F495002

General Info

Members Datasets Scaffolds Average Seq Length
1602 660 3198 314

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|640427133|640488419
Length 362
Sequence DVRGYARWTPAGRHEFGWTVVRTAHRLNGLILLGQGLPMSRIYADNARSIGNTPLVMINRLGPKGVSIMAKIEGRNPAYSVKCRIGAGMIWDAEDSGRIKPGMTLVEPTSGNTGIGLAFVAAARGYKLMLTMPASMSLERRKVLKALGAELVLTEPAKGMKGAIEKAAEIAASNPEQYYMPQQFENPSNPAIHEKTTGPEIWNDTDGGIDVLVAGVGTGGTITGVSRYIKNTKGKQILSVAVEPASSPVISQTLAGEEVKPSPHKIQGIGAGFVPKNLDLSMVDRVELVDDNEAKQMALRLMREEGILCGISCGAAMAAAVRLAERPEMQGKNIVVILPDSGERYLSSMLFSDMFSEQELVQ

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
73 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
110 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
116 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
119 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
120 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
122 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
130 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
132 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
133 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
135 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
136 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
186 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
187 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
195 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
200 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
201 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
202 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
203 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
204 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
205 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
206 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
207 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
208 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
209 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
210 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
211 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
212 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
216 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
217 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
218 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
219 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
220 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
221 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
222 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
223 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
224 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
225 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
226 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
227 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
228 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
229 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
230 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
231 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
232 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
233 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
234 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
235 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
236 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
237 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
238 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
239 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
240 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
241 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
242 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
243 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
244 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
247 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
248 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
249 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
250 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
251 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
252 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
253 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
254 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
255 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
256 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
257 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
258 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
259 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
260 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
261 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
262 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
263 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
264 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
265 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
266 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
267 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
268 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
269 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
270 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
271 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
272 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
273 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
274 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
275 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
276 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
277 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
278 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
279 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
280 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
281 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
282 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
283 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
284 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
285 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
286 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
287 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
288 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
289 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
290 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
291 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
292 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
293 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
294 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
295 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
296 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
297 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
298 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
299 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
300 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
301 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
302 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
303 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
304 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
305 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
306 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
307 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
308 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
309 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
310 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
311 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
312 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
313 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
314 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
315 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
316 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
317 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
318 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
319 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
320 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
321 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
322 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
323 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
324 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
325 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
326 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
327 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
328 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
329 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
330 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
331 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
332 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
333 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
334 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
335 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
336 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
337 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
338 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
339 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
340 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
341 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
342 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
343 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
344 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
345 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
346 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
347 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
348 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
349 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
350 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
351 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
352 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
353 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
354 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
355 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
356 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
357 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
358 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
359 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
360 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
361 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
362 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
363 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
364 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
365 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
366 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
367 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
368 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
369 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
370 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
371 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
372 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
373 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
374 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
375 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
376 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
377 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
378 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
379 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
380 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
381 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
382 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
383 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
384 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
385 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
386 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
387 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
388 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
389 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
390 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
391 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
392 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
393 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
394 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
395 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
396 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
397 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
398 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
399 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
400 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
401 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
402 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
403 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
404 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
405 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
406 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
407 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
408 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
409 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
410 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
411 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
412 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
413 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
414 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
419 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
429 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
430 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
431 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
432 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
433 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
434 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
435 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
436 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
437 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
438 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
439 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
440 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
443 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
444 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
445 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
446 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
447 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
448 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
449 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
450 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
451 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
452 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
453 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
454 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
455 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
456 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
457 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
458 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
459 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
460 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
461 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
462 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
463 2506520008 Serratia plymuthica AS12 Isolate Unclassified
464 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
465 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
466 2511231004 Pseudomonas sp. GM102 Isolate Nodule
467 2511231007 Pseudomonas sp. GM18 Isolate Nodule
468 2511231011 Pseudomonas sp. GM30 Isolate Nodule
469 2511231016 Pseudomonas sp. GM50 Isolate Nodule
470 2511231018 Pseudomonas sp. GM60 Isolate Nodule
471 2511231019 Pseudomonas sp. GM67 Isolate Nodule
472 2511231022 Pseudomonas sp. GM79 Isolate Nodule
473 2511231024 Pseudomonas sp. GM84 Isolate Nodule
474 2527291627 Frankia casuarinae Thr Isolate Nodule
475 2527291629 Frankia sp. BMG5.23 Isolate Nodule
476 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
477 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
478 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
479 2547132512 Azospira oryzae 6a3 Isolate Unclassified
480 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
481 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
482 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
483 2576861822 Frankia sp. CeD Isolate Nodule
484 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
485 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
486 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
487 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
488 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
489 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
490 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
491 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
492 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
493 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
494 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
495 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
496 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
497 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
498 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
499 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
500 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
501 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
502 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
503 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
504 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
505 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
506 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
507 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
508 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
509 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
510 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
511 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
512 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
513 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
514 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
515 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
516 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
517 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
518 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
519 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
520 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
521 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
522 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
523 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
524 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
525 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
526 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
527 2626541554 Frankia sp. AvcI.1 Isolate Nodule
528 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
529 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
530 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
531 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
532 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
533 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
534 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
535 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
536 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
537 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
538 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
539 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
540 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
541 2684623036 Frankia sp. CgIM4 Isolate Nodule
542 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
543 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
544 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
545 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
546 2710264753 Frankia sp. KB5 Isolate Nodule
547 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
548 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
549 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
550 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
551 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
552 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
553 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
554 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
555 2765235841 Pseudomonas putida AA7 Isolate Unclassified
556 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
557 2773857670 Pseudomonas sp. 478 Isolate Unclassified
558 2773857673 Pseudomonas sp. 443 Isolate Unclassified
559 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
560 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
561 2773857924 Frankia sp. CgIS1 Isolate Nodule
562 2784132063 Pseudomonas sp. 424 Isolate Unclassified
563 2784132072 Pseudomonas sp. 460 Isolate Unclassified
564 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
565 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
566 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
567 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
568 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
569 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
570 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
571 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
572 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
573 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
574 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
575 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
576 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
577 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
578 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
579 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
580 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
581 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
582 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
583 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
584 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
585 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
586 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
587 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
588 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
589 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
590 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
591 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
592 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
593 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
594 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
595 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
596 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
597 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
598 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
599 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
600 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
601 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
602 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
603 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
604 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
605 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
606 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
607 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
608 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
609 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
610 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
611 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
612 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
613 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
614 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
615 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
616 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
617 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
618 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
619 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
620 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
621 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
622 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
623 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
624 2932406140 Serratia sp. 2723 Isolate Rhizosphere
625 2937967321 Serratia sp. YC16 Isolate Unclassified
626 2939577877 Serratia sp. 509 Isolate Rhizosphere
627 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
628 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
629 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
630 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
631 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
632 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
633 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
634 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
635 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
636 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
637 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
638 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
639 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
640 637000116 Frankia casuarinae CcI3 Isolate Nodule
641 640753048 Serratia proteamaculans 568 Isolate Endosphere
642 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
643 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
644 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
645 8004592986 Serratia sp. S119 Isolate Unclassified
646 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
647 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
648 8052494512 Pseudomonas putida LD6 Isolate Unclassified
649 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
650 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
651 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
652 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
653 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
654 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
655 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
656 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
657 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
658 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
659 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
660 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.08
Metatranscriptomes 1.31
Isolates 12.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.06
Bulb 0
Endosphere 2.25
Nodule 1.69
Rhizoplane 4.06
Rhizosphere 81.77
Stem 0
Stem Tuber 0.37
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_6404 2124908027 Bacteria 7500
2 MRS2a_Contig_914 2124908027 Bacteria 8140
3 SwRhRL2b_contig_2277002 2162886007 Bacteria 2239
4 JGI25162J39368_1000100 3300002737 Bacteria 94568
5 JGI25163J39215_1000894 3300002771 Bacteria 6912
6 JGI25164J39214_1000079 3300002772 Bacteria 94568
7 JGI25165J46597_1000183 3300003214 Bacteria 94568
8 Ga0055538_1000078 3300003751 Bacteria 86114
9 Ga0055539_1000119 3300003752 Bacteria 86114
10 Ga0055533_1000127 3300003756 Bacteria 86114
11 Ga0055532_1000068 3300003758 Bacteria 138828
12 Ga0055525_1000163 3300003759 Bacteria 86114
13 Ga0055536_1016854 3300003781 Bacteria 2420
14 Ga0055541_1000079 3300003841 Bacteria 86114
15 Ga0058692_1000067 3300003856 Bacteria 88996
16 Ga0058692_1000911 3300003856 Bacteria 11646
17 Ga0058692_1017134 3300003856 Bacteria 1595
18 Ga0065714_10001613 3300005288 Bacteria 5331
19 Ga0065714_10067998 3300005288 Bacteria 5045
20 Ga0065704_10003637 3300005289 Bacteria 4069
21 Ga0065704_10006591 3300005289 Bacteria 4786
22 Ga0065712_10002299 3300005290 Bacteria 6611
23 Ga0065715_10005136 3300005293 Bacteria 3683
24 Ga0070658_10077856 3300005327 Bacteria 2720
25 Ga0070683_100022822 3300005329 Bacteria 5597
26 Ga0070683_100025908 3300005329 Bacteria 5274
27 Ga0070683_100043891 3300005329 Bacteria 4121
28 Ga0070683_100063164 3300005329 Bacteria 3444
29 Ga0070683_100065855 3300005329 Bacteria 3374
30 Ga0070683_100100147 3300005329 Unclassified 2728
31 Ga0070683_100128431 3300005329 Bacteria 2397
32 Ga0070683_100318770 3300005329 Bacteria 1479
33 Ga0070690_100190414 3300005330 Bacteria 1422
34 Ga0070670_100000018 3300005331 Bacteria 221691
35 Ga0070670_100135408 3300005331 Bacteria 2129
36 Ga0068869_100135873 3300005334 Bacteria 1894
37 Ga0070682_100039334 3300005337 Bacteria 2906
38 Ga0068868_100031941 3300005338 Bacteria 4047
39 Ga0070660_100017653 3300005339 Bacteria 5203
40 Ga0070691_10001552 3300005341 Bacteria 9903
41 Ga0070691_10012197 3300005341 Bacteria 3936
42 Ga0070661_100192544 3300005344 Bacteria 1556
43 Ga0070668_100375171 3300005347 Bacteria 1209
44 Ga0070669_100000954 3300005353 Bacteria 21107
45 Ga0070675_100092910 3300005354 Bacteria 2530
46 Ga0070671_100000084 3300005355 Bacteria 59737
47 Ga0070671_100249178 3300005355 Bacteria 1509
48 Ga0070688_100000916 3300005365 Bacteria 14728
49 Ga0070659_100012188 3300005366 Bacteria 6372
50 Ga0070667_100000002 3300005367 Bacteria 504831
51 Ga0070714_100038188 3300005435 Bacteria 4038
52 Ga0070714_100042300 3300005435 Bacteria 3849
53 Ga0070714_100047786 3300005435 Bacteria 3637
54 Ga0070714_100096603 3300005435 Bacteria 2596
55 Ga0070714_100222041 3300005435 Bacteria 1737
56 Ga0070713_100013534 3300005436 Bacteria 6029
57 Ga0070713_100017674 3300005436 Bacteria 5402
58 Ga0070713_100049646 3300005436 Bacteria 3462
59 Ga0070713_100436349 3300005436 Bacteria 1228
60 Ga0070710_10103815 3300005437 Bacteria 1697
61 Ga0070711_100016406 3300005439 Bacteria 4704
62 Ga0070711_100079683 3300005439 Bacteria 2330
63 Ga0070708_100168989 3300005445 Bacteria 2041
64 Ga0070708_100182915 3300005445 Bacteria 1959
65 Ga0070663_100328580 3300005455 Bacteria 1232
66 Ga0070678_100259453 3300005456 Bacteria 1461
67 Ga0070662_100326916 3300005457 Bacteria 1252
68 Ga0070681_10013442 3300005458 Bacteria 8134
69 Ga0070681_10031212 3300005458 Bacteria 5347
70 Ga0070681_10107898 3300005458 Bacteria 2725
71 Ga0070681_10146899 3300005458 Bacteria 2286
72 Ga0070685_10000009 3300005466 Bacteria 166260
73 Ga0070706_100001466 3300005467 Bacteria 24814
74 Ga0070706_100325542 3300005467 Bacteria 1433
75 Ga0070707_100005111 3300005468 Bacteria 12300
76 Ga0070707_100061755 3300005468 Bacteria 3594
77 Ga0070699_100184904 3300005518 Bacteria 1850
78 Ga0070699_100191326 3300005518 Bacteria 1818
79 Ga0070679_100003415 3300005530 Bacteria 14542
80 Ga0070679_100070265 3300005530 Bacteria 3493
81 Ga0070679_100198544 3300005530 Bacteria 1973
82 Ga0070679_100255785 3300005530 Bacteria 1707
83 Ga0070684_100002254 3300005535 Bacteria 14182
84 Ga0070684_100060988 3300005535 Bacteria 3300
85 Ga0070684_100079773 3300005535 Bacteria 2894
86 Ga0070684_100128047 3300005535 Bacteria 2289
87 Ga0070684_100208463 3300005535 Bacteria 1781
88 Ga0070684_100240764 3300005535 Bacteria 1653
89 Ga0068853_100013136 3300005539 Bacteria 6758
90 Ga0068853_100042324 3300005539 Bacteria 3894
91 Ga0070696_100000147 3300005546 Bacteria 39206
92 Ga0070696_100004865 3300005546 Bacteria 8975
93 Ga0070665_100004663 3300005548 Bacteria 14320
94 Ga0070665_100060824 3300005548 Bacteria 3786
95 Ga0070665_100083206 3300005548 Bacteria 3205
96 Ga0068855_100004962 3300005563 Bacteria 16231
97 Ga0068855_100015449 3300005563 Bacteria 9191
98 Ga0068855_100390540 3300005563 Bacteria 1526
99 Ga0070664_100145049 3300005564 Bacteria 2093
100 Ga0070664_100267301 3300005564 Bacteria 1540
101 Ga0068857_100000451 3300005577 Bacteria 29292
102 Ga0068857_100006173 3300005577 Bacteria 10245
103 Ga0068857_100039946 3300005577 Bacteria 4159
104 Ga0068856_100000957 3300005614 Bacteria 30820
105 Ga0068856_100045631 3300005614 Bacteria 4316
106 Ga0068856_100144072 3300005614 Bacteria 2390
107 Ga0068852_100005614 3300005616 Bacteria 9000
108 Ga0068852_100012657 3300005616 Bacteria 6416
109 Ga0068864_100000002 3300005618 Bacteria 658857
110 Ga0068863_100132291 3300005841 Bacteria 2382
111 Ga0068858_100012945 3300005842 Bacteria 7867
112 Ga0068858_100033049 3300005842 Bacteria 4805
113 Ga0068858_100117640 3300005842 Bacteria 2484
114 Ga0068858_100136070 3300005842 Bacteria 2305
115 Ga0068858_100162062 3300005842 Bacteria 2106
116 Ga0068860_100000499 3300005843 Bacteria 48692
117 Ga0068862_100005568 3300005844 Bacteria 10522
118 Ga0081455_10032641 3300005937 Bacteria 4689
119 Ga0070717_10307513 3300006028 Bacteria 1410
120 Ga0075366_10038768 3300006195 Bacteria 2814
121 Ga0097621_100061966 3300006237 Bacteria 3069
122 Ga0068871_100013774 3300006358 Bacteria 6012
123 Ga0068871_100137250 3300006358 Bacteria 2078
124 Ga0068871_100205207 3300006358 Bacteria 1703
125 Ga0075428_100050306 3300006844 Bacteria 4571
126 Ga0075436_100004138 3300006914 Bacteria 9955
127 Ga0097620_100173920 3300006931 Bacteria 2235
128 Ga0099823_1000074 3300006944 Bacteria 48327
129 Ga0099823_1063482 3300006944 Bacteria 1843
130 Ga0079104_1001016 3300006946 Bacteria 21709
131 Ga0079104_1001936 3300006946 Bacteria 12328
132 Ga0079104_1012482 3300006946 Bacteria 2666
133 Ga0079104_1029289 3300006946 Bacteria 1388
134 Ga0105251_10000653 3300009011 Bacteria 31977
135 Ga0105251_10003325 3300009011 Bacteria 11738
136 Ga0105251_10005450 3300009011 Bacteria 8309
137 Ga0105251_10013205 3300009011 Bacteria 4630
138 Ga0105251_10023484 3300009011 Bacteria 3182
139 Ga0105251_10026906 3300009011 Bacteria 2923
140 Ga0105251_10029981 3300009011 Bacteria 2735
141 Ga0105251_10033879 3300009011 Bacteria 2531
142 Ga0105251_10035079 3300009011 Bacteria 2477
143 Ga0105251_10048767 3300009011 Bacteria 2029
144 Ga0105244_10000248 3300009036 Bacteria 55384
145 Ga0105244_10000274 3300009036 Bacteria 51929
146 Ga0105244_10002675 3300009036 Bacteria 13334
147 Ga0105244_10009787 3300009036 Bacteria 5855
148 Ga0105244_10010093 3300009036 Bacteria 5751
149 Ga0105244_10015761 3300009036 Bacteria 4327
150 Ga0105244_10033838 3300009036 Bacteria 2693
151 Ga0105244_10035696 3300009036 Bacteria 2610
152 Ga0105244_10035795 3300009036 Bacteria 2605
153 Ga0105244_10035887 3300009036 Bacteria 2602
154 Ga0105250_10013939 3300009092 Bacteria 3310
155 Ga0105250_10018481 3300009092 Bacteria 2823
156 Ga0105250_10021791 3300009092 Bacteria 2585
157 Ga0105250_10022369 3300009092 Bacteria 2550
158 Ga0105250_10034542 3300009092 Bacteria 2029
159 Ga0105250_10034581 3300009092 Bacteria 2028
160 Ga0105240_10002636 3300009093 Bacteria 28586
161 Ga0105240_10003683 3300009093 Bacteria 23696
162 Ga0105240_10005123 3300009093 Bacteria 19605
163 Ga0105240_10005449 3300009093 Bacteria 18962
164 Ga0105240_10007191 3300009093 Bacteria 16213
165 Ga0105240_10026186 3300009093 Bacteria 7652
166 Ga0105240_10047714 3300009093 Bacteria 5418
167 Ga0105240_10054350 3300009093 Bacteria 5018
168 Ga0105240_10074490 3300009093 Bacteria 4190
169 Ga0105240_10184676 3300009093 Bacteria 2457
170 Ga0105240_10251119 3300009093 Bacteria 2045
171 Ga0105240_10308746 3300009093 Bacteria 1807
172 Ga0105240_10759923 3300009093 Bacteria 1053
173 Ga0111539_10008365 3300009094 Bacteria 13165
174 Ga0111539_10016907 3300009094 Bacteria 9030
175 Ga0111539_10119867 3300009094 Bacteria 3083
176 Ga0111539_10187945 3300009094 Bacteria 2411
177 Ga0105245_10000694 3300009098 Bacteria 30357
178 Ga0105245_10373911 3300009098 Bacteria 1417
179 Ga0105245_10434957 3300009098 Bacteria 1318
180 Ga0105245_10477401 3300009098 Bacteria 1259
181 Ga0105247_10000176 3300009101 Bacteria 62687
182 Ga0105247_10004537 3300009101 Bacteria 8851
183 Ga0114129_10002078 3300009147 Bacteria 27546
184 Ga0105243_10000263 3300009148 Bacteria 59080
185 Ga0105243_10023492 3300009148 Bacteria 4695
186 Ga0105241_10000001 3300009174 Bacteria 879793
187 Ga0105241_10007966 3300009174 Bacteria 7793
188 Ga0105241_10043069 3300009174 Bacteria 3418
189 Ga0105241_10091320 3300009174 Bacteria 2402
190 Ga0105241_10164967 3300009174 Bacteria 1824
191 Ga0105241_10248325 3300009174 Bacteria 1507
192 Ga0105242_10015261 3300009176 Bacteria 5967
193 Ga0105242_10026595 3300009176 Bacteria 4586
194 Ga0105242_10089909 3300009176 Bacteria 2582
195 Ga0105242_10146764 3300009176 Bacteria 2053
196 Ga0105242_10263249 3300009176 Bacteria 1559
197 Ga0105248_10006442 3300009177 Bacteria 12880
198 Ga0105248_10006574 3300009177 Bacteria 12746
199 Ga0105248_10029592 3300009177 Bacteria 6110
200 Ga0105248_10460787 3300009177 Bacteria 1433
201 Ga0105248_10739221 3300009177 Bacteria 1110
202 Ga0105237_10008345 3300009545 Bacteria 11231
203 Ga0105237_10008700 3300009545 Bacteria 10965
204 Ga0105237_10016948 3300009545 Bacteria 7558
205 Ga0105237_10149607 3300009545 Bacteria 2331
206 Ga0105238_10000238 3300009551 Bacteria 61471
207 Ga0105238_10001852 3300009551 Bacteria 21198
208 Ga0105238_10006092 3300009551 Bacteria 11962
209 Ga0105238_10008661 3300009551 Bacteria 10181
210 Ga0105238_10091092 3300009551 Bacteria 3037
211 Ga0105238_10093299 3300009551 Bacteria 2998
212 Ga0105238_10117899 3300009551 Bacteria 2635
213 Ga0105238_10121358 3300009551 Bacteria 2593
214 Ga0105238_10181828 3300009551 Bacteria 2079
215 Ga0105249_10012651 3300009553 Bacteria 7441
216 Ga0099796_10027099 3300010159 Bacteria 1827
217 Ga0105246_10005750 3300011119 Bacteria 7566
218 Ga0105246_10025988 3300011119 Bacteria 3819
219 Ga0105246_10087869 3300011119 Bacteria 2232
220 Ga0157373_10000593 3300013100 Bacteria 28147
221 Ga0157373_10003913 3300013100 Bacteria 11243
222 Ga0157373_10016161 3300013100 Bacteria 5448
223 Ga0157373_10028452 3300013100 Bacteria 4032
224 Ga0157371_10000497 3300013102 Bacteria 47594
225 Ga0157371_10015917 3300013102 Bacteria 5627
226 Ga0157371_10078133 3300013102 Bacteria 2344
227 Ga0157371_10215321 3300013102 Bacteria 1379
228 Ga0157370_10001630 3300013104 Bacteria 27714
229 Ga0157370_10006826 3300013104 Bacteria 12512
230 Ga0157370_10007129 3300013104 Bacteria 12195
231 Ga0157370_10025437 3300013104 Bacteria 5859
232 Ga0157370_10028766 3300013104 Bacteria 5464
233 Ga0157370_10039334 3300013104 Bacteria 4571
234 Ga0157370_10093954 3300013104 Bacteria 2814
235 Ga0157370_10199378 3300013104 Bacteria 1857
236 Ga0157369_10009351 3300013105 Bacteria 11208
237 Ga0157369_10015015 3300013105 Bacteria 8740
238 Ga0157369_10032457 3300013105 Bacteria 5742
239 Ga0157369_10128690 3300013105 Bacteria 2684
240 Ga0157369_10131266 3300013105 Bacteria 2654
241 Ga0157369_10285226 3300013105 Bacteria 1719
242 Ga0157369_10487229 3300013105 Bacteria 1276
243 Ga0157374_10016482 3300013296 Bacteria 6497
244 Ga0157374_10084829 3300013296 Bacteria 3011
245 Ga0157374_10192967 3300013296 Bacteria 1992
246 Ga0157378_10376010 3300013297 Bacteria 1394
247 Ga0163162_10139987 3300013306 Bacteria 2532
248 Ga0163162_10303072 3300013306 Bacteria 1730
249 Ga0163162_10391986 3300013306 Bacteria 1521
250 Ga0157372_10000598 3300013307 Bacteria 39369
251 Ga0157372_10041986 3300013307 Bacteria 5057
252 Ga0157372_10047751 3300013307 Bacteria 4758
253 Ga0157372_10196571 3300013307 Bacteria 2336
254 Ga0157372_10266118 3300013307 Bacteria 1991
255 Ga0157372_10836391 3300013307 Bacteria 1069
256 Ga0157375_10040468 3300013308 Bacteria 4493
257 Ga0163163_10000627 3300014325 Bacteria 30451
258 Ga0163163_10031285 3300014325 Bacteria 5136
259 Ga0163163_10100549 3300014325 Bacteria 2914
260 Ga0182008_10014996 3300014497 Bacteria 4052
261 Ga0182008_10034069 3300014497 Bacteria 2554
262 Ga0157379_10158519 3300014968 Bacteria 2043
263 Ga0157376_10116201 3300014969 Bacteria 2363
264 Ga0182006_1000174 3300015261 Bacteria 67705
265 Ga0182006_1003543 3300015261 Bacteria 7963
266 Ga0182006_1009467 3300015261 Bacteria 4363
267 Ga0182006_1017180 3300015261 Bacteria 3078
268 Ga0182007_10000143 3300015262 Bacteria 47807
269 Ga0182005_1002054 3300015265 Bacteria 7536
270 Ga0163161_10000003 3300017792 Bacteria 339847
271 Ga0163161_10036567 3300017792 Bacteria 3516
272 Ga0163161_10045290 3300017792 Bacteria 3172
273 Ga0163161_10159843 3300017792 Bacteria 1718
274 Ga0163161_10261768 3300017792 Bacteria 1351
275 Ga0197907_10075445 3300020069 Bacteria 983
276 Ga0206355_1560789 3300020076 Bacteria 1166
277 Ga0206351_10065214 3300020077 Bacteria 1319
278 Ga0206352_10666988 3300020078 Bacteria 1059
279 Ga0206350_10221737 3300020080 Bacteria 1167
280 Ga0206350_10379269 3300020080 Bacteria 1675
281 Ga0206350_10938216 3300020080 Bacteria 1119
282 Ga0206354_10594356 3300020081 Bacteria 1305
283 Ga0206354_11413883 3300020081 Bacteria 1380
284 Ga0206353_11342932 3300020082 Bacteria 1827
285 Ga0213872_10000050 3300021361 Bacteria 109093
286 Ga0213872_10000905 3300021361 Bacteria 21307
287 Ga0213874_10004805 3300021377 Bacteria 3116
288 Ga0213876_10010217 3300021384 Bacteria 5041
289 Ga0213876_10029263 3300021384 Bacteria 2903
290 Ga0213875_10000019 3300021388 Bacteria 231333
291 Ga0213875_10016825 3300021388 Bacteria 3541
292 Ga0213875_10042529 3300021388 Bacteria 2134
293 Ga0213875_10065563 3300021388 Bacteria 1697
294 Ga0213871_10034082 3300021441 Bacteria 1341
295 Ga0224712_10039765 3300022467 Bacteria 1765
296 Ga0224712_10099106 3300022467 Bacteria 1233
297 Ga0224712_10135246 3300022467 Bacteria 1080
298 Ga0209435_100837 3300025206 Bacteria 4839
299 Ga0209760_100052 3300025207 Bacteria 103453
300 Ga0209784_100015 3300025224 Bacteria 482117
301 Ga0209566_100012 3300025225 Bacteria 482281
302 Ga0209674_100027 3300025226 Bacteria 482281
303 Ga0209147_100019 3300025229 Bacteria 482139
304 Ga0209563_100031 3300025230 Bacteria 482281
305 Ga0207427_100029 3300025231 Bacteria 376678
306 Ga0209437_100009 3300025233 Bacteria 915954
307 Ga0209258_100381 3300025242 Bacteria 56739
308 Ga0209646_1000344 3300025246 Bacteria 34445
309 Ga0209026_1000711 3300025250 Bacteria 19707
310 Ga0209677_100016 3300025253 Bacteria 482117
311 Ga0209759_1003201 3300025256 Bacteria 6639
312 Ga0209759_1010992 3300025256 Bacteria 2608
313 Ga0209233_1000032 3300025261 Bacteria 623596
314 Ga0209676_1000026 3300025292 Bacteria 574599
315 Ga0209676_1000532 3300025292 Bacteria 59471
316 Ga0209025_1053028 3300025294 Bacteria 1595
317 Ga0209050_1010390 3300025298 Bacteria 4595
318 Ga0207696_1000001 3300025711 Bacteria 2579611
319 Ga0207696_1000010 3300025711 Bacteria 534681
320 Ga0207696_1002599 3300025711 Bacteria 8757
321 Ga0207696_1003215 3300025711 Bacteria 7543
322 Ga0207696_1010018 3300025711 Bacteria 3498
323 Ga0207696_1021950 3300025711 Bacteria 2036
324 Ga0207696_1023146 3300025711 Bacteria 1963
325 Ga0207655_1000002 3300025728 Bacteria 1148694
326 Ga0207655_1000151 3300025728 Bacteria 127538
327 Ga0207655_1000197 3300025728 Bacteria 106282
328 Ga0207655_1000262 3300025728 Bacteria 83031
329 Ga0207655_1001327 3300025728 Bacteria 23344
330 Ga0207655_1009222 3300025728 Bacteria 6155
331 Ga0207655_1014210 3300025728 Bacteria 4515
332 Ga0207655_1014306 3300025728 Bacteria 4494
333 Ga0207655_1014419 3300025728 Bacteria 4468
334 Ga0207655_1014540 3300025728 Bacteria 4442
335 Ga0207655_1015788 3300025728 Bacteria 4174
336 Ga0207713_1000070 3300025735 Bacteria 186597
337 Ga0207713_1000072 3300025735 Bacteria 185652
338 Ga0207713_1005079 3300025735 Bacteria 8353
339 Ga0207713_1011564 3300025735 Bacteria 4785
340 Ga0207713_1023540 3300025735 Bacteria 2896
341 Ga0207713_1028889 3300025735 Bacteria 2493
342 Ga0207713_1038613 3300025735 Bacteria 2024
343 Ga0207713_1053053 3300025735 Bacteria 1600
344 Ga0207710_10000051 3300025900 Bacteria 182751
345 Ga0207710_10000455 3300025900 Bacteria 26350
346 Ga0207710_10004382 3300025900 Bacteria 6166
347 Ga0207680_10061334 3300025903 Bacteria 2293
348 Ga0207699_10026412 3300025906 Bacteria 3200
349 Ga0207684_10003450 3300025910 Bacteria 15417
350 Ga0207684_10372437 3300025910 Bacteria 1229
351 Ga0207684_10415456 3300025910 Bacteria 1156
352 Ga0207654_10000004 3300025911 Bacteria 902334
353 Ga0207654_10083975 3300025911 Bacteria 1924
354 Ga0207707_10032118 3300025912 Bacteria 4595
355 Ga0207707_10064455 3300025912 Bacteria 3190
356 Ga0207707_10112455 3300025912 Bacteria 2380
357 Ga0207707_10224707 3300025912 Bacteria 1634
358 Ga0207695_10000964 3300025913 Bacteria 51291
359 Ga0207695_10005339 3300025913 Bacteria 17095
360 Ga0207695_10009140 3300025913 Bacteria 12299
361 Ga0207695_10031123 3300025913 Bacteria 5858
362 Ga0207695_10049362 3300025913 Bacteria 4437
363 Ga0207695_10069201 3300025913 Bacteria 3612
364 Ga0207695_10086193 3300025913 Bacteria 3168
365 Ga0207695_10134361 3300025913 Bacteria 2428
366 Ga0207695_10342244 3300025913 Bacteria 1383
367 Ga0207671_10027273 3300025914 Bacteria 4270
368 Ga0207671_10050164 3300025914 Bacteria 3090
369 Ga0207693_10018001 3300025915 Bacteria 5630
370 Ga0207663_10016462 3300025916 Bacteria 4101
371 Ga0207663_10073947 3300025916 Bacteria 2207
372 Ga0207660_10006888 3300025917 Bacteria 7357
373 Ga0207660_10053276 3300025917 Bacteria 2883
374 Ga0207657_10010431 3300025919 Bacteria 9272
375 Ga0207657_10054869 3300025919 Bacteria 3444
376 Ga0207652_10002345 3300025921 Bacteria 16034
377 Ga0207652_10071427 3300025921 Bacteria 3016
378 Ga0207646_10009466 3300025922 Bacteria 9626
379 Ga0207681_10000509 3300025923 Bacteria 27059
380 Ga0207694_10005299 3300025924 Bacteria 9940
381 Ga0207694_10021698 3300025924 Bacteria 4866
382 Ga0207694_10023587 3300025924 Bacteria 4671
383 Ga0207694_10024889 3300025924 Bacteria 4547
384 Ga0207694_10071687 3300025924 Bacteria 2707
385 Ga0207650_10000002 3300025925 Bacteria 1439222
386 Ga0207687_10005523 3300025927 Bacteria 8363
387 Ga0207687_10007962 3300025927 Bacteria 6937
388 Ga0207687_10064122 3300025927 Bacteria 2604
389 Ga0207687_10276527 3300025927 Bacteria 1344
390 Ga0207700_10001065 3300025928 Bacteria 15796
391 Ga0207700_10078984 3300025928 Bacteria 2561
392 Ga0207700_10148524 3300025928 Bacteria 1935
393 Ga0207700_10150068 3300025928 Bacteria 1925
394 Ga0207700_10386293 3300025928 Bacteria 1225
395 Ga0207664_10035151 3300025929 Bacteria 3864
396 Ga0207664_10035512 3300025929 Bacteria 3847
397 Ga0207664_10179579 3300025929 Bacteria 1816
398 Ga0207664_10231859 3300025929 Bacteria 1605
399 Ga0207644_10001798 3300025931 Bacteria 13907
400 Ga0207644_10272376 3300025931 Bacteria 1357
401 Ga0207690_10016310 3300025932 Bacteria 4516
402 Ga0207690_10114010 3300025932 Bacteria 1951
403 Ga0207706_10284593 3300025933 Bacteria 1441
404 Ga0207686_10002054 3300025934 Bacteria 11093
405 Ga0207709_10000158 3300025935 Bacteria 91810
406 Ga0207709_10009838 3300025935 Bacteria 5267
407 Ga0207669_10357081 3300025937 Bacteria 1131
408 Ga0207691_10376693 3300025940 Bacteria 1212
409 Ga0207711_10000752 3300025941 Bacteria 31778
410 Ga0207711_10025879 3300025941 Bacteria 4921
411 Ga0207711_10041953 3300025941 Bacteria 3897
412 Ga0207711_10192714 3300025941 Bacteria 1858
413 Ga0207689_10157260 3300025942 Bacteria 1874
414 Ga0207661_10001589 3300025944 Bacteria 15456
415 Ga0207661_10011029 3300025944 Bacteria 6532
416 Ga0207661_10019484 3300025944 Bacteria 5059
417 Ga0207661_10077113 3300025944 Unclassified 2740
418 Ga0207661_10101271 3300025944 Bacteria 2419
419 Ga0207661_10381350 3300025944 Bacteria 1276
420 Ga0207661_10457424 3300025944 Bacteria 1163
421 Ga0207679_10124674 3300025945 Bacteria 2057
422 Ga0207679_10218628 3300025945 Bacteria 1602
423 Ga0207667_10000778 3300025949 Bacteria 41337
424 Ga0207667_10012222 3300025949 Bacteria 9917
425 Ga0207667_10018428 3300025949 Bacteria 7828
426 Ga0207712_10054911 3300025961 Bacteria 2799
427 Ga0207658_10000001 3300025986 Bacteria 1439333
428 Ga0207677_10067902 3300026023 Bacteria 2499
429 Ga0207703_10008479 3300026035 Bacteria 8122
430 Ga0207639_10026567 3300026041 Bacteria 4207
431 Ga0207702_10007438 3300026078 Bacteria 9346
432 Ga0207702_10033061 3300026078 Bacteria 4317
433 Ga0207702_10051541 3300026078 Bacteria 3479
434 Ga0207702_10051880 3300026078 Bacteria 3469
435 Ga0207641_10067303 3300026088 Bacteria 3068
436 Ga0207641_10259950 3300026088 Bacteria 1625
437 Ga0207641_10404785 3300026088 Bacteria 1311
438 Ga0207676_10000001 3300026095 Bacteria 1439222
439 Ga0207674_10000320 3300026116 Bacteria 61127
440 Ga0207674_10011685 3300026116 Bacteria 9857
441 Ga0207674_10049531 3300026116 Bacteria 4296
442 Ga0207683_10223164 3300026121 Bacteria 1717
443 Ga0207683_10276890 3300026121 Bacteria 1533
444 Ga0207683_10288828 3300026121 Bacteria 1499
445 Ga0207698_10445850 3300026142 Bacteria 1248
446 Ga0209281_1000038 3300027111 Bacteria 361154
447 Ga0209281_1000172 3300027111 Bacteria 151766
448 Ga0209281_1001784 3300027111 Bacteria 10840
449 Ga0209389_1000063 3300027296 Bacteria 102403
450 Ga0209371_1000196 3300027312 Bacteria 89093
451 Ga0209371_1000576 3300027312 Bacteria 33041
452 Ga0209371_1002233 3300027312 Bacteria 11185
453 Ga0209371_1003223 3300027312 Bacteria 8182
454 Ga0209371_1007522 3300027312 Bacteria 3777
455 Ga0209969_1003123 3300027360 Bacteria 2291
456 Ga0209984_1010318 3300027424 Bacteria 1197
457 Ga0209982_1005413 3300027552 Bacteria 1844
458 Ga0209971_1007555 3300027682 Bacteria 2580
459 Ga0209974_10006192 3300027876 Bacteria 4190
460 Ga0209974_10045407 3300027876 Bacteria 1467
461 Ga0207428_10175085 3300027907 Bacteria 1623
462 Ga0265354_1000479 3300028016 Bacteria 6947
463 Ga0265356_1000429 3300028017 Bacteria 7644
464 Ga0268266_10005113 3300028379 Bacteria 12359
465 Ga0268266_10007323 3300028379 Bacteria 9973
466 Ga0268266_10043227 3300028379 Bacteria 3850
467 Ga0268265_10000455 3300028380 Bacteria 43315
468 Ga0268265_10543460 3300028380 Bacteria 1102
469 Ga0268264_10000004 3300028381 Bacteria 1116842
470 Ga0265337_1010645 3300028556 Bacteria 3210
471 Ga0265337_1021446 3300028556 Bacteria 2013
472 Ga0265326_10006844 3300028558 Bacteria 3518
473 Ga0265326_10007728 3300028558 Bacteria 3280
474 Ga0265326_10013258 3300028558 Bacteria 2413
475 Ga0265319_1000117 3300028563 Bacteria 60512
476 Ga0265334_10010142 3300028573 Bacteria 3976
477 Ga0265318_10000127 3300028577 Bacteria 70203
478 Ga0265318_10045528 3300028577 Bacteria 1658
479 Ga0265318_10051719 3300028577 Bacteria 1542
480 Ga0265318_10074020 3300028577 Bacteria 1261
481 Ga0265323_10000442 3300028653 Bacteria 23783
482 Ga0265323_10000729 3300028653 Bacteria 17814
483 Ga0265323_10001018 3300028653 Bacteria 14603
484 Ga0265323_10001673 3300028653 Bacteria 10615
485 Ga0265323_10015696 3300028653 Bacteria 2974
486 Ga0265323_10023964 3300028653 Bacteria 2324
487 Ga0265322_10001727 3300028654 Bacteria 6930
488 Ga0265322_10019771 3300028654 Bacteria 1931
489 Ga0265322_10026141 3300028654 Bacteria 1669
490 Ga0265336_10003605 3300028666 Bacteria 6047
491 Ga0265336_10005093 3300028666 Bacteria 4889
492 Ga0307517_10113040 3300028786 Bacteria 2052
493 Ga0265338_10004158 3300028800 Bacteria 19773
494 Ga0265338_10006215 3300028800 Bacteria 15298
495 Ga0265338_10006479 3300028800 Bacteria 14906
496 Ga0265338_10040825 3300028800 Bacteria 4352
497 Ga0265338_10049222 3300028800 Bacteria 3823
498 Ga0265338_10083055 3300028800 Bacteria 2681
499 Ga0265338_10121263 3300028800 Bacteria 2084
500 Ga0265338_10181457 3300028800 Bacteria 1604
501 Ga0265338_10263578 3300028800 Bacteria 1266
502 Ga0265324_10000026 3300029957 Bacteria 161746
503 Ga0265324_10000069 3300029957 Bacteria 83572
504 Ga0265324_10000093 3300029957 Bacteria 69020
505 Ga0265324_10000411 3300029957 Bacteria 30799
506 Ga0265324_10008668 3300029957 Bacteria 4022
507 Ga0265324_10010285 3300029957 Bacteria 3615
508 Ga0265324_10067460 3300029957 Bacteria 1220
509 Ga0268256_1000158 3300030500 Bacteria 89061
510 Ga0268256_1000503 3300030500 Bacteria 33041
511 Ga0268256_1001972 3300030500 Bacteria 11185
512 Ga0268256_1007753 3300030500 Bacteria 3777
513 Ga0316183_1015099 3300030742 Bacteria 4141
514 Ga0265770_1000818 3300030878 Bacteria 4308
515 Ga0265765_1000811 3300030879 Bacteria 2673
516 Ga0265760_10000954 3300031090 Bacteria 8365
517 Ga0265760_10029106 3300031090 Bacteria 1623
518 Ga0265330_10000112 3300031235 Bacteria 66619
519 Ga0265330_10005890 3300031235 Bacteria 6072
520 Ga0265330_10005891 3300031235 Bacteria 6072
521 Ga0265330_10007670 3300031235 Bacteria 5242
522 Ga0265330_10010228 3300031235 Bacteria 4427
523 Ga0265330_10013565 3300031235 Bacteria 3795
524 Ga0265330_10021605 3300031235 Bacteria 2934
525 Ga0265330_10024877 3300031235 Bacteria 2715
526 Ga0265330_10029355 3300031235 Bacteria 2474
527 Ga0265330_10033380 3300031235 Bacteria 2301
528 Ga0265330_10035564 3300031235 Bacteria 2222
529 Ga0265330_10050703 3300031235 Bacteria 1820
530 Ga0265330_10117082 3300031235 Bacteria 1136
531 Ga0265332_10000013 3300031238 Bacteria 250095
532 Ga0265332_10000052 3300031238 Bacteria 109708
533 Ga0265332_10000062 3300031238 Bacteria 95133
534 Ga0265332_10000234 3300031238 Bacteria 44285
535 Ga0265332_10001836 3300031238 Bacteria 11330
536 Ga0265332_10003905 3300031238 Bacteria 7110
537 Ga0265332_10010180 3300031238 Bacteria 4186
538 Ga0265332_10034307 3300031238 Bacteria 2206
539 Ga0265332_10056281 3300031238 Bacteria 1685
540 Ga0265332_10070650 3300031238 Bacteria 1487
541 Ga0265328_10000076 3300031239 Bacteria 51815
542 Ga0265328_10000128 3300031239 Bacteria 36428
543 Ga0265328_10000297 3300031239 Bacteria 23171
544 Ga0265328_10001141 3300031239 Bacteria 12239
545 Ga0265328_10002442 3300031239 Bacteria 8339
546 Ga0265328_10005003 3300031239 Bacteria 5712
547 Ga0265328_10006581 3300031239 Bacteria 4897
548 Ga0265328_10014488 3300031239 Bacteria 3104
549 Ga0265328_10022723 3300031239 Bacteria 2384
550 Ga0265328_10035767 3300031239 Bacteria 1836
551 Ga0265320_10000969 3300031240 Bacteria 21356
552 Ga0265320_10002060 3300031240 Bacteria 14160
553 Ga0265320_10004794 3300031240 Bacteria 8790
554 Ga0265320_10005502 3300031240 Bacteria 8122
555 Ga0265320_10073931 3300031240 Bacteria 1601
556 Ga0265325_10003074 3300031241 Bacteria 11029
557 Ga0265325_10006487 3300031241 Bacteria 7094
558 Ga0265325_10008975 3300031241 Bacteria 5870
559 Ga0265325_10011735 3300031241 Bacteria 5026
560 Ga0265325_10038411 3300031241 Bacteria 2527
561 Ga0265325_10053699 3300031241 Bacteria 2065
562 Ga0265325_10123463 3300031241 Bacteria 1246
563 Ga0265325_10160877 3300031241 Bacteria 1056
564 Ga0265329_10000059 3300031242 Bacteria 48321
565 Ga0265329_10001427 3300031242 Bacteria 11542
566 Ga0265329_10001667 3300031242 Bacteria 10644
567 Ga0265329_10001674 3300031242 Bacteria 10614
568 Ga0265329_10011734 3300031242 Bacteria 3175
569 Ga0265329_10014035 3300031242 Bacteria 2838
570 Ga0265329_10014042 3300031242 Bacteria 2837
571 Ga0265329_10021672 3300031242 Bacteria 2156
572 Ga0265340_10000044 3300031247 Bacteria 56454
573 Ga0265340_10000882 3300031247 Bacteria 16980
574 Ga0265340_10002279 3300031247 Bacteria 10963
575 Ga0265340_10010569 3300031247 Bacteria 4933
576 Ga0265340_10012413 3300031247 Bacteria 4500
577 Ga0265340_10091168 3300031247 Bacteria 1425
578 Ga0265339_10000001 3300031249 Bacteria 613713
579 Ga0265339_10000004 3300031249 Bacteria 269533
580 Ga0265339_10000018 3300031249 Bacteria 181364
581 Ga0265339_10001637 3300031249 Bacteria 16530
582 Ga0265339_10003001 3300031249 Bacteria 11897
583 Ga0265339_10003717 3300031249 Bacteria 10642
584 Ga0265339_10004363 3300031249 Bacteria 9654
585 Ga0265339_10036307 3300031249 Bacteria 2759
586 Ga0265339_10070381 3300031249 Bacteria 1866
587 Ga0265339_10072546 3300031249 Bacteria 1832
588 Ga0265339_10085234 3300031249 Bacteria 1664
589 Ga0265331_10000036 3300031250 Bacteria 199058
590 Ga0265331_10000108 3300031250 Bacteria 110148
591 Ga0265331_10000145 3300031250 Bacteria 92545
592 Ga0265331_10000591 3300031250 Bacteria 32363
593 Ga0265331_10001957 3300031250 Bacteria 14384
594 Ga0265331_10002644 3300031250 Bacteria 12006
595 Ga0265331_10012348 3300031250 Bacteria 4630
596 Ga0265331_10047240 3300031250 Bacteria 2072
597 Ga0265331_10063883 3300031250 Bacteria 1733
598 Ga0265331_10068261 3300031250 Bacteria 1667
599 Ga0265331_10107964 3300031250 Bacteria 1278
600 Ga0265331_10113555 3300031250 Bacteria 1241
601 Ga0265327_10000008 3300031251 Bacteria 658870
602 Ga0265327_10000213 3300031251 Bacteria 121151
603 Ga0265327_10000229 3300031251 Bacteria 113907
604 Ga0265327_10000503 3300031251 Bacteria 67795
605 Ga0265327_10004005 3300031251 Bacteria 13426
606 Ga0265327_10004822 3300031251 Bacteria 11700
607 Ga0265327_10007133 3300031251 Bacteria 8718
608 Ga0265327_10007583 3300031251 Bacteria 8333
609 Ga0265327_10019468 3300031251 Bacteria 4169
610 Ga0265316_10000011 3300031344 Bacteria 227018
611 Ga0265316_10000731 3300031344 Bacteria 36246
612 Ga0265316_10000847 3300031344 Bacteria 33692
613 Ga0265316_10001116 3300031344 Bacteria 29109
614 Ga0265316_10001265 3300031344 Bacteria 27129
615 Ga0265316_10002090 3300031344 Bacteria 21001
616 Ga0265316_10002305 3300031344 Bacteria 19950
617 Ga0265316_10002945 3300031344 Bacteria 17419
618 Ga0265316_10003493 3300031344 Bacteria 15863
619 Ga0265316_10008374 3300031344 Bacteria 9602
620 Ga0265316_10012518 3300031344 Bacteria 7600
621 Ga0265316_10013282 3300031344 Bacteria 7325
622 Ga0265316_10029280 3300031344 Bacteria 4529
623 Ga0265316_10030608 3300031344 Bacteria 4409
624 Ga0265316_10044714 3300031344 Bacteria 3520
625 Ga0265316_10055363 3300031344 Bacteria 3102
626 Ga0265316_10085315 3300031344 Bacteria 2417
627 Ga0265316_10150442 3300031344 Bacteria 1744
628 Ga0265316_10151517 3300031344 Bacteria 1737
629 Ga0265316_10170975 3300031344 Bacteria 1621
630 Ga0265316_10208700 3300031344 Bacteria 1445
631 Ga0265316_10221885 3300031344 Bacteria 1394
632 Ga0265316_10227276 3300031344 Bacteria 1375
633 Ga0265316_10229035 3300031344 Bacteria 1369
634 Ga0265316_10277884 3300031344 Bacteria 1224
635 Ga0265316_10287086 3300031344 Bacteria 1201
636 Ga0265316_10338294 3300031344 Bacteria 1091
637 Ga0307509_10274381 3300031507 Bacteria 1452
638 Ga0307408_100000178 3300031548 Bacteria 71389
639 Ga0307408_100011056 3300031548 Bacteria 5958
640 Ga0307408_100020260 3300031548 Bacteria 4486
641 Ga0265313_10000056 3300031595 Bacteria 109106
642 Ga0265313_10001373 3300031595 Bacteria 22850
643 Ga0265313_10018959 3300031595 Bacteria 3847
644 Ga0265313_10040724 3300031595 Bacteria 2294
645 Ga0265313_10058884 3300031595 Bacteria 1809
646 Ga0316579_10061196 3300031691 Bacteria 1772
647 Ga0265314_10000007 3300031711 Bacteria 491737
648 Ga0265314_10000271 3300031711 Bacteria 76021
649 Ga0265314_10000933 3300031711 Bacteria 34474
650 Ga0265314_10001549 3300031711 Bacteria 25351
651 Ga0265314_10002364 3300031711 Bacteria 19452
652 Ga0265314_10003597 3300031711 Bacteria 14919
653 Ga0265314_10003642 3300031711 Bacteria 14820
654 Ga0265314_10005145 3300031711 Bacteria 11889
655 Ga0265314_10017132 3300031711 Bacteria 5695
656 Ga0265314_10033095 3300031711 Bacteria 3795
657 Ga0265314_10035236 3300031711 Bacteria 3650
658 Ga0265314_10137277 3300031711 Bacteria 1517
659 Ga0265314_10139318 3300031711 Bacteria 1502
660 Ga0265342_10000058 3300031712 Bacteria 118791
661 Ga0265342_10000472 3300031712 Bacteria 43635
662 Ga0265342_10000619 3300031712 Bacteria 37353
663 Ga0265342_10000762 3300031712 Bacteria 32881
664 Ga0265342_10000924 3300031712 Bacteria 29168
665 Ga0265342_10001136 3300031712 Bacteria 25428
666 Ga0265342_10001742 3300031712 Bacteria 19865
667 Ga0265342_10007313 3300031712 Bacteria 8102
668 Ga0265342_10007898 3300031712 Bacteria 7714
669 Ga0265342_10012661 3300031712 Bacteria 5706
670 Ga0265342_10014722 3300031712 Bacteria 5182
671 Ga0265342_10019789 3300031712 Bacteria 4331
672 Ga0265342_10021895 3300031712 Bacteria 4073
673 Ga0265342_10166351 3300031712 Bacteria 1216
674 Ga0316576_10017817 3300031727 Bacteria 4836
675 Ga0316576_10028196 3300031727 Bacteria 3955
676 Ga0316576_10043506 3300031727 Bacteria 3240
677 Ga0316576_10070843 3300031727 Bacteria 2571
678 Ga0316576_10265500 3300031727 Bacteria 1287
679 Ga0316578_10008951 3300031728 Bacteria 5121
680 Ga0316578_10079635 3300031728 Bacteria 1948
681 Ga0316578_10102627 3300031728 Bacteria 1715
682 Ga0307516_10000202 3300031730 Bacteria 77604
683 Ga0307405_10020411 3300031731 Bacteria 3701
684 Ga0316577_10076069 3300031733 Bacteria 1874
685 Ga0316577_10140008 3300031733 Bacteria 1363
686 Ga0307413_10010098 3300031824 Bacteria 4558
687 Ga0307406_10013085 3300031901 Bacteria 4744
688 Ga0307406_10051967 3300031901 Bacteria 2604
689 Ga0307406_10054623 3300031901 Bacteria 2549
690 Ga0307407_10026019 3300031903 Bacteria 3093
691 Ga0307412_10004978 3300031911 Bacteria 7425
692 Ga0307412_10010098 3300031911 Bacteria 5430
693 Ga0307412_10011635 3300031911 Bacteria 5101
694 Ga0307409_100041096 3300031995 Bacteria 3450
695 Ga0307414_10010683 3300032004 Bacteria 5344
696 Ga0307414_10056920 3300032004 Bacteria 2745
697 Ga0307411_10004175 3300032005 Bacteria 6866
698 Ga0316593_10037039 3300032168 Bacteria 1611
699 Ga0316593_10067502 3300032168 Bacteria 1232
700 Ga0316593_10071261 3300032168 Bacteria 1202
701 Ga0316596_1042114 3300033541 Bacteria 1201
702 Ga0373926_0007884 3300035083 Bacteria 3548
703 Ga0373926_0008882 3300035083 Bacteria 3349
704 Ga0373934_0003185 3300035086 Bacteria 5999
705 Ga0373934_0016862 3300035086 Bacteria 2781
706 Ga0373932_0009979 3300035112 Bacteria 2291
707 Ga0373936_0066099 3300035113 Bacteria 1484
708 Ga0373945_0106995 3300035116 Bacteria 1100
709 Ga0373953_0011245 3300035117 Bacteria 3138
710 Ga0373953_0021778 3300035117 Bacteria 2409
711 Ga0373954_0014791 3300035118 Bacteria 3482
712 Ga0373954_0044561 3300035118 Bacteria 2071
713 Ga0373956_0001217 3300035119 Bacteria 10658
714 Ga0373957_0042689 3300035120 Bacteria 1712
715 Ga0373955_0114834 3300035172 Bacteria 1560
716 Ga0373955_0174821 3300035172 Bacteria 1272
717 Ga0316574_0004307 3300035398 Bacteria 7433
718 Ga0316574_0020761 3300035398 Bacteria 3891
719 Ga0316574_0096617 3300035398 Bacteria 1888
720 Ga0316574_0241945 3300035398 Bacteria 1153
721 Ga0316574_0243127 3300035398 Bacteria 1150
722 Ga0373931_0167068 3300035691 Bacteria 1294
723 Ga0373935_0133566 3300035692 Bacteria 1670
724 Ga0373935_0145989 3300035692 Bacteria 1602
725 Ga0373927_0001539 3300035695 Bacteria 17343
726 Ga0373927_0002742 3300035695 Bacteria 12842
727 Ga0373927_0009722 3300035695 Bacteria 6446
728 Ga0373927_0063083 3300035695 Bacteria 2397
729 Ga0373927_0118306 3300035695 Bacteria 1729
730 Ga0373927_0301155 3300035695 Bacteria 1055
731 Ga0373933_0073672 3300035724 Bacteria 2081
732 Ga0373933_0095320 3300035724 Bacteria 1841
733 Ga0373947_0000740 3300035725 Bacteria 19574
734 Ga0373947_0099937 3300035725 Bacteria 1822
735 Ga0373937_0007741 3300036401 Bacteria 9312
736 Ga0373937_0019221 3300036401 Bacteria 6116
737 Ga0373937_0035160 3300036401 Bacteria 4559
738 Ga0373937_0227032 3300036401 Bacteria 1758
739 Ga0373937_0315761 3300036401 Bacteria 1478
740 Ga0373937_0339483 3300036401 Bacteria 1422
741 Ga0373937_0576904 3300036401 Bacteria 1068
742 Ga0316582_0036189 3300036647 Bacteria 3053
743 Ga0316582_0133884 3300036647 Bacteria 1667
744 Ga0316582_0205402 3300036647 Bacteria 1345
745 Ga0316584_0009600 3300036712 Bacteria 6726
746 Ga0316584_0024907 3300036712 Bacteria 4384
747 Ga0316584_0114947 3300036712 Bacteria 2013
748 Ga0373925_0000099 3300037068 Bacteria 93726
749 Ga0373925_0005608 3300037068 Bacteria 9345
750 Ga0373925_0015028 3300037068 Bacteria 5596
751 Ga0373925_0058578 3300037068 Bacteria 2888
752 Ga0373925_0076615 3300037068 Bacteria 2537
753 Ga0373925_0169322 3300037068 Bacteria 1724
754 Ga0395900_0025210 3300037418 Bacteria 6088
755 Ga0395900_0070182 3300037418 Bacteria 3602
756 Ga0395905_0003402 3300037471 Bacteria 17035
757 Ga0395905_0172075 3300037471 Bacteria 2034
758 Ga0436364_0176175 3300037853 Bacteria 4885
759 Ga0436364_0366372 3300037853 Bacteria 231753
760 Ga0436364_0514524 3300037853 Bacteria 1248
761 Ga0436364_0748631 3300037853 Bacteria 1323
762 Ga0436364_0807765 3300037853 Bacteria 7401
763 Ga0436364_0853204 3300037853 Bacteria 6229
764 Ga0436364_1151958 3300037853 Bacteria 3445
765 Ga0436364_1386202 3300037853 Bacteria 3656
766 Ga0436364_1410728 3300037853 Bacteria 4621
767 Ga0436364_1414125 3300037853 Bacteria 18149
768 Ga0436364_1489063 3300037853 Bacteria 6681
769 Ga0436364_1501586 3300037853 Bacteria 1905
770 Ga0400490_10431 3300038726 Bacteria 21033
771 Ga0400486_10993 3300038742 Bacteria 2242
772 Ga0400483_030371 3300039062 Bacteria 16130
773 Ga0400489_59676 3300039093 Bacteria 4698
774 Ga0436365_0139104 3300039437 Bacteria 12303
775 Ga0436365_0497797 3300039437 Bacteria 2851
776 Ga0436365_0721041 3300039437 Bacteria 3132
777 Ga0436365_1100189 3300039437 Bacteria 3446
778 Ga0436365_1490124 3300039437 Bacteria 4606
779 Ga0436360_0328545 3300039438 Bacteria 2166
780 Ga0436360_0378330 3300039438 Bacteria 8772
781 Ga0436360_1032306 3300039438 Bacteria 2846
782 Ga0436360_1333063 3300039438 Bacteria 2341
783 Ga0436361_0269507 3300039447 Bacteria 102308
784 Ga0436361_0285134 3300039447 Bacteria 3111
785 Ga0436361_0567168 3300039447 Bacteria 164343
786 Ga0436361_0682766 3300039447 Bacteria 3159
787 Ga0436363_1560073 3300039450 Bacteria 10797
788 Ga0436362_0084096 3300039453 Bacteria 5279
789 Ga0436362_0297328 3300039453 Bacteria 1754
790 Ga0439436_0007650 3300041404 Bacteria 3324
791 Ga0439438_000002 3300041405 Bacteria 618223
792 Ga0439438_000442 3300041405 Bacteria 18697
793 Ga0439438_003869 3300041405 Bacteria 5904
794 Ga0439438_004424 3300041405 Bacteria 5397
795 Ga0439438_012015 3300041405 Bacteria 2672
796 Ga0439438_013815 3300041405 Bacteria 2421
797 Ga0439447_001496 3300041407 Bacteria 8564
798 Ga0439447_002909 3300041407 Bacteria 6128
799 Ga0439447_003162 3300041407 Bacteria 5866
800 Ga0439447_008240 3300041407 Bacteria 3241
801 Ga0439466_0005969 3300041411 Bacteria 4638
802 Ga0439466_0006786 3300041411 Bacteria 4343
803 Ga0439466_0015267 3300041411 Bacteria 2790
804 Ga0439465_0006145 3300041413 Bacteria 3819
805 Ga0451855_1019283 3300041511 Bacteria 1912
806 Ga0439432_001052 3300042006 Bacteria 10485
807 Ga0439432_001239 3300042006 Bacteria 9653
808 Ga0439432_002018 3300042006 Bacteria 7686
809 Ga0439432_002789 3300042006 Bacteria 6512
810 Ga0439432_003342 3300042006 Bacteria 5957
811 Ga0439451_001638 3300042009 Bacteria 4446
812 Ga0439451_003813 3300042009 Bacteria 3061
813 Ga0439452_000003 3300042010 Bacteria 942815
814 Ga0439452_009904 3300042010 Bacteria 2792
815 Ga0439452_022042 3300042010 Bacteria 1653
816 Ga0439456_000271 3300042013 Bacteria 12605
817 Ga0439456_008922 3300042013 Bacteria 2070
818 Ga0450911_000002 3300042115 Bacteria 277703
819 Ga0450911_001193 3300042115 Bacteria 6338
820 Ga0450919_000614 3300042121 Bacteria 4509
821 Ga0450890_000186 3300042127 Bacteria 9401
822 Ga0450902_001984 3300042137 Bacteria 2862
823 Ga0450903_001828 3300042138 Bacteria 3879
824 Ga0450903_002098 3300042138 Bacteria 3585
825 Ga0450905_000029 3300042142 Bacteria 11982
826 Ga0450906_000658 3300042145 Bacteria 7392
827 Ga0450907_000132 3300042146 Bacteria 28311
828 Ga0450907_002076 3300042146 Bacteria 3972
829 Ga0439446_0008405 3300042156 Bacteria 2739
830 Ga0439446_0017328 3300042156 Bacteria 2012
831 Ga0450908_005178 3300042184 Bacteria 2500
832 Ga0450909_002104 3300042185 Bacteria 2810
833 Ga0439434_0000469 3300042435 Bacteria 11490
834 Ga0439464_0002709 3300042439 Bacteria 4394
835 Ga0439464_0009344 3300042439 Bacteria 2580
836 Ga0439460_0001104 3300042461 Bacteria 6297
837 Ga0439460_0005590 3300042461 Bacteria 3091
838 Ga0451577_0000035 3300042876 Bacteria 373467
839 Ga0451577_0000127 3300042876 Bacteria 168002
840 Ga0451577_0000644 3300042876 Bacteria 55517
841 Ga0451577_0001119 3300042876 Bacteria 38024
842 Ga0451577_0001484 3300042876 Bacteria 31087
843 Ga0451577_0003259 3300042876 Bacteria 18253
844 Ga0451577_0003915 3300042876 Bacteria 16080
845 Ga0451577_0008660 3300042876 Bacteria 9881
846 Ga0451577_0013211 3300042876 Bacteria 7736
847 Ga0451577_0015851 3300042876 Bacteria 6993
848 Ga0451577_0016891 3300042876 Bacteria 6749
849 Ga0451577_0026629 3300042876 Bacteria 5237
850 Ga0451577_0032932 3300042876 Bacteria 4671
851 Ga0451577_0034763 3300042876 Bacteria 4542
852 Ga0451577_0055642 3300042876 Bacteria 3529
853 Ga0451577_0065739 3300042876 Bacteria 3234
854 Ga0451577_0074573 3300042876 Bacteria 3026
855 Ga0451577_0081767 3300042876 Bacteria 2881
856 Ga0451577_0088449 3300042876 Bacteria 2764
857 Ga0451577_0095159 3300042876 Bacteria 2660
858 Ga0451577_0103585 3300042876 Bacteria 2543
859 Ga0451577_0161923 3300042876 Bacteria 2015
860 Ga0451577_0190718 3300042876 Bacteria 1849
861 Ga0451577_0392613 3300042876 Bacteria 1259
862 Ga0439440_0003112 3300042993 Bacteria 3173
863 Ga0439440_0009520 3300042993 Bacteria 2013
864 Ga0453683_0000001 3300044673 Bacteria 1384965
865 Ga0453683_0000009 3300044673 Bacteria 491115
866 Ga0453683_0000018 3300044673 Bacteria 309212
867 Ga0453683_0000233 3300044673 Bacteria 73679
868 Ga0453683_0004304 3300044673 Bacteria 10144
869 Ga0453683_0004940 3300044673 Bacteria 9370
870 Ga0453683_0006674 3300044673 Bacteria 7897
871 Ga0453683_0028839 3300044673 Bacteria 3512
872 Ga0453683_0065747 3300044673 Bacteria 2267
873 Ga0453683_0074008 3300044673 Bacteria 2132
874 Ga0453683_0171101 3300044673 Bacteria 1376
875 Ga0453683_0254441 3300044673 Bacteria 1120
876 Ga0453684_0000048 3300044712 Bacteria 559743
877 Ga0453684_0000097 3300044712 Bacteria 377772
878 Ga0453684_0000115 3300044712 Bacteria 355501
879 Ga0453684_0000221 3300044712 Bacteria 249908
880 Ga0453684_0000242 3300044712 Bacteria 234895
881 Ga0453684_0000499 3300044712 Bacteria 153532
882 Ga0453684_0000539 3300044712 Bacteria 143526
883 Ga0453684_0000555 3300044712 Bacteria 140770
884 Ga0453684_0000941 3300044712 Bacteria 96005
885 Ga0453684_0001135 3300044712 Bacteria 83367
886 Ga0453684_0001752 3300044712 Bacteria 58035
887 Ga0453684_0002408 3300044712 Bacteria 45598
888 Ga0453684_0002894 3300044712 Bacteria 40256
889 Ga0453684_0003084 3300044712 Bacteria 38484
890 Ga0453684_0004632 3300044712 Bacteria 28590
891 Ga0453684_0005926 3300044712 Bacteria 23699
892 Ga0453684_0007878 3300044712 Bacteria 19352
893 Ga0453684_0007938 3300044712 Bacteria 19252
894 Ga0453684_0013644 3300044712 Bacteria 13164
895 Ga0453684_0016279 3300044712 Bacteria 11645
896 Ga0453684_0019676 3300044712 Bacteria 10253
897 Ga0453684_0021899 3300044712 Bacteria 9513
898 Ga0453684_0030419 3300044712 Bacteria 7629
899 Ga0453684_0046636 3300044712 Bacteria 5761
900 Ga0453684_0048265 3300044712 Bacteria 5633
901 Ga0453684_0055436 3300044712 Bacteria 5153
902 Ga0453684_0057574 3300044712 Bacteria 5029
903 Ga0453684_0069986 3300044712 Bacteria 4447
904 Ga0453684_0070696 3300044712 Bacteria 4418
905 Ga0453684_0087668 3300044712 Bacteria 3856
906 Ga0453684_0097761 3300044712 Bacteria 3602
907 Ga0453684_0112724 3300044712 Bacteria 3301
908 Ga0453684_0134239 3300044712 Bacteria 2966
909 Ga0453684_0142404 3300044712 Bacteria 2861
910 Ga0453684_0152488 3300044712 Bacteria 2744
911 Ga0453684_0162295 3300044712 Bacteria 2642
912 Ga0453684_0167310 3300044712 Bacteria 2594
913 Ga0453684_0209441 3300044712 Bacteria 2267
914 Ga0453684_0352507 3300044712 Bacteria 1659
915 Ga0453684_0485017 3300044712 Bacteria 1371
916 Ga0453684_0504267 3300044712 Bacteria 1339
917 Ga0451576_0000488 3300045051 Bacteria 87699
918 Ga0451576_0000897 3300045051 Bacteria 56638
919 Ga0451576_0001625 3300045051 Bacteria 37674
920 Ga0451576_0002883 3300045051 Bacteria 24561
921 Ga0451576_0003235 3300045051 Bacteria 22666
922 Ga0451576_0007599 3300045051 Bacteria 12911
923 Ga0451576_0010023 3300045051 Bacteria 10916
924 Ga0451576_0017004 3300045051 Bacteria 8007
925 Ga0451576_0018382 3300045051 Bacteria 7664
926 Ga0451576_0029987 3300045051 Bacteria 5817
927 Ga0451576_0059407 3300045051 Bacteria 3991
928 Ga0451576_0083463 3300045051 Bacteria 3324
929 Ga0451576_0084574 3300045051 Bacteria 3300
930 Ga0451576_0091231 3300045051 Bacteria 3169
931 Ga0451576_0131379 3300045051 Bacteria 2610
932 Ga0451576_0145838 3300045051 Bacteria 2468
933 Ga0451576_0148525 3300045051 Bacteria 2444
934 Ga0451576_0217205 3300045051 Bacteria 1996
935 Ga0451576_0249655 3300045051 Bacteria 1854
936 Ga0451576_0396624 3300045051 Bacteria 1446
937 Ga0451576_0400895 3300045051 Bacteria 1438
938 Ga0451576_0431901 3300045051 Bacteria 1382
939 Ga0451576_0441847 3300045051 Bacteria 1365
940 Ga0451576_0741327 3300045051 Bacteria 1032
941 Ga0495617_000327 3300046452 Bacteria 26705
942 Ga0495627_000044 3300046453 Bacteria 182964
943 Ga0495627_000143 3300046453 Bacteria 85459
944 Ga0495627_001530 3300046453 Bacteria 13262
945 Ga0495627_005662 3300046453 Bacteria 4992
946 Ga0495627_005817 3300046453 Bacteria 4906
947 Ga0495592_0014490 3300046454 Bacteria 5983
948 Ga0495603_0019488 3300046455 Bacteria 4105
949 Ga0495590_0003015 3300046457 Bacteria 6901
950 Ga0495590_0026310 3300046457 Bacteria 2043
951 Ga0495590_0026839 3300046457 Bacteria 2021
952 Ga0495591_000023 3300046458 Bacteria 191598
953 Ga0495591_003647 3300046458 Bacteria 7836
954 Ga0495591_004045 3300046458 Bacteria 7325
955 Ga0495591_004793 3300046458 Bacteria 6466
956 Ga0495591_005488 3300046458 Bacteria 5861
957 Ga0495591_006035 3300046458 Bacteria 5459
958 Ga0495591_009042 3300046458 Bacteria 4003
959 Ga0495591_010786 3300046458 Bacteria 3511
960 Ga0495638_0032805 3300046460 Bacteria 3324
961 Ga0495651_0007664 3300046462 Bacteria 8253
962 Ga0495651_0053021 3300046462 Bacteria 3124
963 Ga0495653_0061150 3300046463 Bacteria 2850
964 Ga0495653_0111964 3300046463 Bacteria 1960
965 Ga0495650_0000065 3300046471 Bacteria 275124
966 Ga0495650_0000620 3300046471 Bacteria 48027
967 Ga0495650_0006361 3300046471 Bacteria 7378
968 Ga0495650_0009633 3300046471 Bacteria 5476
969 Ga0495580_0011408 3300046472 Bacteria 6875
970 Ga0495580_0017429 3300046472 Bacteria 5372
971 Ga0495580_0037314 3300046472 Bacteria 3489
972 Ga0495580_0108737 3300046472 Bacteria 1925
973 Ga0495605_0000048 3300046474 Bacteria 170182
974 Ga0495605_0000094 3300046474 Bacteria 112717
975 Ga0495605_0000330 3300046474 Bacteria 47649
976 Ga0495605_0000486 3300046474 Bacteria 34396
977 Ga0495605_0001320 3300046474 Bacteria 16426
978 Ga0495605_0005925 3300046474 Bacteria 7065
979 Ga0495605_0006308 3300046474 Bacteria 6834
980 Ga0495605_0042442 3300046474 Bacteria 2260
981 Ga0495605_0108899 3300046474 Bacteria 1266
982 Ga0495639_0000714 3300046475 Bacteria 15193
983 Ga0495664_0003394 3300046477 Bacteria 8652
984 Ga0495664_0224992 3300046477 Bacteria 1136
985 Ga0495584_0001356 3300046491 Bacteria 14814
986 Ga0495584_0004349 3300046491 Bacteria 7629
987 Ga0495584_0004438 3300046491 Bacteria 7549
988 Ga0495584_0020003 3300046491 Bacteria 3400
989 Ga0495585_0005478 3300046492 Bacteria 7990
990 Ga0495585_0022896 3300046492 Bacteria 3585
991 Ga0495594_0003631 3300046499 Bacteria 7933
992 Ga0495594_0188393 3300046499 Bacteria 1175
993 Ga0495596_0012119 3300046500 Bacteria 3699
994 Ga0495607_0000349 3300046501 Bacteria 47780
995 Ga0495607_0000396 3300046501 Bacteria 44362
996 Ga0495607_0001009 3300046501 Bacteria 25910
997 Ga0495607_0001535 3300046501 Bacteria 20312
998 Ga0495607_0003645 3300046501 Bacteria 11690
999 Ga0495607_0005366 3300046501 Bacteria 9203
1000 Ga0495607_0006278 3300046501 Bacteria 8378
1001 Ga0495607_0021862 3300046501 Bacteria 4022
1002 Ga0495607_0047000 3300046501 Bacteria 2530
1003 Ga0495607_0059081 3300046501 Bacteria 2188
1004 Ga0495607_0102701 3300046501 Bacteria 1528
1005 Ga0495583_0000096 3300046506 Bacteria 151090
1006 Ga0495583_0001432 3300046506 Bacteria 24231
1007 Ga0495583_0006317 3300046506 Bacteria 7780
1008 Ga0495583_0010134 3300046506 Bacteria 5533
1009 Ga0495583_0010743 3300046506 Bacteria 5309
1010 Ga0495583_0017557 3300046506 Bacteria 3794
1011 Ga0495583_0050576 3300046506 Bacteria 1898
1012 Ga0495606_0001112 3300046507 Bacteria 38418
1013 Ga0495606_0002582 3300046507 Bacteria 20733
1014 Ga0495606_0004094 3300046507 Bacteria 14816
1015 Ga0495606_0008803 3300046507 Bacteria 8665
1016 Ga0495606_0015513 3300046507 Bacteria 5864
1017 Ga0495606_0016101 3300046507 Bacteria 5723
1018 Ga0495608_0053847 3300046511 Bacteria 2661
1019 Ga0495610_0000021 3300046512 Bacteria 336300
1020 Ga0495610_0012081 3300046512 Bacteria 5222
1021 Ga0495610_0034270 3300046512 Bacteria 2616
1022 Ga0495616_0004161 3300046513 Bacteria 9170
1023 Ga0495616_0025122 3300046513 Bacteria 3186
1024 Ga0495616_0059646 3300046513 Bacteria 1876
1025 Ga0495620_0000001 3300046515 Bacteria 386508
1026 Ga0495620_0000002 3300046515 Bacteria 373737
1027 Ga0495620_0000757 3300046515 Bacteria 19829
1028 Ga0495620_0001337 3300046515 Bacteria 14977
1029 Ga0495620_0004859 3300046515 Bacteria 7538
1030 Ga0495628_0012932 3300046516 Bacteria 7028
1031 Ga0495628_0180534 3300046516 Bacteria 1597
1032 Ga0495630_0001621 3300046517 Bacteria 15640
1033 Ga0495630_0024426 3300046517 Bacteria 4469
1034 Ga0495631_0001469 3300046518 Bacteria 14301
1035 Ga0495631_0014162 3300046518 Bacteria 3854
1036 Ga0495631_0014537 3300046518 Bacteria 3796
1037 Ga0495631_0032838 3300046518 Bacteria 2337
1038 Ga0495632_0002507 3300046519 Bacteria 13918
1039 Ga0495632_0004158 3300046519 Bacteria 9921
1040 Ga0495632_0004287 3300046519 Bacteria 9736
1041 Ga0495632_0023780 3300046519 Bacteria 3266
1042 Ga0495632_0024047 3300046519 Bacteria 3243
1043 Ga0495637_0000630 3300046520 Bacteria 24850
1044 Ga0495637_0001225 3300046520 Bacteria 15558
1045 Ga0495637_0001699 3300046520 Bacteria 12710
1046 Ga0495637_0005266 3300046520 Bacteria 6619
1047 Ga0495637_0018833 3300046520 Bacteria 3198
1048 Ga0495643_0000303 3300046522 Bacteria 68802
1049 Ga0495643_0000560 3300046522 Bacteria 45977
1050 Ga0495643_0001685 3300046522 Bacteria 19270
1051 Ga0495643_0002672 3300046522 Bacteria 13791
1052 Ga0495643_0013070 3300046522 Bacteria 4986
1053 Ga0495643_0015736 3300046522 Bacteria 4461
1054 Ga0495643_0018964 3300046522 Bacteria 3984
1055 Ga0495644_0003708 3300046523 Bacteria 6012
1056 Ga0495644_0006504 3300046523 Bacteria 4525
1057 Ga0495648_0000521 3300046524 Bacteria 41448
1058 Ga0495648_0001868 3300046524 Bacteria 20138
1059 Ga0495648_0008904 3300046524 Bacteria 7843
1060 Ga0495648_0009937 3300046524 Bacteria 7303
1061 Ga0495648_0020975 3300046524 Bacteria 4540
1062 Ga0495648_0024807 3300046524 Bacteria 4072
1063 Ga0495648_0025968 3300046524 Bacteria 3954
1064 Ga0495648_0037701 3300046524 Bacteria 3102
1065 Ga0495648_0093676 3300046524 Bacteria 1674
1066 Ga0495666_0003007 3300046526 Bacteria 8461
1067 Ga0495642_0001462 3300046528 Bacteria 10574
1068 Ga0495642_0003590 3300046528 Bacteria 6101
1069 Ga0495642_0003766 3300046528 Bacteria 5936
1070 Ga0495652_0008745 3300046529 Bacteria 9218
1071 Ga0495652_0056581 3300046529 Bacteria 3330
1072 Ga0495652_0351409 3300046529 Bacteria 1056
1073 Ga0495654_0000096 3300046530 Bacteria 99777
1074 Ga0495654_0000102 3300046530 Bacteria 96991
1075 Ga0495654_0000588 3300046530 Bacteria 29030
1076 Ga0495654_0005166 3300046530 Bacteria 7614
1077 Ga0495654_0007690 3300046530 Bacteria 5997
1078 Ga0495654_0010751 3300046530 Bacteria 4971
1079 Ga0495654_0013991 3300046530 Bacteria 4279
1080 Ga0495654_0104304 3300046530 Bacteria 1301
1081 Ga0495665_0021153 3300046531 Bacteria 3495
1082 Ga0495640_0110106 3300046533 Bacteria 1800
1083 Ga0495587_0001493 3300046536 Bacteria 15596
1084 Ga0495587_0004848 3300046536 Bacteria 8828
1085 Ga0495609_0000012 3300046538 Bacteria 333994
1086 Ga0495609_0000079 3300046538 Bacteria 118997
1087 Ga0495609_0001254 3300046538 Bacteria 17456
1088 Ga0495609_0003270 3300046538 Bacteria 9357
1089 Ga0495609_0005619 3300046538 Bacteria 6538
1090 Ga0495609_0009678 3300046538 Bacteria 4652
1091 Ga0495609_0057899 3300046538 Bacteria 1714
1092 Ga0495597_0000016 3300046542 Bacteria 167456
1093 Ga0495597_0021120 3300046542 Bacteria 3028
1094 Ga0495645_0037723 3300046543 Bacteria 3524
1095 Ga0495645_0131099 3300046543 Bacteria 1756
1096 Ga0495645_0167920 3300046543 Bacteria 1512
1097 Ga0495622_0000809 3300046557 Bacteria 17316
1098 Ga0495622_0001364 3300046557 Bacteria 12491
1099 Ga0495622_0029990 3300046557 Bacteria 2541
1100 Ga0495633_0000034 3300046558 Bacteria 185552
1101 Ga0495633_0031235 3300046558 Bacteria 2584
1102 Ga0495667_0060055 3300046559 Bacteria 2494
1103 Ga0495667_0118620 3300046559 Bacteria 1709
1104 Ga0495667_0194558 3300046559 Bacteria 1299
1105 Ga0495656_0001632 3300046615 Bacteria 7338
1106 Ga0495668_0065953 3300046616 Bacteria 1992
1107 Ga0495634_0000967 3300046642 Bacteria 27121
1108 Ga0495611_0000656 3300046648 Bacteria 19743
1109 Ga0495611_0016202 3300046648 Bacteria 3186
1110 Ga0495611_0036628 3300046648 Bacteria 2178
1111 Ga0495625_0000076 3300046660 Bacteria 163580
1112 Ga0495625_0047649 3300046660 Bacteria 3089
1113 Ga0495635_0000752 3300046663 Bacteria 21018
1114 Ga0495635_0089474 3300046663 Bacteria 2106
1115 Ga0495659_0001347 3300046664 Bacteria 8436
1116 Ga0495659_0017477 3300046664 Bacteria 2377
1117 Ga0495661_0000004 3300046665 Bacteria 555340
1118 Ga0495661_0000099 3300046665 Bacteria 106462
1119 Ga0495661_0000146 3300046665 Bacteria 82292
1120 Ga0495661_0000773 3300046665 Bacteria 30663
1121 Ga0495661_0025579 3300046665 Bacteria 3811
1122 Ga0495661_0030918 3300046665 Bacteria 3404
1123 Ga0495661_0042222 3300046665 Bacteria 2812
1124 Ga0495661_0110881 3300046665 Bacteria 1529
1125 Ga0495588_0004580 3300046674 Bacteria 6111
1126 Ga0495599_0002296 3300046678 Bacteria 11119
1127 Ga0495599_0015207 3300046678 Bacteria 4773
1128 Ga0495623_0001889 3300046679 Bacteria 14069
1129 Ga0495623_0006999 3300046679 Bacteria 7328
1130 Ga0495646_0011937 3300046680 Bacteria 5525
1131 Ga0495646_0037210 3300046680 Bacteria 3012
1132 Ga0495669_0016103 3300046684 Bacteria 3201
1133 Ga0495670_0002495 3300046691 Bacteria 9090
1134 Ga0495670_0023981 3300046691 Bacteria 3012
1135 Ga0495670_0034984 3300046691 Bacteria 2502
1136 Ga0495671_0000024 3300046692 Bacteria 246812
1137 Ga0495671_0000908 3300046692 Bacteria 21076
1138 Ga0495671_0002113 3300046692 Bacteria 12706
1139 Ga0495671_0002880 3300046692 Bacteria 10758
1140 Ga0495671_0003585 3300046692 Bacteria 9480
1141 Ga0495671_0004322 3300046692 Bacteria 8540
1142 Ga0495671_0010611 3300046692 Bacteria 5094
1143 Ga0495671_0018765 3300046692 Bacteria 3666
1144 Ga0495649_0001633 3300046694 Bacteria 16680
1145 Ga0495649_0003386 3300046694 Bacteria 10781
1146 Ga0495649_0003919 3300046694 Bacteria 9844
1147 Ga0495649_0008042 3300046694 Bacteria 6370
1148 Ga0495649_0010145 3300046694 Bacteria 5567
1149 Ga0495649_0049172 3300046694 Bacteria 2290
1150 Ga0495589_0000003 3300046794 Bacteria 453448
1151 Ga0495589_0000194 3300046794 Bacteria 53082
1152 Ga0495589_0008684 3300046794 Bacteria 5291
1153 Ga0495589_0024274 3300046794 Bacteria 3082
1154 Ga0495589_0089809 3300046794 Bacteria 1492
1155 Ga0495600_0046810 3300046809 Bacteria 2821
1156 Ga0495660_0000017 3300046810 Bacteria 320655
1157 Ga0495660_0000824 3300046810 Bacteria 23044
1158 Ga0495660_0012602 3300046810 Bacteria 4906
1159 Ga0495660_0020560 3300046810 Bacteria 3783
1160 Ga0495660_0022401 3300046810 Bacteria 3607
1161 Ga0495660_0023907 3300046810 Bacteria 3482
1162 Ga0495604_0069019 3300047317 Bacteria 2680
1163 Ga0495604_0081857 3300047317 Bacteria 2415
1164 Ga0495604_0163470 3300047317 Bacteria 1571
1165 Ga0495636_0000764 3300047318 Bacteria 11844
1166 Ga0495674_0005437 3300047319 Bacteria 12235
1167 Ga0495674_0007240 3300047319 Bacteria 10618
1168 Ga0495674_0044383 3300047319 Bacteria 3953
1169 Ga0495672_0000001 3300047320 Bacteria 1458820
1170 Ga0495672_0004429 3300047320 Bacteria 11506
1171 Ga0495672_0005100 3300047320 Bacteria 10485
1172 Ga0495672_0008463 3300047320 Bacteria 7588
1173 Ga0495672_0077988 3300047320 Bacteria 1854
1174 Ga0495676_0000016 3300047321 Bacteria 196310
1175 Ga0495680_0018000 3300047322 Bacteria 6011
1176 Ga0495680_0038892 3300047322 Bacteria 3799
1177 Ga0495680_0130297 3300047322 Bacteria 1849
1178 Ga0495683_0000034 3300047323 Bacteria 148959
1179 Ga0495683_0015091 3300047323 Bacteria 4022
1180 Ga0495683_0036322 3300047323 Bacteria 2501
1181 Ga0495683_0125868 3300047323 Bacteria 1212
1182 Ga0495687_006222 3300047443 Bacteria 7365
1183 Ga0495675_0033821 3300047444 Bacteria 3263
1184 Ga0495675_0068006 3300047444 Bacteria 2251
1185 Ga0495675_0273848 3300047444 Bacteria 1008
1186 Ga0495677_0003900 3300047445 Bacteria 5768
1187 Ga0495679_000087 3300047446 Bacteria 85691
1188 Ga0495679_000377 3300047446 Bacteria 34132
1189 Ga0495679_012040 3300047446 Bacteria 3313
1190 Ga0495673_0000019 3300047469 Bacteria 554389
1191 Ga0495673_0001933 3300047469 Bacteria 15387
1192 Ga0495673_0002323 3300047469 Bacteria 13555
1193 Ga0495673_0009651 3300047469 Bacteria 5321
1194 Ga0495673_0015126 3300047469 Bacteria 3986
1195 Ga0495673_0015438 3300047469 Bacteria 3935
1196 Ga0495673_0027991 3300047469 Bacteria 2674
1197 Ga0495673_0043729 3300047469 Bacteria 2002
1198 Ga0495673_0097623 3300047469 Bacteria 1192
1199 Ga0495681_0016581 3300047470 Bacteria 4121
1200 Ga0495684_0000398 3300047471 Bacteria 35517
1201 Ga0495684_0040686 3300047471 Bacteria 3563
1202 Ga0495684_0195055 3300047471 Bacteria 1495
1203 Ga0495686_0016655 3300047472 Bacteria 4977
1204 Ga0495686_0075906 3300047472 Bacteria 2060
1205 Ga0495593_0045035 3300047673 Bacteria 2356
1206 Ga0495602_0015186 3300048088 Bacteria 7783
1207 Ga0495602_0186702 3300048088 Bacteria 1593
1208 Ga0495602_0194688 3300048088 Bacteria 1551
1209 Ga0495615_0002290 3300048090 Bacteria 3049
1210 Ga0495626_0000098 3300048091 Bacteria 113821
1211 Ga0495626_0004696 3300048091 Bacteria 8284
1212 Ga0495626_0006801 3300048091 Bacteria 6463
1213 Ga0495626_0033602 3300048091 Bacteria 2457
1214 Ga0495626_0038730 3300048091 Bacteria 2258
1215 Ga0496102_0000991 3300048905 Bacteria 26693
1216 Ga0496102_0034926 3300048905 Bacteria 4525
1217 Ga0496103_0000997 3300048906 Bacteria 19928
1218 Ga0496103_0048117 3300048906 Bacteria 2635
1219 Ga0496104_0000260 3300048907 Bacteria 46567
1220 Ga0496104_0148724 3300048907 Bacteria 2249
1221 Ga0496104_0404671 3300048907 Bacteria 1277
1222 Ga0496105_0000156 3300048908 Bacteria 45175
1223 Ga0496105_0163634 3300048908 Bacteria 1826
1224 Ga0496110_0009694 3300048913 Bacteria 7799
1225 Ga0496110_0048656 3300048913 Bacteria 3717
1226 Ga0496110_0056893 3300048913 Bacteria 3441
1227 Ga0496110_0136059 3300048913 Bacteria 2220
1228 Ga0496111_0126132 3300048914 Bacteria 1892
1229 Ga0496112_0006585 3300048915 Bacteria 10224
1230 Ga0496113_0173044 3300048916 Bacteria 1710
1231 Ga0496114_0003707 3300048917 Bacteria 11759
1232 Ga0496114_0061464 3300048917 Bacteria 3142
1233 Ga0496115_0007686 3300048918 Bacteria 7946
1234 Ga0496115_0024949 3300048918 Bacteria 4651
1235 Ga0496115_0287935 3300048918 Bacteria 1348
1236 Ga0496116_0000007 3300048919 Bacteria 795464
1237 Ga0496116_0010359 3300048919 Bacteria 7826
1238 Ga0496116_0045906 3300048919 Bacteria 2953
1239 Ga0496117_0001323 3300048920 Bacteria 36451
1240 Ga0496117_0001620 3300048920 Bacteria 31800
1241 Ga0496117_0002783 3300048920 Bacteria 21400
1242 Ga0496117_0003088 3300048920 Bacteria 19934
1243 Ga0496117_0006308 3300048920 Bacteria 12062
1244 Ga0496117_0012255 3300048920 Bacteria 7580
1245 Ga0496117_0018402 3300048920 Bacteria 5786
1246 Ga0496118_0002712 3300048921 Bacteria 23338
1247 Ga0496118_0002985 3300048921 Bacteria 21881
1248 Ga0496118_0006537 3300048921 Bacteria 12752
1249 Ga0496118_0036587 3300048921 Bacteria 3965
1250 Ga0496118_0052475 3300048921 Bacteria 3109
1251 Ga0496119_0000612 3300048922 Bacteria 48284
1252 Ga0496120_0001054 3300048923 Bacteria 36515
1253 Ga0496120_0008485 3300048923 Bacteria 7452
1254 Ga0496121_0007202 3300048924 Bacteria 13471
1255 Ga0496121_0030502 3300048924 Bacteria 4951
1256 Ga0496121_0034409 3300048924 Bacteria 4560
1257 Ga0496121_0094533 3300048924 Bacteria 2325
1258 Ga0496122_0001943 3300048925 Bacteria 31037
1259 Ga0496122_0002404 3300048925 Bacteria 26680
1260 Ga0496122_0007083 3300048925 Bacteria 12597
1261 Ga0496122_0019738 3300048925 Bacteria 6141
1262 Ga0496122_0022598 3300048925 Bacteria 5583
1263 Ga0496123_0000439 3300048926 Bacteria 74838
1264 Ga0496123_0001575 3300048926 Bacteria 31163
1265 Ga0496123_0014417 3300048926 Bacteria 6553
1266 Ga0496123_0026678 3300048926 Bacteria 4320
1267 Ga0496123_0054519 3300048926 Bacteria 2631
1268 Ga0496123_0058743 3300048926 Bacteria 2492
1269 Ga0496124_0000132 3300048927 Bacteria 155405
1270 Ga0496124_0001693 3300048927 Bacteria 31219
1271 Ga0496124_0002023 3300048927 Bacteria 27562
1272 Ga0496124_0006195 3300048927 Bacteria 13110
1273 Ga0496124_0006210 3300048927 Bacteria 13091
1274 Ga0496124_0015103 3300048927 Bacteria 7424
1275 Ga0496124_0038452 3300048927 Bacteria 4155
1276 Ga0496124_0045902 3300048927 Bacteria 3744
1277 Ga0496124_0059474 3300048927 Bacteria 3210
1278 Ga0496124_0060348 3300048927 Bacteria 3181
1279 Ga0496124_0173557 3300048927 Bacteria 1666
1280 Ga0496125_0000380 3300048928 Bacteria 82955
1281 Ga0496125_0001691 3300048928 Bacteria 30828
1282 Ga0496125_0004712 3300048928 Bacteria 15545
1283 Ga0496125_0024615 3300048928 Bacteria 5530
1284 Ga0496125_0038928 3300048928 Bacteria 4105
1285 Ga0496125_0099344 3300048928 Bacteria 2150
1286 Ga0496126_0000101 3300048929 Bacteria 201606
1287 Ga0496126_0097180 3300048929 Bacteria 2581
1288 Ga0496126_0154973 3300048929 Bacteria 1961
1289 Ga0496126_0339330 3300048929 Bacteria 1231
1290 Ga0496126_0388229 3300048929 Bacteria 1135
1291 Ga0495678_000049 3300049459 Bacteria 163929
1292 Ga0495678_000579 3300049459 Bacteria 34743
1293 Ga0495678_002688 3300049459 Bacteria 11735
1294 Ga0495678_006374 3300049459 Bacteria 6291
1295 Ga0495678_008976 3300049459 Bacteria 4993
1296 Ga0495678_039896 3300049459 Bacteria 1890
1297 Ga0495678_080824 3300049459 Bacteria 1167
1298 Ga0495682_0000011 3300049460 Bacteria 278474
1299 Ga0495682_0000128 3300049460 Bacteria 65703
1300 Ga0495682_0001668 3300049460 Bacteria 11355
1301 Ga0495682_0017012 3300049460 Bacteria 2749
1302 Ga0495682_0019899 3300049460 Bacteria 2521
1303 Ga0501031_0011752 3300049568 Bacteria 5711
1304 Ga0501031_0030930 3300049568 Bacteria 3493
1305 Ga0501032_0001038 3300049569 Bacteria 22303
1306 Ga0501032_0001256 3300049569 Bacteria 20363
1307 Ga0501032_0006131 3300049569 Bacteria 8855
1308 Ga0501032_0009678 3300049569 Bacteria 6982
1309 Ga0501033_0003841 3300049570 Bacteria 12212
1310 Ga0501033_0007400 3300049570 Bacteria 8549
1311 Ga0501033_0009063 3300049570 Bacteria 7677
1312 Ga0501033_0016351 3300049570 Bacteria 5619
1313 Ga0501034_0000041 3300049571 Bacteria 229264
1314 Ga0501034_0002365 3300049571 Bacteria 22914
1315 Ga0501034_0008207 3300049571 Bacteria 11064
1316 Ga0501034_0020051 3300049571 Bacteria 6828
1317 Ga0501034_0030857 3300049571 Bacteria 5447
1318 Ga0501034_0127735 3300049571 Bacteria 2527
1319 Ga0501034_0324523 3300049571 Bacteria 1472
1320 Ga0501036_0000583 3300049572 Bacteria 26372
1321 Ga0501036_0000764 3300049572 Bacteria 23858
1322 Ga0501037_0002333 3300049573 Bacteria 13707
1323 Ga0501037_0014890 3300049573 Bacteria 5721
1324 Ga0501037_0040016 3300049573 Bacteria 3450
1325 Ga0501037_0124890 3300049573 Bacteria 1848
1326 Ga0501037_0134521 3300049573 Bacteria 1771
1327 Ga0501038_0003064 3300049574 Bacteria 15576
1328 Ga0501038_0007027 3300049574 Bacteria 10398
1329 Ga0501038_0007681 3300049574 Bacteria 9943
1330 Ga0501038_0020808 3300049574 Bacteria 5896
1331 Ga0501038_0157567 3300049574 Bacteria 1848
1332 Ga0501039_0004609 3300049575 Bacteria 10423
1333 Ga0501039_0011648 3300049575 Bacteria 6697
1334 Ga0501039_0171108 3300049575 Bacteria 1708
1335 Ga0501040_0009107 3300049576 Bacteria 6463
1336 Ga0501040_0106982 3300049576 Bacteria 1954
1337 Ga0501042_0003284 3300049578 Bacteria 10121
1338 Ga0501042_0142376 3300049578 Bacteria 1729
1339 Ga0501043_0004581 3300049579 Bacteria 11214
1340 Ga0501043_0005319 3300049579 Bacteria 10404
1341 Ga0501043_0006282 3300049579 Bacteria 9537
1342 Ga0501043_0035508 3300049579 Bacteria 3921
1343 Ga0501043_0139463 3300049579 Bacteria 1899
1344 Ga0501046_0000889 3300049580 Bacteria 29096
1345 Ga0501046_0001127 3300049580 Bacteria 26110
1346 Ga0501046_0050465 3300049580 Bacteria 3287
1347 Ga0501047_0002434 3300049581 Bacteria 17788
1348 Ga0501048_0005502 3300049582 Bacteria 9636
1349 Ga0501048_0031545 3300049582 Bacteria 3833
1350 Ga0501067_0012770 3300049583 Bacteria 4653
1351 Ga0501068_0011869 3300049584 Bacteria 4925
1352 Ga0501068_0129193 3300049584 Bacteria 1579
1353 Ga0501069_0000937 3300049585 Bacteria 13931
1354 Ga0501070_0030461 3300049586 Bacteria 4521
1355 Ga0501072_0011524 3300049588 Bacteria 6757
1356 Ga0501073_0026765 3300049589 Bacteria 4129
1357 Ga0501076_0205757 3300049592 Bacteria 1608
1358 Ga0501077_0004163 3300049593 Bacteria 8737
1359 Ga0501079_0028748 3300049741 Bacteria 4267
1360 Ga0501080_0145730 3300049742 Bacteria 2189
1361 Ga0501081_0181438 3300049743 Bacteria 1523
1362 Ga0501083_0002458 3300049744 Bacteria 12688
1363 Ga0501083_0007866 3300049744 Bacteria 7552
1364 Ga0501035_0000158 3300049822 Bacteria 82890
1365 Ga0501035_0003883 3300049822 Bacteria 14259
1366 Ga0501035_0006972 3300049822 Bacteria 10552
1367 Ga0501035_0191013 3300049822 Bacteria 1761
1368 Ga0501044_0000190 3300049823 Bacteria 77415
1369 Ga0501044_0015234 3300049823 Bacteria 8282
1370 Ga0501044_0028814 3300049823 Bacteria 5857
1371 Ga0501044_0084786 3300049823 Bacteria 3201
1372 Ga0501044_0126007 3300049823 Bacteria 2559
1373 Ga0501044_0164704 3300049823 Bacteria 2192
1374 Ga0501044_0253119 3300049823 Bacteria 1701
1375 Ga0501045_0001759 3300049824 Bacteria 14603
1376 Ga0501226_000007 3300049853 Bacteria 227827
1377 nmdc:mga05p37_2980_c1 3300050507 Bacteria 19673
1378 nmdc:mga06r32_274823_c1 3300050510 Bacteria 1672
1379 nmdc:mga08y16_181967_c1 3300050511 Bacteria 2182
1380 nmdc:mga08y16_6325_c1 3300050511 Bacteria 12421
1381 nmdc:mga08y16_95630_c1 3300050511 Bacteria 3094
1382 nmdc:mga08x19_624_c1 3300050514 Bacteria 22809
1383 Ga0495601_0021931 3300053077 Bacteria 3917
1384 Ga0495601_0248421 3300053077 Bacteria 1162
1385 Ga0495612_0024226 3300053078 Bacteria 2437
1386 Ga0500595_007403 3300053119 Bacteria 4556
1387 Ga0500618_005360 3300053125 Bacteria 3913
1388 Ga0500621_000005 3300053126 Bacteria 320383
1389 Ga0500659_0035137 3300053135 Bacteria 2731
1390 Ga0500564_013234 3300053138 Bacteria 3688
1391 Ga0500568_0005172 3300053139 Bacteria 6802
1392 Ga0500604_0053869 3300053151 Bacteria 1248
1393 Ga0500616_0035421 3300053153 Bacteria 2714
1394 Ga0501084_0001126 3300054114 Bacteria 20857
1395 Ga0501084_0019920 3300054114 Bacteria 5592
1396 Ga0590071_005287 3300059421 Bacteria 3112
1397 Ga0501082_0005501 3300060353 Bacteria 10993
1398 640488419 640427133 Bacteria 4567418
1399 2506579725 2506520007 Bacteria 5442880
1400 2506584864 2506520008 Bacteria 5443009
1401 2508853525 2508501071 Bacteria 5454741
1402 2510285074 2510065053 Bacteria 5005518
1403 2511254484 2511231004 Bacteria 6669789
1404 2511269701 2511231007 Bacteria 6306603
1405 2511298767 2511231011 Bacteria 6149768
1406 2511329179 2511231016 Bacteria 6704427
1407 2511341334 2511231018 Bacteria 6436256
1408 2511347513 2511231019 Bacteria 6520662
1409 2511360643 2511231022 Bacteria 6719296
1410 2511374796 2511231024 Bacteria 5835885
1411 2528203243 2527291627 Bacteria 5309833
1412 2528214404 2527291629 Bacteria 5267418
1413 2538426471 2537561728 Bacteria 5149301
1414 2546947887 2546825537 Bacteria 5389291
1415 2547373094 2547132103 Bacteria 5115736
1416 2548846078 2547132512 Bacteria 3416496
1417 2552746416 2551306352 Bacteria 3873115
1418 2555246088 2554235231 Bacteria 5215788
1419 2566034961 2565956521 Bacteria 4468993
1420 2579749772 2576861822 Bacteria 5004595
1421 2579858337 2579778521 Bacteria 7624758
1422 2597862830 2597489888 Bacteria 6179543
1423 2597868631 2597489889 Bacteria 6297495
1424 2599328570 2599185155 Bacteria 5827168
1425 2599396608 2599185167 Bacteria 6353609
1426 2599453332 2599185179 Bacteria 6611171
1427 2599503933 2599185188 Bacteria 6164180
1428 2599507589 2599185189 Bacteria 5862825
1429 2599514664 2599185190 Bacteria 6285678
1430 2599517405 2599185191 Bacteria 6297582
1431 2599772729 2599185248 Bacteria 6696816
1432 2599889226 2599185289 Bacteria 6778765
1433 2599894071 2599185290 Bacteria 6289611
1434 2599896547 2599185291 Bacteria 6775623
1435 2599926649 2599185299 Bacteria 4854625
1436 2599931901 2599185300 Bacteria 6062622
1437 2599945551 2599185302 Bacteria 5954930
1438 2599956669 2599185304 Bacteria 5951361
1439 2599962622 2599185305 Bacteria 6748700
1440 2599965242 2599185306 Bacteria 6637356
1441 2599973907 2599185307 Bacteria 6194719
1442 2599978788 2599185308 Bacteria 6621546
1443 2599985409 2599185309 Bacteria 5969593
1444 2599991840 2599185310 Bacteria 6014457
1445 2599996561 2599185311 Bacteria 6354990
1446 2600002363 2599185312 Bacteria 5912071
1447 2600006884 2599185313 Bacteria 6658188
1448 2600010474 2599185314 Bacteria 6621749
1449 2600021397 2599185315 Bacteria 6771107
1450 2600026382 2599185316 Bacteria 6320029
1451 2600032463 2599185317 Bacteria 6435722
1452 2600036318 2599185318 Bacteria 6961590
1453 2600043615 2599185319 Bacteria 6637840
1454 2600049896 2599185320 Bacteria 5963263
1455 2600053523 2599185321 Bacteria 6764560
1456 2600061461 2599185322 Bacteria 6763055
1457 2600067385 2599185323 Bacteria 6688755
1458 2600070392 2599185324 Bacteria 6590677
1459 2600080220 2599185325 Bacteria 6324919
1460 2600362025 2600254930 Bacteria 6431253
1461 2601626537 2600255283 Bacteria 6061572
1462 2601691366 2600255296 Bacteria 5784754
1463 2624493752 2623620446 Bacteria 6500345
1464 2626635872 2626541554 Bacteria 7741902
1465 2644187584 2643221633 Bacteria 6733554
1466 2644283634 2643221650 Bacteria 7029547
1467 2644625113 2643221713 Bacteria 6554480
1468 2649121677 2648501241 Bacteria 5312320
1469 2652547489 2651869719 Bacteria 6047974
1470 2652975972 2651869818 Bacteria 5864031
1471 2656276837 2654587920 Bacteria 5475511
1472 2671090423 2667528170 Bacteria 6786960
1473 2671130395 2667528176 Bacteria 6724917
1474 2677896682 2675903420 Bacteria 6247433
1475 2678229663 2675903507 Bacteria 3737791
1476 2678262380 2675903515 Bacteria 6580491
1477 2686356135 2684622997 Bacteria 4624240
1478 2686541628 2684623036 Bacteria 5199090
1479 2687238447 2684623219 Bacteria 8442773
1480 2687239187 2684623219 Bacteria 8442773
1481 2688393533 2687453341 Bacteria 6534136
1482 2688394040 2687453341 Bacteria 6534136
1483 2689446254 2687453601 Bacteria 5546041
1484 2707100223 2706794495 Bacteria 4536932
1485 2710604992 2710264753 Bacteria 5455564
1486 2723247659 2721755607 Bacteria 5841722
1487 2729147406 2728369097 Bacteria 4333476
1488 2738691410 2738541271 Bacteria 5657310
1489 2739267185 2738543016 Bacteria 5657564
1490 2739290022 2738543020 Bacteria 5718238
1491 2739295334 2738543021 Bacteria 5718241
1492 2745008726 2744054620 Bacteria 6551379
1493 2745162055 2744054655 Bacteria 3552603
1494 2765582576 2765235841 Bacteria 6137024
1495 2772440165 2772190666 Bacteria 5117644
1496 2774121349 2773857670 Bacteria 6407454
1497 2774135982 2773857673 Bacteria 6513460
1498 2774391356 2773857761 Bacteria 3837365
1499 2774436090 2773857770 Bacteria 3911866
1500 2774864360 2773857924 Bacteria 5256821
1501 2784259992 2784132063 Bacteria 6262788
1502 2784317308 2784132072 Bacteria 6596533
1503 2794596176 2791355520 Bacteria 5948615
1504 2807409656 2806310737 Bacteria 5751088
1505 2807457957 2806310745 Bacteria 5742165
1506 2808858227 2808606361 Bacteria 6136259
1507 2808904563 2808606373 Bacteria 4423627
1508 2808924150 2808606376 Bacteria 6248667
1509 2808938384 2808606378 Bacteria 6177535
1510 2808941811 2808606379 Bacteria 5022697
1511 2808946091 2808606380 Bacteria 6248705
1512 2808957514 2808606382 Bacteria 6841132
1513 2808966712 2808606383 Bacteria 6138645
1514 2809001542 2808606389 Bacteria 6138126
1515 2809125354 2808606414 Bacteria 4917181
1516 2812367911 2811994881 Bacteria 6298475
1517 2813727714 2811995292 Bacteria 5303342
1518 2819654504 2818991456 Bacteria 6123676
1519 2825653259 2825651385 Bacteria 6715909
1520 2826584468 2826581358 Bacteria 5963467
1521 2842810088 2842805378 Bacteria 5385175
1522 2842818035 2842815866 Bacteria 5947510
1523 2842840061 2842837860 Bacteria 6066181
1524 2842849342 2842849001 Bacteria 5924277
1525 2842858989 2842854478 Bacteria 6143501
1526 2843691833 2843690924 Bacteria 5169057
1527 2846041089 2846037992 Bacteria 4526407
1528 2846542270 2846540461 Bacteria 5471451
1529 2852107147 2852103415 Bacteria 5193810
1530 2852658718 2852657418 Bacteria 6472974
1531 2854605894 2854601825 Bacteria 4797592
1532 2855196988 2855195626 Bacteria 4927512
1533 2858467416 2858466076 Bacteria 4722413
1534 2860340223 2860339153 Bacteria 6846989
1535 2869555603 2869551831 Bacteria 5474685
1536 2871273881 2871272651 Bacteria 5042015
1537 2871283649 2871282230 Bacteria 4917173
1538 2880232108 2880230671 Bacteria 6140320
1539 2887631791 2887630918 Bacteria 3239855
1540 2888370254 2888366609 Bacteria 5155009
1541 2888377233 2888373701 Bacteria 5098052
1542 2900054533 2900051742 Bacteria 4985156
1543 2904522362 2904518522 Bacteria 6068986
1544 2912965141 2912963787 Bacteria 5646108
1545 2913038352 2913036834 Bacteria 6704877
1546 2916182991 2916178963 Bacteria 5265078
1547 2916702311 2916699645 Bacteria 3568996
1548 2919160059 2919155634 Bacteria 4860545
1549 2919185239 2919182534 Bacteria 3907101
1550 2919481620 2919481497 Bacteria 6907839
1551 2919496615 2919493220 Bacteria 4598500
1552 2919500817 2919497567 Bacteria 4408621
1553 2919509235 2919506607 Bacteria 3392955
1554 2919547101 2919543075 Bacteria 4728703
1555 2919700339 2919697872 Bacteria 6553725
1556 2923521962 2923519811 Bacteria 6298479
1557 2923529294 2923525760 Bacteria 4472324
1558 2923587523 2923586266 Bacteria 6565975
1559 2929145797 2929144301 Bacteria 6622272
1560 2931370863 2931369376 Bacteria 6847892
1561 2931392496 2931390751 Bacteria 6273349
1562 2931399874 2931396565 Bacteria 7251677
1563 2932410748 2932406140 Bacteria 5134491
1564 2937968796 2937967321 Bacteria 5094075
1565 2939582212 2939577877 Bacteria 5132791
1566 2939653501 2939651529 Bacteria 5895393
1567 2945929108 2945928738 Bacteria 6053221
1568 2945961817 2945961074 Bacteria 7342064
1569 2946011338 2946006987 Bacteria 6705746
1570 2984569470 2984568884 Bacteria 3884413
1571 2988733332 2988728565 Bacteria 6124362
1572 3007256756 3007252601 Bacteria 4559114
1573 3007319005 3007315729 Bacteria 5076637
1574 3007421130 3007419365 Bacteria 7026924
1575 3007512825 3007511990 Bacteria 6481491
1576 3007806354 3007803356 Bacteria 5931491
1577 3007867986 3007866637 Bacteria 5899198
1578 3007876025 3007872151 Bacteria 5268868
1579 637879757 637000116 Bacteria 5433628
1580 640939000 640753048 Bacteria 5495657
1581 651176454 651053060 Bacteria 4689946
1582 8002317854 8002317523 Bacteria 8051857
1583 8002746318 8002745576 Bacteria 4840272
1584 8004596328 8004592986 Bacteria 5122074
1585 8015397568 8015394850 Bacteria 5064660
1586 8019776994 8019775933 Bacteria 6858656
1587 8052498645 8052494512 Bacteria 5765634
1588 8054351917 8054347763 Bacteria 5901107
1589 8054914687 8054913762 Bacteria 7713009
1590 8054933913 8054929484 Bacteria 5599761
1591 8055695288 8055693939 Bacteria 4772047
1592 8055819527 8055817908 Bacteria 6609162
1593 8055880244 8055878733 Bacteria 5907058
1594 8056119958 8056115690 Bacteria 5527654
1595 8056122118 8056120720 Bacteria 5758328
1596 8056141600 8056137416 Bacteria 6147080
1597 8056147478 8056143049 Bacteria 6307666
1598 8056159314 8056155041 Bacteria 6486948
1599 8056164810 8056161164 Bacteria 6106669
1600 MRS2a_Contig_6404
1601 MRS2a_Contig_914
1602 SwRhRL2b_contig_2277002
1603 JGI25162J39368_1000100
1604 JGI25163J39215_1000894
1605 JGI25164J39214_1000079
1606 JGI25165J46597_1000183
1607 Ga0055538_1000078
1608 Ga0055539_1000119
1609 Ga0055533_1000127
1610 Ga0055532_1000068
1611 Ga0055525_1000163
1612 Ga0055536_1016854
1613 Ga0055541_1000079
1614 Ga0058692_1000067
1615 Ga0058692_1000911
1616 Ga0058692_1017134
1617 Ga0065714_10001613
1618 Ga0065714_10067998
1619 Ga0065704_10003637
1620 Ga0065704_10006591
1621 Ga0065712_10002299
1622 Ga0065715_10005136
1623 Ga0070658_10077856
1624 Ga0070683_100022822
1625 Ga0070683_100025908
1626 Ga0070683_100043891
1627 Ga0070683_100063164
1628 Ga0070683_100065855
1629 Ga0070683_100100147
1630 Ga0070683_100128431
1631 Ga0070683_100318770
1632 Ga0070690_100190414
1633 Ga0070670_100000018
1634 Ga0070670_100135408
1635 Ga0068869_100135873
1636 Ga0070682_100039334
1637 Ga0068868_100031941
1638 Ga0070660_100017653
1639 Ga0070691_10001552
1640 Ga0070691_10012197
1641 Ga0070661_100192544
1642 Ga0070668_100375171
1643 Ga0070669_100000954
1644 Ga0070675_100092910
1645 Ga0070671_100000084
1646 Ga0070671_100249178
1647 Ga0070688_100000916
1648 Ga0070659_100012188
1649 Ga0070667_100000002
1650 Ga0070714_100038188
1651 Ga0070714_100042300
1652 Ga0070714_100047786
1653 Ga0070714_100096603
1654 Ga0070714_100222041
1655 Ga0070713_100013534
1656 Ga0070713_100017674
1657 Ga0070713_100049646
1658 Ga0070713_100436349
1659 Ga0070710_10103815
1660 Ga0070711_100016406
1661 Ga0070711_100079683
1662 Ga0070708_100168989
1663 Ga0070708_100182915
1664 Ga0070663_100328580
1665 Ga0070678_100259453
1666 Ga0070662_100326916
1667 Ga0070681_10013442
1668 Ga0070681_10031212
1669 Ga0070681_10107898
1670 Ga0070681_10146899
1671 Ga0070685_10000009
1672 Ga0070706_100001466
1673 Ga0070706_100325542
1674 Ga0070707_100005111
1675 Ga0070707_100061755
1676 Ga0070699_100184904
1677 Ga0070699_100191326
1678 Ga0070679_100003415
1679 Ga0070679_100070265
1680 Ga0070679_100198544
1681 Ga0070679_100255785
1682 Ga0070684_100002254
1683 Ga0070684_100060988
1684 Ga0070684_100079773
1685 Ga0070684_100128047
1686 Ga0070684_100208463
1687 Ga0070684_100240764
1688 Ga0068853_100013136
1689 Ga0068853_100042324
1690 Ga0070696_100000147
1691 Ga0070696_100004865
1692 Ga0070665_100004663
1693 Ga0070665_100060824
1694 Ga0070665_100083206
1695 Ga0068855_100004962
1696 Ga0068855_100015449
1697 Ga0068855_100390540
1698 Ga0070664_100145049
1699 Ga0070664_100267301
1700 Ga0068857_100000451
1701 Ga0068857_100006173
1702 Ga0068857_100039946
1703 Ga0068856_100000957
1704 Ga0068856_100045631
1705 Ga0068856_100144072
1706 Ga0068852_100005614
1707 Ga0068852_100012657
1708 Ga0068864_100000002
1709 Ga0068863_100132291
1710 Ga0068858_100012945
1711 Ga0068858_100033049
1712 Ga0068858_100117640
1713 Ga0068858_100136070
1714 Ga0068858_100162062
1715 Ga0068860_100000499
1716 Ga0068862_100005568
1717 Ga0081455_10032641
1718 Ga0070717_10307513
1719 Ga0075366_10038768
1720 Ga0097621_100061966
1721 Ga0068871_100013774
1722 Ga0068871_100137250
1723 Ga0068871_100205207
1724 Ga0075428_100050306
1725 Ga0075436_100004138
1726 Ga0097620_100173920
1727 Ga0099823_1000074
1728 Ga0099823_1063482
1729 Ga0079104_1001016
1730 Ga0079104_1001936
1731 Ga0079104_1012482
1732 Ga0079104_1029289
1733 Ga0105251_10000653
1734 Ga0105251_10003325
1735 Ga0105251_10005450
1736 Ga0105251_10013205
1737 Ga0105251_10023484
1738 Ga0105251_10026906
1739 Ga0105251_10029981
1740 Ga0105251_10033879
1741 Ga0105251_10035079
1742 Ga0105251_10048767
1743 Ga0105244_10000248
1744 Ga0105244_10000274
1745 Ga0105244_10002675
1746 Ga0105244_10009787
1747 Ga0105244_10010093
1748 Ga0105244_10015761
1749 Ga0105244_10033838
1750 Ga0105244_10035696
1751 Ga0105244_10035795
1752 Ga0105244_10035887
1753 Ga0105250_10013939
1754 Ga0105250_10018481
1755 Ga0105250_10021791
1756 Ga0105250_10022369
1757 Ga0105250_10034542
1758 Ga0105250_10034581
1759 Ga0105240_10002636
1760 Ga0105240_10003683
1761 Ga0105240_10005123
1762 Ga0105240_10005449
1763 Ga0105240_10007191
1764 Ga0105240_10026186
1765 Ga0105240_10047714
1766 Ga0105240_10054350
1767 Ga0105240_10074490
1768 Ga0105240_10184676
1769 Ga0105240_10251119
1770 Ga0105240_10308746
1771 Ga0105240_10759923
1772 Ga0111539_10008365
1773 Ga0111539_10016907
1774 Ga0111539_10119867
1775 Ga0111539_10187945
1776 Ga0105245_10000694
1777 Ga0105245_10373911
1778 Ga0105245_10434957
1779 Ga0105245_10477401
1780 Ga0105247_10000176
1781 Ga0105247_10004537
1782 Ga0114129_10002078
1783 Ga0105243_10000263
1784 Ga0105243_10023492
1785 Ga0105241_10000001
1786 Ga0105241_10007966
1787 Ga0105241_10043069
1788 Ga0105241_10091320
1789 Ga0105241_10164967
1790 Ga0105241_10248325
1791 Ga0105242_10015261
1792 Ga0105242_10026595
1793 Ga0105242_10089909
1794 Ga0105242_10146764
1795 Ga0105242_10263249
1796 Ga0105248_10006442
1797 Ga0105248_10006574
1798 Ga0105248_10029592
1799 Ga0105248_10460787
1800 Ga0105248_10739221
1801 Ga0105237_10008345
1802 Ga0105237_10008700
1803 Ga0105237_10016948
1804 Ga0105237_10149607
1805 Ga0105238_10000238
1806 Ga0105238_10001852
1807 Ga0105238_10006092
1808 Ga0105238_10008661
1809 Ga0105238_10091092
1810 Ga0105238_10093299
1811 Ga0105238_10117899
1812 Ga0105238_10121358
1813 Ga0105238_10181828
1814 Ga0105249_10012651
1815 Ga0099796_10027099
1816 Ga0105246_10005750
1817 Ga0105246_10025988
1818 Ga0105246_10087869
1819 Ga0157373_10000593
1820 Ga0157373_10003913
1821 Ga0157373_10016161
1822 Ga0157373_10028452
1823 Ga0157371_10000497
1824 Ga0157371_10015917
1825 Ga0157371_10078133
1826 Ga0157371_10215321
1827 Ga0157370_10001630
1828 Ga0157370_10006826
1829 Ga0157370_10007129
1830 Ga0157370_10025437
1831 Ga0157370_10028766
1832 Ga0157370_10039334
1833 Ga0157370_10093954
1834 Ga0157370_10199378
1835 Ga0157369_10009351
1836 Ga0157369_10015015
1837 Ga0157369_10032457
1838 Ga0157369_10128690
1839 Ga0157369_10131266
1840 Ga0157369_10285226
1841 Ga0157369_10487229
1842 Ga0157374_10016482
1843 Ga0157374_10084829
1844 Ga0157374_10192967
1845 Ga0157378_10376010
1846 Ga0163162_10139987
1847 Ga0163162_10303072
1848 Ga0163162_10391986
1849 Ga0157372_10000598
1850 Ga0157372_10041986
1851 Ga0157372_10047751
1852 Ga0157372_10196571
1853 Ga0157372_10266118
1854 Ga0157372_10836391
1855 Ga0157375_10040468
1856 Ga0163163_10000627
1857 Ga0163163_10031285
1858 Ga0163163_10100549
1859 Ga0182008_10014996
1860 Ga0182008_10034069
1861 Ga0157379_10158519
1862 Ga0157376_10116201
1863 Ga0182006_1000174
1864 Ga0182006_1003543
1865 Ga0182006_1009467
1866 Ga0182006_1017180
1867 Ga0182007_10000143
1868 Ga0182005_1002054
1869 Ga0163161_10000003
1870 Ga0163161_10036567
1871 Ga0163161_10045290
1872 Ga0163161_10159843
1873 Ga0163161_10261768
1874 Ga0197907_10075445
1875 Ga0206355_1560789
1876 Ga0206351_10065214
1877 Ga0206352_10666988
1878 Ga0206350_10221737
1879 Ga0206350_10379269
1880 Ga0206350_10938216
1881 Ga0206354_10594356
1882 Ga0206354_11413883
1883 Ga0206353_11342932
1884 Ga0213872_10000050
1885 Ga0213872_10000905
1886 Ga0213874_10004805
1887 Ga0213876_10010217
1888 Ga0213876_10029263
1889 Ga0213875_10000019
1890 Ga0213875_10016825
1891 Ga0213875_10042529
1892 Ga0213875_10065563
1893 Ga0213871_10034082
1894 Ga0224712_10039765
1895 Ga0224712_10099106
1896 Ga0224712_10135246
1897 Ga0209435_100837
1898 Ga0209760_100052
1899 Ga0209784_100015
1900 Ga0209566_100012
1901 Ga0209674_100027
1902 Ga0209147_100019
1903 Ga0209563_100031
1904 Ga0207427_100029
1905 Ga0209437_100009
1906 Ga0209258_100381
1907 Ga0209646_1000344
1908 Ga0209026_1000711
1909 Ga0209677_100016
1910 Ga0209759_1003201
1911 Ga0209759_1010992
1912 Ga0209233_1000032
1913 Ga0209676_1000026
1914 Ga0209676_1000532
1915 Ga0209025_1053028
1916 Ga0209050_1010390
1917 Ga0207696_1000001
1918 Ga0207696_1000010
1919 Ga0207696_1002599
1920 Ga0207696_1003215
1921 Ga0207696_1010018
1922 Ga0207696_1021950
1923 Ga0207696_1023146
1924 Ga0207655_1000002
1925 Ga0207655_1000151
1926 Ga0207655_1000197
1927 Ga0207655_1000262
1928 Ga0207655_1001327
1929 Ga0207655_1009222
1930 Ga0207655_1014210
1931 Ga0207655_1014306
1932 Ga0207655_1014419
1933 Ga0207655_1014540
1934 Ga0207655_1015788
1935 Ga0207713_1000070
1936 Ga0207713_1000072
1937 Ga0207713_1005079
1938 Ga0207713_1011564
1939 Ga0207713_1023540
1940 Ga0207713_1028889
1941 Ga0207713_1038613
1942 Ga0207713_1053053
1943 Ga0207710_10000051
1944 Ga0207710_10000455
1945 Ga0207710_10004382
1946 Ga0207680_10061334
1947 Ga0207699_10026412
1948 Ga0207684_10003450
1949 Ga0207684_10372437
1950 Ga0207684_10415456
1951 Ga0207654_10000004
1952 Ga0207654_10083975
1953 Ga0207707_10032118
1954 Ga0207707_10064455
1955 Ga0207707_10112455
1956 Ga0207707_10224707
1957 Ga0207695_10000964
1958 Ga0207695_10005339
1959 Ga0207695_10009140
1960 Ga0207695_10031123
1961 Ga0207695_10049362
1962 Ga0207695_10069201
1963 Ga0207695_10086193
1964 Ga0207695_10134361
1965 Ga0207695_10342244
1966 Ga0207671_10027273
1967 Ga0207671_10050164
1968 Ga0207693_10018001
1969 Ga0207663_10016462
1970 Ga0207663_10073947
1971 Ga0207660_10006888
1972 Ga0207660_10053276
1973 Ga0207657_10010431
1974 Ga0207657_10054869
1975 Ga0207652_10002345
1976 Ga0207652_10071427
1977 Ga0207646_10009466
1978 Ga0207681_10000509
1979 Ga0207694_10005299
1980 Ga0207694_10021698
1981 Ga0207694_10023587
1982 Ga0207694_10024889
1983 Ga0207694_10071687
1984 Ga0207650_10000002
1985 Ga0207687_10005523
1986 Ga0207687_10007962
1987 Ga0207687_10064122
1988 Ga0207687_10276527
1989 Ga0207700_10001065
1990 Ga0207700_10078984
1991 Ga0207700_10148524
1992 Ga0207700_10150068
1993 Ga0207700_10386293
1994 Ga0207664_10035151
1995 Ga0207664_10035512
1996 Ga0207664_10179579
1997 Ga0207664_10231859
1998 Ga0207644_10001798
1999 Ga0207644_10272376
2000 Ga0207690_10016310
2001 Ga0207690_10114010
2002 Ga0207706_10284593
2003 Ga0207686_10002054
2004 Ga0207709_10000158
2005 Ga0207709_10009838
2006 Ga0207669_10357081
2007 Ga0207691_10376693
2008 Ga0207711_10000752
2009 Ga0207711_10025879
2010 Ga0207711_10041953
2011 Ga0207711_10192714
2012 Ga0207689_10157260
2013 Ga0207661_10001589
2014 Ga0207661_10011029
2015 Ga0207661_10019484
2016 Ga0207661_10077113
2017 Ga0207661_10101271
2018 Ga0207661_10381350
2019 Ga0207661_10457424
2020 Ga0207679_10124674
2021 Ga0207679_10218628
2022 Ga0207667_10000778
2023 Ga0207667_10012222
2024 Ga0207667_10018428
2025 Ga0207712_10054911
2026 Ga0207658_10000001
2027 Ga0207677_10067902
2028 Ga0207703_10008479
2029 Ga0207639_10026567
2030 Ga0207702_10007438
2031 Ga0207702_10033061
2032 Ga0207702_10051541
2033 Ga0207702_10051880
2034 Ga0207641_10067303
2035 Ga0207641_10259950
2036 Ga0207641_10404785
2037 Ga0207676_10000001
2038 Ga0207674_10000320
2039 Ga0207674_10011685
2040 Ga0207674_10049531
2041 Ga0207683_10223164
2042 Ga0207683_10276890
2043 Ga0207683_10288828
2044 Ga0207698_10445850
2045 Ga0209281_1000038
2046 Ga0209281_1000172
2047 Ga0209281_1001784
2048 Ga0209389_1000063
2049 Ga0209371_1000196
2050 Ga0209371_1000576
2051 Ga0209371_1002233
2052 Ga0209371_1003223
2053 Ga0209371_1007522
2054 Ga0209969_1003123
2055 Ga0209984_1010318
2056 Ga0209982_1005413
2057 Ga0209971_1007555
2058 Ga0209974_10006192
2059 Ga0209974_10045407
2060 Ga0207428_10175085
2061 Ga0265354_1000479
2062 Ga0265356_1000429
2063 Ga0268266_10005113
2064 Ga0268266_10007323
2065 Ga0268266_10043227
2066 Ga0268265_10000455
2067 Ga0268265_10543460
2068 Ga0268264_10000004
2069 Ga0265337_1010645
2070 Ga0265337_1021446
2071 Ga0265326_10006844
2072 Ga0265326_10007728
2073 Ga0265326_10013258
2074 Ga0265319_1000117
2075 Ga0265334_10010142
2076 Ga0265318_10000127
2077 Ga0265318_10045528
2078 Ga0265318_10051719
2079 Ga0265318_10074020
2080 Ga0265323_10000442
2081 Ga0265323_10000729
2082 Ga0265323_10001018
2083 Ga0265323_10001673
2084 Ga0265323_10015696
2085 Ga0265323_10023964
2086 Ga0265322_10001727
2087 Ga0265322_10019771
2088 Ga0265322_10026141
2089 Ga0265336_10003605
2090 Ga0265336_10005093
2091 Ga0307517_10113040
2092 Ga0265338_10004158
2093 Ga0265338_10006215
2094 Ga0265338_10006479
2095 Ga0265338_10040825
2096 Ga0265338_10049222
2097 Ga0265338_10083055
2098 Ga0265338_10121263
2099 Ga0265338_10181457
2100 Ga0265338_10263578
2101 Ga0265324_10000026
2102 Ga0265324_10000069
2103 Ga0265324_10000093
2104 Ga0265324_10000411
2105 Ga0265324_10008668
2106 Ga0265324_10010285
2107 Ga0265324_10067460
2108 Ga0268256_1000158
2109 Ga0268256_1000503
2110 Ga0268256_1001972
2111 Ga0268256_1007753
2112 Ga0316183_1015099
2113 Ga0265770_1000818
2114 Ga0265765_1000811
2115 Ga0265760_10000954
2116 Ga0265760_10029106
2117 Ga0265330_10000112
2118 Ga0265330_10005890
2119 Ga0265330_10005891
2120 Ga0265330_10007670
2121 Ga0265330_10010228
2122 Ga0265330_10013565
2123 Ga0265330_10021605
2124 Ga0265330_10024877
2125 Ga0265330_10029355
2126 Ga0265330_10033380
2127 Ga0265330_10035564
2128 Ga0265330_10050703
2129 Ga0265330_10117082
2130 Ga0265332_10000013
2131 Ga0265332_10000052
2132 Ga0265332_10000062
2133 Ga0265332_10000234
2134 Ga0265332_10001836
2135 Ga0265332_10003905
2136 Ga0265332_10010180
2137 Ga0265332_10034307
2138 Ga0265332_10056281
2139 Ga0265332_10070650
2140 Ga0265328_10000076
2141 Ga0265328_10000128
2142 Ga0265328_10000297
2143 Ga0265328_10001141
2144 Ga0265328_10002442
2145 Ga0265328_10005003
2146 Ga0265328_10006581
2147 Ga0265328_10014488
2148 Ga0265328_10022723
2149 Ga0265328_10035767
2150 Ga0265320_10000969
2151 Ga0265320_10002060
2152 Ga0265320_10004794
2153 Ga0265320_10005502
2154 Ga0265320_10073931
2155 Ga0265325_10003074
2156 Ga0265325_10006487
2157 Ga0265325_10008975
2158 Ga0265325_10011735
2159 Ga0265325_10038411
2160 Ga0265325_10053699
2161 Ga0265325_10123463
2162 Ga0265325_10160877
2163 Ga0265329_10000059
2164 Ga0265329_10001427
2165 Ga0265329_10001667
2166 Ga0265329_10001674
2167 Ga0265329_10011734
2168 Ga0265329_10014035
2169 Ga0265329_10014042
2170 Ga0265329_10021672
2171 Ga0265340_10000044
2172 Ga0265340_10000882
2173 Ga0265340_10002279
2174 Ga0265340_10010569
2175 Ga0265340_10012413
2176 Ga0265340_10091168
2177 Ga0265339_10000001
2178 Ga0265339_10000004
2179 Ga0265339_10000018
2180 Ga0265339_10001637
2181 Ga0265339_10003001
2182 Ga0265339_10003717
2183 Ga0265339_10004363
2184 Ga0265339_10036307
2185 Ga0265339_10070381
2186 Ga0265339_10072546
2187 Ga0265339_10085234
2188 Ga0265331_10000036
2189 Ga0265331_10000108
2190 Ga0265331_10000145
2191 Ga0265331_10000591
2192 Ga0265331_10001957
2193 Ga0265331_10002644
2194 Ga0265331_10012348
2195 Ga0265331_10047240
2196 Ga0265331_10063883
2197 Ga0265331_10068261
2198 Ga0265331_10107964
2199 Ga0265331_10113555
2200 Ga0265327_10000008
2201 Ga0265327_10000213
2202 Ga0265327_10000229
2203 Ga0265327_10000503
2204 Ga0265327_10004005
2205 Ga0265327_10004822
2206 Ga0265327_10007133
2207 Ga0265327_10007583
2208 Ga0265327_10019468
2209 Ga0265316_10000011
2210 Ga0265316_10000731
2211 Ga0265316_10000847
2212 Ga0265316_10001116
2213 Ga0265316_10001265
2214 Ga0265316_10002090
2215 Ga0265316_10002305
2216 Ga0265316_10002945
2217 Ga0265316_10003493
2218 Ga0265316_10008374
2219 Ga0265316_10012518
2220 Ga0265316_10013282
2221 Ga0265316_10029280
2222 Ga0265316_10030608
2223 Ga0265316_10044714
2224 Ga0265316_10055363
2225 Ga0265316_10085315
2226 Ga0265316_10150442
2227 Ga0265316_10151517
2228 Ga0265316_10170975
2229 Ga0265316_10208700
2230 Ga0265316_10221885
2231 Ga0265316_10227276
2232 Ga0265316_10229035
2233 Ga0265316_10277884
2234 Ga0265316_10287086
2235 Ga0265316_10338294
2236 Ga0307509_10274381
2237 Ga0307408_100000178
2238 Ga0307408_100011056
2239 Ga0307408_100020260
2240 Ga0265313_10000056
2241 Ga0265313_10001373
2242 Ga0265313_10018959
2243 Ga0265313_10040724
2244 Ga0265313_10058884
2245 Ga0316579_10061196
2246 Ga0265314_10000007
2247 Ga0265314_10000271
2248 Ga0265314_10000933
2249 Ga0265314_10001549
2250 Ga0265314_10002364
2251 Ga0265314_10003597
2252 Ga0265314_10003642
2253 Ga0265314_10005145
2254 Ga0265314_10017132
2255 Ga0265314_10033095
2256 Ga0265314_10035236
2257 Ga0265314_10137277
2258 Ga0265314_10139318
2259 Ga0265342_10000058
2260 Ga0265342_10000472
2261 Ga0265342_10000619
2262 Ga0265342_10000762
2263 Ga0265342_10000924
2264 Ga0265342_10001136
2265 Ga0265342_10001742
2266 Ga0265342_10007313
2267 Ga0265342_10007898
2268 Ga0265342_10012661
2269 Ga0265342_10014722
2270 Ga0265342_10019789
2271 Ga0265342_10021895
2272 Ga0265342_10166351
2273 Ga0316576_10017817
2274 Ga0316576_10028196
2275 Ga0316576_10043506
2276 Ga0316576_10070843
2277 Ga0316576_10265500
2278 Ga0316578_10008951
2279 Ga0316578_10079635
2280 Ga0316578_10102627
2281 Ga0307516_10000202
2282 Ga0307405_10020411
2283 Ga0316577_10076069
2284 Ga0316577_10140008
2285 Ga0307413_10010098
2286 Ga0307406_10013085
2287 Ga0307406_10051967
2288 Ga0307406_10054623
2289 Ga0307407_10026019
2290 Ga0307412_10004978
2291 Ga0307412_10010098
2292 Ga0307412_10011635
2293 Ga0307409_100041096
2294 Ga0307414_10010683
2295 Ga0307414_10056920
2296 Ga0307411_10004175
2297 Ga0316593_10037039
2298 Ga0316593_10067502
2299 Ga0316593_10071261
2300 Ga0316596_1042114
2301 Ga0373926_0007884
2302 Ga0373926_0008882
2303 Ga0373934_0003185
2304 Ga0373934_0016862
2305 Ga0373932_0009979
2306 Ga0373936_0066099
2307 Ga0373945_0106995
2308 Ga0373953_0011245
2309 Ga0373953_0021778
2310 Ga0373954_0014791
2311 Ga0373954_0044561
2312 Ga0373956_0001217
2313 Ga0373957_0042689
2314 Ga0373955_0114834
2315 Ga0373955_0174821
2316 Ga0316574_0004307
2317 Ga0316574_0020761
2318 Ga0316574_0096617
2319 Ga0316574_0241945
2320 Ga0316574_0243127
2321 Ga0373931_0167068
2322 Ga0373935_0133566
2323 Ga0373935_0145989
2324 Ga0373927_0001539
2325 Ga0373927_0002742
2326 Ga0373927_0009722
2327 Ga0373927_0063083
2328 Ga0373927_0118306
2329 Ga0373927_0301155
2330 Ga0373933_0073672
2331 Ga0373933_0095320
2332 Ga0373947_0000740
2333 Ga0373947_0099937
2334 Ga0373937_0007741
2335 Ga0373937_0019221
2336 Ga0373937_0035160
2337 Ga0373937_0227032
2338 Ga0373937_0315761
2339 Ga0373937_0339483
2340 Ga0373937_0576904
2341 Ga0316582_0036189
2342 Ga0316582_0133884
2343 Ga0316582_0205402
2344 Ga0316584_0009600
2345 Ga0316584_0024907
2346 Ga0316584_0114947
2347 Ga0373925_0000099
2348 Ga0373925_0005608
2349 Ga0373925_0015028
2350 Ga0373925_0058578
2351 Ga0373925_0076615
2352 Ga0373925_0169322
2353 Ga0395900_0025210
2354 Ga0395900_0070182
2355 Ga0395905_0003402
2356 Ga0395905_0172075
2357 Ga0436364_0176175
2358 Ga0436364_0366372
2359 Ga0436364_0514524
2360 Ga0436364_0748631
2361 Ga0436364_0807765
2362 Ga0436364_0853204
2363 Ga0436364_1151958
2364 Ga0436364_1386202
2365 Ga0436364_1410728
2366 Ga0436364_1414125
2367 Ga0436364_1489063
2368 Ga0436364_1501586
2369 Ga0400490_10431
2370 Ga0400486_10993
2371 Ga0400483_030371
2372 Ga0400489_59676
2373 Ga0436365_0139104
2374 Ga0436365_0497797
2375 Ga0436365_0721041
2376 Ga0436365_1100189
2377 Ga0436365_1490124
2378 Ga0436360_0328545
2379 Ga0436360_0378330
2380 Ga0436360_1032306
2381 Ga0436360_1333063
2382 Ga0436361_0269507
2383 Ga0436361_0285134
2384 Ga0436361_0567168
2385 Ga0436361_0682766
2386 Ga0436363_1560073
2387 Ga0436362_0084096
2388 Ga0436362_0297328
2389 Ga0439436_0007650
2390 Ga0439438_000002
2391 Ga0439438_000442
2392 Ga0439438_003869
2393 Ga0439438_004424
2394 Ga0439438_012015
2395 Ga0439438_013815
2396 Ga0439447_001496
2397 Ga0439447_002909
2398 Ga0439447_003162
2399 Ga0439447_008240
2400 Ga0439466_0005969
2401 Ga0439466_0006786
2402 Ga0439466_0015267
2403 Ga0439465_0006145
2404 Ga0451855_1019283
2405 Ga0439432_001052
2406 Ga0439432_001239
2407 Ga0439432_002018
2408 Ga0439432_002789
2409 Ga0439432_003342
2410 Ga0439451_001638
2411 Ga0439451_003813
2412 Ga0439452_000003
2413 Ga0439452_009904
2414 Ga0439452_022042
2415 Ga0439456_000271
2416 Ga0439456_008922
2417 Ga0450911_000002
2418 Ga0450911_001193
2419 Ga0450919_000614
2420 Ga0450890_000186
2421 Ga0450902_001984
2422 Ga0450903_001828
2423 Ga0450903_002098
2424 Ga0450905_000029
2425 Ga0450906_000658
2426 Ga0450907_000132
2427 Ga0450907_002076
2428 Ga0439446_0008405
2429 Ga0439446_0017328
2430 Ga0450908_005178
2431 Ga0450909_002104
2432 Ga0439434_0000469
2433 Ga0439464_0002709
2434 Ga0439464_0009344
2435 Ga0439460_0001104
2436 Ga0439460_0005590
2437 Ga0451577_0000035
2438 Ga0451577_0000127
2439 Ga0451577_0000644
2440 Ga0451577_0001119
2441 Ga0451577_0001484
2442 Ga0451577_0003259
2443 Ga0451577_0003915
2444 Ga0451577_0008660
2445 Ga0451577_0013211
2446 Ga0451577_0015851
2447 Ga0451577_0016891
2448 Ga0451577_0026629
2449 Ga0451577_0032932
2450 Ga0451577_0034763
2451 Ga0451577_0055642
2452 Ga0451577_0065739
2453 Ga0451577_0074573
2454 Ga0451577_0081767
2455 Ga0451577_0088449
2456 Ga0451577_0095159
2457 Ga0451577_0103585
2458 Ga0451577_0161923
2459 Ga0451577_0190718
2460 Ga0451577_0392613
2461 Ga0439440_0003112
2462 Ga0439440_0009520
2463 Ga0453683_0000001
2464 Ga0453683_0000009
2465 Ga0453683_0000018
2466 Ga0453683_0000233
2467 Ga0453683_0004304
2468 Ga0453683_0004940
2469 Ga0453683_0006674
2470 Ga0453683_0028839
2471 Ga0453683_0065747
2472 Ga0453683_0074008
2473 Ga0453683_0171101
2474 Ga0453683_0254441
2475 Ga0453684_0000048
2476 Ga0453684_0000097
2477 Ga0453684_0000115
2478 Ga0453684_0000221
2479 Ga0453684_0000242
2480 Ga0453684_0000499
2481 Ga0453684_0000539
2482 Ga0453684_0000555
2483 Ga0453684_0000941
2484 Ga0453684_0001135
2485 Ga0453684_0001752
2486 Ga0453684_0002408
2487 Ga0453684_0002894
2488 Ga0453684_0003084
2489 Ga0453684_0004632
2490 Ga0453684_0005926
2491 Ga0453684_0007878
2492 Ga0453684_0007938
2493 Ga0453684_0013644
2494 Ga0453684_0016279
2495 Ga0453684_0019676
2496 Ga0453684_0021899
2497 Ga0453684_0030419
2498 Ga0453684_0046636
2499 Ga0453684_0048265
2500 Ga0453684_0055436
2501 Ga0453684_0057574
2502 Ga0453684_0069986
2503 Ga0453684_0070696
2504 Ga0453684_0087668
2505 Ga0453684_0097761
2506 Ga0453684_0112724
2507 Ga0453684_0134239
2508 Ga0453684_0142404
2509 Ga0453684_0152488
2510 Ga0453684_0162295
2511 Ga0453684_0167310
2512 Ga0453684_0209441
2513 Ga0453684_0352507
2514 Ga0453684_0485017
2515 Ga0453684_0504267
2516 Ga0451576_0000488
2517 Ga0451576_0000897
2518 Ga0451576_0001625
2519 Ga0451576_0002883
2520 Ga0451576_0003235
2521 Ga0451576_0007599
2522 Ga0451576_0010023
2523 Ga0451576_0017004
2524 Ga0451576_0018382
2525 Ga0451576_0029987
2526 Ga0451576_0059407
2527 Ga0451576_0083463
2528 Ga0451576_0084574
2529 Ga0451576_0091231
2530 Ga0451576_0131379
2531 Ga0451576_0145838
2532 Ga0451576_0148525
2533 Ga0451576_0217205
2534 Ga0451576_0249655
2535 Ga0451576_0396624
2536 Ga0451576_0400895
2537 Ga0451576_0431901
2538 Ga0451576_0441847
2539 Ga0451576_0741327
2540 Ga0495617_000327
2541 Ga0495627_000044
2542 Ga0495627_000143
2543 Ga0495627_001530
2544 Ga0495627_005662
2545 Ga0495627_005817
2546 Ga0495592_0014490
2547 Ga0495603_0019488
2548 Ga0495590_0003015
2549 Ga0495590_0026310
2550 Ga0495590_0026839
2551 Ga0495591_000023
2552 Ga0495591_003647
2553 Ga0495591_004045
2554 Ga0495591_004793
2555 Ga0495591_005488
2556 Ga0495591_006035
2557 Ga0495591_009042
2558 Ga0495591_010786
2559 Ga0495638_0032805
2560 Ga0495651_0007664
2561 Ga0495651_0053021
2562 Ga0495653_0061150
2563 Ga0495653_0111964
2564 Ga0495650_0000065
2565 Ga0495650_0000620
2566 Ga0495650_0006361
2567 Ga0495650_0009633
2568 Ga0495580_0011408
2569 Ga0495580_0017429
2570 Ga0495580_0037314
2571 Ga0495580_0108737
2572 Ga0495605_0000048
2573 Ga0495605_0000094
2574 Ga0495605_0000330
2575 Ga0495605_0000486
2576 Ga0495605_0001320
2577 Ga0495605_0005925
2578 Ga0495605_0006308
2579 Ga0495605_0042442
2580 Ga0495605_0108899
2581 Ga0495639_0000714
2582 Ga0495664_0003394
2583 Ga0495664_0224992
2584 Ga0495584_0001356
2585 Ga0495584_0004349
2586 Ga0495584_0004438
2587 Ga0495584_0020003
2588 Ga0495585_0005478
2589 Ga0495585_0022896
2590 Ga0495594_0003631
2591 Ga0495594_0188393
2592 Ga0495596_0012119
2593 Ga0495607_0000349
2594 Ga0495607_0000396
2595 Ga0495607_0001009
2596 Ga0495607_0001535
2597 Ga0495607_0003645
2598 Ga0495607_0005366
2599 Ga0495607_0006278
2600 Ga0495607_0021862
2601 Ga0495607_0047000
2602 Ga0495607_0059081
2603 Ga0495607_0102701
2604 Ga0495583_0000096
2605 Ga0495583_0001432
2606 Ga0495583_0006317
2607 Ga0495583_0010134
2608 Ga0495583_0010743
2609 Ga0495583_0017557
2610 Ga0495583_0050576
2611 Ga0495606_0001112
2612 Ga0495606_0002582
2613 Ga0495606_0004094
2614 Ga0495606_0008803
2615 Ga0495606_0015513
2616 Ga0495606_0016101
2617 Ga0495608_0053847
2618 Ga0495610_0000021
2619 Ga0495610_0012081
2620 Ga0495610_0034270
2621 Ga0495616_0004161
2622 Ga0495616_0025122
2623 Ga0495616_0059646
2624 Ga0495620_0000001
2625 Ga0495620_0000002
2626 Ga0495620_0000757
2627 Ga0495620_0001337
2628 Ga0495620_0004859
2629 Ga0495628_0012932
2630 Ga0495628_0180534
2631 Ga0495630_0001621
2632 Ga0495630_0024426
2633 Ga0495631_0001469
2634 Ga0495631_0014162
2635 Ga0495631_0014537
2636 Ga0495631_0032838
2637 Ga0495632_0002507
2638 Ga0495632_0004158
2639 Ga0495632_0004287
2640 Ga0495632_0023780
2641 Ga0495632_0024047
2642 Ga0495637_0000630
2643 Ga0495637_0001225
2644 Ga0495637_0001699
2645 Ga0495637_0005266
2646 Ga0495637_0018833
2647 Ga0495643_0000303
2648 Ga0495643_0000560
2649 Ga0495643_0001685
2650 Ga0495643_0002672
2651 Ga0495643_0013070
2652 Ga0495643_0015736
2653 Ga0495643_0018964
2654 Ga0495644_0003708
2655 Ga0495644_0006504
2656 Ga0495648_0000521
2657 Ga0495648_0001868
2658 Ga0495648_0008904
2659 Ga0495648_0009937
2660 Ga0495648_0020975
2661 Ga0495648_0024807
2662 Ga0495648_0025968
2663 Ga0495648_0037701
2664 Ga0495648_0093676
2665 Ga0495666_0003007
2666 Ga0495642_0001462
2667 Ga0495642_0003590
2668 Ga0495642_0003766
2669 Ga0495652_0008745
2670 Ga0495652_0056581
2671 Ga0495652_0351409
2672 Ga0495654_0000096
2673 Ga0495654_0000102
2674 Ga0495654_0000588
2675 Ga0495654_0005166
2676 Ga0495654_0007690
2677 Ga0495654_0010751
2678 Ga0495654_0013991
2679 Ga0495654_0104304
2680 Ga0495665_0021153
2681 Ga0495640_0110106
2682 Ga0495587_0001493
2683 Ga0495587_0004848
2684 Ga0495609_0000012
2685 Ga0495609_0000079
2686 Ga0495609_0001254
2687 Ga0495609_0003270
2688 Ga0495609_0005619
2689 Ga0495609_0009678
2690 Ga0495609_0057899
2691 Ga0495597_0000016
2692 Ga0495597_0021120
2693 Ga0495645_0037723
2694 Ga0495645_0131099
2695 Ga0495645_0167920
2696 Ga0495622_0000809
2697 Ga0495622_0001364
2698 Ga0495622_0029990
2699 Ga0495633_0000034
2700 Ga0495633_0031235
2701 Ga0495667_0060055
2702 Ga0495667_0118620
2703 Ga0495667_0194558
2704 Ga0495656_0001632
2705 Ga0495668_0065953
2706 Ga0495634_0000967
2707 Ga0495611_0000656
2708 Ga0495611_0016202
2709 Ga0495611_0036628
2710 Ga0495625_0000076
2711 Ga0495625_0047649
2712 Ga0495635_0000752
2713 Ga0495635_0089474
2714 Ga0495659_0001347
2715 Ga0495659_0017477
2716 Ga0495661_0000004
2717 Ga0495661_0000099
2718 Ga0495661_0000146
2719 Ga0495661_0000773
2720 Ga0495661_0025579
2721 Ga0495661_0030918
2722 Ga0495661_0042222
2723 Ga0495661_0110881
2724 Ga0495588_0004580
2725 Ga0495599_0002296
2726 Ga0495599_0015207
2727 Ga0495623_0001889
2728 Ga0495623_0006999
2729 Ga0495646_0011937
2730 Ga0495646_0037210
2731 Ga0495669_0016103
2732 Ga0495670_0002495
2733 Ga0495670_0023981
2734 Ga0495670_0034984
2735 Ga0495671_0000024
2736 Ga0495671_0000908
2737 Ga0495671_0002113
2738 Ga0495671_0002880
2739 Ga0495671_0003585
2740 Ga0495671_0004322
2741 Ga0495671_0010611
2742 Ga0495671_0018765
2743 Ga0495649_0001633
2744 Ga0495649_0003386
2745 Ga0495649_0003919
2746 Ga0495649_0008042
2747 Ga0495649_0010145
2748 Ga0495649_0049172
2749 Ga0495589_0000003
2750 Ga0495589_0000194
2751 Ga0495589_0008684
2752 Ga0495589_0024274
2753 Ga0495589_0089809
2754 Ga0495600_0046810
2755 Ga0495660_0000017
2756 Ga0495660_0000824
2757 Ga0495660_0012602
2758 Ga0495660_0020560
2759 Ga0495660_0022401
2760 Ga0495660_0023907
2761 Ga0495604_0069019
2762 Ga0495604_0081857
2763 Ga0495604_0163470
2764 Ga0495636_0000764
2765 Ga0495674_0005437
2766 Ga0495674_0007240
2767 Ga0495674_0044383
2768 Ga0495672_0000001
2769 Ga0495672_0004429
2770 Ga0495672_0005100
2771 Ga0495672_0008463
2772 Ga0495672_0077988
2773 Ga0495676_0000016
2774 Ga0495680_0018000
2775 Ga0495680_0038892
2776 Ga0495680_0130297
2777 Ga0495683_0000034
2778 Ga0495683_0015091
2779 Ga0495683_0036322
2780 Ga0495683_0125868
2781 Ga0495687_006222
2782 Ga0495675_0033821
2783 Ga0495675_0068006
2784 Ga0495675_0273848
2785 Ga0495677_0003900
2786 Ga0495679_000087
2787 Ga0495679_000377
2788 Ga0495679_012040
2789 Ga0495673_0000019
2790 Ga0495673_0001933
2791 Ga0495673_0002323
2792 Ga0495673_0009651
2793 Ga0495673_0015126
2794 Ga0495673_0015438
2795 Ga0495673_0027991
2796 Ga0495673_0043729
2797 Ga0495673_0097623
2798 Ga0495681_0016581
2799 Ga0495684_0000398
2800 Ga0495684_0040686
2801 Ga0495684_0195055
2802 Ga0495686_0016655
2803 Ga0495686_0075906
2804 Ga0495593_0045035
2805 Ga0495602_0015186
2806 Ga0495602_0186702
2807 Ga0495602_0194688
2808 Ga0495615_0002290
2809 Ga0495626_0000098
2810 Ga0495626_0004696
2811 Ga0495626_0006801
2812 Ga0495626_0033602
2813 Ga0495626_0038730
2814 Ga0496102_0000991
2815 Ga0496102_0034926
2816 Ga0496103_0000997
2817 Ga0496103_0048117
2818 Ga0496104_0000260
2819 Ga0496104_0148724
2820 Ga0496104_0404671
2821 Ga0496105_0000156
2822 Ga0496105_0163634
2823 Ga0496110_0009694
2824 Ga0496110_0048656
2825 Ga0496110_0056893
2826 Ga0496110_0136059
2827 Ga0496111_0126132
2828 Ga0496112_0006585
2829 Ga0496113_0173044
2830 Ga0496114_0003707
2831 Ga0496114_0061464
2832 Ga0496115_0007686
2833 Ga0496115_0024949
2834 Ga0496115_0287935
2835 Ga0496116_0000007
2836 Ga0496116_0010359
2837 Ga0496116_0045906
2838 Ga0496117_0001323
2839 Ga0496117_0001620
2840 Ga0496117_0002783
2841 Ga0496117_0003088
2842 Ga0496117_0006308
2843 Ga0496117_0012255
2844 Ga0496117_0018402
2845 Ga0496118_0002712
2846 Ga0496118_0002985
2847 Ga0496118_0006537
2848 Ga0496118_0036587
2849 Ga0496118_0052475
2850 Ga0496119_0000612
2851 Ga0496120_0001054
2852 Ga0496120_0008485
2853 Ga0496121_0007202
2854 Ga0496121_0030502
2855 Ga0496121_0034409
2856 Ga0496121_0094533
2857 Ga0496122_0001943
2858 Ga0496122_0002404
2859 Ga0496122_0007083
2860 Ga0496122_0019738
2861 Ga0496122_0022598
2862 Ga0496123_0000439
2863 Ga0496123_0001575
2864 Ga0496123_0014417
2865 Ga0496123_0026678
2866 Ga0496123_0054519
2867 Ga0496123_0058743
2868 Ga0496124_0000132
2869 Ga0496124_0001693
2870 Ga0496124_0002023
2871 Ga0496124_0006195
2872 Ga0496124_0006210
2873 Ga0496124_0015103
2874 Ga0496124_0038452
2875 Ga0496124_0045902
2876 Ga0496124_0059474
2877 Ga0496124_0060348
2878 Ga0496124_0173557
2879 Ga0496125_0000380
2880 Ga0496125_0001691
2881 Ga0496125_0004712
2882 Ga0496125_0024615
2883 Ga0496125_0038928
2884 Ga0496125_0099344
2885 Ga0496126_0000101
2886 Ga0496126_0097180
2887 Ga0496126_0154973
2888 Ga0496126_0339330
2889 Ga0496126_0388229
2890 Ga0495678_000049
2891 Ga0495678_000579
2892 Ga0495678_002688
2893 Ga0495678_006374
2894 Ga0495678_008976
2895 Ga0495678_039896
2896 Ga0495678_080824
2897 Ga0495682_0000011
2898 Ga0495682_0000128
2899 Ga0495682_0001668
2900 Ga0495682_0017012
2901 Ga0495682_0019899
2902 Ga0501031_0011752
2903 Ga0501031_0030930
2904 Ga0501032_0001038
2905 Ga0501032_0001256
2906 Ga0501032_0006131
2907 Ga0501032_0009678
2908 Ga0501033_0003841
2909 Ga0501033_0007400
2910 Ga0501033_0009063
2911 Ga0501033_0016351
2912 Ga0501034_0000041
2913 Ga0501034_0002365
2914 Ga0501034_0008207
2915 Ga0501034_0020051
2916 Ga0501034_0030857
2917 Ga0501034_0127735
2918 Ga0501034_0324523
2919 Ga0501036_0000583
2920 Ga0501036_0000764
2921 Ga0501037_0002333
2922 Ga0501037_0014890
2923 Ga0501037_0040016
2924 Ga0501037_0124890
2925 Ga0501037_0134521
2926 Ga0501038_0003064
2927 Ga0501038_0007027
2928 Ga0501038_0007681
2929 Ga0501038_0020808
2930 Ga0501038_0157567
2931 Ga0501039_0004609
2932 Ga0501039_0011648
2933 Ga0501039_0171108
2934 Ga0501040_0009107
2935 Ga0501040_0106982
2936 Ga0501042_0003284
2937 Ga0501042_0142376
2938 Ga0501043_0004581
2939 Ga0501043_0005319
2940 Ga0501043_0006282
2941 Ga0501043_0035508
2942 Ga0501043_0139463
2943 Ga0501046_0000889
2944 Ga0501046_0001127
2945 Ga0501046_0050465
2946 Ga0501047_0002434
2947 Ga0501048_0005502
2948 Ga0501048_0031545
2949 Ga0501067_0012770
2950 Ga0501068_0011869
2951 Ga0501068_0129193
2952 Ga0501069_0000937
2953 Ga0501070_0030461
2954 Ga0501072_0011524
2955 Ga0501073_0026765
2956 Ga0501076_0205757
2957 Ga0501077_0004163
2958 Ga0501079_0028748
2959 Ga0501080_0145730
2960 Ga0501081_0181438
2961 Ga0501083_0002458
2962 Ga0501083_0007866
2963 Ga0501035_0000158
2964 Ga0501035_0003883
2965 Ga0501035_0006972
2966 Ga0501035_0191013
2967 Ga0501044_0000190
2968 Ga0501044_0015234
2969 Ga0501044_0028814
2970 Ga0501044_0084786
2971 Ga0501044_0126007
2972 Ga0501044_0164704
2973 Ga0501044_0253119
2974 Ga0501045_0001759
2975 Ga0501226_000007
2976 nmdc:mga05p37_2980_c1
2977 nmdc:mga06r32_274823_c1
2978 nmdc:mga08y16_181967_c1
2979 nmdc:mga08y16_6325_c1
2980 nmdc:mga08y16_95630_c1
2981 nmdc:mga08x19_624_c1
2982 Ga0495601_0021931
2983 Ga0495601_0248421
2984 Ga0495612_0024226
2985 Ga0500595_007403
2986 Ga0500618_005360
2987 Ga0500621_000005
2988 Ga0500659_0035137
2989 Ga0500564_013234
2990 Ga0500568_0005172
2991 Ga0500604_0053869
2992 Ga0500616_0035421
2993 Ga0501084_0001126
2994 Ga0501084_0019920
2995 Ga0590071_005287
2996 Ga0501082_0005501
2997 640488419
2998 2506579725
2999 2506584864
3000 2508853525
3001 2510285074
3002 2511254484
3003 2511269701
3004 2511298767
3005 2511329179
3006 2511341334
3007 2511347513
3008 2511360643
3009 2511374796
3010 2528203243
3011 2528214404
3012 2538426471
3013 2546947887
3014 2547373094
3015 2548846078
3016 2552746416
3017 2555246088
3018 2566034961
3019 2579749772
3020 2579858337
3021 2597862830
3022 2597868631
3023 2599328570
3024 2599396608
3025 2599453332
3026 2599503933
3027 2599507589
3028 2599514664
3029 2599517405
3030 2599772729
3031 2599889226
3032 2599894071
3033 2599896547
3034 2599926649
3035 2599931901
3036 2599945551
3037 2599956669
3038 2599962622
3039 2599965242
3040 2599973907
3041 2599978788
3042 2599985409
3043 2599991840
3044 2599996561
3045 2600002363
3046 2600006884
3047 2600010474
3048 2600021397
3049 2600026382
3050 2600032463
3051 2600036318
3052 2600043615
3053 2600049896
3054 2600053523
3055 2600061461
3056 2600067385
3057 2600070392
3058 2600080220
3059 2600362025
3060 2601626537
3061 2601691366
3062 2624493752
3063 2626635872
3064 2644187584
3065 2644283634
3066 2644625113
3067 2649121677
3068 2652547489
3069 2652975972
3070 2656276837
3071 2671090423
3072 2671130395
3073 2677896682
3074 2678229663
3075 2678262380
3076 2686356135
3077 2686541628
3078 2687238447
3079 2687239187
3080 2688393533
3081 2688394040
3082 2689446254
3083 2707100223
3084 2710604992
3085 2723247659
3086 2729147406
3087 2738691410
3088 2739267185
3089 2739290022
3090 2739295334
3091 2745008726
3092 2745162055
3093 2765582576
3094 2772440165
3095 2774121349
3096 2774135982
3097 2774391356
3098 2774436090
3099 2774864360
3100 2784259992
3101 2784317308
3102 2794596176
3103 2807409656
3104 2807457957
3105 2808858227
3106 2808904563
3107 2808924150
3108 2808938384
3109 2808941811
3110 2808946091
3111 2808957514
3112 2808966712
3113 2809001542
3114 2809125354
3115 2812367911
3116 2813727714
3117 2819654504
3118 2825653259
3119 2826584468
3120 2842810088
3121 2842818035
3122 2842840061
3123 2842849342
3124 2842858989
3125 2843691833
3126 2846041089
3127 2846542270
3128 2852107147
3129 2852658718
3130 2854605894
3131 2855196988
3132 2858467416
3133 2860340223
3134 2869555603
3135 2871273881
3136 2871283649
3137 2880232108
3138 2887631791
3139 2888370254
3140 2888377233
3141 2900054533
3142 2904522362
3143 2912965141
3144 2913038352
3145 2916182991
3146 2916702311
3147 2919160059
3148 2919185239
3149 2919481620
3150 2919496615
3151 2919500817
3152 2919509235
3153 2919547101
3154 2919700339
3155 2923521962
3156 2923529294
3157 2923587523
3158 2929145797
3159 2931370863
3160 2931392496
3161 2931399874
3162 2932410748
3163 2937968796
3164 2939582212
3165 2939653501
3166 2945929108
3167 2945961817
3168 2946011338
3169 2984569470
3170 2988733332
3171 3007256756
3172 3007319005
3173 3007421130
3174 3007512825
3175 3007806354
3176 3007867986
3177 3007876025
3178 637879757
3179 640939000
3180 651176454
3181 8002317854
3182 8002746318
3183 8004596328
3184 8015397568
3185 8019776994
3186 8052498645
3187 8054351917
3188 8054914687
3189 8054933913
3190 8055695288
3191 8055819527
3192 8055880244
3193 8056119958
3194 8056122118
3195 8056141600
3196 8056147478
3197 8056159314
3198 8056164810

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

47

340

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c35-assembly1.cif.gz_A-2 crystal structure of m96a mutant of o-acetyl-l-serine sulfhydrylase from haemophilus influenzae 0.984 4 312
7cm8-assembly1.cif.gz_A-2 high resolution crystal structure of m92a mutant of o-acetyl-l-serine sulfhydrylase from haemophilus influenzae 0.9828 4 312
4ore-assembly1.cif.gz_X-2 error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9812 4 312
5j43-assembly1.cif.gz_A cdia-ct from uropathogenic escherichia coli in complex with cysk 0.98 2 314
7yof-assembly1.cif.gz_A-2 crystal structure of triple mutant (d67e, a68p, i88l) of o-acetyl-l-serine sulfhydrylase from haemophilus influenzae at 2.3 a 0.98 4 312
ID Description Score Start End Superfamily
1d6sB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9807 2 314 3.40.50.1100
af_I1L6I6_202_359_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9723 150 314 3.40.50.1100
1d6sB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9706 2 314 3.40.50.1100
5xa2A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9698 4 316 3.40.50.1100
3vbeA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9687 159 314 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A7C6E4F2-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9993 139 316 GO:0006534
GO:0009069
GO:0044272
AF-V6AE82-F1-model_v4 deleted 0.9977 1 323
AF-A0A7S1NQW6-F1-model_v4 Tryptophan synthase beta chain-like PALP domain-containing protein 0.9977 91 265 GO:0019344
AF-A4VMC6-F1-model_v4 Cysteine synthase (EC 2.5.1.47) 0.9968 1 323 GO:0004124
GO:0006535
AF-A0A836NXP8-F1-model_v4 deleted 0.9966 1 286

Map