	Pseudomonas sp. GV054	Isolate	Unclassified
560	2738543021	Pseudomonas sp. GV071	Isolate	Unclassified
561	2738543025	Pseudomonas sp. GV091	Isolate	Unclassified
562	2740892503	Pseudomonas chlororaphis piscium PCL1391	Isolate	Unclassified
563	2744054620	Pseudomonas thivervalensis LMG 21626	Isolate	Unclassified
564	2765235841	Pseudomonas putida AA7	Isolate	Unclassified
565	2773857670	Pseudomonas sp. 478	Isolate	Unclassified
566	2773857673	Pseudomonas sp. 443	Isolate	Unclassified
567	2784132063	Pseudomonas sp. 424	Isolate	Unclassified
568	2784132072	Pseudomonas sp. 460	Isolate	Unclassified
569	2791355520	Pseudomonas sp. s211(2017)	Isolate	Unclassified
570	2806310737	Pseudomonas mosselii BS011	Isolate	Unclassified
571	2806310745	Pseudomonas mosselii PtA1	Isolate	Unclassified
572	2808606361	Pseudomonas sp. SJZ075	Isolate	Rhizosphere
573	2808606373	Pseudomonas sp. SLBN-2	Isolate	Unclassified
574	2808606376	Pseudomonas sp. SJZ074	Isolate	Rhizosphere
575	2808606377	Pseudomonas sp. SJZ083	Isolate	Rhizosphere
576	2808606378	Pseudomonas sp. SJZ078	Isolate	Rhizosphere
577	2808606379	Pseudomonas sp. SJZ079	Isolate	Rhizosphere
578	2808606380	Pseudomonas sp. SJZ085	Isolate	Rhizosphere
579	2808606381	Pseudomonas sp. SJZ077	Isolate	Rhizosphere
580	2808606382	Pseudomonas sp. SJZ080	Isolate	Rhizosphere
581	2808606383	Pseudomonas sp. SJZ124	Isolate	Rhizosphere
582	2808606385	Pseudomonas sp. SJZ103	Isolate	Rhizosphere
583	2808606388	Pseudomonas sp. SJZ094	Isolate	Rhizosphere
584	2808606389	Pseudomonas sp. SJZ101	Isolate	Rhizosphere
585	2808606445	Pseudomonas sp. SJZ131	Isolate	Rhizosphere
586	2811994881	Pseudomonas sp. SLBN-26	Isolate	Unclassified
587	2816332298	Pseudomonas veronii R02	Isolate	Rhizosphere
588	2818991456	Pseudomonas koreensis 3286	Isolate	Rhizosphere
589	2818991464	Pseudomonas protegens 3295	Isolate	Rhizosphere
590	2823421272	Pseudomonas mendocina S5.2	Isolate	Rhizoplane
591	2825651385	Pseudomonas brassicacearum L13-6-12	Isolate	Rhizosphere
592	2826581358	Pseudomonas viridiflava CDRTc14	Isolate	Unclassified
593	2834028612	Pseudomonas fluorescens 513	Isolate	Unclassified
594	2842805378	Pseudomonas sp. R-72599	Isolate	Unclassified
595	2842815866	Pseudomonas sp. R-72210	Isolate	Unclassified
596	2842826826	Pseudomonas sp. R-72172	Isolate	Unclassified
597	2842832357	Pseudomonas sp. R-72164	Isolate	Unclassified
598	2842837860	Pseudomonas sp. R-72102	Isolate	Unclassified
599	2842843487	Pseudomonas sp. R-72074	Isolate	Unclassified
600	2842849001	Pseudomonas sp. R-72008	Isolate	Unclassified
601	2842854478	Pseudomonas sp. R-71998	Isolate	Unclassified
602	2844665904	Pseudomonas protegens H1F10C	Isolate	Unclassified
603	2852612431	Pseudomonas sp. SJZ073	Isolate	Rhizosphere
604	2852657418	Pseudomonas sp. JAI115	Isolate	Rhizosphere
605	2852667396	Pseudomonas sp. JAI120	Isolate	Rhizosphere
606	2860339153	Pseudomonas sp. JAI111	Isolate	Rhizosphere
607	2860867994	Pseudomonas sp. R1-43-08	Isolate	Rhizosphere
608	2878029506	Pseudomonas fluorescens DR397	Isolate	Rhizosphere
609	2880230671	Pseudomonas fluorescens LBUM677	Isolate	Unclassified
610	2904518522	Pseudomonas fluorescens 4488	Isolate	Rhizosphere
611	2904550169	Stutzerimonas stutzeri 1099	Isolate	Rhizosphere
612	2908446538	Pseudomonas sp. R76	Isolate	Rhizosphere
613	2912963787	Pseudomonas sp. R32	Isolate	Rhizosphere
614	2913036834	Pseudomonas viciae 11K1	Isolate	Rhizosphere
615	2917070673	Pseudomonas protegens CHA0	Isolate	Rhizosphere
616	2919063839	Pseudomonas pharyngis 1098	Isolate	Rhizosphere
617	2919155634	Pseudomonas fulva 1992	Isolate	Unclassified
618	2919385768	Pseudomonas sp. 2957	Isolate	Unclassified
619	2919456309	Pseudomonas sp. 3296	Isolate	Rhizosphere
620	2919481497	Pseudomonas brassicacearum 3432	Isolate	Unclassified
621	2919487758	Pseudomonas koreensis 3441	Isolate	Unclassified
622	2919501602	Pseudomonas alcaliphila 3512	Isolate	Unclassified
623	2919534386	Rheinheimera pacifica 3879	Isolate	Unclassified
624	2919688452	Pararheinheimera soli 4138	Isolate	Unclassified
625	2919697872	Pseudomonas frederiksbergensis 4169	Isolate	Unclassified
626	2923153595	Pseudomonas chlororaphis piscium PCL1391	Isolate	Unclassified
627	2923519811	Pseudomonas otitidis SLBN-103	Isolate	Rhizosphere
628	2923586266	Pseudomonas fluorescens 1550	Isolate	Rhizosphere
629	2926063275	Pseudomonas sp. 3400	Isolate	Unclassified
630	2929144301	Pseudomonas sp. R-71838 Hybrid assembly	Isolate	Unclassified
631	2929189879	Pseudomonas sp. R-71842 Hybrid assembly	Isolate	Unclassified
632	2931369376	Pseudomonas fluorescens DR133	Isolate	Rhizosphere
633	2931390751	Pseudomonas sp. DR208	Isolate	Rhizosphere
634	2931396565	Pseudomonas sp. DR48	Isolate	Rhizosphere
635	2935353572	Pseudomonas protegens TECH19	Isolate	Unclassified
636	2939636861	Pseudomonas sp. 2725	Isolate	Rhizosphere
637	2939651529	Pseudomonas sp. 2835	Isolate	Rhizosphere
638	2945928738	Pseudomonas cedrina W1I11	Isolate	Rhizosphere
639	2945961074	Pseudomonas sp. W2I6	Isolate	Rhizosphere
640	2946006987	Pseudomonas sp. W3I7	Isolate	Rhizosphere
641	2946027586	Pseudomonas sp. W4I3	Isolate	Rhizosphere
642	2947233263	Pseudomonas synxantha W2I4	Isolate	Rhizosphere
643	2952252522	Salinicola sp. DM10	Isolate	Unclassified
644	2969304461	Pseudomonas sp. R84	Isolate	Rhizosphere
645	2974289157	Pseudomonas fluorescens SORGH_AS 191	Isolate	Unclassified
646	2984286254	Pseudomonas chlororaphis aurantiaca JD37	Isolate	Rhizosphere
647	2988728565	Pseudomonas corrugata RM1-1-4	Isolate	Rhizosphere
648	2990196909	Pseudomonas mangrovi TC-11	Isolate	Unclassified
649	2998139840	Pseudomonas iranensis SWRI54	Isolate	Rhizosphere
650	3007252601	Pseudomonas punonensis D1-6	Isolate	Unclassified
651	3007315729	Pseudomonas argentinensis SA190	Isolate	Unclassified
652	3007395558	Pseudomonas chlororaphis PCL1601	Isolate	Rhizosphere
653	3007419365	Pseudomonas vanderleydeniana RW8P3	Isolate	Unclassified
654	3007511990	Pseudomonas fluorescens G20-18	Isolate	Rhizosphere
655	3007614139	Pseudomonas sp. PB106	Isolate	Unclassified
656	3007619802	Pseudomonas sp. PB120	Isolate	Unclassified
657	3007718800	Pseudomonas fluorescens BW11P2	Isolate	Rhizosphere
658	3007803356	Pseudomonas sp. CM27	Isolate	Unclassified
659	3007855910	Pseudomonas khorasanensis SWRI153	Isolate	Rhizosphere
660	3007861166	Pseudomonas hamedanensis SWRI65	Isolate	Rhizosphere
661	3007866637	Pseudomonas marvdashtae SWRI102	Isolate	Rhizosphere
662	3007872151	Pseudomonas sp. SWRI51	Isolate	Rhizosphere
663	637000220	Pseudomonas protegens Pf-5	Isolate	Rhizoplane
664	640427133	Stutzerimonas stutzeri A1501	Isolate	Rhizosphere
665	651053060	Stutzerimonas stutzeri CMT.A.9	Isolate	Rhizosphere
666	8011350971	Pseudomonas sp. 30_B	Isolate	Rhizosphere
667	8015687852	Pseudomonas chlororaphis aurantiaca RP4	Isolate	Rhizosphere
668	8019769354	Pseudomonas sp. MSSRFD41	Isolate	Rhizosphere
669	8019775933	Pseudomonas sp. PvR083	Isolate	Rhizosphere
670	8029995093	Pseudomonas atacamensis SM1	Isolate	Rhizosphere
671	8034962539	Pseudomonas sediminis PI11	Isolate	Rhizosphere
672	8052494512	Pseudomonas putida LD6	Isolate	Unclassified
673	8054285046	Pseudomonas petroselini MAFF 311096	Isolate	Nodule
674	8054347763	Pseudomonas carnis NWU Be30	Isolate	Unclassified
675	8054503363	Pseudomonas sivasensis BsEB-1	Isolate	Unclassified
676	8054929484	Pseudomonas vlassakiae RW4S1	Isolate	Rhizosphere
677	8055770955	Pseudomonas chlororaphis qlu-1	Isolate	Rhizosphere
678	8055817908	Pseudomonas pergaminensis 1008	Isolate	Rhizosphere
679	8055878733	Pseudomonas palmensis BBB001	Isolate	Rhizosphere
680	8056115690	Pseudomonas muyukensis COW39	Isolate	Rhizosphere
681	8056120720	Pseudomonas maumuensis COW77	Isolate	Rhizosphere
682	8056125926	Pseudomonas azerbaijanorientalis SWRI123	Isolate	Rhizosphere
683	8056131705	Pseudomonas asgharzadehiana SWRI132	Isolate	Rhizosphere
684	8056137416	Pseudomonas fakonensis COW40	Isolate	Rhizosphere
685	8056143049	Pseudomonas alvandae SWRI17	Isolate	Rhizosphere
686	8056148874	Pseudomonas khavaziana SWRI124	Isolate	Rhizosphere
687	8056155041	Pseudomonas farris SWRI79	Isolate	Rhizosphere
688	8056161164	Pseudomonas azadiae SWRI103	Isolate	Rhizosphere
689	8056166840	Pseudomonas triticicola SWRI88	Isolate	Rhizosphere
690	8056172158	Pseudomonas ekonensis COR58	Isolate	Rhizosphere
691	8056177738	Pseudomonas azerbaijanoccidentalis SWRI74	Isolate	Rhizosphere
692	8056569372	Pseudomonas serboccidentalis IT-P374	Isolate	Rhizosphere
693	8057798959	Pseudomonas piscis BW16M1	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	83.4
Metatranscriptomes	0.38
Isolates	16.23

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	4.26
Nodule	1.94
Rhizoplane	6.58
Rhizosphere	77.94
Stem	0
Stem Tuber	0
Unclassified	1.07

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	MRS2a_Contig_171	2124908027	Bacteria	22045
2	MRS2a_Contig_6967	2124908027	Bacteria	3308
3	SwRhRL2b_contig_1451204	2162886007	Bacteria	1529
4	SwRhRL2b_contig_691707	2162886007	Bacteria	2668
5	MBSR1b_contig_12180039	2162886012	Bacteria	1496
6	JGI24741J21665_1015105	3300001915	Bacteria	1279
7	JGI25162J39368_1000126	3300002737	Bacteria	84404
8	JGI25162J39368_1001425	3300002737	Bacteria	12960
9	JGI25163J39215_1002661	3300002771	Bacteria	1721
10	JGI25163J39215_1002760	3300002771	Bacteria	1640
11	JGI25164J39214_1000100	3300002772	Bacteria	84404
12	JGI25164J39214_1000703	3300002772	Bacteria	12960
13	JGI25165J46597_1000207	3300003214	Bacteria	84404
14	JGI25165J46597_1001416	3300003214	Bacteria	12960
15	Ga0007409J51694_1047625	3300003575	Bacteria	6922
16	Ga0007416J51690_1045476	3300003577	Bacteria	6861
17	Ga0055538_1000029	3300003751	Bacteria	203858
18	Ga0055539_1000039	3300003752	Bacteria	203858
19	Ga0055533_1000049	3300003756	Bacteria	203858
20	Ga0055532_1000049	3300003758	Bacteria	174079
21	Ga0055525_1000077	3300003759	Bacteria	166608
22	Ga0055535_1003857	3300003761	Bacteria	3959
23	Ga0055536_1000062	3300003781	Bacteria	99169
24	Ga0055536_1005866	3300003781	Bacteria	5893
25	Ga0055536_1005929	3300003781	Bacteria	5842
26	Ga0055536_1041588	3300003781	Bacteria	1083
27	Ga0055530_10002470	3300003791	Bacteria	11858
28	Ga0055530_10003906	3300003791	Bacteria	8114
29	Ga0055530_10007963	3300003791	Bacteria	4334
30	Ga0055540_1001086	3300003792	Bacteria	17251
31	Ga0055540_1006959	3300003792	Bacteria	4371
32	Ga0055540_1007302	3300003792	Bacteria	4202
33	Ga0055531_10001423	3300003794	Bacteria	17662
34	Ga0055541_1000026	3300003841	Bacteria	203858
35	Ga0058692_1011602	3300003856	Bacteria	2120
36	Ga0065714_10001303	3300005288	Bacteria	1392
37	Ga0065714_10014444	3300005288	Bacteria	2267
38	Ga0065714_10021449	3300005288	Bacteria	1857
39	Ga0065714_10069503	3300005288	Bacteria	4199
40	Ga0065714_10070811	3300005288	Bacteria	3758
41	Ga0065714_10073081	3300005288	Bacteria	3244
42	Ga0065704_10006087	3300005289	Bacteria	3829
43	Ga0065704_10038396	3300005289	Bacteria	942
44	Ga0065704_10078027	3300005289	Bacteria	4547
45	Ga0065704_10082904	3300005289	Bacteria	3536
46	Ga0065704_10138543	3300005289	Bacteria	1543
47	Ga0065712_10067895	3300005290	Bacteria	22221
48	Ga0065712_10073356	3300005290	Bacteria	4418
49	Ga0065715_10341422	3300005293	Bacteria	966
50	Ga0065715_10378122	3300005293	Bacteria	911
51	Ga0070676_10138993	3300005328	Bacteria	1544
52	Ga0070676_10182855	3300005328	Bacteria	1364
53	Ga0070676_10332729	3300005328	Bacteria	1039
54	Ga0070676_10391042	3300005328	Bacteria	965
55	Ga0070683_100396623	3300005329	Bacteria	1316
56	Ga0070690_100000719	3300005330	Bacteria	16991
57	Ga0070670_100007345	3300005331	Bacteria	9353
58	Ga0070670_100019001	3300005331	Bacteria	5893
59	Ga0070670_100019945	3300005331	Bacteria	5755
60	Ga0070670_100037004	3300005331	Bacteria	4199
61	Ga0068869_100003518	3300005334	Bacteria	9607
62	Ga0068869_100091777	3300005334	Bacteria	2285
63	Ga0068869_100371145	3300005334	Bacteria	1171
64	Ga0070666_10031212	3300005335	Bacteria	3517
65	Ga0070689_100000456	3300005340	Bacteria	24162
66	Ga0070687_100245619	3300005343	Bacteria	1109
67	Ga0070661_100000066	3300005344	Bacteria	84469
68	Ga0070692_10064081	3300005345	Bacteria	1943
69	Ga0070692_10201527	3300005345	Bacteria	1166
70	Ga0070668_100023051	3300005347	Bacteria	4706
71	Ga0070668_100276875	3300005347	Bacteria	1400
72	Ga0070669_100000310	3300005353	Bacteria	38441
73	Ga0070669_100002278	3300005353	Bacteria	13917
74	Ga0070669_100704280	3300005353	Bacteria	853
75	Ga0070675_100004285	3300005354	Bacteria	10867
76	Ga0070671_100073649	3300005355	Bacteria	2853
77	Ga0070674_100067525	3300005356	Bacteria	2515
78	Ga0070674_100187930	3300005356	Bacteria	1587
79	Ga0070673_100012875	3300005364	Bacteria	5760
80	Ga0070688_100003781	3300005365	Bacteria	7843
81	Ga0070659_100403227	3300005366	Bacteria	1155
82	Ga0070659_100429489	3300005366	Bacteria	1118
83	Ga0070667_100015612	3300005367	Bacteria	6279
84	Ga0070714_100290989	3300005435	Bacteria	1520
85	Ga0070713_100080241	3300005436	Bacteria	2782
86	Ga0070705_100047677	3300005440	Bacteria	2478
87	Ga0070700_100020606	3300005441	Bacteria	3822
88	Ga0070708_100012416	3300005445	Bacteria	6954
89	Ga0070678_100271730	3300005456	Bacteria	1430
90	Ga0070662_100000560	3300005457	Bacteria	22585
91	Ga0070662_100010655	3300005457	Bacteria	6046
92	Ga0070662_100146748	3300005457	Bacteria	1833
93	Ga0070662_100183306	3300005457	Bacteria	1652
94	Ga0070681_10184216	3300005458	Bacteria	2009
95	Ga0070681_10347650	3300005458	Bacteria	1393
96	Ga0070681_10624568	3300005458	Bacteria	992
97	Ga0070685_10043870	3300005466	Bacteria	2558
98	Ga0070685_10099447	3300005466	Bacteria	1774
99	Ga0070707_100050612	3300005468	Unclassified	3982
100	Ga0070707_100268048	3300005468	Bacteria	1661
101	Ga0070698_100001630	3300005471	Bacteria	24982
102	Ga0070699_100051049	3300005518	Unclassified	3581
103	Ga0070684_100002650	3300005535	Bacteria	13202
104	Ga0070697_100025329	3300005536	Unclassified	4732
105	Ga0070697_100042428	3300005536	Bacteria	3681
106	Ga0070697_100183470	3300005536	Bacteria	1774
107	Ga0068853_100006406	3300005539	Bacteria	9353
108	Ga0070672_100206976	3300005543	Bacteria	1642
109	Ga0070672_100708327	3300005543	Bacteria	882
110	Ga0070686_100001421	3300005544	Bacteria	13503
111	Ga0070695_100242531	3300005545	Bacteria	1308
112	Ga0070695_100382655	3300005545	Bacteria	1062
113	Ga0070693_100080419	3300005547	Bacteria	1941
114	Ga0070665_100010087	3300005548	Bacteria	9559
115	Ga0070665_100011182	3300005548	Bacteria	9075
116	Ga0070665_100045076	3300005548	Bacteria	4428
117	Ga0070665_100075428	3300005548	Bacteria	3379
118	Ga0070665_100125618	3300005548	Bacteria	2568
119	Ga0070704_100165899	3300005549	Bacteria	1751
120	Ga0068855_100166818	3300005563	Bacteria	2496
121	Ga0070664_100000034	3300005564	Bacteria	82848
122	Ga0070664_100000627	3300005564	Bacteria	27072
123	Ga0070664_100511218	3300005564	Bacteria	1108
124	Ga0068857_100051108	3300005577	Bacteria	3666
125	Ga0068857_100299477	3300005577	Bacteria	1482
126	Ga0068857_100706888	3300005577	Bacteria	958
127	Ga0068854_100004163	3300005578	Bacteria	9096
128	Ga0068854_100129224	3300005578	Bacteria	1927
129	Ga0070702_100003859	3300005615	Bacteria	6785
130	Ga0070702_100463345	3300005615	Bacteria	922
131	Ga0068859_100003159	3300005617	Bacteria	16751
132	Ga0068864_100014873	3300005618	Bacteria	6466
133	Ga0068866_10087266	3300005718	Bacteria	1690
134	Ga0068861_100003678	3300005719	Bacteria	10230
135	Ga0068851_10000006	3300005834	Bacteria	258116
136	Ga0068870_10039576	3300005840	Bacteria	2440
137	Ga0068863_100001397	3300005841	Bacteria	23940
138	Ga0068863_100595954	3300005841	Bacteria	1093
139	Ga0068863_100955194	3300005841	Bacteria	859
140	Ga0068858_100015959	3300005842	Bacteria	7054
141	Ga0068858_100088357	3300005842	Bacteria	2884
142	Ga0068860_100055149	3300005843	Bacteria	3777
143	Ga0068862_100002861	3300005844	Bacteria	15127
144	Ga0068862_100035148	3300005844	Bacteria	4242
145	Ga0068862_100202108	3300005844	Bacteria	1792
146	Ga0068862_100474628	3300005844	Bacteria	1183
147	Ga0070717_10007349	3300006028	Bacteria	8179
148	Ga0075364_10046097	3300006051	Bacteria	2838
149	Ga0075364_10257016	3300006051	Bacteria	1187
150	Ga0075432_10008574	3300006058	Bacteria	3487
151	Ga0075432_10009709	3300006058	Bacteria	3276
152	Ga0070716_100358480	3300006173	Bacteria	1035
153	Ga0075367_10280642	3300006178	Bacteria	1047
154	Ga0075366_10109039	3300006195	Bacteria	1665
155	Ga0097621_100010282	3300006237	Bacteria	6837
156	Ga0097621_100190504	3300006237	Bacteria	1776
157	Ga0097621_100750207	3300006237	Unclassified	901
158	Ga0075370_10241869	3300006353	Bacteria	1069
159	Ga0068871_100004635	3300006358	Bacteria	9602
160	Ga0075428_100265145	3300006844	Bacteria	1849
161	Ga0075428_100326608	3300006844	Bacteria	1648
162	Ga0075431_100007997	3300006847	Bacteria	10549
163	Ga0075431_100162762	3300006847	Bacteria	2294
164	Ga0075433_10506590	3300006852	Bacteria	1062
165	Ga0075436_100110690	3300006914	Bacteria	1917
166	Ga0075436_100192508	3300006914	Bacteria	1443
167	Ga0075436_100199810	3300006914	Bacteria	1416
168	Ga0075436_100258488	3300006914	Bacteria	1241
169	Ga0097620_100003159	3300006931	Bacteria	16751
170	Ga0099823_1000054	3300006944	Bacteria	55085
171	Ga0079104_1000168	3300006946	Bacteria	93546
172	Ga0079104_1000917	3300006946	Bacteria	23727
173	Ga0079104_1008299	3300006946	Bacteria	3652
174	Ga0079104_1061440	3300006946	Bacteria	808
175	Ga0099826_10041729	3300006948	Bacteria	3180
176	Ga0105251_10000004	3300009011	Bacteria	285212
177	Ga0105251_10000149	3300009011	Bacteria	71244
178	Ga0105251_10000935	3300009011	Bacteria	26139
179	Ga0105251_10007261	3300009011	Bacteria	6870
180	Ga0105251_10008400	3300009011	Bacteria	6216
181	Ga0105251_10008504	3300009011	Bacteria	6165
182	Ga0105251_10014429	3300009011	Bacteria	4367
183	Ga0105251_10019003	3300009011	Bacteria	3639
184	Ga0105251_10021793	3300009011	Bacteria	3338
185	Ga0105244_10000922	3300009036	Bacteria	24861
186	Ga0105244_10002753	3300009036	Bacteria	13108
187	Ga0105244_10008859	3300009036	Bacteria	6241
188	Ga0105244_10009872	3300009036	Bacteria	5826
189	Ga0105244_10010706	3300009036	Bacteria	5544
190	Ga0105244_10015168	3300009036	Bacteria	4426
191	Ga0105244_10016594	3300009036	Bacteria	4190
192	Ga0105244_10019111	3300009036	Bacteria	3833
193	Ga0105244_10020978	3300009036	Bacteria	3620
194	Ga0105244_10150388	3300009036	Bacteria	1116
195	Ga0105250_10000235	3300009092	Bacteria	46317
196	Ga0105250_10003383	3300009092	Bacteria	7565
197	Ga0105250_10004467	3300009092	Bacteria	6432
198	Ga0105250_10015626	3300009092	Bacteria	3108
199	Ga0105250_10018123	3300009092	Bacteria	2855
200	Ga0105250_10052397	3300009092	Bacteria	1637
201	Ga0111539_10028141	3300009094	Bacteria	6862
202	Ga0111539_10074684	3300009094	Bacteria	3994
203	Ga0105245_10032469	3300009098	Bacteria	4622
204	Ga0105245_10035703	3300009098	Bacteria	4413
205	Ga0114129_10483575	3300009147	Bacteria	1620
206	Ga0114129_10847723	3300009147	Bacteria	1162
207	Ga0105243_10001292	3300009148	Bacteria	22446
208	Ga0105243_10001767	3300009148	Bacteria	18576
209	Ga0105243_10048834	3300009148	Bacteria	3337
210	Ga0105243_10051064	3300009148	Bacteria	3269
211	Ga0105243_10082160	3300009148	Bacteria	2632
212	Ga0105243_10113837	3300009148	Bacteria	2269
213	Ga0105243_10116182	3300009148	Bacteria	2247
214	Ga0105243_10127448	3300009148	Unclassified	2155
215	Ga0105243_10232047	3300009148	Bacteria	1638
216	Ga0105241_10196023	3300009174	Bacteria	1684
217	Ga0105242_10000233	3300009176	Bacteria	43902
218	Ga0105248_10031547	3300009177	Bacteria	5922
219	Ga0105248_10144389	3300009177	Bacteria	2685
220	Ga0105248_10447996	3300009177	Bacteria	1455
221	Ga0105237_10000160	3300009545	Bacteria	95183
222	Ga0105249_10011694	3300009553	Bacteria	7719
223	Ga0105249_10091591	3300009553	Bacteria	2845
224	Ga0105249_10360269	3300009553	Bacteria	1475
225	Ga0105249_10369054	3300009553	Bacteria	1458
226	Ga0105239_10378102	3300010375	Bacteria	1601
227	Ga0105246_10000822	3300011119	Bacteria	17660
228	Ga0105246_10007947	3300011119	Bacteria	6511
229	Ga0105246_10029231	3300011119	Bacteria	3628
230	Ga0105246_10035518	3300011119	Bacteria	3332
231	Ga0157345_1000347	3300012498	Bacteria	5414
232	Ga0157345_1001213	3300012498	Bacteria	1832
233	Ga0157373_10001605	3300013100	Bacteria	17261
234	Ga0157373_10038460	3300013100	Bacteria	3429
235	Ga0157373_10044239	3300013100	Bacteria	3179
236	Ga0157373_10044865	3300013100	Bacteria	3156
237	Ga0157373_10168738	3300013100	Bacteria	1540
238	Ga0157373_10205811	3300013100	Bacteria	1388
239	Ga0157371_10000460	3300013102	Bacteria	49750
240	Ga0157371_10007535	3300013102	Bacteria	8798
241	Ga0157371_10026024	3300013102	Bacteria	4257
242	Ga0157371_10035291	3300013102	Bacteria	3584
243	Ga0157370_10005690	3300013104	Bacteria	13932
244	Ga0157370_10114694	3300013104	Bacteria	2517
245	Ga0157370_10196643	3300013104	Bacteria	1871
246	Ga0157370_10200401	3300013104	Bacteria	1851
247	Ga0157370_10211042	3300013104	Bacteria	1799
248	Ga0157370_10584906	3300013104	Bacteria	1023
249	Ga0157369_10024260	3300013105	Bacteria	6750
250	Ga0157369_10101555	3300013105	Bacteria	3065
251	Ga0157374_10290568	3300013296	Bacteria	1615
252	Ga0163162_10004406	3300013306	Bacteria	13546
253	Ga0163162_10036266	3300013306	Bacteria	4913
254	Ga0163162_10049386	3300013306	Bacteria	4216
255	Ga0163162_10606341	3300013306	Bacteria	1221
256	Ga0157372_10000815	3300013307	Bacteria	33774
257	Ga0157372_10080528	3300013307	Bacteria	3685
258	Ga0157375_10191804	3300013308	Bacteria	2198
259	Ga0157375_10213551	3300013308	Bacteria	2087
260	Ga0157375_10257952	3300013308	Bacteria	1905
261	Ga0163163_10001762	3300014325	Bacteria	18241
262	Ga0163163_10123676	3300014325	Bacteria	2623
263	Ga0182008_10000570	3300014497	Bacteria	27277
264	Ga0182008_10009461	3300014497	Bacteria	5257
265	Ga0182008_10010235	3300014497	Bacteria	5026
266	Ga0182008_10021109	3300014497	Bacteria	3348
267	Ga0182008_10028961	3300014497	Bacteria	2799
268	Ga0182008_10029387	3300014497	Bacteria	2777
269	Ga0157377_10005529	3300014745	Bacteria	5948
270	Ga0157377_10363385	3300014745	Bacteria	975
271	Ga0157379_10300798	3300014968	Bacteria	1462
272	Ga0157379_10372322	3300014968	Bacteria	1310
273	Ga0157376_10009699	3300014969	Bacteria	7007
274	Ga0157376_10319306	3300014969	Bacteria	1476
275	Ga0182006_1010353	3300015261	Bacteria	4148
276	Ga0182006_1013729	3300015261	Bacteria	3505
277	Ga0182006_1014261	3300015261	Bacteria	3429
278	Ga0182006_1017575	3300015261	Bacteria	3036
279	Ga0182006_1033200	3300015261	Bacteria	2070
280	Ga0182007_10006004	3300015262	Bacteria	5264
281	Ga0182005_1004963	3300015265	Bacteria	4215
282	Ga0182005_1005966	3300015265	Bacteria	3769
283	Ga0163161_10002088	3300017792	Bacteria	14477
284	Ga0163161_10026335	3300017792	Bacteria	4119
285	Ga0163161_10032561	3300017792	Bacteria	3723
286	Ga0163161_10054321	3300017792	Bacteria	2907
287	Ga0163161_10099733	3300017792	Bacteria	2160
288	Ga0163161_10105763	3300017792	Bacteria	2099
289	Ga0163161_10169443	3300017792	Bacteria	1669
290	Ga0213872_10014367	3300021361	Bacteria	3694
291	Ga0209435_104244	3300025206	Bacteria	1625
292	Ga0209760_100124	3300025207	Bacteria	51804
293	Ga0209760_100248	3300025207	Bacteria	22328
294	Ga0209784_100045	3300025224	Bacteria	203911
295	Ga0209566_100057	3300025225	Bacteria	203960
296	Ga0209674_100080	3300025226	Bacteria	203960
297	Ga0209147_100079	3300025229	Bacteria	203960
298	Ga0209563_100078	3300025230	Bacteria	203960
299	Ga0209563_100693	3300025230	Bacteria	10636
300	Ga0207427_100001	3300025231	Bacteria	1410763
301	Ga0207427_100004	3300025231	Bacteria	939600
302	Ga0209437_100003	3300025233	Bacteria	1517827
303	Ga0209437_100028	3300025233	Bacteria	540136
304	Ga0209258_100178	3300025242	Bacteria	138843
305	Ga0209646_1000311	3300025246	Bacteria	38501
306	Ga0209677_100045	3300025253	Bacteria	203960
307	Ga0209759_1019274	3300025256	Bacteria	1623
308	Ga0209233_1000007	3300025261	Bacteria	1411234
309	Ga0209233_1000008	3300025261	Bacteria	1356712
310	Ga0209675_1006640	3300025291	Bacteria	4600
311	Ga0209676_1000056	3300025292	Bacteria	361329
312	Ga0209676_1000078	3300025292	Bacteria	296293
313	Ga0209676_1000101	3300025292	Bacteria	227976
314	Ga0209676_1000721	3300025292	Bacteria	45474
315	Ga0209676_1004156	3300025292	Bacteria	8235
316	Ga0209676_1025598	3300025292	Bacteria	1889
317	Ga0209050_1000027	3300025298	Bacteria	483261
318	Ga0209050_1000041	3300025298	Bacteria	408004
319	Ga0209050_1000181	3300025298	Bacteria	142533
320	Ga0209050_1012325	3300025298	Bacteria	3932
321	Ga0209051_1000061	3300025303	Bacteria	253485
322	Ga0209051_1000065	3300025303	Bacteria	231445
323	Ga0209051_1000085	3300025303	Bacteria	189973
324	Ga0209257_1000105	3300025304	Bacteria	243729
325	Ga0207656_10000017	3300025321	Bacteria	117646
326	Ga0207696_1000022	3300025711	Bacteria	427529
327	Ga0207696_1000032	3300025711	Bacteria	380071
328	Ga0207696_1000044	3300025711	Bacteria	300953
329	Ga0207696_1000121	3300025711	Bacteria	143687
330	Ga0207696_1003748	3300025711	Bacteria	6792
331	Ga0207696_1010960	3300025711	Bacteria	3296
332	Ga0207696_1012123	3300025711	Bacteria	3061
333	Ga0207696_1014335	3300025711	Bacteria	2725
334	Ga0207696_1015398	3300025711	Bacteria	2595
335	Ga0207696_1015997	3300025711	Bacteria	2524
336	Ga0207655_1000005	3300025728	Bacteria	917277
337	Ga0207655_1000015	3300025728	Bacteria	600662
338	Ga0207655_1000086	3300025728	Bacteria	206068
339	Ga0207655_1000240	3300025728	Bacteria	90267
340	Ga0207655_1000462	3300025728	Bacteria	53331
341	Ga0207655_1001109	3300025728	Bacteria	26304
342	Ga0207655_1001511	3300025728	Bacteria	21214
343	Ga0207655_1002564	3300025728	Bacteria	14532
344	Ga0207655_1010677	3300025728	Bacteria	5552
345	Ga0207655_1010955	3300025728	Bacteria	5447
346	Ga0207655_1014380	3300025728	Bacteria	4477
347	Ga0207655_1015351	3300025728	Bacteria	4265
348	Ga0207655_1021397	3300025728	Bacteria	3284
349	Ga0207655_1021619	3300025728	Bacteria	3258
350	Ga0207655_1022609	3300025728	Bacteria	3145
351	Ga0207655_1022848	3300025728	Bacteria	3119
352	Ga0207655_1032143	3300025728	Bacteria	2403
353	Ga0207655_1034497	3300025728	Bacteria	2274
354	Ga0207655_1042674	3300025728	Bacteria	1928
355	Ga0207655_1066925	3300025728	Bacteria	1355
356	Ga0207713_1000013	3300025735	Bacteria	475751
357	Ga0207713_1000104	3300025735	Bacteria	138310
358	Ga0207713_1000356	3300025735	Bacteria	50001
359	Ga0207713_1000454	3300025735	Bacteria	42911
360	Ga0207713_1002869	3300025735	Bacteria	12103
361	Ga0207713_1005217	3300025735	Bacteria	8196
362	Ga0207713_1005892	3300025735	Bacteria	7568
363	Ga0207713_1007324	3300025735	Bacteria	6536
364	Ga0207713_1008142	3300025735	Bacteria	6077
365	Ga0207713_1009230	3300025735	Bacteria	5585
366	Ga0207713_1011540	3300025735	Bacteria	4792
367	Ga0207713_1018084	3300025735	Bacteria	3501
368	Ga0207713_1028558	3300025735	Bacteria	2513
369	Ga0207713_1030937	3300025735	Bacteria	2376
370	Ga0207713_1038032	3300025735	Bacteria	2046
371	Ga0207713_1042962	3300025735	Bacteria	1871
372	Ga0207713_1055597	3300025735	Bacteria	1544
373	Ga0207642_10015135	3300025899	Bacteria	2865
374	Ga0207642_10017031	3300025899	Bacteria	2754
375	Ga0207680_10043693	3300025903	Bacteria	2630
376	Ga0207645_10019435	3300025907	Bacteria	4453
377	Ga0207645_10090336	3300025907	Bacteria	1969
378	Ga0207645_10289298	3300025907	Bacteria	1089
379	Ga0207643_10061761	3300025908	Bacteria	2140
380	Ga0207684_10106107	3300025910	Unclassified	2403
381	Ga0207654_10061044	3300025911	Bacteria	2204
382	Ga0207654_10218408	3300025911	Bacteria	1263
383	Ga0207707_10328576	3300025912	Bacteria	1319
384	Ga0207671_10000019	3300025914	Bacteria	317781
385	Ga0207693_10147820	3300025915	Bacteria	1848
386	Ga0207662_10123404	3300025918	Bacteria	1626
387	Ga0207649_10000004	3300025920	Bacteria	360726
388	Ga0207649_10005922	3300025920	Bacteria	6626
389	Ga0207652_10391192	3300025921	Bacteria	1255
390	Ga0207646_10157473	3300025922	Unclassified	2049
391	Ga0207681_10000679	3300025923	Bacteria	22341
392	Ga0207681_10006793	3300025923	Bacteria	7017
393	Ga0207681_10076673	3300025923	Bacteria	2348
394	Ga0207681_10400484	3300025923	Bacteria	1109
395	Ga0207650_10000668	3300025925	Bacteria	26952
396	Ga0207650_10001102	3300025925	Bacteria	19910
397	Ga0207659_10010690	3300025926	Bacteria	5772
398	Ga0207687_10018389	3300025927	Bacteria	4612
399	Ga0207687_10351363	3300025927	Bacteria	1201
400	Ga0207700_10083513	3300025928	Bacteria	2501
401	Ga0207644_10015594	3300025931	Bacteria	5103
402	Ga0207644_10295146	3300025931	Bacteria	1305
403	Ga0207706_10001474	3300025933	Bacteria	23502
404	Ga0207706_10019929	3300025933	Bacteria	6028
405	Ga0207706_10033343	3300025933	Bacteria	4585
406	Ga0207706_10273596	3300025933	Bacteria	1473
407	Ga0207706_10370770	3300025933	Bacteria	1243
408	Ga0207686_10002443	3300025934	Bacteria	10104
409	Ga0207686_10018350	3300025934	Bacteria	3960
410	Ga0207686_10416841	3300025934	Bacteria	1026
411	Ga0207709_10000067	3300025935	Bacteria	189188
412	Ga0207709_10000757	3300025935	Bacteria	25461
413	Ga0207709_10046537	3300025935	Bacteria	2633
414	Ga0207709_10060606	3300025935	Bacteria	2360
415	Ga0207709_10075331	3300025935	Bacteria	2156
416	Ga0207709_10118332	3300025935	Bacteria	1784
417	Ga0207709_10205547	3300025935	Bacteria	1410
418	Ga0207670_10008692	3300025936	Bacteria	5750
419	Ga0207669_10019420	3300025937	Bacteria	3538
420	Ga0207669_10365187	3300025937	Bacteria	1120
421	Ga0207704_10067105	3300025938	Unclassified	2255
422	Ga0207665_10374906	3300025939	Bacteria	1079
423	Ga0207691_10201732	3300025940	Bacteria	1731
424	Ga0207691_10801561	3300025940	Unclassified	791
425	Ga0207711_10005659	3300025941	Bacteria	10556
426	Ga0207711_10020084	3300025941	Bacteria	5568
427	Ga0207711_10565018	3300025941	Bacteria	1061
428	Ga0207689_10002855	3300025942	Bacteria	15930
429	Ga0207689_10180699	3300025942	Bacteria	1740
430	Ga0207689_10498314	3300025942	Bacteria	1020
431	Ga0207679_10000019	3300025945	Bacteria	230270
432	Ga0207679_10010986	3300025945	Bacteria	5843
433	Ga0207651_10003796	3300025960	Bacteria	7482
434	Ga0207651_10251808	3300025960	Bacteria	1445
435	Ga0207712_10008471	3300025961	Bacteria	6501
436	Ga0207712_10248162	3300025961	Bacteria	1437
437	Ga0207640_10243984	3300025981	Bacteria	1390
438	Ga0207658_10017612	3300025986	Bacteria	4926
439	Ga0207658_10255156	3300025986	Bacteria	1492
440	Ga0207677_10010677	3300026023	Bacteria	5203
441	Ga0207677_10197299	3300026023	Bacteria	1597
442	Ga0207703_10073102	3300026035	Bacteria	2835
443	Ga0207639_10003002	3300026041	Bacteria	11354
444	Ga0207708_10062007	3300026075	Bacteria	2856
445	Ga0207641_10002890	3300026088	Bacteria	15549
446	Ga0207641_10189382	3300026088	Bacteria	1890
447	Ga0207648_10007485	3300026089	Bacteria	10729
448	Ga0207648_10030556	3300026089	Bacteria	4769
449	Ga0207648_10057745	3300026089	Bacteria	3386
450	Ga0207676_10013694	3300026095	Bacteria	5823
451	Ga0207676_10134002	3300026095	Bacteria	2111
452	Ga0207674_10015582	3300026116	Bacteria	8347
453	Ga0207674_10041108	3300026116	Bacteria	4784
454	Ga0207674_10261163	3300026116	Bacteria	1679
455	Ga0207675_100005363	3300026118	Bacteria	12308
456	Ga0207683_10212405	3300026121	Bacteria	1762
457	Ga0207683_10409403	3300026121	Bacteria	1248
458	Ga0207698_10653513	3300026142	Bacteria	1042
459	Ga0209281_1000013	3300027111	Bacteria	653449
460	Ga0209281_1000015	3300027111	Bacteria	590084
461	Ga0209281_1006192	3300027111	Bacteria	3162
462	Ga0209281_1010143	3300027111	Bacteria	2172
463	Ga0209389_1000002	3300027296	Bacteria	333932
464	Ga0209371_1000239	3300027312	Bacteria	68842
465	Ga0209371_1000253	3300027312	Bacteria	65388
466	Ga0209996_1002616	3300027395	Bacteria	2235
467	Ga0210000_1005600	3300027462	Bacteria	1822
468	Ga0209995_1000414	3300027471	Bacteria	6643
469	Ga0210002_1025235	3300027617	Bacteria	971
470	Ga0209983_1000325	3300027665	Bacteria	9954
471	Ga0209971_1001041	3300027682	Bacteria	7079
472	Ga0207428_10014943	3300027907	Bacteria	6727
473	Ga0207428_10068923	3300027907	Bacteria	2782
474	Ga0207428_10107094	3300027907	Bacteria	2154
475	Ga0207428_10178972	3300027907	Bacteria	1603
476	Ga0207428_10237320	3300027907	Bacteria	1363
477	Ga0268266_10049461	3300028379	Bacteria	3606
478	Ga0268266_10054245	3300028379	Unclassified	3444
479	Ga0268266_10083402	3300028379	Bacteria	2790
480	Ga0268266_10187976	3300028379	Bacteria	1885
481	Ga0268265_10000650	3300028380	Bacteria	34459
482	Ga0268265_10292948	3300028380	Bacteria	1462
483	Ga0268265_10478530	3300028380	Bacteria	1169
484	Ga0268264_10084699	3300028381	Bacteria	2719
485	Ga0265319_1019905	3300028563	Bacteria	2496
486	Ga0265338_10031292	3300028800	Bacteria	5219
487	Ga0268256_1000199	3300030500	Bacteria	68849
488	Ga0268256_1000367	3300030500	Bacteria	42860
489	Ga0316177_1192305	3300030731	Bacteria	2322
490	Ga0314311_1259691	3300030733	Bacteria	4088
491	Ga0316178_1029444	3300030735	Bacteria	13753
492	Ga0265328_10004765	3300031239	Bacteria	5858
493	Ga0265331_10013025	3300031250	Bacteria	4481
494	Ga0265331_10032074	3300031250	Bacteria	2605
495	Ga0265327_10000133	3300031251	Bacteria	163887
496	Ga0265327_10000463	3300031251	Bacteria	72345
497	Ga0307509_10000013	3300031507	Bacteria	283027
498	Ga0307408_100000081	3300031548	Bacteria	106920
499	Ga0307408_100029937	3300031548	Bacteria	3776
500	Ga0307408_100036505	3300031548	Bacteria	3455
501	Ga0307408_100128295	3300031548	Bacteria	1975
502	Ga0316575_10101170	3300031665	Bacteria	1172
503	Ga0316579_10014494	3300031691	Bacteria	3410
504	Ga0307405_10044598	3300031731	Bacteria	2712
505	Ga0307405_10055321	3300031731	Bacteria	2483
506	Ga0307405_10063105	3300031731	Bacteria	2348
507	Ga0307405_10084486	3300031731	Bacteria	2084
508	Ga0316577_10018931	3300031733	Bacteria	3810
509	Ga0307413_10077359	3300031824	Bacteria	2118
510	Ga0307413_10361853	3300031824	Bacteria	1123
511	Ga0307413_10503511	3300031824	Bacteria	973
512	Ga0307410_10047645	3300031852	Unclassified	2866
513	Ga0307410_10089743	3300031852	Bacteria	2178
514	Ga0307410_10131461	3300031852	Bacteria	1839
515	Ga0307406_10384481	3300031901	Bacteria	1107
516	Ga0307406_10549815	3300031901	Bacteria	944
517	Ga0307407_10035521	3300031903	Bacteria	2738
518	Ga0307407_10119643	3300031903	Bacteria	1667
519	Ga0307412_10003321	3300031911	Bacteria	8937
520	Ga0307412_10031495	3300031911	Bacteria	3350
521	Ga0307412_10135039	3300031911	Bacteria	1798
522	Ga0307412_10149474	3300031911	Bacteria	1721
523	Ga0307412_10602220	3300031911	Bacteria	931
524	Ga0307409_100025594	3300031995	Bacteria	4142
525	Ga0307409_100092724	3300031995	Bacteria	2479
526	Ga0307409_100367754	3300031995	Bacteria	1362
527	Ga0307416_100030005	3300032002	Bacteria	4074
528	Ga0307416_100036222	3300032002	Bacteria	3781
529	Ga0307414_10022993	3300032004	Bacteria	3943
530	Ga0307414_10069231	3300032004	Bacteria	2536
531	Ga0307414_10179981	3300032004	Bacteria	1699
532	Ga0307414_10225412	3300032004	Bacteria	1541
533	Ga0307411_10074082	3300032005	Bacteria	2318
534	Ga0307411_10105001	3300032005	Bacteria	2007
535	Ga0307411_10369781	3300032005	Bacteria	1175
536	Ga0307415_100084167	3300032126	Bacteria	2281
537	Ga0307415_100174414	3300032126	Bacteria	1680
538	Ga0307415_100355682	3300032126	Bacteria	1235
539	Ga0316585_10078473	3300032137	Bacteria	1075
540	Ga0316593_10000099	3300032168	Bacteria	11220
541	Ga0316593_10014115	3300032168	Bacteria	2377
542	Ga0316593_10110773	3300032168	Bacteria	980
543	Ga0307510_10049469	3300033180	Bacteria	4470
544	Ga0373944_0051811	3300035089	Bacteria	1295
545	Ga0373955_0066993	3300035172	Bacteria	1998
546	Ga0373955_0127967	3300035172	Unclassified	1481
547	Ga0373924_0279692	3300035410	Unclassified	740
548	Ga0373933_0282283	3300035724	Bacteria	1073
549	Ga0373937_0169200	3300036401	Bacteria	2050
550	Ga0372808_012930	3300036459	Bacteria	1187
551	Ga0316582_0001289	3300036647	Bacteria	10845
552	Ga0316582_0022179	3300036647	Bacteria	3766
553	Ga0316582_0183759	3300036647	Bacteria	1423
554	Ga0316584_0017354	3300036712	Bacteria	5172
555	Ga0316584_0037905	3300036712	Bacteria	3585
556	Ga0316584_0049147	3300036712	Bacteria	3152
557	Ga0373925_0252703	3300037068	Bacteria	1414
558	Ga0436361_0266070	3300039447	Bacteria	2816
559	Ga0436361_0402518	3300039447	Bacteria	3236
560	Ga0436361_0853791	3300039447	Unclassified	1258
561	Ga0436361_0886702	3300039447	Bacteria	1371
562	Ga0436361_1090902	3300039447	Bacteria	923
563	Ga0436363_0453668	3300039450	Bacteria	3450
564	Ga0439436_0000833	3300041404	Bacteria	8396
565	Ga0439438_001224	3300041405	Bacteria	11394
566	Ga0439438_001549	3300041405	Bacteria	10138
567	Ga0439438_004008	3300041405	Bacteria	5784
568	Ga0439438_005594	3300041405	Bacteria	4588
569	Ga0439438_005790	3300041405	Bacteria	4487
570	Ga0439438_009352	3300041405	Bacteria	3177
571	Ga0439438_010359	3300041405	Bacteria	2949
572	Ga0439438_012607	3300041405	Bacteria	2586
573	Ga0439438_014920	3300041405	Bacteria	2300
574	Ga0439438_021047	3300041405	Bacteria	1823
575	Ga0439447_004142	3300041407	Bacteria	5037
576	Ga0439447_008988	3300041407	Bacteria	3059
577	Ga0439447_009049	3300041407	Bacteria	3041
578	Ga0439447_010776	3300041407	Bacteria	2699
579	Ga0439447_011832	3300041407	Bacteria	2528
580	Ga0439447_020833	3300041407	Bacteria	1732
581	Ga0439447_021385	3300041407	Bacteria	1704
582	Ga0439447_055998	3300041407	Bacteria	934
583	Ga0439466_0000342	3300041411	Bacteria	17912
584	Ga0439466_0003474	3300041411	Bacteria	6107
585	Ga0439466_0008671	3300041411	Bacteria	3830
586	Ga0439466_0010056	3300041411	Bacteria	3518
587	Ga0439466_0010233	3300041411	Bacteria	3488
588	Ga0439466_0019467	3300041411	Bacteria	2428
589	Ga0439466_0023531	3300041411	Bacteria	2165
590	Ga0439466_0024435	3300041411	Bacteria	2117
591	Ga0439466_0044354	3300041411	Bacteria	1473
592	Ga0439465_0016289	3300041413	Bacteria	2319
593	Ga0439431_0003060	3300041997	Bacteria	3671
594	Ga0439437_000399	3300042000	Bacteria	4188
595	Ga0439432_002272	3300042006	Bacteria	7244
596	Ga0439432_007703	3300042006	Bacteria	3809
597	Ga0439432_010293	3300042006	Bacteria	3243
598	Ga0439432_023996	3300042006	Bacteria	2005
599	Ga0439432_028347	3300042006	Bacteria	1823
600	Ga0439432_035862	3300042006	Bacteria	1588
601	Ga0439451_004096	3300042009	Bacteria	2960
602	Ga0439451_005064	3300042009	Bacteria	2681
603	Ga0439451_008818	3300042009	Bacteria	2043
604	Ga0439451_010053	3300042009	Bacteria	1908
605	Ga0439451_010169	3300042009	Bacteria	1898
606	Ga0439451_033649	3300042009	Bacteria	1030
607	Ga0439452_001929	3300042010	Bacteria	7949
608	Ga0439452_003201	3300042010	Bacteria	5790
609	Ga0439452_009021	3300042010	Bacteria	2965
610	Ga0439452_010042	3300042010	Bacteria	2767
611	Ga0439452_013708	3300042010	Bacteria	2268
612	Ga0439452_017846	3300042010	Bacteria	1899
613	Ga0439452_023445	3300042010	Bacteria	1588
614	Ga0439452_033172	3300042010	Bacteria	1255
615	Ga0439455_0009743	3300042012	Bacteria	2094
616	Ga0439456_000039	3300042013	Bacteria	48127
617	Ga0439463_000853	3300042016	Bacteria	8362
618	Ga0439463_002002	3300042016	Bacteria	5301
619	Ga0439463_086530	3300042016	Bacteria	806
620	Ga0450911_000037	3300042115	Bacteria	60341
621	Ga0450911_001642	3300042115	Bacteria	4967
622	Ga0450911_003964	3300042115	Bacteria	2496
623	Ga0450911_005848	3300042115	Bacteria	1874
624	Ga0450919_002466	3300042121	Bacteria	2396
625	Ga0450920_003526	3300042122	Bacteria	2716
626	Ga0450922_001072	3300042124	Bacteria	2742
627	Ga0450888_007943	3300042126	Bacteria	1186
628	Ga0450890_002228	3300042127	Bacteria	2693
629	Ga0450891_002892	3300042129	Bacteria	1695
630	Ga0450900_001058	3300042136	Bacteria	2539
631	Ga0450902_000054	3300042137	Bacteria	10769
632	Ga0450902_001616	3300042137	Bacteria	3102
633	Ga0450902_004122	3300042137	Bacteria	2155
634	Ga0450903_005673	3300042138	Bacteria	2086
635	Ga0450904_000010	3300042139	Bacteria	43301
636	Ga0450904_010490	3300042139	Bacteria	915
637	Ga0450905_000679	3300042142	Bacteria	4166
638	Ga0450905_001423	3300042142	Bacteria	3055
639	Ga0450905_014329	3300042142	Bacteria	1130
640	Ga0450906_006204	3300042145	Bacteria	2420
641	Ga0450906_009913	3300042145	Bacteria	1808
642	Ga0450907_001932	3300042146	Bacteria	4188
643	Ga0450907_002488	3300042146	Bacteria	3503
644	Ga0450907_004667	3300042146	Bacteria	2349
645	Ga0450910_003911	3300042147	Bacteria	1997
646	Ga0439446_0000240	3300042156	Bacteria	10126
647	Ga0439446_0004286	3300042156	Bacteria	3605
648	Ga0439446_0010458	3300042156	Bacteria	2498
649	Ga0439446_0025440	3300042156	Bacteria	1691
650	Ga0450908_008905	3300042184	Bacteria	1874
651	Ga0450908_009004	3300042184	Bacteria	1862
652	Ga0450909_000714	3300042185	Bacteria	4453
653	Ga0439434_0000961	3300042435	Bacteria	8290
654	Ga0439434_0004881	3300042435	Bacteria	3924
655	Ga0439434_0043007	3300042435	Bacteria	1390
656	Ga0439459_0003627	3300042438	Bacteria	2461
657	Ga0439464_0004058	3300042439	Bacteria	3727
658	Ga0439460_0002311	3300042461	Bacteria	4585
659	Ga0439460_0019492	3300042461	Bacteria	1838
660	Ga0450916_001065	3300042530	Bacteria	2670
661	Ga0450916_015004	3300042530	Bacteria	1015
662	Ga0450893_0003022	3300042532	Bacteria	2646
663	Ga0450901_001489	3300042533	Bacteria	2666
664	Ga0450901_002348	3300042533	Bacteria	2053
665	Ga0451577_0015060	3300042876	Bacteria	7195
666	Ga0451577_0042643	3300042876	Bacteria	4068
667	Ga0439440_0006002	3300042993	Bacteria	2430
668	Ga0439440_0011180	3300042993	Bacteria	1889
669	Ga0439440_0034438	3300042993	Bacteria	1211
670	Ga0453684_0021288	3300044712	Bacteria	9700
671	Ga0453684_0038545	3300044712	Bacteria	6531
672	Ga0453684_0323772	3300044712	Bacteria	1745
673	Ga0466957_0022085	3300044842	Bacteria	3753
674	Ga0451576_0006228	3300045051	Bacteria	14692
675	Ga0495617_006990	3300046452	Bacteria	3934
676	Ga0495617_008831	3300046452	Bacteria	3468
677	Ga0495617_010175	3300046452	Bacteria	3221
678	Ga0495617_011834	3300046452	Bacteria	2976
679	Ga0495617_016434	3300046452	Bacteria	2502
680	Ga0495617_035200	3300046452	Bacteria	1681
681	Ga0495617_035936	3300046452	Bacteria	1662
682	Ga0495617_048118	3300046452	Bacteria	1419
683	Ga0495627_000021	3300046453	Bacteria	282454
684	Ga0495627_000279	3300046453	Bacteria	51531
685	Ga0495627_002877	3300046453	Bacteria	7932
686	Ga0495627_012871	3300046453	Bacteria	2954
687	Ga0495627_014761	3300046453	Bacteria	2716
688	Ga0495627_080545	3300046453	Bacteria	944
689	Ga0495603_0019669	3300046455	Bacteria	4088
690	Ga0495603_0277600	3300046455	Bacteria	963
691	Ga0495590_0005949	3300046457	Bacteria	4783
692	Ga0495590_0016364	3300046457	Bacteria	2678
693	Ga0495590_0017594	3300046457	Bacteria	2570
694	Ga0495590_0069610	3300046457	Bacteria	1233
695	Ga0495591_000015	3300046458	Bacteria	252107
696	Ga0495591_001669	3300046458	Bacteria	13384
697	Ga0495591_002885	3300046458	Bacteria	9218
698	Ga0495591_004439	3300046458	Bacteria	6880
699	Ga0495591_008588	3300046458	Bacteria	4167
700	Ga0495591_017922	3300046458	Bacteria	2415
701	Ga0495591_019956	3300046458	Bacteria	2228
702	Ga0495591_022689	3300046458	Bacteria	2023
703	Ga0495591_023035	3300046458	Bacteria	2003
704	Ga0495591_023688	3300046458	Bacteria	1961
705	Ga0495591_030044	3300046458	Bacteria	1644
706	Ga0495638_0007372	3300046460	Bacteria	7894
707	Ga0495638_0036374	3300046460	Bacteria	3137
708	Ga0495638_0055561	3300046460	Bacteria	2458
709	Ga0495638_0058604	3300046460	Bacteria	2386
710	Ga0495638_0069392	3300046460	Bacteria	2160
711	Ga0495638_0122312	3300046460	Bacteria	1536
712	Ga0495638_0133732	3300046460	Bacteria	1454
713	Ga0495638_0158103	3300046460	Bacteria	1309
714	Ga0495638_0306666	3300046460	Bacteria	853
715	Ga0495653_0004180	3300046463	Bacteria	11682
716	Ga0495653_0081973	3300046463	Bacteria	2382
717	Ga0495653_0122134	3300046463	Bacteria	1854
718	Ga0495653_0164470	3300046463	Bacteria	1537
719	Ga0495650_0000672	3300046471	Bacteria	44486
720	Ga0495650_0004078	3300046471	Bacteria	10214
721	Ga0495650_0010244	3300046471	Bacteria	5243
722	Ga0495650_0014847	3300046471	Bacteria	4023
723	Ga0495650_0022764	3300046471	Bacteria	2999
724	Ga0495650_0037643	3300046471	Bacteria	2103
725	Ga0495650_0051113	3300046471	Bacteria	1704
726	Ga0495582_0040447	3300046473	Bacteria	2567
727	Ga0495605_0000016	3300046474	Bacteria	289508
728	Ga0495605_0000031	3300046474	Bacteria	213242
729	Ga0495605_0005949	3300046474	Bacteria	7056
730	Ga0495605_0009557	3300046474	Bacteria	5443
731	Ga0495605_0012810	3300046474	Bacteria	4640
732	Ga0495605_0020101	3300046474	Bacteria	3552
733	Ga0495605_0031769	3300046474	Bacteria	2694
734	Ga0495605_0031806	3300046474	Bacteria	2693
735	Ga0495605_0034297	3300046474	Bacteria	2570
736	Ga0495605_0036229	3300046474	Bacteria	2488
737	Ga0495605_0040464	3300046474	Bacteria	2327
738	Ga0495605_0063532	3300046474	Bacteria	1761
739	Ga0495605_0067446	3300046474	Bacteria	1697
740	Ga0495639_0002355	3300046475	Bacteria	8263
741	Ga0495639_0049233	3300046475	Bacteria	1912
742	Ga0495584_0005988	3300046491	Bacteria	6406
743	Ga0495584_0012531	3300046491	Bacteria	4328
744	Ga0495584_0012719	3300046491	Bacteria	4295
745	Ga0495584_0015260	3300046491	Bacteria	3913
746	Ga0495584_0021042	3300046491	Bacteria	3312
747	Ga0495584_0027651	3300046491	Bacteria	2873
748	Ga0495584_0034231	3300046491	Bacteria	2570
749	Ga0495584_0036858	3300046491	Bacteria	2470
750	Ga0495584_0041200	3300046491	Bacteria	2331
751	Ga0495584_0049714	3300046491	Bacteria	2112
752	Ga0495584_0113765	3300046491	Bacteria	1369
753	Ga0495585_0006592	3300046492	Bacteria	7176
754	Ga0495585_0022832	3300046492	Bacteria	3591
755	Ga0495585_0045779	3300046492	Bacteria	2441
756	Ga0495585_0059474	3300046492	Bacteria	2105
757	Ga0495585_0062101	3300046492	Bacteria	2052
758	Ga0495585_0077647	3300046492	Bacteria	1802
759	Ga0495585_0087684	3300046492	Bacteria	1679
760	Ga0495585_0116968	3300046492	Bacteria	1413
761	Ga0495585_0136152	3300046492	Bacteria	1289
762	Ga0495594_0002644	3300046499	Bacteria	9322
763	Ga0495594_0019107	3300046499	Bacteria	3639
764	Ga0495594_0048410	3300046499	Bacteria	2335
765	Ga0495594_0159199	3300046499	Bacteria	1283
766	Ga0495596_0005366	3300046500	Bacteria	6065
767	Ga0495596_0005876	3300046500	Bacteria	5733
768	Ga0495596_0024558	3300046500	Bacteria	2439
769	Ga0495596_0145018	3300046500	Bacteria	922
770	Ga0495607_0000213	3300046501	Bacteria	61906
771	Ga0495607_0000248	3300046501	Bacteria	57955
772	Ga0495607_0000780	3300046501	Bacteria	30486
773	Ga0495607_0002842	3300046501	Bacteria	13733
774	Ga0495607_0009954	3300046501	Bacteria	6402
775	Ga0495607_0010598	3300046501	Bacteria	6186
776	Ga0495607_0011600	3300046501	Bacteria	5859
777	Ga0495607_0019456	3300046501	Bacteria	4314
778	Ga0495607_0027191	3300046501	Bacteria	3541
779	Ga0495607_0030137	3300046501	Bacteria	3333
780	Ga0495607_0032884	3300046501	Bacteria	3160
781	Ga0495607_0032982	3300046501	Bacteria	3154
782	Ga0495607_0036827	3300046501	Bacteria	2944
783	Ga0495607_0037458	3300046501	Bacteria	2913
784	Ga0495607_0048015	3300046501	Bacteria	2497
785	Ga0495607_0070640	3300046501	Bacteria	1950
786	Ga0495607_0072289	3300046501	Bacteria	1920
787	Ga0495607_0082589	3300046501	Bacteria	1762
788	Ga0495607_0109140	3300046501	Bacteria	1469
789	Ga0495607_0113200	3300046501	Bacteria	1435
790	Ga0495607_0143011	3300046501	Bacteria	1232
791	Ga0495607_0144008	3300046501	Bacteria	1226
792	Ga0495583_0000041	3300046506	Bacteria	234707
793	Ga0495583_0000698	3300046506	Bacteria	43244
794	Ga0495583_0001956	3300046506	Bacteria	18948
795	Ga0495583_0003486	3300046506	Bacteria	11919
796	Ga0495583_0007614	3300046506	Bacteria	6759
797	Ga0495583_0016954	3300046506	Bacteria	3888
798	Ga0495583_0026736	3300046506	Bacteria	2855
799	Ga0495583_0034128	3300046506	Bacteria	2440
800	Ga0495583_0190318	3300046506	Bacteria	837
801	Ga0495606_0000055	3300046507	Bacteria	199348
802	Ga0495606_0000076	3300046507	Bacteria	166969
803	Ga0495606_0002535	3300046507	Bacteria	21017
804	Ga0495606_0023678	3300046507	Bacteria	4444
805	Ga0495606_0050908	3300046507	Bacteria	2705
806	Ga0495606_0064208	3300046507	Bacteria	2337
807	Ga0495606_0067047	3300046507	Bacteria	2273
808	Ga0495606_0083156	3300046507	Bacteria	1985
809	Ga0495606_0141793	3300046507	Bacteria	1418
810	Ga0495606_0150054	3300046507	Bacteria	1369
811	Ga0495610_0011574	3300046512	Bacteria	5380
812	Ga0495610_0016739	3300046512	Bacteria	4209
813	Ga0495610_0021849	3300046512	Bacteria	3511
814	Ga0495610_0031218	3300046512	Bacteria	2782
815	Ga0495610_0032819	3300046512	Bacteria	2691
816	Ga0495610_0034496	3300046512	Bacteria	2605
817	Ga0495610_0041739	3300046512	Bacteria	2300
818	Ga0495610_0048829	3300046512	Bacteria	2075
819	Ga0495610_0055695	3300046512	Bacteria	1904
820	Ga0495610_0082407	3300046512	Bacteria	1474
821	Ga0495610_0182014	3300046512	Bacteria	873
822	Ga0495616_0018287	3300046513	Bacteria	3850
823	Ga0495616_0022459	3300046513	Bacteria	3407
824	Ga0495616_0023093	3300046513	Bacteria	3350
825	Ga0495616_0025380	3300046513	Bacteria	3167
826	Ga0495616_0037838	3300046513	Bacteria	2479
827	Ga0495616_0041922	3300046513	Bacteria	2332
828	Ga0495616_0061219	3300046513	Bacteria	1846
829	Ga0495616_0099844	3300046513	Bacteria	1362
830	Ga0495616_0110628	3300046513	Bacteria	1276
831	Ga0495616_0127904	3300046513	Bacteria	1167
832	Ga0495620_0000013	3300046515	Bacteria	160349
833	Ga0495620_0000015	3300046515	Bacteria	154625
834	Ga0495620_0004506	3300046515	Bacteria	7838
835	Ga0495620_0007041	3300046515	Bacteria	6134
836	Ga0495620_0009539	3300046515	Bacteria	5153
837	Ga0495620_0020921	3300046515	Bacteria	3185
838	Ga0495620_0028256	3300046515	Bacteria	2611
839	Ga0495620_0030607	3300046515	Bacteria	2475
840	Ga0495620_0039633	3300046515	Bacteria	2080
841	Ga0495630_0138273	3300046517	Bacteria	1851
842	Ga0495630_0542920	3300046517	Bacteria	891
843	Ga0495631_0001077	3300046518	Bacteria	16951
844	Ga0495631_0005402	3300046518	Bacteria	6686
845	Ga0495631_0013286	3300046518	Bacteria	3999
846	Ga0495631_0018500	3300046518	Bacteria	3277
847	Ga0495631_0019417	3300046518	Bacteria	3187
848	Ga0495631_0045872	3300046518	Bacteria	1923
849	Ga0495631_0056887	3300046518	Bacteria	1703
850	Ga0495632_0000912	3300046519	Bacteria	25920
851	Ga0495632_0000914	3300046519	Bacteria	25916
852	Ga0495632_0004792	3300046519	Bacteria	9107
853	Ga0495632_0006071	3300046519	Bacteria	7836
854	Ga0495632_0013874	3300046519	Bacteria	4579
855	Ga0495632_0016441	3300046519	Bacteria	4116
856	Ga0495632_0021792	3300046519	Bacteria	3445
857	Ga0495632_0023043	3300046519	Bacteria	3329
858	Ga0495632_0033788	3300046519	Bacteria	2622
859	Ga0495632_0034919	3300046519	Bacteria	2570
860	Ga0495632_0038242	3300046519	Bacteria	2430
861	Ga0495632_0039888	3300046519	Bacteria	2367
862	Ga0495632_0047112	3300046519	Bacteria	2139
863	Ga0495632_0058396	3300046519	Bacteria	1880
864	Ga0495632_0058489	3300046519	Bacteria	1878
865	Ga0495632_0075146	3300046519	Bacteria	1617
866	Ga0495637_0002612	3300046520	Bacteria	9881
867	Ga0495637_0004529	3300046520	Bacteria	7191
868	Ga0495637_0005694	3300046520	Bacteria	6319
869	Ga0495637_0007261	3300046520	Bacteria	5510
870	Ga0495637_0017172	3300046520	Bacteria	3376
871	Ga0495637_0018263	3300046520	Bacteria	3255
872	Ga0495637_0019162	3300046520	Bacteria	3165
873	Ga0495637_0020767	3300046520	Bacteria	3015
874	Ga0495637_0022348	3300046520	Bacteria	2885
875	Ga0495637_0022776	3300046520	Bacteria	2854
876	Ga0495637_0029922	3300046520	Bacteria	2419
877	Ga0495637_0033601	3300046520	Bacteria	2251
878	Ga0495637_0035383	3300046520	Bacteria	2181
879	Ga0495637_0043875	3300046520	Bacteria	1906
880	Ga0495637_0044521	3300046520	Bacteria	1889
881	Ga0495637_0046189	3300046520	Bacteria	1843
882	Ga0495637_0046435	3300046520	Bacteria	1837
883	Ga0495637_0057101	3300046520	Bacteria	1613
884	Ga0495637_0069147	3300046520	Bacteria	1429
885	Ga0495643_0000223	3300046522	Bacteria	86920
886	Ga0495643_0000903	3300046522	Bacteria	31380
887	Ga0495643_0005943	3300046522	Bacteria	8141
888	Ga0495643_0017044	3300046522	Bacteria	4256
889	Ga0495643_0024183	3300046522	Bacteria	3448
890	Ga0495643_0025143	3300046522	Bacteria	3372
891	Ga0495643_0039907	3300046522	Bacteria	2565
892	Ga0495643_0050678	3300046522	Bacteria	2235
893	Ga0495643_0079633	3300046522	Bacteria	1707
894	Ga0495643_0082044	3300046522	Bacteria	1676
895	Ga0495644_0002168	3300046523	Bacteria	7885
896	Ga0495644_0010883	3300046523	Bacteria	3505
897	Ga0495644_0011456	3300046523	Bacteria	3414
898	Ga0495644_0013322	3300046523	Bacteria	3156
899	Ga0495648_0001423	3300046524	Bacteria	23410
900	Ga0495648_0013055	3300046524	Bacteria	6162
901	Ga0495648_0015574	3300046524	Bacteria	5515
902	Ga0495648_0023408	3300046524	Bacteria	4230
903	Ga0495648_0025075	3300046524	Bacteria	4044
904	Ga0495648_0034686	3300046524	Bacteria	3280
905	Ga0495648_0041479	3300046524	Bacteria	2905
906	Ga0495648_0044521	3300046524	Bacteria	2769
907	Ga0495648_0047699	3300046524	Bacteria	2644
908	Ga0495648_0051298	3300046524	Bacteria	2514
909	Ga0495648_0059460	3300046524	Bacteria	2279
910	Ga0495648_0103951	3300046524	Bacteria	1560
911	Ga0495648_0181519	3300046524	Bacteria	1069
912	Ga0495666_0028181	3300046526	Bacteria	2763
913	Ga0495666_0028814	3300046526	Bacteria	2731
914	Ga0495666_0060953	3300046526	Bacteria	1802
915	Ga0495666_0076875	3300046526	Bacteria	1582
916	Ga0495666_0079427	3300046526	Bacteria	1553
917	Ga0495642_0007697	3300046528	Bacteria	4127
918	Ga0495642_0016767	3300046528	Bacteria	2857
919	Ga0495642_0098837	3300046528	Bacteria	1240
920	Ga0495654_0003364	3300046530	Bacteria	9852
921	Ga0495654_0003578	3300046530	Bacteria	9458
922	Ga0495654_0005355	3300046530	Bacteria	7476
923	Ga0495654_0011029	3300046530	Bacteria	4906
924	Ga0495654_0017170	3300046530	Bacteria	3809
925	Ga0495654_0019515	3300046530	Bacteria	3545
926	Ga0495654_0026301	3300046530	Bacteria	2992
927	Ga0495654_0026889	3300046530	Bacteria	2954
928	Ga0495654_0026928	3300046530	Bacteria	2951
929	Ga0495654_0027126	3300046530	Bacteria	2939
930	Ga0495654_0041676	3300046530	Bacteria	2282
931	Ga0495654_0049043	3300046530	Bacteria	2069
932	Ga0495654_0049607	3300046530	Bacteria	2055
933	Ga0495654_0049807	3300046530	Bacteria	2050
934	Ga0495654_0054386	3300046530	Bacteria	1942
935	Ga0495654_0084047	3300046530	Bacteria	1487
936	Ga0495654_0115631	3300046530	Bacteria	1219
937	Ga0495587_0011359	3300046536	Bacteria	5643
938	Ga0495587_0090248	3300046536	Bacteria	1770
939	Ga0495609_0000015	3300046538	Bacteria	322474
940	Ga0495609_0000070	3300046538	Bacteria	128181
941	Ga0495609_0003891	3300046538	Bacteria	8374
942	Ga0495609_0007126	3300046538	Bacteria	5622
943	Ga0495609_0011234	3300046538	Bacteria	4270
944	Ga0495609_0017860	3300046538	Bacteria	3292
945	Ga0495609_0026590	3300046538	Bacteria	2649
946	Ga0495609_0051738	3300046538	Bacteria	1828
947	Ga0495597_0000005	3300046542	Bacteria	286580
948	Ga0495597_0007051	3300046542	Bacteria	5754
949	Ga0495597_0017816	3300046542	Bacteria	3337
950	Ga0495597_0024033	3300046542	Bacteria	2815
951	Ga0495597_0027481	3300046542	Bacteria	2609
952	Ga0495597_0033890	3300046542	Bacteria	2309
953	Ga0495597_0036774	3300046542	Bacteria	2202
954	Ga0495597_0043811	3300046542	Bacteria	1991
955	Ga0495597_0104564	3300046542	Bacteria	1191
956	Ga0495622_0003963	3300046557	Bacteria	6912
957	Ga0495622_0006164	3300046557	Bacteria	5570
958	Ga0495622_0023199	3300046557	Bacteria	2892
959	Ga0495622_0078300	3300046557	Bacteria	1522
960	Ga0495622_0078683	3300046557	Bacteria	1518
961	Ga0495622_0180547	3300046557	Bacteria	946
962	Ga0495622_0233470	3300046557	Bacteria	812
963	Ga0495633_0000060	3300046558	Bacteria	144561
964	Ga0495633_0058007	3300046558	Bacteria	1817
965	Ga0495633_0094701	3300046558	Bacteria	1387
966	Ga0495656_0007313	3300046615	Bacteria	3897
967	Ga0495656_0050322	3300046615	Bacteria	1778
968	Ga0495668_0005973	3300046616	Bacteria	8089
969	Ga0495668_0014935	3300046616	Bacteria	4543
970	Ga0495668_0021887	3300046616	Bacteria	3658
971	Ga0495668_0031705	3300046616	Bacteria	2978
972	Ga0495668_0044242	3300046616	Bacteria	2474
973	Ga0495668_0069212	3300046616	Bacteria	1941
974	Ga0495668_0080940	3300046616	Bacteria	1782
975	Ga0495611_0000817	3300046648	Bacteria	17225
976	Ga0495611_0003416	3300046648	Bacteria	7005
977	Ga0495611_0008468	3300046648	Bacteria	4352
978	Ga0495611_0177806	3300046648	Bacteria	994
979	Ga0495625_0001491	3300046660	Bacteria	28149
980	Ga0495625_0039315	3300046660	Bacteria	3455
981	Ga0495625_0048065	3300046660	Bacteria	3074
982	Ga0495625_0056725	3300046660	Bacteria	2787
983	Ga0495625_0060601	3300046660	Bacteria	2680
984	Ga0495625_0060645	3300046660	Bacteria	2679
985	Ga0495625_0071993	3300046660	Bacteria	2425
986	Ga0495625_0073865	3300046660	Bacteria	2389
987	Ga0495625_0082198	3300046660	Bacteria	2240
988	Ga0495625_0092578	3300046660	Bacteria	2088
989	Ga0495635_0024927	3300046663	Bacteria	4167
990	Ga0495659_0003433	3300046664	Bacteria	5057
991	Ga0495659_0006875	3300046664	Bacteria	3597
992	Ga0495661_0000110	3300046665	Bacteria	97854
993	Ga0495661_0000139	3300046665	Bacteria	85160
994	Ga0495661_0000194	3300046665	Bacteria	70173
995	Ga0495661_0000304	3300046665	Bacteria	56019
996	Ga0495661_0033167	3300046665	Bacteria	3258
997	Ga0495661_0034653	3300046665	Bacteria	3174
998	Ga0495661_0045968	3300046665	Bacteria	2667
999	Ga0495661_0048299	3300046665	Bacteria	2586
1000	Ga0495661_0049273	3300046665	Bacteria	2555
1001	Ga0495661_0073246	3300046665	Bacteria	1996
1002	Ga0495661_0145959	3300046665	Bacteria	1282
1003	Ga0495588_0053045	3300046674	Bacteria	2090
1004	Ga0495657_0089469	3300046675	Bacteria	1978
1005	Ga0495623_0028796	3300046679	Bacteria	3574
1006	Ga0495623_0073396	3300046679	Bacteria	2127
1007	Ga0495646_0047386	3300046680	Bacteria	2616
1008	Ga0495646_0049353	3300046680	Bacteria	2554
1009	Ga0495646_0051265	3300046680	Bacteria	2498
1010	Ga0495613_0074858	3300046689	Bacteria	2465
1011	Ga0495613_0109373	3300046689	Bacteria	1993
1012	Ga0495624_0035375	3300046690	Bacteria	3225
1013	Ga0495670_0002014	3300046691	Bacteria	10003
1014	Ga0495670_0011663	3300046691	Bacteria	4324
1015	Ga0495670_0018131	3300046691	Bacteria	3466
1016	Ga0495670_0026679	3300046691	Bacteria	2860
1017	Ga0495670_0032892	3300046691	Bacteria	2579
1018	Ga0495670_0042087	3300046691	Bacteria	2279
1019	Ga0495670_0100585	3300046691	Bacteria	1488
1020	Ga0495671_0012159	3300046692	Bacteria	4705
1021	Ga0495671_0012308	3300046692	Bacteria	4676
1022	Ga0495671_0019657	3300046692	Bacteria	3566
1023	Ga0495671_0024378	3300046692	Bacteria	3150
1024	Ga0495671_0025919	3300046692	Bacteria	3043
1025	Ga0495671_0030073	3300046692	Bacteria	2784
1026	Ga0495671_0033768	3300046692	Bacteria	2604
1027	Ga0495671_0038679	3300046692	Bacteria	2410
1028	Ga0495671_0040673	3300046692	Bacteria	2343
1029	Ga0495671_0049899	3300046692	Bacteria	2085
1030	Ga0495671_0054005	3300046692	Bacteria	1992
1031	Ga0495671_0075482	3300046692	Bacteria	1653
1032	Ga0495649_0002123	3300046694	Bacteria	14216
1033	Ga0495649_0005972	3300046694	Bacteria	7633
1034	Ga0495649_0007467	3300046694	Bacteria	6660
1035	Ga0495649_0021051	3300046694	Bacteria	3656
1036	Ga0495649_0021264	3300046694	Bacteria	3635
1037	Ga0495649_0024872	3300046694	Bacteria	3337
1038	Ga0495649_0051810	3300046694	Bacteria	2225
1039	Ga0495649_0052077	3300046694	Bacteria	2218
1040	Ga0495649_0080205	3300046694	Bacteria	1745
1041	Ga0495649_0090182	3300046694	Bacteria	1634
1042	Ga0495649_0098465	3300046694	Bacteria	1555
1043	Ga0495589_0000855	3300046794	Bacteria	19099
1044	Ga0495589_0007319	3300046794	Bacteria	5784
1045	Ga0495589_0015046	3300046794	Bacteria	3981
1046	Ga0495589_0017341	3300046794	Bacteria	3696
1047	Ga0495589_0032608	3300046794	Bacteria	2618
1048	Ga0495589_0050600	3300046794	Bacteria	2054
1049	Ga0495589_0057921	3300046794	Bacteria	1905
1050	Ga0495589_0062720	3300046794	Bacteria	1823
1051	Ga0495589_0067841	3300046794	Bacteria	1745
1052	Ga0495600_0005020	3300046809	Bacteria	7955
1053	Ga0495600_0089228	3300046809	Bacteria	2011
1054	Ga0495660_0001756	3300046810	Bacteria	14444
1055	Ga0495660_0003768	3300046810	Bacteria	9298
1056	Ga0495660_0012162	3300046810	Bacteria	4993
1057	Ga0495660_0012461	3300046810	Bacteria	4936
1058	Ga0495660_0023430	3300046810	Bacteria	3520
1059	Ga0495660_0037271	3300046810	Bacteria	2709
1060	Ga0495660_0040878	3300046810	Bacteria	2569
1061	Ga0495660_0043801	3300046810	Bacteria	2465
1062	Ga0495660_0044186	3300046810	Bacteria	2452
1063	Ga0495660_0051200	3300046810	Bacteria	2247
1064	Ga0495660_0057350	3300046810	Bacteria	2101
1065	Ga0495660_0065231	3300046810	Bacteria	1944
1066	Ga0495660_0071753	3300046810	Bacteria	1835
1067	Ga0495660_0084041	3300046810	Bacteria	1665
1068	Ga0495660_0191757	3300046810	Bacteria	981
1069	Ga0495660_0234043	3300046810	Bacteria	859
1070	Ga0495660_0255303	3300046810	Bacteria	811
1071	Ga0495581_0035809	3300047315	Bacteria	2871
1072	Ga0495581_0048987	3300047315	Bacteria	2439
1073	Ga0495604_0069747	3300047317	Bacteria	2663
1074	Ga0495604_0096090	3300047317	Bacteria	2187
1075	Ga0495636_0139648	3300047318	Bacteria	1081
1076	Ga0495674_0094175	3300047319	Bacteria	2555
1077	Ga0495672_0004124	3300047320	Bacteria	12097
1078	Ga0495672_0019813	3300047320	Bacteria	4426
1079	Ga0495672_0021920	3300047320	Bacteria	4160
1080	Ga0495672_0022683	3300047320	Bacteria	4076
1081	Ga0495672_0022705	3300047320	Bacteria	4073
1082	Ga0495672_0023187	3300047320	Bacteria	4022
1083	Ga0495672_0025191	3300047320	Bacteria	3814
1084	Ga0495672_0035433	3300047320	Bacteria	3073
1085	Ga0495672_0039660	3300047320	Bacteria	2862
1086	Ga0495672_0040582	3300047320	Bacteria	2821
1087	Ga0495672_0040686	3300047320	Bacteria	2816
1088	Ga0495672_0042293	3300047320	Bacteria	2748
1089	Ga0495672_0043338	3300047320	Bacteria	2706
1090	Ga0495672_0056128	3300047320	Bacteria	2294
1091	Ga0495672_0063290	3300047320	Bacteria	2124
1092	Ga0495672_0087841	3300047320	Bacteria	1715
1093	Ga0495672_0142541	3300047320	Bacteria	1250
1094	Ga0495676_0000013	3300047321	Bacteria	213031
1095	Ga0495676_0049710	3300047321	Bacteria	3368
1096	Ga0495676_0078924	3300047321	Bacteria	2504
1097	Ga0495680_0045292	3300047322	Bacteria	3473
1098	Ga0495680_0055417	3300047322	Bacteria	3075
1099	Ga0495680_0123538	3300047322	Bacteria	1909
1100	Ga0495683_0000027	3300047323	Bacteria	153730
1101	Ga0495683_0000261	3300047323	Bacteria	47209
1102	Ga0495683_0008434	3300047323	Bacteria	5512
1103	Ga0495683_0012183	3300047323	Bacteria	4520
1104	Ga0495683_0015414	3300047323	Bacteria	3978
1105	Ga0495683_0019221	3300047323	Bacteria	3526
1106	Ga0495683_0029219	3300047323	Bacteria	2817
1107	Ga0495683_0050496	3300047323	Bacteria	2081
1108	Ga0495683_0052965	3300047323	Bacteria	2024
1109	Ga0495683_0079541	3300047323	Bacteria	1600
1110	Ga0495687_010031	3300047443	Bacteria	5232
1111	Ga0495687_012754	3300047443	Bacteria	4426
1112	Ga0495687_020397	3300047443	Bacteria	3229
1113	Ga0495687_038737	3300047443	Bacteria	2113
1114	Ga0495675_0025539	3300047444	Bacteria	3765
1115	Ga0495675_0203974	3300047444	Bacteria	1202
1116	Ga0495677_0008888	3300047445	Bacteria	3718
1117	Ga0495679_000206	3300047446	Bacteria	51518
1118	Ga0495679_001765	3300047446	Bacteria	11865
1119	Ga0495679_025228	3300047446	Bacteria	1990
1120	Ga0495679_028561	3300047446	Bacteria	1829
1121	Ga0495679_049446	3300047446	Bacteria	1268
1122	Ga0495685_107500	3300047447	Bacteria	919
1123	Ga0495673_0002579	3300047469	Bacteria	12608
1124	Ga0495673_0003090	3300047469	Bacteria	11196
1125	Ga0495673_0010469	3300047469	Bacteria	5038
1126	Ga0495673_0010910	3300047469	Bacteria	4916
1127	Ga0495673_0011603	3300047469	Bacteria	4727
1128	Ga0495673_0011642	3300047469	Bacteria	4718
1129	Ga0495673_0013537	3300047469	Bacteria	4279
1130	Ga0495673_0015057	3300047469	Bacteria	3999
1131	Ga0495673_0015361	3300047469	Bacteria	3947
1132	Ga0495673_0017562	3300047469	Bacteria	3627
1133	Ga0495673_0018296	3300047469	Bacteria	3535
1134	Ga0495673_0022618	3300047469	Bacteria	3077
1135	Ga0495673_0025448	3300047469	Bacteria	2840
1136	Ga0495673_0026358	3300047469	Bacteria	2780
1137	Ga0495673_0027377	3300047469	Bacteria	2715
1138	Ga0495673_0031299	3300047469	Bacteria	2491
1139	Ga0495673_0034373	3300047469	Bacteria	2344
1140	Ga0495673_0036207	3300047469	Bacteria	2266
1141	Ga0495673_0037760	3300047469	Bacteria	2203
1142	Ga0495673_0048823	3300047469	Bacteria	1864
1143	Ga0495673_0057895	3300047469	Bacteria	1672
1144	Ga0495673_0067455	3300047469	Bacteria	1514
1145	Ga0495673_0083245	3300047469	Bacteria	1321
1146	Ga0495681_0003664	3300047470	Bacteria	10667
1147	Ga0495681_0005466	3300047470	Bacteria	8496
1148	Ga0495681_0010709	3300047470	Bacteria	5528
1149	Ga0495681_0011975	3300047470	Bacteria	5122
1150	Ga0495681_0023766	3300047470	Bacteria	3245
1151	Ga0495681_0023768	3300047470	Bacteria	3245
1152	Ga0495681_0024241	3300047470	Bacteria	3202
1153	Ga0495681_0029332	3300047470	Bacteria	2816
1154	Ga0495681_0038714	3300047470	Bacteria	2334
1155	Ga0495681_0039156	3300047470	Bacteria	2317
1156	Ga0495681_0042656	3300047470	Bacteria	2194
1157	Ga0495681_0043014	3300047470	Bacteria	2181
1158	Ga0495681_0057852	3300047470	Bacteria	1799
1159	Ga0495681_0094505	3300047470	Bacteria	1315
1160	Ga0495684_0105134	3300047471	Bacteria	2133
1161	Ga0495686_0038266	3300047472	Bacteria	3068
1162	Ga0495686_0040851	3300047472	Bacteria	2955
1163	Ga0495686_0069749	3300047472	Bacteria	2166
1164	Ga0495686_0116061	3300047472	Bacteria	1600
1165	Ga0495593_0028238	3300047673	Bacteria	3082
1166	Ga0495593_0040781	3300047673	Bacteria	2498
1167	Ga0495593_0058171	3300047673	Bacteria	2028
1168	Ga0495593_0108646	3300047673	Bacteria	1417
1169	Ga0495626_0000056	3300048091	Bacteria	150654
1170	Ga0495626_0004948	3300048091	Bacteria	7991
1171	Ga0495626_0011052	3300048091	Bacteria	4788
1172	Ga0495626_0013013	3300048091	Bacteria	4337
1173	Ga0495626_0015084	3300048091	Bacteria	3961
1174	Ga0495626_0025240	3300048091	Bacteria	2907
1175	Ga0495626_0028464	3300048091	Bacteria	2708
1176	Ga0495626_0034099	3300048091	Bacteria	2436
1177	Ga0495626_0066381	3300048091	Bacteria	1631
1178	Ga0495626_0072007	3300048091	Bacteria	1551
1179	Ga0495626_0073259	3300048091	Bacteria	1534
1180	Ga0496100_0290706	3300048903	Bacteria	1221
1181	Ga0496101_0000466	3300048904	Bacteria	25564
1182	Ga0496101_0204999	3300048904	Bacteria	1526
1183	Ga0496101_0396859	3300048904	Bacteria	1086
1184	Ga0496102_0047483	3300048905	Bacteria	3902
1185	Ga0496102_0048910	3300048905	Bacteria	3845
1186	Ga0496102_0119841	3300048905	Bacteria	2457
1187	Ga0496103_0148800	3300048906	Bacteria	1499
1188	Ga0496103_0448210	3300048906	Unclassified	828
1189	Ga0496104_0035910	3300048907	Bacteria	4630
1190	Ga0496104_0040014	3300048907	Unclassified	4392
1191	Ga0496104_0110288	3300048907	Bacteria	2638
1192	Ga0496105_0021755	3300048908	Bacteria	5191
1193	Ga0496105_0537611	3300048908	Bacteria	914
1194	Ga0496106_0029970	3300048909	Bacteria	4057
1195	Ga0496106_0074362	3300048909	Unclassified	2601
1196	Ga0496106_0280225	3300048909	Bacteria	1336
1197	Ga0496106_0451695	3300048909	Bacteria	1032
1198	Ga0496107_0051088	3300048910	Bacteria	2981
1199	Ga0496108_0006415	3300048911	Bacteria	9536
1200	Ga0496108_0367584	3300048911	Bacteria	1256
1201	Ga0496109_0100366	3300048912	Bacteria	2685
1202	Ga0496110_0011106	3300048913	Bacteria	7357
1203	Ga0496110_0102429	3300048913	Bacteria	2567
1204	Ga0496111_0455062	3300048914	Bacteria	944
1205	Ga0496111_0467446	3300048914	Bacteria	930
1206	Ga0496112_0057089	3300048915	Bacteria	3843
1207	Ga0496113_0096123	3300048916	Bacteria	2290
1208	Ga0496114_0003061	3300048917	Bacteria	12809
1209	Ga0496114_0011632	3300048917	Bacteria	7037
1210	Ga0496114_0018708	3300048917	Bacteria	5605
1211	Ga0496114_0036799	3300048917	Bacteria	4046
1212	Ga0496114_0222178	3300048917	Bacteria	1658
1213	Ga0496114_0528798	3300048917	Bacteria	1043
1214	Ga0496114_0659308	3300048917	Bacteria	920
1215	Ga0496115_0072519	3300048918	Bacteria	2794
1216	Ga0496116_0000999	3300048919	Bacteria	34585
1217	Ga0496116_0018019	3300048919	Bacteria	5457
1218	Ga0496116_0024148	3300048919	Bacteria	4503
1219	Ga0496116_0058643	3300048919	Bacteria	2508
1220	Ga0496116_0073068	3300048919	Bacteria	2164
1221	Ga0496116_0103382	3300048919	Bacteria	1695
1222	Ga0496117_0002620	3300048920	Bacteria	22324
1223	Ga0496117_0003526	3300048920	Bacteria	18097
1224	Ga0496117_0006411	3300048920	Bacteria	11929
1225	Ga0496117_0064060	3300048920	Bacteria	2508
1226	Ga0496117_0067455	3300048920	Bacteria	2421
1227	Ga0496117_0078850	3300048920	Bacteria	2172
1228	Ga0496117_0081934	3300048920	Bacteria	2115
1229	Ga0496117_0084676	3300048920	Bacteria	2067
1230	Ga0496118_0001807	3300048921	Bacteria	30813
1231	Ga0496118_0010787	3300048921	Bacteria	9006
1232	Ga0496118_0059014	3300048921	Bacteria	2861
1233	Ga0496118_0077160	3300048921	Bacteria	2364
1234	Ga0496118_0079127	3300048921	Bacteria	2321
1235	Ga0496118_0095404	3300048921	Bacteria	2030
1236	Ga0496118_0096652	3300048921	Bacteria	2012
1237	Ga0496118_0112378	3300048921	Bacteria	1803
1238	Ga0496119_0000112	3300048922	Bacteria	114767
1239	Ga0496119_0177031	3300048922	Bacteria	1121
1240	Ga0496120_0004409	3300048923	Bacteria	11819
1241	Ga0496121_0002354	3300048924	Bacteria	29143
1242	Ga0496121_0003009	3300048924	Bacteria	24478
1243	Ga0496121_0022025	3300048924	Bacteria	6206
1244	Ga0496121_0035563	3300048924	Bacteria	4462
1245	Ga0496121_0064610	3300048924	Bacteria	2983
1246	Ga0496121_0083832	3300048924	Bacteria	2515
1247	Ga0496121_0131674	3300048924	Bacteria	1870
1248	Ga0496121_0260684	3300048924	Bacteria	1197
1249	Ga0496122_0000122	3300048925	Bacteria	181491
1250	Ga0496122_0009298	3300048925	Bacteria	10388
1251	Ga0496122_0026934	3300048925	Bacteria	4935
1252	Ga0496122_0033077	3300048925	Bacteria	4260
1253	Ga0496122_0081786	3300048925	Bacteria	2246
1254	Ga0496122_0104926	3300048925	Bacteria	1876
1255	Ga0496122_0188092	3300048925	Bacteria	1222
1256	Ga0496123_0000391	3300048926	Bacteria	82015
1257	Ga0496123_0001340	3300048926	Bacteria	34830
1258	Ga0496123_0012443	3300048926	Bacteria	7253
1259	Ga0496123_0070247	3300048926	Bacteria	2192
1260	Ga0496123_0081476	3300048926	Bacteria	1966
1261	Ga0496123_0083128	3300048926	Bacteria	1937
1262	Ga0496123_0113908	3300048926	Bacteria	1539
1263	Ga0496124_0000222	3300048927	Bacteria	110854
1264	Ga0496124_0010141	3300048927	Bacteria	9589
1265	Ga0496124_0012924	3300048927	Bacteria	8190
1266	Ga0496124_0013421	3300048927	Bacteria	7995
1267	Ga0496124_0016180	3300048927	Bacteria	7110
1268	Ga0496124_0034795	3300048927	Bacteria	4414
1269	Ga0496124_0039152	3300048927	Bacteria	4111
1270	Ga0496124_0053019	3300048927	Bacteria	3441
1271	Ga0496124_0110306	3300048927	Bacteria	2215
1272	Ga0496124_0149010	3300048927	Bacteria	1838
1273	Ga0496124_0302255	3300048927	Bacteria	1155
1274	Ga0496125_0000908	3300048928	Bacteria	46824
1275	Ga0496125_0027866	3300048928	Bacteria	5112
1276	Ga0496125_0027889	3300048928	Bacteria	5109
1277	Ga0496125_0097043	3300048928	Bacteria	2185
1278	Ga0496126_0015473	3300048929	Bacteria	7672
1279	Ga0495678_000031	3300049459	Bacteria	215528
1280	Ga0495678_000039	3300049459	Bacteria	191665
1281	Ga0495678_004626	3300049459	Bacteria	7900
1282	Ga0495678_008903	3300049459	Bacteria	5018
1283	Ga0495678_011885	3300049459	Bacteria	4149
1284	Ga0495678_017708	3300049459	Bacteria	3219
1285	Ga0495678_020941	3300049459	Bacteria	2886
1286	Ga0495678_029588	3300049459	Bacteria	2298
1287	Ga0495678_029622	3300049459	Bacteria	2296
1288	Ga0495678_039841	3300049459	Bacteria	1892
1289	Ga0495678_041063	3300049459	Bacteria	1854
1290	Ga0495682_0000577	3300049460	Bacteria	24873
1291	Ga0495682_0004465	3300049460	Bacteria	5977
1292	Ga0495682_0021667	3300049460	Bacteria	2406
1293	Ga0495682_0021913	3300049460	Bacteria	2392
1294	Ga0495682_0026083	3300049460	Bacteria	2172
1295	Ga0495682_0097601	3300049460	Bacteria	1054
1296	Ga0495682_0099269	3300049460	Bacteria	1044
1297	Ga0501296_010262	3300049519	Bacteria	1108
1298	Ga0501031_0107100	3300049568	Bacteria	1825
1299	Ga0501032_0017099	3300049569	Bacteria	5096
1300	Ga0501034_0000137	3300049571	Bacteria	136592
1301	Ga0501034_0172146	3300049571	Bacteria	2132
1302	Ga0501037_0042957	3300049573	Bacteria	3322
1303	Ga0501040_0124079	3300049576	Bacteria	1813
1304	Ga0501067_0114862	3300049583	Bacteria	1497
1305	Ga0501069_0164182	3300049585	Bacteria	1279
1306	Ga0501202_015693	3300049652	Bacteria	1461
1307	Ga0501233_002763	3300049668	Bacteria	3114
1308	Ga0501235_013911	3300049669	Bacteria	1772
1309	Ga0501239_004342	3300049672	Bacteria	1388
1310	Ga0501243_016013	3300049675	Bacteria	1208
1311	Ga0501246_003346	3300049676	Bacteria	1291
1312	Ga0501225_0014126	3300049705	Bacteria	2231
1313	Ga0501245_005509	3300049708	Bacteria	1755
1314	Ga0501241_006626	3300049758	Bacteria	2128
1315	Ga0501262_034679	3300049759	Bacteria	737
1316	Ga0501268_028519	3300049765	Bacteria	998
1317	Ga0501268_032138	3300049765	Bacteria	955
1318	Ga0501270_008138	3300049767	Bacteria	1318
1319	Ga0501273_015947	3300049770	Bacteria	980
1320	Ga0501274_009760	3300049771	Bacteria	877
1321	Ga0501035_0128903	3300049822	Bacteria	2206
1322	Ga0501212_011543	3300049851	Bacteria	1274
1323	Ga0501226_000017	3300049853	Bacteria	150879
1324	nmdc:mga00v17_172978_c1	3300050491	Bacteria	1393
1325	nmdc:mga00v17_89631_c1	3300050491	Bacteria	1930
1326	nmdc:mga09592_87736_c1	3300050508	Bacteria	2656
1327	nmdc:mga0qj67_141644_c1	3300050509	Bacteria	1950
1328	nmdc:mga06r32_203096_c1	3300050510	Bacteria	1969
1329	nmdc:mga06r32_2428_c1	3300050510	Bacteria	16680
1330	nmdc:mga08y16_6548_c1	3300050511	Bacteria	12212
1331	Ga0495595_0006275	3300053084	Bacteria	4842
1332	Ga0495619_0001225	3300053085	Bacteria	16804
1333	Ga0500618_003306	3300053125	Bacteria	5589
1334	Ga0500659_0022945	3300053135	Bacteria	3402
1335	Ga0500573_0024813	3300053140	Bacteria	3447
1336	Ga0500596_007977	3300053735	Bacteria	1704
1337	Ga0501082_0549490	3300060353	Bacteria	1010
1338	8057161894	8057160832	Bacteria	3268302
1339	2511257403	2511231004	Bacteria	6669789
1340	2511268772	2511231006	Bacteria	6794709
1341	2511270781	2511231007	Bacteria	6306603
1342	2511277035	2511231008	Bacteria	6624100
1343	2511291521	2511231010	Bacteria	6373152
1344	2511296156	2511231011	Bacteria	6149768
1345	2511301349	2511231012	Bacteria	6738011
1346	2511311931	2511231014	Bacteria	6462302
1347	2511318293	2511231015	Bacteria	6598026
1348	2511323551	2511231016	Bacteria	6704427
1349	2511333872	2511231017	Bacteria	6503007
1350	2511337189	2511231018	Bacteria	6436256
1351	2511346140	2511231019	Bacteria	6520662
1352	2511352549	2511231020	Bacteria	6115223
1353	2511355006	2511231021	Bacteria	7302637
1354	2511364019	2511231022	Bacteria	6719296
1355	2511370147	2511231023	Bacteria	6808468
1356	2511375561	2511231024	Bacteria	5835885
1357	2511411121	2511231031	Bacteria	6558529
1358	2511826707	2511231156	Bacteria	6845832
1359	2512328305	2512047018	Bacteria	6663241
1360	2554817003	2554235132	Bacteria	6772433
1361	2555244599	2554235231	Bacteria	5215788
1362	2555668035	2554235341	Bacteria	6867980
1363	2583790478	2582580891	Bacteria	6800976
1364	2597856251	2597489887	Bacteria	6666321
1365	2597862330	2597489888	Bacteria	6179543
1366	2597868050	2597489889	Bacteria	6297495
1367	2599330099	2599185155	Bacteria	5827168
1368	2599355035	2599185160	Bacteria	6844013
1369	2599361141	2599185161	Bacteria	6960462
1370	2599367463	2599185162	Bacteria	6957254
1371	2599374253	2599185163	Bacteria	6995158
1372	2599380141	2599185164	Bacteria	6841688
1373	2599386588	2599185165	Bacteria	6843250
1374	2599393111	2599185166	Bacteria	6959206
1375	2599397064	2599185167	Bacteria	6353609
1376	2599404878	2599185168	Bacteria	6997636
1377	2599449057	2599185179	Bacteria	6611171
1378	2599461869	2599185181	Bacteria	6844519
1379	2599467088	2599185182	Bacteria	6883168
1380	2599483493	2599185185	Bacteria	6652270
1381	2599491038	2599185186	Bacteria	6831633
1382	2599502942	2599185188	Bacteria	6164180
1383	2599508825	2599185189	Bacteria	5862825
1384	2599511199	2599185190	Bacteria	6285678
1385	2599519310	2599185191	Bacteria	6297582
1386	2599616769	2599185212	Bacteria	6765997
1387	2599771228	2599185248	Bacteria	6696816
1388	2599805399	2599185257	Bacteria	6492581
1389	2599879646	2599185288	Bacteria	6666191
1390	2599886000	2599185289	Bacteria	6778765
1391	2599890573	2599185290	Bacteria	6289611
1392	2599897714	2599185291	Bacteria	6775623
1393	2599930030	2599185300	Bacteria	6062622
1394	2599945440	2599185302	Bacteria	5954930
1395	2599948145	2599185303	Bacteria	6512725
1396	2599955712	2599185304	Bacteria	5951361
1397	2599961082	2599185305	Bacteria	6748700
1398	2599967230	2599185306	Bacteria	6637356
1399	2599974110	2599185307	Bacteria	6194719
1400	2599980373	2599185308	Bacteria	6621546
1401	2599985824	2599185309	Bacteria	5969593
1402	2599990718	2599185310	Bacteria	6014457
1403	2599996040	2599185311	Bacteria	6354990
1404	2600001896	2599185312	Bacteria	5912071
1405	2600005620	2599185313	Bacteria	6658188
1406	2600014184	2599185314	Bacteria	6621749
1407	2600019134	2599185315	Bacteria	6771107
1408	2600025610	2599185316	Bacteria	6320029
1409	2600027775	2599185317	Bacteria	6435722
1410	2600033509	2599185318	Bacteria	6961590
1411	2600040205	2599185319	Bacteria	6637840
1412	2600049423	2599185320	Bacteria	5963263
1413	2600056702	2599185321	Bacteria	6764560
1414	2600059173	2599185322	Bacteria	6763055
1415	2600064311	2599185323	Bacteria	6688755
1416	2600074720	2599185324	Bacteria	6590677
1417	2600077241	2599185325	Bacteria	6324919
1418	2600214491	2599185356	Bacteria	6843884
1419	2600356942	2600254930	Bacteria	6431253
1420	2600364105	2600254931	Bacteria	6734225
1421	2600442959	2600254954	Bacteria	5100516
1422	2601625731	2600255283	Bacteria	6061572
1423	2601690915	2600255296	Bacteria	5784754
1424	2601774804	2600255313	Bacteria	6842543
1425	2601800068	2600255318	Bacteria	6383414
1426	2602009565	2600255389	Bacteria	5275336
1427	2606074667	2603880185	Bacteria	6379190
1428	2606127530	2603880199	Bacteria	6377649
1429	2608379678	2606217733	Bacteria	6360972
1430	2621301545	2619619299	Bacteria	6649820
1431	2624478815	2623620443	Bacteria	6427864
1432	2624494137	2623620446	Bacteria	6500345
1433	2643844244	2643221565	Bacteria	6216018
1434	2643868899	2643221571	Bacteria	6228673
1435	2643952316	2643221589	Bacteria	6250934
1436	2644023921	2643221602	Bacteria	6249926
1437	2644188327	2643221633	Bacteria	6733554
1438	2644282467	2643221650	Bacteria	7029547
1439	2644624006	2643221713	Bacteria	6554480
1440	2652547709	2651869719	Bacteria	6047974
1441	2671089809	2667528170	Bacteria	6786960
1442	2671097636	2667528171	Bacteria	6900659
1443	2671125561	2667528176	Bacteria	6724917
1444	2671767865	2671180172	Bacteria	6495783
1445	2677898173	2675903420	Bacteria	6247433
1446	2678265072	2675903515	Bacteria	6580491
1447	2691330958	2690315857	Bacteria	4396207
1448	2715750820	2713897148	Bacteria	5883533
1449	2715757532	2713897149	Bacteria	6506249
1450	2718632700	2718217725	Bacteria	5758958
1451	2723247219	2721755607	Bacteria	5841722
1452	2729145897	2728369097	Bacteria	4333476
1453	2738673765	2738541265	Bacteria	6594665
1454	2738691549	2738541271	Bacteria	5657310
1455	2738752158	2738541282	Bacteria	6593925
1456	2738809104	2738541294	Bacteria	6925949
1457	2738861199	2738541303	Bacteria	6591772
1458	2738896464	2738541309	Bacteria	6926455
1459	2739198360	2738543004	Bacteria	6381073
1460	2739256876	2738543015	Bacteria	6750701
1461	2739267324	2738543016	Bacteria	5657564
1462	2739286201	2738543020	Bacteria	5718238
1463	2739291514	2738543021	Bacteria	5718241
1464	2739316418	2738543025	Bacteria	6600348
1465	2743735660	2740892503	Bacteria	6855563
1466	2745005529	2744054620	Bacteria	6551379
1467	2765585692	2765235841	Bacteria	6137024
1468	2774122159	2773857670	Bacteria	6407454
1469	2774136708	2773857673	Bacteria	6513460
1470	2784260460	2784132063	Bacteria	6262788
1471	2784314404	2784132072	Bacteria	6596533
1472	2794595622	2791355520	Bacteria	5948615
1473	2807406923	2806310737	Bacteria	5751088
1474	2807455255	2806310745	Bacteria	5742165
1475	2808858593	2808606361	Bacteria	6136259
1476	2808904660	2808606373	Bacteria	4423627
1477	2808921885	2808606376	Bacteria	6248667
1478	2808928760	2808606377	Bacteria	6646337
1479	2808938782	2808606378	Bacteria	6177535
1480	2808941657	2808606379	Bacteria	5022697
1481	2808944006	2808606380	Bacteria	6248705
1482	2808950881	2808606381	Bacteria	6646461
1483	2808960446	2808606382	Bacteria	6841132
1484	2808967098	2808606383	Bacteria	6138645
1485	2808975244	2808606385	Bacteria	6711065
1486	2808991117	2808606388	Bacteria	6706662
1487	2809001908	2808606389	Bacteria	6138126
1488	2809215753	2808606445	Bacteria	6057339
1489	2812368112	2811994881	Bacteria	6298475
1490	2817489100	2816332298	Bacteria	6852809
1491	2819658370	2818991456	Bacteria	6123676
1492	2819702719	2818991464	Bacteria	6907494
1493	2823424588	2823421272	Bacteria	5372474
1494	2825656031	2825651385	Bacteria	6715909
1495	2826585738	2826581358	Bacteria	5963467
1496	2834029004	2834028612	Bacteria	6354979
1497	2842805628	2842805378	Bacteria	5385175
1498	2842818608	2842815866	Bacteria	5947510
1499	2842828721	2842826826	Bacteria	5974129
1500	2842835716	2842832357	Bacteria	5959113
1501	2842843215	2842837860	Bacteria	6066181
1502	2842847463	2842843487	Bacteria	6004777
1503	2842853830	2842849001	Bacteria	5924277
1504	2842856435	2842854478	Bacteria	6143501
1505	2844668537	2844665904	Bacteria	6817974
1506	2852615511	2852612431	Bacteria	6885235
1507	2852662829	2852657418	Bacteria	6472974
1508	2852670479	2852667396	Bacteria	6885555
1509	2860340642	2860339153	Bacteria	6846989
1510	2860869033	2860867994	Bacteria	5645326
1511	2878030779	2878029506	Bacteria	6418441
1512	2880231691	2880230671	Bacteria	6140320
1513	2904520726	2904518522	Bacteria	6068986
1514	2904551111	2904550169	Bacteria	6221258
1515	2908447826	2908446538	Bacteria	6829095
1516	2912967956	2912963787	Bacteria	5646108
1517	2913041681	2913036834	Bacteria	6704877
1518	2917071797	2917070673	Bacteria	6868303
1519	2919067271	2919063839	Bacteria	6302690
1520	2919159285	2919155634	Bacteria	4860545
1521	2919385830	2919385768	Bacteria	5897293
1522	2919458351	2919456309	Bacteria	6586567
1523	2919484619	2919481497	Bacteria	6907839
1524	2919492792	2919487758	Bacteria	5929766
1525	2919504318	2919501602	Bacteria	5286340
1526	2919534513	2919534386	Bacteria	4577686
1527	2919691004	2919688452	Bacteria	4595932
1528	2919699947	2919697872	Bacteria	6553725
1529	2923154669	2923153595	Bacteria	6870622
1530	2923522165	2923519811	Bacteria	6298479
1531	2923590330	2923586266	Bacteria	6565975
1532	2926065109	2926063275	Bacteria	5285848
1533	2929149004	2929144301	Bacteria	6622272
1534	2929191030	2929189879	Bacteria	5930554
1535	2931373575	2931369376	Bacteria	6847892
1536	2931392035	2931390751	Bacteria	6273349
1537	2931399456	2931396565	Bacteria	7251677
1538	2935353970	2935353572	Unclassified	6955622
1539	2939638122	2939636861	Bacteria	6297853
1540	2939652385	2939651529	Bacteria	5895393
1541	2945929550	2945928738	Bacteria	6053221
1542	2945961261	2945961074	Bacteria	7342064
1543	2946011829	2946006987	Bacteria	6705746
1544	2946029279	2946027586	Bacteria	6049274
1545	2947235827	2947233263	Bacteria	6439278
1546	2952252655	2952252522	Bacteria	4171745
1547	2969305602	2969304461	Bacteria	6601805
1548	2974292767	2974289157	Bacteria	6080362
1549	2984291360	2984286254	Bacteria	6702062
1550	2988730601	2988728565	Bacteria	6124362
1551	2990198319	2990196909	Bacteria	4054280
1552	2998141044	2998139840	Bacteria	6073514
1553	3007253689	3007252601	Bacteria	4559114
1554	3007317537	3007315729	Bacteria	5076637
1555	3007400199	3007395558	Bacteria	6755444
1556	3007420683	3007419365	Bacteria	7026924
1557	3007516336	3007511990	Bacteria	6481491
1558	3007618770	3007614139	Bacteria	6053559
1559	3007622074	3007619802	Bacteria	6411688
1560	3007719274	3007718800	Bacteria	5971527
1561	3007808410	3007803356	Bacteria	5931491
1562	3007860928	3007855910	Bacteria	5637581
1563	3007863734	3007861166	Bacteria	6045338
1564	3007867651	3007866637	Bacteria	5899198
1565	3007875429	3007872151	Bacteria	5268868
1566	637318414	637000220	Bacteria	7074893
1567	640487190	640427133	Bacteria	4567418
1568	651175066	651053060	Bacteria	4689946
1569	8011353176	8011350971	Bacteria	6158957
1570	8015688905	8015687852	Bacteria	6613826
1571	8019773283	8019769354	Bacteria	6924660
1572	8019776613	8019775933	Bacteria	6858656
1573	8029999718	8029995093	Bacteria	5990776
1574	8034962573	8034962539	Bacteria	4884839
1575	8052495673	8052494512	Bacteria	5765634
1576	8054286230	8054285046	Bacteria	6919322
1577	8054352553	8054347763	Bacteria	5901107
1578	8054504613	8054503363	Bacteria	6101651
1579	8054933239	8054929484	Bacteria	5599761
1580	8055772022	8055770955	Bacteria	6827675
1581	8055819055	8055817908	Bacteria	6609162
1582	8055884066	8055878733	Bacteria	5907058
1583	8056117439	8056115690	Bacteria	5527654
1584	8056124775	8056120720	Bacteria	5758328
1585	8056127088	8056125926	Bacteria	6228218
1586	8056132924	8056131705	Bacteria	6107031
1587	8056138577	8056137416	Bacteria	6147080
1588	8056144390	8056143049	Bacteria	6307666
1589	8056149140	8056148874	Bacteria	6479865
1590	8056155596	8056155041	Bacteria	6486948
1591	8056161201	8056161164	Bacteria	6106669
1592	8056170007	8056166840	Bacteria	5820959
1593	8056176141	8056172158	Bacteria	6133900
1594	8056180570	8056177738	Bacteria	6748268
1595	8056569694	8056569372	Bacteria	5997322
1596	8057803311	8057798959	Bacteria	6713499
1597	MRS2a_Contig_171
1598	MRS2a_Contig_6967
1599	SwRhRL2b_contig_1451204
1600	SwRhRL2b_contig_691707
1601	MBSR1b_contig_12180039
1602	JGI24741J21665_1015105
1603	JGI25162J39368_1000126
1604	JGI25162J39368_1001425
1605	JGI25163J39215_1002661
1606	JGI25163J39215_1002760
1607	JGI25164J39214_1000100
1608	JGI25164J39214_1000703
1609	JGI25165J46597_1000207
1610	JGI25165J46597_1001416
1611	Ga0007409J51694_1047625
1612	Ga0007416J51690_1045476
1613	Ga0055538_1000029
1614	Ga0055539_1000039
1615	Ga0055533_1000049
1616	Ga0055532_1000049
1617	Ga0055525_1000077
1618	Ga0055535_1003857
1619	Ga0055536_1000062
1620	Ga0055536_1005866
1621	Ga0055536_1005929
1622	Ga0055536_1041588
1623	Ga0055530_10002470
1624	Ga0055530_10003906
1625	Ga0055530_10007963
1626	Ga0055540_1001086
1627	Ga0055540_1006959
1628	Ga0055540_1007302
1629	Ga0055531_10001423
1630	Ga0055541_1000026
1631	Ga0058692_1011602
1632	Ga0065714_10001303
1633	Ga0065714_10014444
1634	Ga0065714_10021449
1635	Ga0065714_10069503
1636	Ga0065714_10070811
1637	Ga0065714_10073081
1638	Ga0065704_10006087
1639	Ga0065704_10038396
1640	Ga0065704_10078027
1641	Ga0065704_10082904
1642	Ga0065704_10138543
1643	Ga0065712_10067895
1644	Ga0065712_10073356
1645	Ga0065715_10341422
1646	Ga0065715_10378122
1647	Ga0070676_10138993
1648	Ga0070676_10182855
1649	Ga0070676_10332729
1650	Ga0070676_10391042
1651	Ga0070683_100396623
1652	Ga0070690_100000719
1653	Ga0070670_100007345
1654	Ga0070670_100019001
1655	Ga0070670_100019945
1656	Ga0070670_100037004
1657	Ga0068869_100003518
1658	Ga0068869_100091777
1659	Ga0068869_100371145
1660	Ga0070666_10031212
1661	Ga0070689_100000456
1662	Ga0070687_100245619
1663	Ga0070661_100000066
1664	Ga0070692_10064081
1665	Ga0070692_10201527
1666	Ga0070668_100023051
1667	Ga0070668_100276875
1668	Ga0070669_100000310
1669	Ga0070669_100002278
1670	Ga0070669_100704280
1671	Ga0070675_100004285
1672	Ga0070671_100073649
1673	Ga0070674_100067525
1674	Ga0070674_100187930
1675	Ga0070673_100012875
1676	Ga0070688_100003781
1677	Ga0070659_100403227
1678	Ga0070659_100429489
1679	Ga0070667_100015612
1680	Ga0070714_100290989
1681	Ga0070713_100080241
1682	Ga0070705_100047677
1683	Ga0070700_100020606
1684	Ga0070708_100012416
1685	Ga0070678_100271730
1686	Ga0070662_100000560
1687	Ga0070662_100010655
1688	Ga0070662_100146748
1689	Ga0070662_100183306
1690	Ga0070681_10184216
1691	Ga0070681_10347650
1692	Ga0070681_10624568
1693	Ga0070685_10043870
1694	Ga0070685_10099447
1695	Ga0070707_100050612
1696	Ga0070707_100268048
1697	Ga0070698_100001630
1698	Ga0070699_100051049
1699	Ga0070684_100002650
1700	Ga0070697_100025329
1701	Ga0070697_100042428
1702	Ga0070697_100183470
1703	Ga0068853_100006406
1704	Ga0070672_100206976
1705	Ga0070672_100708327
1706	Ga0070686_100001421
1707	Ga0070695_100242531
1708	Ga0070695_100382655
1709	Ga0070693_100080419
1710	Ga0070665_100010087
1711	Ga0070665_100011182
1712	Ga0070665_100045076
1713	Ga0070665_100075428
1714	Ga0070665_100125618
1715	Ga0070704_100165899
1716	Ga0068855_100166818
1717	Ga0070664_100000034
1718	Ga0070664_100000627
1719	Ga0070664_100511218
1720	Ga0068857_100051108
1721	Ga0068857_100299477
1722	Ga0068857_100706888
1723	Ga0068854_100004163
1724	Ga0068854_100129224
1725	Ga0070702_100003859
1726	Ga0070702_100463345
1727	Ga0068859_100003159
1728	Ga0068864_100014873
1729	Ga0068866_10087266
1730	Ga0068861_100003678
1731	Ga0068851_10000006
1732	Ga0068870_10039576
1733	Ga0068863_100001397
1734	Ga0068863_100595954
1735	Ga0068863_100955194
1736	Ga0068858_100015959
1737	Ga0068858_100088357
1738	Ga0068860_100055149
1739	Ga0068862_100002861
1740	Ga0068862_100035148
1741	Ga0068862_100202108
1742	Ga0068862_100474628
1743	Ga0070717_10007349
1744	Ga0075364_10046097
1745	Ga0075364_10257016
1746	Ga0075432_10008574
1747	Ga0075432_10009709
1748	Ga0070716_100358480
1749	Ga0075367_10280642
1750	Ga0075366_10109039
1751	Ga0097621_100010282
1752	Ga0097621_100190504
1753	Ga0097621_100750207
1754	Ga0075370_10241869
1755	Ga0068871_100004635
1756	Ga0075428_100265145
1757	Ga0075428_100326608
1758	Ga0075431_100007997
1759	Ga0075431_100162762
1760	Ga0075433_10506590
1761	Ga0075436_100110690
1762	Ga0075436_100192508
1763	Ga0075436_100199810
1764	Ga0075436_100258488
1765	Ga0097620_100003159
1766	Ga0099823_1000054
1767	Ga0079104_1000168
1768	Ga0079104_1000917
1769	Ga0079104_1008299
1770	Ga0079104_1061440
1771	Ga0099826_10041729
1772	Ga0105251_10000004
1773	Ga0105251_10000149
1774	Ga0105251_10000935
1775	Ga0105251_10007261
1776	Ga0105251_10008400
1777	Ga0105251_10008504
1778	Ga0105251_10014429
1779	Ga0105251_10019003
1780	Ga0105251_10021793
1781	Ga0105244_10000922
1782	Ga0105244_10002753
1783	Ga0105244_10008859
1784	Ga0105244_10009872
1785	Ga0105244_10010706
1786	Ga0105244_10015168
1787	Ga0105244_10016594
1788	Ga0105244_10019111
1789	Ga0105244_10020978
1790	Ga0105244_10150388
1791	Ga0105250_10000235
1792	Ga0105250_10003383
1793	Ga0105250_10004467
1794	Ga0105250_10015626
1795	Ga0105250_10018123
1796	Ga0105250_10052397
1797	Ga0111539_10028141
1798	Ga0111539_10074684
1799	Ga0105245_10032469
1800	Ga0105245_10035703
1801	Ga0114129_10483575
1802	Ga0114129_10847723
1803	Ga0105243_10001292
1804	Ga0105243_10001767
1805	Ga0105243_10048834
1806	Ga0105243_10051064
1807	Ga0105243_10082160
1808	Ga0105243_10113837
1809	Ga0105243_10116182
1810	Ga0105243_10127448
1811	Ga0105243_10232047
1812	Ga0105241_10196023
1813	Ga0105242_10000233
1814	Ga0105248_10031547
1815	Ga0105248_10144389
1816	Ga0105248_10447996
1817	Ga0105237_10000160
1818	Ga0105249_10011694
1819	Ga0105249_10091591
1820	Ga0105249_10360269
1821	Ga0105249_10369054
1822	Ga0105239_10378102
1823	Ga0105246_10000822
1824	Ga0105246_10007947
1825	Ga0105246_10029231
1826	Ga0105246_10035518
1827	Ga0157345_1000347
1828	Ga0157345_1001213
1829	Ga0157373_10001605
1830	Ga0157373_10038460
1831	Ga0157373_10044239
1832	Ga0157373_10044865
1833	Ga0157373_10168738
1834	Ga0157373_10205811
1835	Ga0157371_10000460
1836	Ga0157371_10007535
1837	Ga0157371_10026024
1838	Ga0157371_10035291
1839	Ga0157370_10005690
1840	Ga0157370_10114694
1841	Ga0157370_10196643
1842	Ga0157370_10200401
1843	Ga0157370_10211042
1844	Ga0157370_10584906
1845	Ga0157369_10024260
1846	Ga0157369_10101555
1847	Ga0157374_10290568
1848	Ga0163162_10004406
1849	Ga0163162_10036266
1850	Ga0163162_10049386
1851	Ga0163162_10606341
1852	Ga0157372_10000815
1853	Ga0157372_10080528
1854	Ga0157375_10191804
1855	Ga0157375_10213551
1856	Ga0157375_10257952
1857	Ga0163163_10001762
1858	Ga0163163_10123676
1859	Ga0182008_10000570
1860	Ga0182008_10009461
1861	Ga0182008_10010235
1862	Ga0182008_10021109
1863	Ga0182008_10028961
1864	Ga0182008_10029387
1865	Ga0157377_10005529
1866	Ga0157377_10363385
1867	Ga0157379_10300798
1868	Ga0157379_10372322
1869	Ga0157376_10009699
1870	Ga0157376_10319306
1871	Ga0182006_1010353
1872	Ga0182006_1013729
1873	Ga0182006_1014261
1874	Ga0182006_1017575
1875	Ga0182006_1033200
1876	Ga0182007_10006004
1877	Ga0182005_1004963
1878	Ga0182005_1005966
1879	Ga0163161_10002088
1880	Ga0163161_10026335
1881	Ga0163161_10032561
1882	Ga0163161_10054321
1883	Ga0163161_10099733
1884	Ga0163161_10105763
1885	Ga0163161_10169443
1886	Ga0213872_10014367
1887	Ga0209435_104244
1888	Ga0209760_100124
1889	Ga0209760_100248
1890	Ga0209784_100045
1891	Ga0209566_100057
1892	Ga0209674_100080
1893	Ga0209147_100079
1894	Ga0209563_100078
1895	Ga0209563_100693
1896	Ga0207427_100001
1897	Ga0207427_100004
1898	Ga0209437_100003
1899	Ga0209437_100028
1900	Ga0209258_100178
1901	Ga0209646_1000311
1902	Ga0209677_100045
1903	Ga0209759_1019274
1904	Ga0209233_1000007
1905	Ga0209233_1000008
1906	Ga0209675_1006640
1907	Ga0209676_1000056
1908	Ga0209676_1000078
1909	Ga0209676_1000101
1910	Ga0209676_1000721
1911	Ga0209676_1004156
1912	Ga0209676_1025598
1913	Ga0209050_1000027
1914	Ga0209050_1000041
1915	Ga0209050_1000181
1916	Ga0209050_1012325
1917	Ga0209051_1000061
1918	Ga0209051_1000065
1919	Ga0209051_1000085
1920	Ga0209257_1000105
1921	Ga0207656_10000017
1922	Ga0207696_1000022
1923	Ga0207696_1000032
1924	Ga0207696_1000044
1925	Ga0207696_1000121
1926	Ga0207696_1003748
1927	Ga0207696_1010960
1928	Ga0207696_1012123
1929	Ga0207696_1014335
1930	Ga0207696_1015398
1931	Ga0207696_1015997
1932	Ga0207655_1000005
1933	Ga0207655_1000015
1934	Ga0207655_1000086
1935	Ga0207655_1000240
1936	Ga0207655_1000462
1937	Ga0207655_1001109
1938	Ga0207655_1001511
1939	Ga0207655_1002564
1940	Ga0207655_1010677
1941	Ga0207655_1010955
1942	Ga0207655_1014380
1943	Ga0207655_1015351
1944	Ga0207655_1021397
1945	Ga0207655_1021619
1946	Ga0207655_1022609
1947	Ga0207655_1022848
1948	Ga0207655_1032143
1949	Ga0207655_1034497
1950	Ga0207655_1042674
1951	Ga0207655_1066925
1952	Ga0207713_1000013
1953	Ga0207713_1000104
1954	Ga0207713_1000356
1955	Ga0207713_1000454
1956	Ga0207713_1002869
1957	Ga0207713_1005217
1958	Ga0207713_1005892
1959	Ga0207713_1007324
1960	Ga0207713_1008142
1961	Ga0207713_1009230
1962	Ga0207713_1011540
1963	Ga0207713_1018084
1964	Ga0207713_1028558
1965	Ga0207713_1030937
1966	Ga0207713_1038032
1967	Ga0207713_1042962
1968	Ga0207713_1055597
1969	Ga0207642_10015135
1970	Ga0207642_10017031
1971	Ga0207680_10043693
1972	Ga0207645_10019435
1973	Ga0207645_10090336
1974	Ga0207645_10289298
1975	Ga0207643_10061761
1976	Ga0207684_10106107
1977	Ga0207654_10061044
1978	Ga0207654_10218408
1979	Ga0207707_10328576
1980	Ga0207671_10000019
1981	Ga0207693_10147820
1982	Ga0207662_10123404
1983	Ga0207649_10000004
1984	Ga0207649_10005922
1985	Ga0207652_10391192
1986	Ga0207646_10157473
1987	Ga0207681_10000679
1988	Ga0207681_10006793
1989	Ga0207681_10076673
1990	Ga0207681_10400484
1991	Ga0207650_10000668
1992	Ga0207650_10001102
1993	Ga0207659_10010690
1994	Ga0207687_10018389
1995	Ga0207687_10351363
1996	Ga0207700_10083513
1997	Ga0207644_10015594
1998	Ga0207644_10295146
1999	Ga0207706_10001474
2000	Ga0207706_10019929
2001	Ga0207706_10033343
2002	Ga0207706_10273596
2003	Ga0207706_10370770
2004	Ga0207686_10002443
2005	Ga0207686_10018350
2006	Ga0207686_10416841
2007	Ga0207709_10000067
2008	Ga0207709_10000757
2009	Ga0207709_10046537
2010	Ga0207709_10060606
2011	Ga0207709_10075331
2012	Ga0207709_10118332
2013	Ga0207709_10205547
2014	Ga0207670_10008692
2015	Ga0207669_10019420
2016	Ga0207669_10365187
2017	Ga0207704_10067105
2018	Ga0207665_10374906
2019	Ga0207691_10201732
2020	Ga0207691_10801561
2021	Ga0207711_10005659
2022	Ga0207711_10020084
2023	Ga0207711_10565018
2024	Ga0207689_10002855
2025	Ga0207689_10180699
2026	Ga0207689_10498314
2027	Ga0207679_10000019
2028	Ga0207679_10010986
2029	Ga0207651_10003796
2030	Ga0207651_10251808
2031	Ga0207712_10008471
2032	Ga0207712_10248162
2033	Ga0207640_10243984
2034	Ga0207658_10017612
2035	Ga0207658_10255156
2036	Ga0207677_10010677
2037	Ga0207677_10197299
2038	Ga0207703_10073102
2039	Ga0207639_10003002
2040	Ga0207708_10062007
2041	Ga0207641_10002890
2042	Ga0207641_10189382
2043	Ga0207648_10007485
2044	Ga0207648_10030556
2045	Ga0207648_10057745
2046	Ga0207676_10013694
2047	Ga0207676_10134002
2048	Ga0207674_10015582
2049	Ga0207674_10041108
2050	Ga0207674_10261163
2051	Ga0207675_100005363
2052	Ga0207683_10212405
2053	Ga0207683_10409403
2054	Ga0207698_10653513
2055	Ga0209281_1000013
2056	Ga0209281_1000015
2057	Ga0209281_1006192
2058	Ga0209281_1010143
2059	Ga0209389_1000002
2060	Ga0209371_1000239
2061	Ga0209371_1000253
2062	Ga0209996_1002616
2063	Ga0210000_1005600
2064	Ga0209995_1000414
2065	Ga0210002_1025235
2066	Ga0209983_1000325
2067	Ga0209971_1001041
2068	Ga0207428_10014943
2069	Ga0207428_10068923
2070	Ga0207428_10107094
2071	Ga0207428_10178972
2072	Ga0207428_10237320
2073	Ga0268266_10049461
2074	Ga0268266_10054245
2075	Ga0268266_10083402
2076	Ga0268266_10187976
2077	Ga0268265_10000650
2078	Ga0268265_10292948
2079	Ga0268265_10478530
2080	Ga0268264_10084699
2081	Ga0265319_1019905
2082	Ga0265338_10031292
2083	Ga0268256_1000199
2084	Ga0268256_1000367
2085	Ga0316177_1192305
2086	Ga0314311_1259691
2087	Ga0316178_1029444
2088	Ga0265328_10004765
2089	Ga0265331_10013025
2090	Ga0265331_10032074
2091	Ga0265327_10000133
2092	Ga0265327_10000463
2093	Ga0307509_10000013
2094	Ga0307408_100000081
2095	Ga0307408_100029937
2096	Ga0307408_100036505
2097	Ga0307408_100128295
2098	Ga0316575_10101170
2099	Ga0316579_10014494
2100	Ga0307405_10044598
2101	Ga0307405_10055321
2102	Ga0307405_10063105
2103	Ga0307405_10084486
2104	Ga0316577_10018931
2105	Ga0307413_10077359
2106	Ga0307413_10361853
2107	Ga0307413_10503511
2108	Ga0307410_10047645
2109	Ga0307410_10089743
2110	Ga0307410_10131461
2111	Ga0307406_10384481
2112	Ga0307406_10549815
2113	Ga0307407_10035521
2114	Ga0307407_10119643
2115	Ga0307412_10003321
2116	Ga0307412_10031495
2117	Ga0307412_10135039
2118	Ga0307412_10149474
2119	Ga0307412_10602220
2120	Ga0307409_100025594
2121	Ga0307409_100092724
2122	Ga0307409_100367754
2123	Ga0307416_100030005
2124	Ga0307416_100036222
2125	Ga0307414_10022993
2126	Ga0307414_10069231
2127	Ga0307414_10179981
2128	Ga0307414_10225412
2129	Ga0307411_10074082
2130	Ga0307411_10105001
2131	Ga0307411_10369781
2132	Ga0307415_100084167
2133	Ga0307415_100174414
2134	Ga0307415_100355682
2135	Ga0316585_10078473
2136	Ga0316593_10000099
2137	Ga0316593_10014115
2138	Ga0316593_10110773
2139	Ga0307510_10049469
2140	Ga0373944_0051811
2141	Ga0373955_0066993
2142	Ga0373955_0127967
2143	Ga0373924_0279692
2144	Ga0373933_0282283
2145	Ga0373937_0169200
2146	Ga0372808_012930
2147	Ga0316582_0001289
2148	Ga0316582_0022179
2149	Ga0316582_0183759
2150	Ga0316584_0017354
2151	Ga0316584_0037905
2152	Ga0316584_0049147
2153	Ga0373925_0252703
2154	Ga0436361_0266070
2155	Ga0436361_0402518
2156	Ga0436361_0853791
2157	Ga0436361_0886702
2158	Ga0436361_1090902
2159	Ga0436363_0453668
2160	Ga0439436_0000833
2161	Ga0439438_001224
2162	Ga0439438_001549
2163	Ga0439438_004008
2164	Ga0439438_005594
2165	Ga0439438_005790
2166	Ga0439438_009352
2167	Ga0439438_010359
2168	Ga0439438_012607
2169	Ga0439438_014920
2170	Ga0439438_021047
2171	Ga0439447_004142
2172	Ga0439447_008988
2173	Ga0439447_009049
2174	Ga0439447_010776
2175	Ga0439447_011832
2176	Ga0439447_020833
2177	Ga0439447_021385
2178	Ga0439447_055998
2179	Ga0439466_0000342
2180	Ga0439466_0003474
2181	Ga0439466_0008671
2182	Ga0439466_0010056
2183	Ga0439466_0010233
2184	Ga0439466_0019467
2185	Ga0439466_0023531
2186	Ga0439466_0024435
2187	Ga0439466_0044354
2188	Ga0439465_0016289
2189	Ga0439431_0003060
2190	Ga0439437_000399
2191	Ga0439432_002272
2192	Ga0439432_007703
2193	Ga0439432_010293
2194	Ga0439432_023996
2195	Ga0439432_028347
2196	Ga0439432_035862
2197	Ga0439451_004096
2198	Ga0439451_005064
2199	Ga0439451_008818
2200	Ga0439451_010053
2201	Ga0439451_010169
2202	Ga0439451_033649
2203	Ga0439452_001929
2204	Ga0439452_003201
2205	Ga0439452_009021
2206	Ga0439452_010042
2207	Ga0439452_013708
2208	Ga0439452_017846
2209	Ga0439452_023445
2210	Ga0439452_033172
2211	Ga0439455_0009743
2212	Ga0439456_000039
2213	Ga0439463_000853
2214	Ga0439463_002002
2215	Ga0439463_086530
2216	Ga0450911_000037
2217	Ga0450911_001642
2218	Ga0450911_003964
2219	Ga0450911_005848
2220	Ga0450919_002466
2221	Ga0450920_003526
2222	Ga0450922_001072
2223	Ga0450888_007943
2224	Ga0450890_002228
2225	Ga0450891_002892
2226	Ga0450900_001058
2227	Ga0450902_000054
2228	Ga0450902_001616
2229	Ga0450902_004122
2230	Ga0450903_005673
2231	Ga0450904_000010
2232	Ga0450904_010490
2233	Ga0450905_000679
2234	Ga0450905_001423
2235	Ga0450905_014329
2236	Ga0450906_006204
2237	Ga0450906_009913
2238	Ga0450907_001932
2239	Ga0450907_002488
2240	Ga0450907_004667
2241	Ga0450910_003911
2242	Ga0439446_0000240
2243	Ga0439446_0004286
2244	Ga0439446_0010458
2245	Ga0439446_0025440
2246	Ga0450908_008905
2247	Ga0450908_009004
2248	Ga0450909_000714
2249	Ga0439434_0000961
2250	Ga0439434_0004881
2251	Ga0439434_0043007
2252	Ga0439459_0003627
2253	Ga0439464_0004058
2254	Ga0439460_0002311
2255	Ga0439460_0019492
2256	Ga0450916_001065
2257	Ga0450916_015004
2258	Ga0450893_0003022
2259	Ga0450901_001489
2260	Ga0450901_002348
2261	Ga0451577_0015060
2262	Ga0451577_0042643
2263	Ga0439440_0006002
2264	Ga0439440_0011180
2265	Ga0439440_0034438
2266	Ga0453684_0021288
2267	Ga0453684_0038545
2268	Ga0453684_0323772
2269	Ga0466957_0022085
2270	Ga0451576_0006228
2271	Ga0495617_006990
2272	Ga0495617_008831
2273	Ga0495617_010175
2274	Ga0495617_011834
2275	Ga0495617_016434
2276	Ga0495617_035200
2277	Ga0495617_035936
2278	Ga0495617_048118
2279	Ga0495627_000021
2280	Ga0495627_000279
2281	Ga0495627_002877
2282	Ga0495627_012871
2283	Ga0495627_014761
2284	Ga0495627_080545
2285	Ga0495603_0019669
2286	Ga0495603_0277600
2287	Ga0495590_0005949
2288	Ga0495590_0016364
2289	Ga0495590_0017594
2290	Ga0495590_0069610
2291	Ga0495591_000015
2292	Ga0495591_001669
2293	Ga0495591_002885
2294	Ga0495591_004439
2295	Ga0495591_008588
2296	Ga0495591_017922
2297	Ga0495591_019956
2298	Ga0495591_022689
2299	Ga0495591_023035
2300	Ga0495591_023688
2301	Ga0495591_030044
2302	Ga0495638_0007372
2303	Ga0495638_0036374
2304	Ga0495638_0055561
2305	Ga0495638_0058604
2306	Ga0495638_0069392
2307	Ga0495638_0122312
2308	Ga0495638_0133732
2309	Ga0495638_0158103
2310	Ga0495638_0306666
2311	Ga0495653_0004180
2312	Ga0495653_0081973
2313	Ga0495653_0122134
2314	Ga0495653_0164470
2315	Ga0495650_0000672
2316	Ga0495650_0004078
2317	Ga0495650_0010244
2318	Ga0495650_0014847
2319	Ga0495650_0022764
2320	Ga0495650_0037643
2321	Ga0495650_0051113
2322	Ga0495582_0040447
2323	Ga0495605_0000016
2324	Ga0495605_0000031
2325	Ga0495605_0005949
2326	Ga0495605_0009557
2327	Ga0495605_0012810
2328	Ga0495605_0020101
2329	Ga0495605_0031769
2330	Ga0495605_0031806
2331	Ga0495605_0034297
2332	Ga0495605_0036229
2333	Ga0495605_0040464
2334	Ga0495605_0063532
2335	Ga0495605_0067446
2336	Ga0495639_0002355
2337	Ga0495639_0049233
2338	Ga0495584_0005988
2339	Ga0495584_0012531
2340	Ga0495584_0012719
2341	Ga0495584_0015260
2342	Ga0495584_0021042
2343	Ga0495584_0027651
2344	Ga0495584_0034231
2345	Ga0495584_0036858
2346	Ga0495584_0041200
2347	Ga0495584_0049714
2348	Ga0495584_0113765
2349	Ga0495585_0006592
2350	Ga0495585_0022832
2351	Ga0495585_0045779
2352	Ga0495585_0059474
2353	Ga0495585_0062101
2354	Ga0495585_0077647
2355	Ga0495585_0087684
2356	Ga0495585_0116968
2357	Ga0495585_0136152
2358	Ga0495594_0002644
2359	Ga0495594_0019107
2360	Ga0495594_0048410
2361	Ga0495594_0159199
2362	Ga0495596_0005366
2363	Ga0495596_0005876
2364	Ga0495596_0024558
2365	Ga0495596_0145018
2366	Ga0495607_0000213
2367	Ga0495607_0000248
2368	Ga0495607_0000780
2369	Ga0495607_0002842
2370	Ga0495607_0009954
2371	Ga0495607_0010598
2372	Ga0495607_0011600
2373	Ga0495607_0019456
2374	Ga0495607_0027191
2375	Ga0495607_0030137
2376	Ga0495607_0032884
2377	Ga0495607_0032982
2378	Ga0495607_0036827
2379	Ga0495607_0037458
2380	Ga0495607_0048015
2381	Ga0495607_0070640
2382	Ga0495607_0072289
2383	Ga0495607_0082589
2384	Ga0495607_0109140
2385	Ga0495607_0113200
2386	Ga0495607_0143011
2387	Ga0495607_0144008
2388	Ga0495583_0000041
2389	Ga0495583_0000698
2390	Ga0495583_0001956
2391	Ga0495583_0003486
2392	Ga0495583_0007614
2393	Ga0495583_0016954
2394	Ga0495583_0026736
2395	Ga0495583_0034128
2396	Ga0495583_0190318
2397	Ga0495606_0000055
2398	Ga0495606_0000076
2399	Ga0495606_0002535
2400	Ga0495606_0023678
2401	Ga0495606_0050908
2402	Ga0495606_0064208
2403	Ga0495606_0067047
2404	Ga0495606_0083156
2405	Ga0495606_0141793
2406	Ga0495606_0150054
2407	Ga0495610_0011574
2408	Ga0495610_0016739
2409	Ga0495610_0021849
2410	Ga0495610_0031218
2411	Ga0495610_0032819
2412	Ga0495610_0034496
2413	Ga0495610_0041739
2414	Ga0495610_0048829
2415	Ga0495610_0055695
2416	Ga0495610_0082407
2417	Ga0495610_0182014
2418	Ga0495616_0018287
2419	Ga0495616_0022459
2420	Ga0495616_0023093
2421	Ga0495616_0025380
2422	Ga0495616_0037838
2423	Ga0495616_0041922
2424	Ga0495616_0061219
2425	Ga0495616_0099844
2426	Ga0495616_0110628
2427	Ga0495616_0127904
2428	Ga0495620_0000013
2429	Ga0495620_0000015
2430	Ga0495620_0004506
2431	Ga0495620_0007041
2432	Ga0495620_0009539
2433	Ga0495620_0020921
2434	Ga0495620_0028256
2435	Ga0495620_0030607
2436	Ga0495620_0039633
2437	Ga0495630_0138273
2438	Ga0495630_0542920
2439	Ga0495631_0001077
2440	Ga0495631_0005402
2441	Ga0495631_0013286
2442	Ga0495631_0018500
2443	Ga0495631_0019417
2444	Ga0495631_0045872
2445	Ga0495631_0056887
2446	Ga0495632_0000912
2447	Ga0495632_0000914
2448	Ga0495632_0004792
2449	Ga0495632_0006071
2450	Ga0495632_0013874
2451	Ga0495632_0016441
2452	Ga0495632_0021792
2453	Ga0495632_0023043
2454	Ga0495632_0033788
2455	Ga0495632_0034919
2456	Ga0495632_0038242
2457	Ga0495632_0039888
2458	Ga0495632_0047112
2459	Ga0495632_0058396
2460	Ga0495632_0058489
2461	Ga0495632_0075146
2462	Ga0495637_0002612
2463	Ga0495637_0004529
2464	Ga0495637_0005694
2465	Ga0495637_0007261
2466	Ga0495637_0017172
2467	Ga0495637_0018263
2468	Ga0495637_0019162
2469	Ga0495637_0020767
2470	Ga0495637_0022348
2471	Ga0495637_0022776
2472	Ga0495637_0029922
2473	Ga0495637_0033601
2474	Ga0495637_0035383
2475	Ga0495637_0043875
2476	Ga0495637_0044521
2477	Ga0495637_0046189
2478	Ga0495637_0046435
2479	Ga0495637_0057101
2480	Ga0495637_0069147
2481	Ga0495643_0000223
2482	Ga0495643_0000903
2483	Ga0495643_0005943
2484	Ga0495643_0017044
2485	Ga0495643_0024183
2486	Ga0495643_0025143
2487	Ga0495643_0039907
2488	Ga0495643_0050678
2489	Ga0495643_0079633
2490	Ga0495643_0082044
2491	Ga0495644_0002168
2492	Ga0495644_0010883
2493	Ga0495644_0011456
2494	Ga0495644_0013322
2495	Ga0495648_0001423
2496	Ga0495648_0013055
2497	Ga0495648_0015574
2498	Ga0495648_0023408
2499	Ga0495648_0025075
2500	Ga0495648_0034686
2501	Ga0495648_0041479
2502	Ga0495648_0044521
2503	Ga0495648_0047699
2504	Ga0495648_0051298
2505	Ga0495648_0059460
2506	Ga0495648_0103951
2507	Ga0495648_0181519
2508	Ga0495666_0028181
2509	Ga0495666_0028814
2510	Ga0495666_0060953
2511	Ga0495666_0076875
2512	Ga0495666_0079427
2513	Ga0495642_0007697
2514	Ga0495642_0016767
2515	Ga0495642_0098837
2516	Ga0495654_0003364
2517	Ga0495654_0003578
2518	Ga0495654_0005355
2519	Ga0495654_0011029
2520	Ga0495654_0017170
2521	Ga0495654_0019515
2522	Ga0495654_0026301
2523	Ga0495654_0026889
2524	Ga0495654_0026928
2525	Ga0495654_0027126
2526	Ga0495654_0041676
2527	Ga0495654_0049043
2528	Ga0495654_0049607
2529	Ga0495654_0049807
2530	Ga0495654_0054386
2531	Ga0495654_0084047
2532	Ga0495654_0115631
2533	Ga0495587_0011359
2534	Ga0495587_0090248
2535	Ga0495609_0000015
2536	Ga0495609_0000070
2537	Ga0495609_0003891
2538	Ga0495609_0007126
2539	Ga0495609_0011234
2540	Ga0495609_0017860
2541	Ga0495609_0026590
2542	Ga0495609_0051738
2543	Ga0495597_0000005
2544	Ga0495597_0007051
2545	Ga0495597_0017816
2546	Ga0495597_0024033
2547	Ga0495597_0027481
2548	Ga0495597_0033890
2549	Ga0495597_0036774
2550	Ga0495597_0043811
2551	Ga0495597_0104564
2552	Ga0495622_0003963
2553	Ga0495622_0006164
2554	Ga0495622_0023199
2555	Ga0495622_0078300
2556	Ga0495622_0078683
2557	Ga0495622_0180547
2558	Ga0495622_0233470
2559	Ga0495633_0000060
2560	Ga0495633_0058007
2561	Ga0495633_0094701
2562	Ga0495656_0007313
2563	Ga0495656_0050322
2564	Ga0495668_0005973
2565	Ga0495668_0014935
2566	Ga0495668_0021887
2567	Ga0495668_0031705
2568	Ga0495668_0044242
2569	Ga0495668_0069212
2570	Ga0495668_0080940
2571	Ga0495611_0000817
2572	Ga0495611_0003416
2573	Ga0495611_0008468
2574	Ga0495611_0177806
2575	Ga0495625_0001491
2576	Ga0495625_0039315
2577	Ga0495625_0048065
2578	Ga0495625_0056725
2579	Ga0495625_0060601
2580	Ga0495625_0060645
2581	Ga0495625_0071993
2582	Ga0495625_0073865
2583	Ga0495625_0082198
2584	Ga0495625_0092578
2585	Ga0495635_0024927
2586	Ga0495659_0003433
2587	Ga0495659_0006875
2588	Ga0495661_0000110
2589	Ga0495661_0000139
2590	Ga0495661_0000194
2591	Ga0495661_0000304
2592	Ga0495661_0033167
2593	Ga0495661_0034653
2594	Ga0495661_0045968
2595	Ga0495661_0048299
2596	Ga0495661_0049273
2597	Ga0495661_0073246
2598	Ga0495661_0145959
2599	Ga0495588_0053045
2600	Ga0495657_0089469
2601	Ga0495623_0028796
2602	Ga0495623_0073396
2603	Ga0495646_0047386
2604	Ga0495646_0049353
2605	Ga0495646_0051265
2606	Ga0495613_0074858
2607	Ga0495613_0109373
2608	Ga0495624_0035375
2609	Ga0495670_0002014
2610	Ga0495670_0011663
2611	Ga0495670_0018131
2612	Ga0495670_0026679
2613	Ga0495670_0032892
2614	Ga0495670_0042087
2615	Ga0495670_0100585
2616	Ga0495671_0012159
2617	Ga0495671_0012308
2618	Ga0495671_0019657
2619	Ga0495671_0024378
2620	Ga0495671_0025919
2621	Ga0495671_0030073
2622	Ga0495671_0033768
2623	Ga0495671_0038679
2624	Ga0495671_0040673
2625	Ga0495671_0049899
2626	Ga0495671_0054005
2627	Ga0495671_0075482
2628	Ga0495649_0002123
2629	Ga0495649_0005972
2630	Ga0495649_0007467
2631	Ga0495649_0021051
2632	Ga0495649_0021264
2633	Ga0495649_0024872
2634	Ga0495649_0051810
2635	Ga0495649_0052077
2636	Ga0495649_0080205
2637	Ga0495649_0090182
2638	Ga0495649_0098465
2639	Ga0495589_0000855
2640	Ga0495589_0007319
2641	Ga0495589_0015046
2642	Ga0495589_0017341
2643	Ga0495589_0032608
2644	Ga0495589_0050600
2645	Ga0495589_0057921
2646	Ga0495589_0062720
2647	Ga0495589_0067841
2648	Ga0495600_0005020
2649	Ga0495600_0089228
2650	Ga0495660_0001756
2651	Ga0495660_0003768
2652	Ga0495660_0012162
2653	Ga0495660_0012461
2654	Ga0495660_0023430
2655	Ga0495660_0037271
2656	Ga0495660_0040878
2657	Ga0495660_0043801
2658	Ga0495660_0044186
2659	Ga0495660_0051200
2660	Ga0495660_0057350
2661	Ga0495660_0065231
2662	Ga0495660_0071753
2663	Ga0495660_0084041
2664	Ga0495660_0191757
2665	Ga0495660_0234043
2666	Ga0495660_0255303
2667	Ga0495581_0035809
2668	Ga0495581_0048987
2669	Ga0495604_0069747
2670	Ga0495604_0096090
2671	Ga0495636_0139648
2672	Ga0495674_0094175
2673	Ga0495672_0004124
2674	Ga0495672_0019813
2675	Ga0495672_0021920
2676	Ga0495672_0022683
2677	Ga0495672_0022705
2678	Ga0495672_0023187
2679	Ga0495672_0025191
2680	Ga0495672_0035433
2681	Ga0495672_0039660
2682	Ga0495672_0040582
2683	Ga0495672_0040686
2684	Ga0495672_0042293
2685	Ga0495672_0043338
2686	Ga0495672_0056128
2687	Ga0495672_0063290
2688	Ga0495672_0087841
2689	Ga0495672_0142541
2690	Ga0495676_0000013
2691	Ga0495676_0049710
2692	Ga0495676_0078924
2693	Ga0495680_0045292
2694	Ga0495680_0055417
2695	Ga0495680_0123538
2696	Ga0495683_0000027
2697	Ga0495683_0000261
2698	Ga0495683_0008434
2699	Ga0495683_0012183
2700	Ga0495683_0015414
2701	Ga0495683_0019221
2702	Ga0495683_0029219
2703	Ga0495683_0050496
2704	Ga0495683_0052965
2705	Ga0495683_0079541
2706	Ga0495687_010031
2707	Ga0495687_012754
2708	Ga0495687_020397
2709	Ga0495687_038737
2710	Ga0495675_0025539
2711	Ga0495675_0203974
2712	Ga0495677_0008888
2713	Ga0495679_000206
2714	Ga0495679_001765
2715	Ga0495679_025228
2716	Ga0495679_028561
2717	Ga0495679_049446
2718	Ga0495685_107500
2719	Ga0495673_0002579
2720	Ga0495673_0003090
2721	Ga0495673_0010469
2722	Ga0495673_0010910
2723	Ga0495673_0011603
2724	Ga0495673_0011642
2725	Ga0495673_0013537
2726	Ga0495673_0015057
2727	Ga0495673_0015361
2728	Ga0495673_0017562
2729	Ga0495673_0018296
2730	Ga0495673_0022618
2731	Ga0495673_0025448
2732	Ga0495673_0026358
2733	Ga0495673_0027377
2734	Ga0495673_0031299
2735	Ga0495673_0034373
2736	Ga0495673_0036207
2737	Ga0495673_0037760
2738	Ga0495673_0048823
2739	Ga0495673_0057895
2740	Ga0495673_0067455
2741	Ga0495673_0083245
2742	Ga0495681_0003664
2743	Ga0495681_0005466
2744	Ga0495681_0010709
2745	Ga0495681_0011975
2746	Ga0495681_0023766
2747	Ga0495681_0023768
2748	Ga0495681_0024241
2749	Ga0495681_0029332
2750	Ga0495681_0038714
2751	Ga0495681_0039156
2752	Ga0495681_0042656
2753	Ga0495681_0043014
2754	Ga0495681_0057852
2755	Ga0495681_0094505
2756	Ga0495684_0105134
2757	Ga0495686_0038266
2758	Ga0495686_0040851
2759	Ga0495686_0069749
2760	Ga0495686_0116061
2761	Ga0495593_0028238
2762	Ga0495593_0040781
2763	Ga0495593_0058171
2764	Ga0495593_0108646
2765	Ga0495626_0000056
2766	Ga0495626_0004948
2767	Ga0495626_0011052
2768	Ga0495626_0013013
2769	Ga0495626_0015084
2770	Ga0495626_0025240
2771	Ga0495626_0028464
2772	Ga0495626_0034099
2773	Ga0495626_0066381
2774	Ga0495626_0072007
2775	Ga0495626_0073259
2776	Ga0496100_0290706
2777	Ga0496101_0000466
2778	Ga0496101_0204999
2779	Ga0496101_0396859
2780	Ga0496102_0047483
2781	Ga0496102_0048910
2782	Ga0496102_0119841
2783	Ga0496103_0148800
2784	Ga0496103_0448210
2785	Ga0496104_0035910
2786	Ga0496104_0040014
2787	Ga0496104_0110288
2788	Ga0496105_0021755
2789	Ga0496105_0537611
2790	Ga0496106_0029970
2791	Ga0496106_0074362
2792	Ga0496106_0280225
2793	Ga0496106_0451695
2794	Ga0496107_0051088
2795	Ga0496108_0006415
2796	Ga0496108_0367584
2797	Ga0496109_0100366
2798	Ga0496110_0011106
2799	Ga0496110_0102429
2800	Ga0496111_0455062
2801	Ga0496111_0467446
2802	Ga0496112_0057089
2803	Ga0496113_0096123
2804	Ga0496114_0003061
2805	Ga0496114_0011632
2806	Ga0496114_0018708
2807	Ga0496114_0036799
2808	Ga0496114_0222178
2809	Ga0496114_0528798
2810	Ga0496114_0659308
2811	Ga0496115_0072519
2812	Ga0496116_0000999
2813	Ga0496116_0018019
2814	Ga0496116_0024148
2815	Ga0496116_0058643
2816	Ga0496116_0073068
2817	Ga0496116_0103382
2818	Ga0496117_0002620
2819	Ga0496117_0003526
2820	Ga0496117_0006411
2821	Ga0496117_0064060
2822	Ga0496117_0067455
2823	Ga0496117_0078850
2824	Ga0496117_0081934
2825	Ga0496117_0084676
2826	Ga0496118_0001807
2827	Ga0496118_0010787
2828	Ga0496118_0059014
2829	Ga0496118_0077160
2830	Ga0496118_0079127
2831	Ga0496118_0095404
2832	Ga0496118_0096652
2833	Ga0496118_0112378
2834	Ga0496119_0000112
2835	Ga0496119_0177031
2836	Ga0496120_0004409
2837	Ga0496121_0002354
2838	Ga0496121_0003009
2839	Ga0496121_0022025
2840	Ga0496121_0035563
2841	Ga0496121_0064610
2842	Ga0496121_0083832
2843	Ga0496121_0131674
2844	Ga0496121_0260684
2845	Ga0496122_0000122
2846	Ga0496122_0009298
2847	Ga0496122_0026934
2848	Ga0496122_0033077
2849	Ga0496122_0081786
2850	Ga0496122_0104926
2851	Ga0496122_0188092
2852	Ga0496123_0000391
2853	Ga0496123_0001340
2854	Ga0496123_0012443
2855	Ga0496123_0070247
2856	Ga0496123_0081476
2857	Ga0496123_0083128
2858	Ga0496123_0113908
2859	Ga0496124_0000222
2860	Ga0496124_0010141
2861	Ga0496124_0012924
2862	Ga0496124_0013421
2863	Ga0496124_0016180
2864	Ga0496124_0034795
2865	Ga0496124_0039152
2866	Ga0496124_0053019
2867	Ga0496124_0110306
2868	Ga0496124_0149010
2869	Ga0496124_0302255
2870	Ga0496125_0000908
2871	Ga0496125_0027866
2872	Ga0496125_0027889
2873	Ga0496125_0097043
2874	Ga0496126_0015473
2875	Ga0495678_000031
2876	Ga0495678_000039
2877	Ga0495678_004626
2878	Ga0495678_008903
2879	Ga0495678_011885
2880	Ga0495678_017708
2881	Ga0495678_020941
2882	Ga0495678_029588
2883	Ga0495678_029622
2884	Ga0495678_039841
2885	Ga0495678_041063
2886	Ga0495682_0000577
2887	Ga0495682_0004465
2888	Ga0495682_0021667
2889	Ga0495682_0021913
2890	Ga0495682_0026083
2891	Ga0495682_0097601
2892	Ga0495682_0099269
2893	Ga0501296_010262
2894	Ga0501031_0107100
2895	Ga0501032_0017099
2896	Ga0501034_0000137
2897	Ga0501034_0172146
2898	Ga0501037_0042957
2899	Ga0501040_0124079
2900	Ga0501067_0114862
2901	Ga0501069_0164182
2902	Ga0501202_015693
2903	Ga0501233_002763
2904	Ga0501235_013911
2905	Ga0501239_004342
2906	Ga0501243_016013
2907	Ga0501246_003346
2908	Ga0501225_0014126
2909	Ga0501245_005509
2910	Ga0501241_006626
2911	Ga0501262_034679
2912	Ga0501268_028519
2913	Ga0501268_032138
2914	Ga0501270_008138
2915	Ga0501273_015947
2916	Ga0501274_009760
2917	Ga0501035_0128903
2918	Ga0501212_011543
2919	Ga0501226_000017
2920	nmdc:mga00v17_172978_c1
2921	nmdc:mga00v17_89631_c1
2922	nmdc:mga09592_87736_c1
2923	nmdc:mga0qj67_141644_c1
2924	nmdc:mga06r32_203096_c1
2925	nmdc:mga06r32_2428_c1
2926	nmdc:mga08y16_6548_c1
2927	Ga0495595_0006275
2928	Ga0495619_0001225
2929	Ga0500618_003306
2930	Ga0500659_0022945
2931	Ga0500573_0024813
2932	Ga0500596_007977
2933	Ga0501082_0549490
2934	8057161894
2935	2511257403
2936	2511268772
2937	2511270781
2938	2511277035
2939	2511291521
2940	2511296156
2941	2511301349
2942	2511311931
2943	2511318293
2944	2511323551
2945	2511333872
2946	2511337189
2947	2511346140
2948	2511352549
2949	2511355006
2950	2511364019
2951	2511370147
2952	2511375561
2953	2511411121
2954	2511826707
2955	2512328305
2956	2554817003
2957	2555244599
2958	2555668035
2959	2583790478
2960	2597856251
2961	2597862330
2962	2597868050
2963	2599330099
2964	2599355035
2965	2599361141
2966	2599367463
2967	2599374253
2968	2599380141
2969	2599386588
2970	2599393111
2971	2599397064
2972	2599404878
2973	2599449057
2974	2599461869
2975	2599467088
2976	2599483493
2977	2599491038
2978	2599502942
2979	2599508825
2980	2599511199
2981	2599519310
2982	2599616769
2983	2599771228
2984	2599805399
2985	2599879646
2986	2599886000
2987	2599890573
2988	2599897714
2989	2599930030
2990	2599945440
2991	2599948145
2992	2599955712
2993	2599961082
2994	2599967230
2995	2599974110
2996	2599980373
2997	2599985824
2998	2599990718
2999	2599996040
3000	2600001896
3001	2600005620
3002	2600014184
3003	2600019134
3004	2600025610
3005	2600027775
3006	2600033509
3007	2600040205
3008	2600049423
3009	2600056702
3010	2600059173
3011	2600064311
3012	2600074720
3013	2600077241
3014	2600214491
3015	2600356942
3016	2600364105
3017	2600442959
3018	2601625731
3019	2601690915
3020	2601774804
3021	2601800068
3022	2602009565
3023	2606074667
3024	2606127530
3025	2608379678
3026	2621301545
3027	2624478815
3028	2624494137
3029	2643844244
3030	2643868899
3031	2643952316
3032	2644023921
3033	2644188327
3034	2644282467
3035	2644624006
3036	2652547709
3037	2671089809
3038	2671097636
3039	2671125561
3040	2671767865
3041	2677898173
3042	2678265072
3043	2691330958
3044	2715750820
3045	2715757532
3046	2718632700
3047	2723247219
3048	2729145897
3049	2738673765
3050	2738691549
3051	2738752158
3052	2738809104
3053	2738861199
3054	2738896464
3055	2739198360
3056	2739256876
3057	2739267324
3058	2739286201
3059	2739291514
3060	2739316418
3061	2743735660
3062	2745005529
3063	2765585692
3064	2774122159
3065	2774136708
3066	2784260460
3067	2784314404
3068	2794595622
3069	2807406923
3070	2807455255
3071	2808858593
3072	2808904660
3073	2808921885
3074	2808928760
3075	2808938782
3076	2808941657
3077	2808944006
3078	2808950881
3079	2808960446
3080	2808967098
3081	2808975244
3082	2808991117
3083	2809001908
3084	2809215753
3085	2812368112
3086	2817489100
3087	2819658370
3088	2819702719
3089	2823424588
3090	2825656031
3091	2826585738
3092	2834029004
3093	2842805628
3094	2842818608
3095	2842828721
3096	2842835716
3097	2842843215
3098	2842847463
3099	2842853830
3100	2842856435
3101	2844668537
3102	2852615511
3103	2852662829
3104	2852670479
3105	2860340642
3106	2860869033
3107	2878030779
3108	2880231691
3109	2904520726
3110	2904551111
3111	2908447826
3112	2912967956
3113	2913041681
3114	2917071797
3115	2919067271
3116	2919159285
3117	2919385830
3118	2919458351
3119	2919484619
3120	2919492792
3121	2919504318
3122	2919534513
3123	2919691004
3124	2919699947
3125	2923154669
3126	2923522165
3127	2923590330
3128	2926065109
3129	2929149004
3130	2929191030
3131	2931373575
3132	2931392035
3133	2931399456
3134	2935353970
3135	2939638122
3136	2939652385
3137	2945929550
3138	2945961261
3139	2946011829
3140	2946029279
3141	2947235827
3142	2952252655
3143	2969305602
3144	2974292767
3145	2984291360
3146	2988730601
3147	2990198319
3148	2998141044
3149	3007253689
3150	3007317537
3151	3007400199
3152	3007420683
3153	3007516336
3154	3007618770
3155	3007622074
3156	3007719274
3157	3007808410
3158	3007860928
3159	3007863734
3160	3007867651
3161	3007875429
3162	637318414
3163	640487190
3164	651175066
3165	8011353176
3166	8015688905
3167	8019773283
3168	8019776613
3169	8029999718
3170	8034962573
3171	8052495673
3172	8054286230
3173	8054352553
3174	8054504613
3175	8054933239
3176	8055772022
3177	8055819055
3178	8055884066
3179	8056117439
3180	8056124775
3181	8056127088
3182	8056132924
3183	8056138577
3184	8056144390
3185	8056149140
3186	8056155596
3187	8056161201
3188	8056170007
3189	8056176141
3190	8056180570
3191	8056569694
3192	8057803311

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03740

PdxJ

Pyridoxal phosphate biosynthesis protein PdxJ

3

235

0.99 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3f4n-assembly2.cif.gz_C	crystal structure of pyridoxal phosphate biosynthetic protein pdxj from yersinia pestis	0.9259	7	242
1ho1-assembly1.cif.gz_C	crystal structure of pyridoxine 5'-phosphate synthase	0.9256	7	242
5dlc-assembly2.cif.gz_D	x-ray crystal structure of a pyridoxine 5-prime-phosphate synthase from pseudomonas aeruginosa	0.9231	6	243
6rg0-assembly2.cif.gz_B	structure of pdxj	0.9224	7	242
1ixo-assembly3.cif.gz_A-2	enzyme-analogue substrate complex of pyridoxine 5'-phosphate synthase	0.9155	7	242

ID	Description	Score	Start	End	Superfamily
3gk0A00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9153	1	242	3.20.20.70
3gk0A00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9006	1	242	3.20.20.70
3o6cA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.8994	6	236	3.20.20.70
3o6cA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.8464	6	236	3.20.20.70
3t40A00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.845	7	223	3.20.20.70

ID	Description	Score	Start	End	GO Terms
AF-A0A7G3EKP2-F1-model_v4	deleted	0.9957	93	195
AF-A0A520ZVJ4-F1-model_v4	Pyridoxine 5'-phosphate synthase (EC 2.6.99.2)	0.9944	6	181	GO:0004222 GO:0004519 GO:0005829 GO:0006364 GO:0008615 GO:0033856 GO:0046872
AF-A0A2N2S5X2-F1-model_v4	Pyridoxine 5'-phosphate synthase (EC 2.6.99.2)	0.9936	7	222	GO:0005829 GO:0008615 GO:0033856
AF-A0A376FMP7-F1-model_v4	Pyridoxine 5'-phosphate synthase (PNP synthase) (EC 2.6.99.2)	0.993	6	222	GO:0005829 GO:0008615 GO:0033856
AF-A0A4U9IGQ4-F1-model_v4	Multifunctional fusion protein [Includes: Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS); Pyridoxine 5'-phosphate synthase (PNP synthase) (EC 2.6.99.2)]	0.9926	6	227	GO:0000287 GO:0005829 GO:0006633 GO:0008615 GO:0008897 GO:0033856

F494973

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03740

PdxJ

Pyridoxal phosphate biosynthesis protein PdxJ

3

235

0.99

Structural Annotation

Top 5 Hits

Map