F495002
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1602 | 660 | 3198 | 314 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|640427133|640488419 |
| Length | 362 |
| Sequence | DVRGYARWTPAGRHEFGWTVVRTAHRLNGLILLGQGLPMSRIYADNARSIGNTPLVMINRLGPKGVSIMAKIEGRNPAYSVKCRIGAGMIWDAEDSGRIKPGMTLVEPTSGNTGIGLAFVAAARGYKLMLTMPASMSLERRKVLKALGAELVLTEPAKGMKGAIEKAAEIAASNPEQYYMPQQFENPSNPAIHEKTTGPEIWNDTDGGIDVLVAGVGTGGTITGVSRYIKNTKGKQILSVAVEPASSPVISQTLAGEEVKPSPHKIQGIGAGFVPKNLDLSMVDRVELVDDNEAKQMALRLMREEGILCGISCGAAMAAAVRLAERPEMQGKNIVVILPDSGERYLSSMLFSDMFSEQELVQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 15 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 18 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 73 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 74 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 110 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 116 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 117 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 118 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 119 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 120 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 133 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 186 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 187 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 194 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 195 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 201 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 202 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 204 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 205 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 206 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 208 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 212 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 218 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 219 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 220 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 222 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 225 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 226 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 227 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 228 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 230 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 232 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 233 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 234 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 235 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 236 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 237 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 238 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 239 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 240 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 241 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 242 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 243 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 244 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 247 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 250 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 251 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 252 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 253 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 255 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 256 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 257 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 258 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 259 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 260 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 261 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 262 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 264 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 265 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 267 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 268 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 269 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 270 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 271 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 272 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 273 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 274 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 275 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 276 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 277 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 278 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 279 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 280 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 281 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 282 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 283 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 284 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 285 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 286 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 287 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 288 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 289 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 290 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 291 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 292 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 293 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 294 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 295 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 296 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 297 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 298 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 299 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 300 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 301 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 302 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 303 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 304 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 305 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 306 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 307 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 392 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 393 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 394 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 395 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 396 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 397 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 398 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 399 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 400 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 401 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 402 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 403 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 404 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 405 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 406 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 407 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 408 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 409 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 410 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 411 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 412 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 444 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 451 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 452 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 453 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 454 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 455 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 456 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 457 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 458 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 460 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 461 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 462 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 463 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 464 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 465 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 466 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 467 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 468 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 469 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 470 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 471 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 472 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 473 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 474 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 475 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 476 | 2537561728 | Pectobacterium wasabiae CFBP 3304 | Isolate | Rhizoplane |
| 477 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 478 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 479 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 480 | 2551306352 | Acinetobacter sp. GG2 | Isolate | Rhizosphere |
| 481 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 482 | 2565956521 | Vibrio rhizosphaerae DSM 18581 | Isolate | Rhizosphere |
| 483 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 484 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 485 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 486 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 487 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 488 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 489 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 490 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 491 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 492 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 493 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 494 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 495 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 496 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 497 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 498 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 499 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 500 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 501 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 502 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 503 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 504 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 505 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 506 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 507 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 508 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 509 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 510 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 511 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 512 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 513 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 514 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 515 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 516 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 517 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 518 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 519 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 520 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 521 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 522 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 523 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 524 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 525 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 526 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 527 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 528 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 529 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 530 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 531 | 2648501241 | Vibrio splendidus UCD-SED7 | Isolate | Rhizosphere |
| 532 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 533 | 2651869818 | Vibrio splendidus UCD-SED10 | Isolate | Rhizosphere |
| 534 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 535 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 536 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 537 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 538 | 2675903507 | Acinetobacter calcoaceticus GK2 | Isolate | Unclassified |
| 539 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 540 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 541 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 542 | 2684623219 | Planctomyces sp. SH-PL14 | Isolate | Unclassified |
| 543 | 2687453341 | Pirellula sp. SH-Sr6A | Isolate | Unclassified |
| 544 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 545 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 546 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 547 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 548 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 549 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 550 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 551 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 552 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 553 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 554 | 2744054655 | Acinetobacter sp. BMW17 | Isolate | Unclassified |
| 555 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 556 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 557 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 558 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 559 | 2773857761 | Acinetobacter sp. 3664 | Isolate | Unclassified |
| 560 | 2773857770 | Acinetobacter sp. 3636 | Isolate | Unclassified |
| 561 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 562 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 563 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 564 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 565 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 566 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 567 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 568 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 569 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 570 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 571 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 572 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 573 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 574 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 575 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 576 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 577 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 578 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 579 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 580 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 581 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 582 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 583 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 584 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 585 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 586 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 587 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 588 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 589 | 2846540461 | Photorhabdus luminescens HIM3 | Isolate | Rhizosphere |
| 590 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 591 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 592 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 593 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 594 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 595 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 596 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 597 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 598 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 599 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 600 | 2887630918 | Psychrosphaera haliotis UCD-MCMsp1aY | Isolate | Unclassified |
| 601 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 602 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 603 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 604 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 605 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 606 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 607 | 2916178963 | Pseudoalteromonas rhizosphaerae RA15 | Isolate | Rhizosphere |
| 608 | 2916699645 | Acinetobacter ursingii M3 | Isolate | Unclassified |
| 609 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 610 | 2919182534 | Acinetobacter calcoaceticus 2589 | Isolate | Rhizosphere |
| 611 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 612 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 613 | 2919497567 | Shewanella putrefaciens 3469 | Isolate | Unclassified |
| 614 | 2919506607 | Acinetobacter sp. 3657 | Isolate | Unclassified |
| 615 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 616 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 617 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 618 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 619 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 620 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 621 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 622 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 623 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 624 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 625 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 626 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 627 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 628 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 629 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 630 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 631 | 2984568884 | Acinetobacter baylyi SORGH_AS893 | Isolate | Aerial Root |
| 632 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 633 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 634 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 635 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 636 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 637 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 638 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 639 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 640 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 641 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 642 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 643 | 8002317523 | Cohnella sp. GbtcB17 | Isolate | Unclassified |
| 644 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 645 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 646 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 647 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 648 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 649 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 650 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 651 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 652 | 8055693939 | Hafnia alvei A23BA | Isolate | Rhizosphere |
| 653 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 654 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 655 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 656 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 657 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 658 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 659 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 660 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.08 |
| Metatranscriptomes | 1.31 |
| Isolates | 12.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.06 |
| Bulb | 0 |
| Endosphere | 2.25 |
| Nodule | 1.69 |
| Rhizoplane | 4.06 |
| Rhizosphere | 81.77 |
| Stem | 0 |
| Stem Tuber | 0.37 |
| Unclassified | 0.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_6404 | 2124908027 | Bacteria | 7500 |
| 2 | MRS2a_Contig_914 | 2124908027 | Bacteria | 8140 |
| 3 | SwRhRL2b_contig_2277002 | 2162886007 | Bacteria | 2239 |
| 4 | JGI25162J39368_1000100 | 3300002737 | Bacteria | 94568 |
| 5 | JGI25163J39215_1000894 | 3300002771 | Bacteria | 6912 |
| 6 | JGI25164J39214_1000079 | 3300002772 | Bacteria | 94568 |
| 7 | JGI25165J46597_1000183 | 3300003214 | Bacteria | 94568 |
| 8 | Ga0055538_1000078 | 3300003751 | Bacteria | 86114 |
| 9 | Ga0055539_1000119 | 3300003752 | Bacteria | 86114 |
| 10 | Ga0055533_1000127 | 3300003756 | Bacteria | 86114 |
| 11 | Ga0055532_1000068 | 3300003758 | Bacteria | 138828 |
| 12 | Ga0055525_1000163 | 3300003759 | Bacteria | 86114 |
| 13 | Ga0055536_1016854 | 3300003781 | Bacteria | 2420 |
| 14 | Ga0055541_1000079 | 3300003841 | Bacteria | 86114 |
| 15 | Ga0058692_1000067 | 3300003856 | Bacteria | 88996 |
| 16 | Ga0058692_1000911 | 3300003856 | Bacteria | 11646 |
| 17 | Ga0058692_1017134 | 3300003856 | Bacteria | 1595 |
| 18 | Ga0065714_10001613 | 3300005288 | Bacteria | 5331 |
| 19 | Ga0065714_10067998 | 3300005288 | Bacteria | 5045 |
| 20 | Ga0065704_10003637 | 3300005289 | Bacteria | 4069 |
| 21 | Ga0065704_10006591 | 3300005289 | Bacteria | 4786 |
| 22 | Ga0065712_10002299 | 3300005290 | Bacteria | 6611 |
| 23 | Ga0065715_10005136 | 3300005293 | Bacteria | 3683 |
| 24 | Ga0070658_10077856 | 3300005327 | Bacteria | 2720 |
| 25 | Ga0070683_100022822 | 3300005329 | Bacteria | 5597 |
| 26 | Ga0070683_100025908 | 3300005329 | Bacteria | 5274 |
| 27 | Ga0070683_100043891 | 3300005329 | Bacteria | 4121 |
| 28 | Ga0070683_100063164 | 3300005329 | Bacteria | 3444 |
| 29 | Ga0070683_100065855 | 3300005329 | Bacteria | 3374 |
| 30 | Ga0070683_100100147 | 3300005329 | Unclassified | 2728 |
| 31 | Ga0070683_100128431 | 3300005329 | Bacteria | 2397 |
| 32 | Ga0070683_100318770 | 3300005329 | Bacteria | 1479 |
| 33 | Ga0070690_100190414 | 3300005330 | Bacteria | 1422 |
| 34 | Ga0070670_100000018 | 3300005331 | Bacteria | 221691 |
| 35 | Ga0070670_100135408 | 3300005331 | Bacteria | 2129 |
| 36 | Ga0068869_100135873 | 3300005334 | Bacteria | 1894 |
| 37 | Ga0070682_100039334 | 3300005337 | Bacteria | 2906 |
| 38 | Ga0068868_100031941 | 3300005338 | Bacteria | 4047 |
| 39 | Ga0070660_100017653 | 3300005339 | Bacteria | 5203 |
| 40 | Ga0070691_10001552 | 3300005341 | Bacteria | 9903 |
| 41 | Ga0070691_10012197 | 3300005341 | Bacteria | 3936 |
| 42 | Ga0070661_100192544 | 3300005344 | Bacteria | 1556 |
| 43 | Ga0070668_100375171 | 3300005347 | Bacteria | 1209 |
| 44 | Ga0070669_100000954 | 3300005353 | Bacteria | 21107 |
| 45 | Ga0070675_100092910 | 3300005354 | Bacteria | 2530 |
| 46 | Ga0070671_100000084 | 3300005355 | Bacteria | 59737 |
| 47 | Ga0070671_100249178 | 3300005355 | Bacteria | 1509 |
| 48 | Ga0070688_100000916 | 3300005365 | Bacteria | 14728 |
| 49 | Ga0070659_100012188 | 3300005366 | Bacteria | 6372 |
| 50 | Ga0070667_100000002 | 3300005367 | Bacteria | 504831 |
| 51 | Ga0070714_100038188 | 3300005435 | Bacteria | 4038 |
| 52 | Ga0070714_100042300 | 3300005435 | Bacteria | 3849 |
| 53 | Ga0070714_100047786 | 3300005435 | Bacteria | 3637 |
| 54 | Ga0070714_100096603 | 3300005435 | Bacteria | 2596 |
| 55 | Ga0070714_100222041 | 3300005435 | Bacteria | 1737 |
| 56 | Ga0070713_100013534 | 3300005436 | Bacteria | 6029 |
| 57 | Ga0070713_100017674 | 3300005436 | Bacteria | 5402 |
| 58 | Ga0070713_100049646 | 3300005436 | Bacteria | 3462 |
| 59 | Ga0070713_100436349 | 3300005436 | Bacteria | 1228 |
| 60 | Ga0070710_10103815 | 3300005437 | Bacteria | 1697 |
| 61 | Ga0070711_100016406 | 3300005439 | Bacteria | 4704 |
| 62 | Ga0070711_100079683 | 3300005439 | Bacteria | 2330 |
| 63 | Ga0070708_100168989 | 3300005445 | Bacteria | 2041 |
| 64 | Ga0070708_100182915 | 3300005445 | Bacteria | 1959 |
| 65 | Ga0070663_100328580 | 3300005455 | Bacteria | 1232 |
| 66 | Ga0070678_100259453 | 3300005456 | Bacteria | 1461 |
| 67 | Ga0070662_100326916 | 3300005457 | Bacteria | 1252 |
| 68 | Ga0070681_10013442 | 3300005458 | Bacteria | 8134 |
| 69 | Ga0070681_10031212 | 3300005458 | Bacteria | 5347 |
| 70 | Ga0070681_10107898 | 3300005458 | Bacteria | 2725 |
| 71 | Ga0070681_10146899 | 3300005458 | Bacteria | 2286 |
| 72 | Ga0070685_10000009 | 3300005466 | Bacteria | 166260 |
| 73 | Ga0070706_100001466 | 3300005467 | Bacteria | 24814 |
| 74 | Ga0070706_100325542 | 3300005467 | Bacteria | 1433 |
| 75 | Ga0070707_100005111 | 3300005468 | Bacteria | 12300 |
| 76 | Ga0070707_100061755 | 3300005468 | Bacteria | 3594 |
| 77 | Ga0070699_100184904 | 3300005518 | Bacteria | 1850 |
| 78 | Ga0070699_100191326 | 3300005518 | Bacteria | 1818 |
| 79 | Ga0070679_100003415 | 3300005530 | Bacteria | 14542 |
| 80 | Ga0070679_100070265 | 3300005530 | Bacteria | 3493 |
| 81 | Ga0070679_100198544 | 3300005530 | Bacteria | 1973 |
| 82 | Ga0070679_100255785 | 3300005530 | Bacteria | 1707 |
| 83 | Ga0070684_100002254 | 3300005535 | Bacteria | 14182 |
| 84 | Ga0070684_100060988 | 3300005535 | Bacteria | 3300 |
| 85 | Ga0070684_100079773 | 3300005535 | Bacteria | 2894 |
| 86 | Ga0070684_100128047 | 3300005535 | Bacteria | 2289 |
| 87 | Ga0070684_100208463 | 3300005535 | Bacteria | 1781 |
| 88 | Ga0070684_100240764 | 3300005535 | Bacteria | 1653 |
| 89 | Ga0068853_100013136 | 3300005539 | Bacteria | 6758 |
| 90 | Ga0068853_100042324 | 3300005539 | Bacteria | 3894 |
| 91 | Ga0070696_100000147 | 3300005546 | Bacteria | 39206 |
| 92 | Ga0070696_100004865 | 3300005546 | Bacteria | 8975 |
| 93 | Ga0070665_100004663 | 3300005548 | Bacteria | 14320 |
| 94 | Ga0070665_100060824 | 3300005548 | Bacteria | 3786 |
| 95 | Ga0070665_100083206 | 3300005548 | Bacteria | 3205 |
| 96 | Ga0068855_100004962 | 3300005563 | Bacteria | 16231 |
| 97 | Ga0068855_100015449 | 3300005563 | Bacteria | 9191 |
| 98 | Ga0068855_100390540 | 3300005563 | Bacteria | 1526 |
| 99 | Ga0070664_100145049 | 3300005564 | Bacteria | 2093 |
| 100 | Ga0070664_100267301 | 3300005564 | Bacteria | 1540 |
| 101 | Ga0068857_100000451 | 3300005577 | Bacteria | 29292 |
| 102 | Ga0068857_100006173 | 3300005577 | Bacteria | 10245 |
| 103 | Ga0068857_100039946 | 3300005577 | Bacteria | 4159 |
| 104 | Ga0068856_100000957 | 3300005614 | Bacteria | 30820 |
| 105 | Ga0068856_100045631 | 3300005614 | Bacteria | 4316 |
| 106 | Ga0068856_100144072 | 3300005614 | Bacteria | 2390 |
| 107 | Ga0068852_100005614 | 3300005616 | Bacteria | 9000 |
| 108 | Ga0068852_100012657 | 3300005616 | Bacteria | 6416 |
| 109 | Ga0068864_100000002 | 3300005618 | Bacteria | 658857 |
| 110 | Ga0068863_100132291 | 3300005841 | Bacteria | 2382 |
| 111 | Ga0068858_100012945 | 3300005842 | Bacteria | 7867 |
| 112 | Ga0068858_100033049 | 3300005842 | Bacteria | 4805 |
| 113 | Ga0068858_100117640 | 3300005842 | Bacteria | 2484 |
| 114 | Ga0068858_100136070 | 3300005842 | Bacteria | 2305 |
| 115 | Ga0068858_100162062 | 3300005842 | Bacteria | 2106 |
| 116 | Ga0068860_100000499 | 3300005843 | Bacteria | 48692 |
| 117 | Ga0068862_100005568 | 3300005844 | Bacteria | 10522 |
| 118 | Ga0081455_10032641 | 3300005937 | Bacteria | 4689 |
| 119 | Ga0070717_10307513 | 3300006028 | Bacteria | 1410 |
| 120 | Ga0075366_10038768 | 3300006195 | Bacteria | 2814 |
| 121 | Ga0097621_100061966 | 3300006237 | Bacteria | 3069 |
| 122 | Ga0068871_100013774 | 3300006358 | Bacteria | 6012 |
| 123 | Ga0068871_100137250 | 3300006358 | Bacteria | 2078 |
| 124 | Ga0068871_100205207 | 3300006358 | Bacteria | 1703 |
| 125 | Ga0075428_100050306 | 3300006844 | Bacteria | 4571 |
| 126 | Ga0075436_100004138 | 3300006914 | Bacteria | 9955 |
| 127 | Ga0097620_100173920 | 3300006931 | Bacteria | 2235 |
| 128 | Ga0099823_1000074 | 3300006944 | Bacteria | 48327 |
| 129 | Ga0099823_1063482 | 3300006944 | Bacteria | 1843 |
| 130 | Ga0079104_1001016 | 3300006946 | Bacteria | 21709 |
| 131 | Ga0079104_1001936 | 3300006946 | Bacteria | 12328 |
| 132 | Ga0079104_1012482 | 3300006946 | Bacteria | 2666 |
| 133 | Ga0079104_1029289 | 3300006946 | Bacteria | 1388 |
| 134 | Ga0105251_10000653 | 3300009011 | Bacteria | 31977 |
| 135 | Ga0105251_10003325 | 3300009011 | Bacteria | 11738 |
| 136 | Ga0105251_10005450 | 3300009011 | Bacteria | 8309 |
| 137 | Ga0105251_10013205 | 3300009011 | Bacteria | 4630 |
| 138 | Ga0105251_10023484 | 3300009011 | Bacteria | 3182 |
| 139 | Ga0105251_10026906 | 3300009011 | Bacteria | 2923 |
| 140 | Ga0105251_10029981 | 3300009011 | Bacteria | 2735 |
| 141 | Ga0105251_10033879 | 3300009011 | Bacteria | 2531 |
| 142 | Ga0105251_10035079 | 3300009011 | Bacteria | 2477 |
| 143 | Ga0105251_10048767 | 3300009011 | Bacteria | 2029 |
| 144 | Ga0105244_10000248 | 3300009036 | Bacteria | 55384 |
| 145 | Ga0105244_10000274 | 3300009036 | Bacteria | 51929 |
| 146 | Ga0105244_10002675 | 3300009036 | Bacteria | 13334 |
| 147 | Ga0105244_10009787 | 3300009036 | Bacteria | 5855 |
| 148 | Ga0105244_10010093 | 3300009036 | Bacteria | 5751 |
| 149 | Ga0105244_10015761 | 3300009036 | Bacteria | 4327 |
| 150 | Ga0105244_10033838 | 3300009036 | Bacteria | 2693 |
| 151 | Ga0105244_10035696 | 3300009036 | Bacteria | 2610 |
| 152 | Ga0105244_10035795 | 3300009036 | Bacteria | 2605 |
| 153 | Ga0105244_10035887 | 3300009036 | Bacteria | 2602 |
| 154 | Ga0105250_10013939 | 3300009092 | Bacteria | 3310 |
| 155 | Ga0105250_10018481 | 3300009092 | Bacteria | 2823 |
| 156 | Ga0105250_10021791 | 3300009092 | Bacteria | 2585 |
| 157 | Ga0105250_10022369 | 3300009092 | Bacteria | 2550 |
| 158 | Ga0105250_10034542 | 3300009092 | Bacteria | 2029 |
| 159 | Ga0105250_10034581 | 3300009092 | Bacteria | 2028 |
| 160 | Ga0105240_10002636 | 3300009093 | Bacteria | 28586 |
| 161 | Ga0105240_10003683 | 3300009093 | Bacteria | 23696 |
| 162 | Ga0105240_10005123 | 3300009093 | Bacteria | 19605 |
| 163 | Ga0105240_10005449 | 3300009093 | Bacteria | 18962 |
| 164 | Ga0105240_10007191 | 3300009093 | Bacteria | 16213 |
| 165 | Ga0105240_10026186 | 3300009093 | Bacteria | 7652 |
| 166 | Ga0105240_10047714 | 3300009093 | Bacteria | 5418 |
| 167 | Ga0105240_10054350 | 3300009093 | Bacteria | 5018 |
| 168 | Ga0105240_10074490 | 3300009093 | Bacteria | 4190 |
| 169 | Ga0105240_10184676 | 3300009093 | Bacteria | 2457 |
| 170 | Ga0105240_10251119 | 3300009093 | Bacteria | 2045 |
| 171 | Ga0105240_10308746 | 3300009093 | Bacteria | 1807 |
| 172 | Ga0105240_10759923 | 3300009093 | Bacteria | 1053 |
| 173 | Ga0111539_10008365 | 3300009094 | Bacteria | 13165 |
| 174 | Ga0111539_10016907 | 3300009094 | Bacteria | 9030 |
| 175 | Ga0111539_10119867 | 3300009094 | Bacteria | 3083 |
| 176 | Ga0111539_10187945 | 3300009094 | Bacteria | 2411 |
| 177 | Ga0105245_10000694 | 3300009098 | Bacteria | 30357 |
| 178 | Ga0105245_10373911 | 3300009098 | Bacteria | 1417 |
| 179 | Ga0105245_10434957 | 3300009098 | Bacteria | 1318 |
| 180 | Ga0105245_10477401 | 3300009098 | Bacteria | 1259 |
| 181 | Ga0105247_10000176 | 3300009101 | Bacteria | 62687 |
| 182 | Ga0105247_10004537 | 3300009101 | Bacteria | 8851 |
| 183 | Ga0114129_10002078 | 3300009147 | Bacteria | 27546 |
| 184 | Ga0105243_10000263 | 3300009148 | Bacteria | 59080 |
| 185 | Ga0105243_10023492 | 3300009148 | Bacteria | 4695 |
| 186 | Ga0105241_10000001 | 3300009174 | Bacteria | 879793 |
| 187 | Ga0105241_10007966 | 3300009174 | Bacteria | 7793 |
| 188 | Ga0105241_10043069 | 3300009174 | Bacteria | 3418 |
| 189 | Ga0105241_10091320 | 3300009174 | Bacteria | 2402 |
| 190 | Ga0105241_10164967 | 3300009174 | Bacteria | 1824 |
| 191 | Ga0105241_10248325 | 3300009174 | Bacteria | 1507 |
| 192 | Ga0105242_10015261 | 3300009176 | Bacteria | 5967 |
| 193 | Ga0105242_10026595 | 3300009176 | Bacteria | 4586 |
| 194 | Ga0105242_10089909 | 3300009176 | Bacteria | 2582 |
| 195 | Ga0105242_10146764 | 3300009176 | Bacteria | 2053 |
| 196 | Ga0105242_10263249 | 3300009176 | Bacteria | 1559 |
| 197 | Ga0105248_10006442 | 3300009177 | Bacteria | 12880 |
| 198 | Ga0105248_10006574 | 3300009177 | Bacteria | 12746 |
| 199 | Ga0105248_10029592 | 3300009177 | Bacteria | 6110 |
| 200 | Ga0105248_10460787 | 3300009177 | Bacteria | 1433 |
| 201 | Ga0105248_10739221 | 3300009177 | Bacteria | 1110 |
| 202 | Ga0105237_10008345 | 3300009545 | Bacteria | 11231 |
| 203 | Ga0105237_10008700 | 3300009545 | Bacteria | 10965 |
| 204 | Ga0105237_10016948 | 3300009545 | Bacteria | 7558 |
| 205 | Ga0105237_10149607 | 3300009545 | Bacteria | 2331 |
| 206 | Ga0105238_10000238 | 3300009551 | Bacteria | 61471 |
| 207 | Ga0105238_10001852 | 3300009551 | Bacteria | 21198 |
| 208 | Ga0105238_10006092 | 3300009551 | Bacteria | 11962 |
| 209 | Ga0105238_10008661 | 3300009551 | Bacteria | 10181 |
| 210 | Ga0105238_10091092 | 3300009551 | Bacteria | 3037 |
| 211 | Ga0105238_10093299 | 3300009551 | Bacteria | 2998 |
| 212 | Ga0105238_10117899 | 3300009551 | Bacteria | 2635 |
| 213 | Ga0105238_10121358 | 3300009551 | Bacteria | 2593 |
| 214 | Ga0105238_10181828 | 3300009551 | Bacteria | 2079 |
| 215 | Ga0105249_10012651 | 3300009553 | Bacteria | 7441 |
| 216 | Ga0099796_10027099 | 3300010159 | Bacteria | 1827 |
| 217 | Ga0105246_10005750 | 3300011119 | Bacteria | 7566 |
| 218 | Ga0105246_10025988 | 3300011119 | Bacteria | 3819 |
| 219 | Ga0105246_10087869 | 3300011119 | Bacteria | 2232 |
| 220 | Ga0157373_10000593 | 3300013100 | Bacteria | 28147 |
| 221 | Ga0157373_10003913 | 3300013100 | Bacteria | 11243 |
| 222 | Ga0157373_10016161 | 3300013100 | Bacteria | 5448 |
| 223 | Ga0157373_10028452 | 3300013100 | Bacteria | 4032 |
| 224 | Ga0157371_10000497 | 3300013102 | Bacteria | 47594 |
| 225 | Ga0157371_10015917 | 3300013102 | Bacteria | 5627 |
| 226 | Ga0157371_10078133 | 3300013102 | Bacteria | 2344 |
| 227 | Ga0157371_10215321 | 3300013102 | Bacteria | 1379 |
| 228 | Ga0157370_10001630 | 3300013104 | Bacteria | 27714 |
| 229 | Ga0157370_10006826 | 3300013104 | Bacteria | 12512 |
| 230 | Ga0157370_10007129 | 3300013104 | Bacteria | 12195 |
| 231 | Ga0157370_10025437 | 3300013104 | Bacteria | 5859 |
| 232 | Ga0157370_10028766 | 3300013104 | Bacteria | 5464 |
| 233 | Ga0157370_10039334 | 3300013104 | Bacteria | 4571 |
| 234 | Ga0157370_10093954 | 3300013104 | Bacteria | 2814 |
| 235 | Ga0157370_10199378 | 3300013104 | Bacteria | 1857 |
| 236 | Ga0157369_10009351 | 3300013105 | Bacteria | 11208 |
| 237 | Ga0157369_10015015 | 3300013105 | Bacteria | 8740 |
| 238 | Ga0157369_10032457 | 3300013105 | Bacteria | 5742 |
| 239 | Ga0157369_10128690 | 3300013105 | Bacteria | 2684 |
| 240 | Ga0157369_10131266 | 3300013105 | Bacteria | 2654 |
| 241 | Ga0157369_10285226 | 3300013105 | Bacteria | 1719 |
| 242 | Ga0157369_10487229 | 3300013105 | Bacteria | 1276 |
| 243 | Ga0157374_10016482 | 3300013296 | Bacteria | 6497 |
| 244 | Ga0157374_10084829 | 3300013296 | Bacteria | 3011 |
| 245 | Ga0157374_10192967 | 3300013296 | Bacteria | 1992 |
| 246 | Ga0157378_10376010 | 3300013297 | Bacteria | 1394 |
| 247 | Ga0163162_10139987 | 3300013306 | Bacteria | 2532 |
| 248 | Ga0163162_10303072 | 3300013306 | Bacteria | 1730 |
| 249 | Ga0163162_10391986 | 3300013306 | Bacteria | 1521 |
| 250 | Ga0157372_10000598 | 3300013307 | Bacteria | 39369 |
| 251 | Ga0157372_10041986 | 3300013307 | Bacteria | 5057 |
| 252 | Ga0157372_10047751 | 3300013307 | Bacteria | 4758 |
| 253 | Ga0157372_10196571 | 3300013307 | Bacteria | 2336 |
| 254 | Ga0157372_10266118 | 3300013307 | Bacteria | 1991 |
| 255 | Ga0157372_10836391 | 3300013307 | Bacteria | 1069 |
| 256 | Ga0157375_10040468 | 3300013308 | Bacteria | 4493 |
| 257 | Ga0163163_10000627 | 3300014325 | Bacteria | 30451 |
| 258 | Ga0163163_10031285 | 3300014325 | Bacteria | 5136 |
| 259 | Ga0163163_10100549 | 3300014325 | Bacteria | 2914 |
| 260 | Ga0182008_10014996 | 3300014497 | Bacteria | 4052 |
| 261 | Ga0182008_10034069 | 3300014497 | Bacteria | 2554 |
| 262 | Ga0157379_10158519 | 3300014968 | Bacteria | 2043 |
| 263 | Ga0157376_10116201 | 3300014969 | Bacteria | 2363 |
| 264 | Ga0182006_1000174 | 3300015261 | Bacteria | 67705 |
| 265 | Ga0182006_1003543 | 3300015261 | Bacteria | 7963 |
| 266 | Ga0182006_1009467 | 3300015261 | Bacteria | 4363 |
| 267 | Ga0182006_1017180 | 3300015261 | Bacteria | 3078 |
| 268 | Ga0182007_10000143 | 3300015262 | Bacteria | 47807 |
| 269 | Ga0182005_1002054 | 3300015265 | Bacteria | 7536 |
| 270 | Ga0163161_10000003 | 3300017792 | Bacteria | 339847 |
| 271 | Ga0163161_10036567 | 3300017792 | Bacteria | 3516 |
| 272 | Ga0163161_10045290 | 3300017792 | Bacteria | 3172 |
| 273 | Ga0163161_10159843 | 3300017792 | Bacteria | 1718 |
| 274 | Ga0163161_10261768 | 3300017792 | Bacteria | 1351 |
| 275 | Ga0197907_10075445 | 3300020069 | Bacteria | 983 |
| 276 | Ga0206355_1560789 | 3300020076 | Bacteria | 1166 |
| 277 | Ga0206351_10065214 | 3300020077 | Bacteria | 1319 |
| 278 | Ga0206352_10666988 | 3300020078 | Bacteria | 1059 |
| 279 | Ga0206350_10221737 | 3300020080 | Bacteria | 1167 |
| 280 | Ga0206350_10379269 | 3300020080 | Bacteria | 1675 |
| 281 | Ga0206350_10938216 | 3300020080 | Bacteria | 1119 |
| 282 | Ga0206354_10594356 | 3300020081 | Bacteria | 1305 |
| 283 | Ga0206354_11413883 | 3300020081 | Bacteria | 1380 |
| 284 | Ga0206353_11342932 | 3300020082 | Bacteria | 1827 |
| 285 | Ga0213872_10000050 | 3300021361 | Bacteria | 109093 |
| 286 | Ga0213872_10000905 | 3300021361 | Bacteria | 21307 |
| 287 | Ga0213874_10004805 | 3300021377 | Bacteria | 3116 |
| 288 | Ga0213876_10010217 | 3300021384 | Bacteria | 5041 |
| 289 | Ga0213876_10029263 | 3300021384 | Bacteria | 2903 |
| 290 | Ga0213875_10000019 | 3300021388 | Bacteria | 231333 |
| 291 | Ga0213875_10016825 | 3300021388 | Bacteria | 3541 |
| 292 | Ga0213875_10042529 | 3300021388 | Bacteria | 2134 |
| 293 | Ga0213875_10065563 | 3300021388 | Bacteria | 1697 |
| 294 | Ga0213871_10034082 | 3300021441 | Bacteria | 1341 |
| 295 | Ga0224712_10039765 | 3300022467 | Bacteria | 1765 |
| 296 | Ga0224712_10099106 | 3300022467 | Bacteria | 1233 |
| 297 | Ga0224712_10135246 | 3300022467 | Bacteria | 1080 |
| 298 | Ga0209435_100837 | 3300025206 | Bacteria | 4839 |
| 299 | Ga0209760_100052 | 3300025207 | Bacteria | 103453 |
| 300 | Ga0209784_100015 | 3300025224 | Bacteria | 482117 |
| 301 | Ga0209566_100012 | 3300025225 | Bacteria | 482281 |
| 302 | Ga0209674_100027 | 3300025226 | Bacteria | 482281 |
| 303 | Ga0209147_100019 | 3300025229 | Bacteria | 482139 |
| 304 | Ga0209563_100031 | 3300025230 | Bacteria | 482281 |
| 305 | Ga0207427_100029 | 3300025231 | Bacteria | 376678 |
| 306 | Ga0209437_100009 | 3300025233 | Bacteria | 915954 |
| 307 | Ga0209258_100381 | 3300025242 | Bacteria | 56739 |
| 308 | Ga0209646_1000344 | 3300025246 | Bacteria | 34445 |
| 309 | Ga0209026_1000711 | 3300025250 | Bacteria | 19707 |
| 310 | Ga0209677_100016 | 3300025253 | Bacteria | 482117 |
| 311 | Ga0209759_1003201 | 3300025256 | Bacteria | 6639 |
| 312 | Ga0209759_1010992 | 3300025256 | Bacteria | 2608 |
| 313 | Ga0209233_1000032 | 3300025261 | Bacteria | 623596 |
| 314 | Ga0209676_1000026 | 3300025292 | Bacteria | 574599 |
| 315 | Ga0209676_1000532 | 3300025292 | Bacteria | 59471 |
| 316 | Ga0209025_1053028 | 3300025294 | Bacteria | 1595 |
| 317 | Ga0209050_1010390 | 3300025298 | Bacteria | 4595 |
| 318 | Ga0207696_1000001 | 3300025711 | Bacteria | 2579611 |
| 319 | Ga0207696_1000010 | 3300025711 | Bacteria | 534681 |
| 320 | Ga0207696_1002599 | 3300025711 | Bacteria | 8757 |
| 321 | Ga0207696_1003215 | 3300025711 | Bacteria | 7543 |
| 322 | Ga0207696_1010018 | 3300025711 | Bacteria | 3498 |
| 323 | Ga0207696_1021950 | 3300025711 | Bacteria | 2036 |
| 324 | Ga0207696_1023146 | 3300025711 | Bacteria | 1963 |
| 325 | Ga0207655_1000002 | 3300025728 | Bacteria | 1148694 |
| 326 | Ga0207655_1000151 | 3300025728 | Bacteria | 127538 |
| 327 | Ga0207655_1000197 | 3300025728 | Bacteria | 106282 |
| 328 | Ga0207655_1000262 | 3300025728 | Bacteria | 83031 |
| 329 | Ga0207655_1001327 | 3300025728 | Bacteria | 23344 |
| 330 | Ga0207655_1009222 | 3300025728 | Bacteria | 6155 |
| 331 | Ga0207655_1014210 | 3300025728 | Bacteria | 4515 |
| 332 | Ga0207655_1014306 | 3300025728 | Bacteria | 4494 |
| 333 | Ga0207655_1014419 | 3300025728 | Bacteria | 4468 |
| 334 | Ga0207655_1014540 | 3300025728 | Bacteria | 4442 |
| 335 | Ga0207655_1015788 | 3300025728 | Bacteria | 4174 |
| 336 | Ga0207713_1000070 | 3300025735 | Bacteria | 186597 |
| 337 | Ga0207713_1000072 | 3300025735 | Bacteria | 185652 |
| 338 | Ga0207713_1005079 | 3300025735 | Bacteria | 8353 |
| 339 | Ga0207713_1011564 | 3300025735 | Bacteria | 4785 |
| 340 | Ga0207713_1023540 | 3300025735 | Bacteria | 2896 |
| 341 | Ga0207713_1028889 | 3300025735 | Bacteria | 2493 |
| 342 | Ga0207713_1038613 | 3300025735 | Bacteria | 2024 |
| 343 | Ga0207713_1053053 | 3300025735 | Bacteria | 1600 |
| 344 | Ga0207710_10000051 | 3300025900 | Bacteria | 182751 |
| 345 | Ga0207710_10000455 | 3300025900 | Bacteria | 26350 |
| 346 | Ga0207710_10004382 | 3300025900 | Bacteria | 6166 |
| 347 | Ga0207680_10061334 | 3300025903 | Bacteria | 2293 |
| 348 | Ga0207699_10026412 | 3300025906 | Bacteria | 3200 |
| 349 | Ga0207684_10003450 | 3300025910 | Bacteria | 15417 |
| 350 | Ga0207684_10372437 | 3300025910 | Bacteria | 1229 |
| 351 | Ga0207684_10415456 | 3300025910 | Bacteria | 1156 |
| 352 | Ga0207654_10000004 | 3300025911 | Bacteria | 902334 |
| 353 | Ga0207654_10083975 | 3300025911 | Bacteria | 1924 |
| 354 | Ga0207707_10032118 | 3300025912 | Bacteria | 4595 |
| 355 | Ga0207707_10064455 | 3300025912 | Bacteria | 3190 |
| 356 | Ga0207707_10112455 | 3300025912 | Bacteria | 2380 |
| 357 | Ga0207707_10224707 | 3300025912 | Bacteria | 1634 |
| 358 | Ga0207695_10000964 | 3300025913 | Bacteria | 51291 |
| 359 | Ga0207695_10005339 | 3300025913 | Bacteria | 17095 |
| 360 | Ga0207695_10009140 | 3300025913 | Bacteria | 12299 |
| 361 | Ga0207695_10031123 | 3300025913 | Bacteria | 5858 |
| 362 | Ga0207695_10049362 | 3300025913 | Bacteria | 4437 |
| 363 | Ga0207695_10069201 | 3300025913 | Bacteria | 3612 |
| 364 | Ga0207695_10086193 | 3300025913 | Bacteria | 3168 |
| 365 | Ga0207695_10134361 | 3300025913 | Bacteria | 2428 |
| 366 | Ga0207695_10342244 | 3300025913 | Bacteria | 1383 |
| 367 | Ga0207671_10027273 | 3300025914 | Bacteria | 4270 |
| 368 | Ga0207671_10050164 | 3300025914 | Bacteria | 3090 |
| 369 | Ga0207693_10018001 | 3300025915 | Bacteria | 5630 |
| 370 | Ga0207663_10016462 | 3300025916 | Bacteria | 4101 |
| 371 | Ga0207663_10073947 | 3300025916 | Bacteria | 2207 |
| 372 | Ga0207660_10006888 | 3300025917 | Bacteria | 7357 |
| 373 | Ga0207660_10053276 | 3300025917 | Bacteria | 2883 |
| 374 | Ga0207657_10010431 | 3300025919 | Bacteria | 9272 |
| 375 | Ga0207657_10054869 | 3300025919 | Bacteria | 3444 |
| 376 | Ga0207652_10002345 | 3300025921 | Bacteria | 16034 |
| 377 | Ga0207652_10071427 | 3300025921 | Bacteria | 3016 |
| 378 | Ga0207646_10009466 | 3300025922 | Bacteria | 9626 |
| 379 | Ga0207681_10000509 | 3300025923 | Bacteria | 27059 |
| 380 | Ga0207694_10005299 | 3300025924 | Bacteria | 9940 |
| 381 | Ga0207694_10021698 | 3300025924 | Bacteria | 4866 |
| 382 | Ga0207694_10023587 | 3300025924 | Bacteria | 4671 |
| 383 | Ga0207694_10024889 | 3300025924 | Bacteria | 4547 |
| 384 | Ga0207694_10071687 | 3300025924 | Bacteria | 2707 |
| 385 | Ga0207650_10000002 | 3300025925 | Bacteria | 1439222 |
| 386 | Ga0207687_10005523 | 3300025927 | Bacteria | 8363 |
| 387 | Ga0207687_10007962 | 3300025927 | Bacteria | 6937 |
| 388 | Ga0207687_10064122 | 3300025927 | Bacteria | 2604 |
| 389 | Ga0207687_10276527 | 3300025927 | Bacteria | 1344 |
| 390 | Ga0207700_10001065 | 3300025928 | Bacteria | 15796 |
| 391 | Ga0207700_10078984 | 3300025928 | Bacteria | 2561 |
| 392 | Ga0207700_10148524 | 3300025928 | Bacteria | 1935 |
| 393 | Ga0207700_10150068 | 3300025928 | Bacteria | 1925 |
| 394 | Ga0207700_10386293 | 3300025928 | Bacteria | 1225 |
| 395 | Ga0207664_10035151 | 3300025929 | Bacteria | 3864 |
| 396 | Ga0207664_10035512 | 3300025929 | Bacteria | 3847 |
| 397 | Ga0207664_10179579 | 3300025929 | Bacteria | 1816 |
| 398 | Ga0207664_10231859 | 3300025929 | Bacteria | 1605 |
| 399 | Ga0207644_10001798 | 3300025931 | Bacteria | 13907 |
| 400 | Ga0207644_10272376 | 3300025931 | Bacteria | 1357 |
| 401 | Ga0207690_10016310 | 3300025932 | Bacteria | 4516 |
| 402 | Ga0207690_10114010 | 3300025932 | Bacteria | 1951 |
| 403 | Ga0207706_10284593 | 3300025933 | Bacteria | 1441 |
| 404 | Ga0207686_10002054 | 3300025934 | Bacteria | 11093 |
| 405 | Ga0207709_10000158 | 3300025935 | Bacteria | 91810 |
| 406 | Ga0207709_10009838 | 3300025935 | Bacteria | 5267 |
| 407 | Ga0207669_10357081 | 3300025937 | Bacteria | 1131 |
| 408 | Ga0207691_10376693 | 3300025940 | Bacteria | 1212 |
| 409 | Ga0207711_10000752 | 3300025941 | Bacteria | 31778 |
| 410 | Ga0207711_10025879 | 3300025941 | Bacteria | 4921 |
| 411 | Ga0207711_10041953 | 3300025941 | Bacteria | 3897 |
| 412 | Ga0207711_10192714 | 3300025941 | Bacteria | 1858 |
| 413 | Ga0207689_10157260 | 3300025942 | Bacteria | 1874 |
| 414 | Ga0207661_10001589 | 3300025944 | Bacteria | 15456 |
| 415 | Ga0207661_10011029 | 3300025944 | Bacteria | 6532 |
| 416 | Ga0207661_10019484 | 3300025944 | Bacteria | 5059 |
| 417 | Ga0207661_10077113 | 3300025944 | Unclassified | 2740 |
| 418 | Ga0207661_10101271 | 3300025944 | Bacteria | 2419 |
| 419 | Ga0207661_10381350 | 3300025944 | Bacteria | 1276 |
| 420 | Ga0207661_10457424 | 3300025944 | Bacteria | 1163 |
| 421 | Ga0207679_10124674 | 3300025945 | Bacteria | 2057 |
| 422 | Ga0207679_10218628 | 3300025945 | Bacteria | 1602 |
| 423 | Ga0207667_10000778 | 3300025949 | Bacteria | 41337 |
| 424 | Ga0207667_10012222 | 3300025949 | Bacteria | 9917 |
| 425 | Ga0207667_10018428 | 3300025949 | Bacteria | 7828 |
| 426 | Ga0207712_10054911 | 3300025961 | Bacteria | 2799 |
| 427 | Ga0207658_10000001 | 3300025986 | Bacteria | 1439333 |
| 428 | Ga0207677_10067902 | 3300026023 | Bacteria | 2499 |
| 429 | Ga0207703_10008479 | 3300026035 | Bacteria | 8122 |
| 430 | Ga0207639_10026567 | 3300026041 | Bacteria | 4207 |
| 431 | Ga0207702_10007438 | 3300026078 | Bacteria | 9346 |
| 432 | Ga0207702_10033061 | 3300026078 | Bacteria | 4317 |
| 433 | Ga0207702_10051541 | 3300026078 | Bacteria | 3479 |
| 434 | Ga0207702_10051880 | 3300026078 | Bacteria | 3469 |
| 435 | Ga0207641_10067303 | 3300026088 | Bacteria | 3068 |
| 436 | Ga0207641_10259950 | 3300026088 | Bacteria | 1625 |
| 437 | Ga0207641_10404785 | 3300026088 | Bacteria | 1311 |
| 438 | Ga0207676_10000001 | 3300026095 | Bacteria | 1439222 |
| 439 | Ga0207674_10000320 | 3300026116 | Bacteria | 61127 |
| 440 | Ga0207674_10011685 | 3300026116 | Bacteria | 9857 |
| 441 | Ga0207674_10049531 | 3300026116 | Bacteria | 4296 |
| 442 | Ga0207683_10223164 | 3300026121 | Bacteria | 1717 |
| 443 | Ga0207683_10276890 | 3300026121 | Bacteria | 1533 |
| 444 | Ga0207683_10288828 | 3300026121 | Bacteria | 1499 |
| 445 | Ga0207698_10445850 | 3300026142 | Bacteria | 1248 |
| 446 | Ga0209281_1000038 | 3300027111 | Bacteria | 361154 |
| 447 | Ga0209281_1000172 | 3300027111 | Bacteria | 151766 |
| 448 | Ga0209281_1001784 | 3300027111 | Bacteria | 10840 |
| 449 | Ga0209389_1000063 | 3300027296 | Bacteria | 102403 |
| 450 | Ga0209371_1000196 | 3300027312 | Bacteria | 89093 |
| 451 | Ga0209371_1000576 | 3300027312 | Bacteria | 33041 |
| 452 | Ga0209371_1002233 | 3300027312 | Bacteria | 11185 |
| 453 | Ga0209371_1003223 | 3300027312 | Bacteria | 8182 |
| 454 | Ga0209371_1007522 | 3300027312 | Bacteria | 3777 |
| 455 | Ga0209969_1003123 | 3300027360 | Bacteria | 2291 |
| 456 | Ga0209984_1010318 | 3300027424 | Bacteria | 1197 |
| 457 | Ga0209982_1005413 | 3300027552 | Bacteria | 1844 |
| 458 | Ga0209971_1007555 | 3300027682 | Bacteria | 2580 |
| 459 | Ga0209974_10006192 | 3300027876 | Bacteria | 4190 |
| 460 | Ga0209974_10045407 | 3300027876 | Bacteria | 1467 |
| 461 | Ga0207428_10175085 | 3300027907 | Bacteria | 1623 |
| 462 | Ga0265354_1000479 | 3300028016 | Bacteria | 6947 |
| 463 | Ga0265356_1000429 | 3300028017 | Bacteria | 7644 |
| 464 | Ga0268266_10005113 | 3300028379 | Bacteria | 12359 |
| 465 | Ga0268266_10007323 | 3300028379 | Bacteria | 9973 |
| 466 | Ga0268266_10043227 | 3300028379 | Bacteria | 3850 |
| 467 | Ga0268265_10000455 | 3300028380 | Bacteria | 43315 |
| 468 | Ga0268265_10543460 | 3300028380 | Bacteria | 1102 |
| 469 | Ga0268264_10000004 | 3300028381 | Bacteria | 1116842 |
| 470 | Ga0265337_1010645 | 3300028556 | Bacteria | 3210 |
| 471 | Ga0265337_1021446 | 3300028556 | Bacteria | 2013 |
| 472 | Ga0265326_10006844 | 3300028558 | Bacteria | 3518 |
| 473 | Ga0265326_10007728 | 3300028558 | Bacteria | 3280 |
| 474 | Ga0265326_10013258 | 3300028558 | Bacteria | 2413 |
| 475 | Ga0265319_1000117 | 3300028563 | Bacteria | 60512 |
| 476 | Ga0265334_10010142 | 3300028573 | Bacteria | 3976 |
| 477 | Ga0265318_10000127 | 3300028577 | Bacteria | 70203 |
| 478 | Ga0265318_10045528 | 3300028577 | Bacteria | 1658 |
| 479 | Ga0265318_10051719 | 3300028577 | Bacteria | 1542 |
| 480 | Ga0265318_10074020 | 3300028577 | Bacteria | 1261 |
| 481 | Ga0265323_10000442 | 3300028653 | Bacteria | 23783 |
| 482 | Ga0265323_10000729 | 3300028653 | Bacteria | 17814 |
| 483 | Ga0265323_10001018 | 3300028653 | Bacteria | 14603 |
| 484 | Ga0265323_10001673 | 3300028653 | Bacteria | 10615 |
| 485 | Ga0265323_10015696 | 3300028653 | Bacteria | 2974 |
| 486 | Ga0265323_10023964 | 3300028653 | Bacteria | 2324 |
| 487 | Ga0265322_10001727 | 3300028654 | Bacteria | 6930 |
| 488 | Ga0265322_10019771 | 3300028654 | Bacteria | 1931 |
| 489 | Ga0265322_10026141 | 3300028654 | Bacteria | 1669 |
| 490 | Ga0265336_10003605 | 3300028666 | Bacteria | 6047 |
| 491 | Ga0265336_10005093 | 3300028666 | Bacteria | 4889 |
| 492 | Ga0307517_10113040 | 3300028786 | Bacteria | 2052 |
| 493 | Ga0265338_10004158 | 3300028800 | Bacteria | 19773 |
| 494 | Ga0265338_10006215 | 3300028800 | Bacteria | 15298 |
| 495 | Ga0265338_10006479 | 3300028800 | Bacteria | 14906 |
| 496 | Ga0265338_10040825 | 3300028800 | Bacteria | 4352 |
| 497 | Ga0265338_10049222 | 3300028800 | Bacteria | 3823 |
| 498 | Ga0265338_10083055 | 3300028800 | Bacteria | 2681 |
| 499 | Ga0265338_10121263 | 3300028800 | Bacteria | 2084 |
| 500 | Ga0265338_10181457 | 3300028800 | Bacteria | 1604 |
| 501 | Ga0265338_10263578 | 3300028800 | Bacteria | 1266 |
| 502 | Ga0265324_10000026 | 3300029957 | Bacteria | 161746 |
| 503 | Ga0265324_10000069 | 3300029957 | Bacteria | 83572 |
| 504 | Ga0265324_10000093 | 3300029957 | Bacteria | 69020 |
| 505 | Ga0265324_10000411 | 3300029957 | Bacteria | 30799 |
| 506 | Ga0265324_10008668 | 3300029957 | Bacteria | 4022 |
| 507 | Ga0265324_10010285 | 3300029957 | Bacteria | 3615 |
| 508 | Ga0265324_10067460 | 3300029957 | Bacteria | 1220 |
| 509 | Ga0268256_1000158 | 3300030500 | Bacteria | 89061 |
| 510 | Ga0268256_1000503 | 3300030500 | Bacteria | 33041 |
| 511 | Ga0268256_1001972 | 3300030500 | Bacteria | 11185 |
| 512 | Ga0268256_1007753 | 3300030500 | Bacteria | 3777 |
| 513 | Ga0316183_1015099 | 3300030742 | Bacteria | 4141 |
| 514 | Ga0265770_1000818 | 3300030878 | Bacteria | 4308 |
| 515 | Ga0265765_1000811 | 3300030879 | Bacteria | 2673 |
| 516 | Ga0265760_10000954 | 3300031090 | Bacteria | 8365 |
| 517 | Ga0265760_10029106 | 3300031090 | Bacteria | 1623 |
| 518 | Ga0265330_10000112 | 3300031235 | Bacteria | 66619 |
| 519 | Ga0265330_10005890 | 3300031235 | Bacteria | 6072 |
| 520 | Ga0265330_10005891 | 3300031235 | Bacteria | 6072 |
| 521 | Ga0265330_10007670 | 3300031235 | Bacteria | 5242 |
| 522 | Ga0265330_10010228 | 3300031235 | Bacteria | 4427 |
| 523 | Ga0265330_10013565 | 3300031235 | Bacteria | 3795 |
| 524 | Ga0265330_10021605 | 3300031235 | Bacteria | 2934 |
| 525 | Ga0265330_10024877 | 3300031235 | Bacteria | 2715 |
| 526 | Ga0265330_10029355 | 3300031235 | Bacteria | 2474 |
| 527 | Ga0265330_10033380 | 3300031235 | Bacteria | 2301 |
| 528 | Ga0265330_10035564 | 3300031235 | Bacteria | 2222 |
| 529 | Ga0265330_10050703 | 3300031235 | Bacteria | 1820 |
| 530 | Ga0265330_10117082 | 3300031235 | Bacteria | 1136 |
| 531 | Ga0265332_10000013 | 3300031238 | Bacteria | 250095 |
| 532 | Ga0265332_10000052 | 3300031238 | Bacteria | 109708 |
| 533 | Ga0265332_10000062 | 3300031238 | Bacteria | 95133 |
| 534 | Ga0265332_10000234 | 3300031238 | Bacteria | 44285 |
| 535 | Ga0265332_10001836 | 3300031238 | Bacteria | 11330 |
| 536 | Ga0265332_10003905 | 3300031238 | Bacteria | 7110 |
| 537 | Ga0265332_10010180 | 3300031238 | Bacteria | 4186 |
| 538 | Ga0265332_10034307 | 3300031238 | Bacteria | 2206 |
| 539 | Ga0265332_10056281 | 3300031238 | Bacteria | 1685 |
| 540 | Ga0265332_10070650 | 3300031238 | Bacteria | 1487 |
| 541 | Ga0265328_10000076 | 3300031239 | Bacteria | 51815 |
| 542 | Ga0265328_10000128 | 3300031239 | Bacteria | 36428 |
| 543 | Ga0265328_10000297 | 3300031239 | Bacteria | 23171 |
| 544 | Ga0265328_10001141 | 3300031239 | Bacteria | 12239 |
| 545 | Ga0265328_10002442 | 3300031239 | Bacteria | 8339 |
| 546 | Ga0265328_10005003 | 3300031239 | Bacteria | 5712 |
| 547 | Ga0265328_10006581 | 3300031239 | Bacteria | 4897 |
| 548 | Ga0265328_10014488 | 3300031239 | Bacteria | 3104 |
| 549 | Ga0265328_10022723 | 3300031239 | Bacteria | 2384 |
| 550 | Ga0265328_10035767 | 3300031239 | Bacteria | 1836 |
| 551 | Ga0265320_10000969 | 3300031240 | Bacteria | 21356 |
| 552 | Ga0265320_10002060 | 3300031240 | Bacteria | 14160 |
| 553 | Ga0265320_10004794 | 3300031240 | Bacteria | 8790 |
| 554 | Ga0265320_10005502 | 3300031240 | Bacteria | 8122 |
| 555 | Ga0265320_10073931 | 3300031240 | Bacteria | 1601 |
| 556 | Ga0265325_10003074 | 3300031241 | Bacteria | 11029 |
| 557 | Ga0265325_10006487 | 3300031241 | Bacteria | 7094 |
| 558 | Ga0265325_10008975 | 3300031241 | Bacteria | 5870 |
| 559 | Ga0265325_10011735 | 3300031241 | Bacteria | 5026 |
| 560 | Ga0265325_10038411 | 3300031241 | Bacteria | 2527 |
| 561 | Ga0265325_10053699 | 3300031241 | Bacteria | 2065 |
| 562 | Ga0265325_10123463 | 3300031241 | Bacteria | 1246 |
| 563 | Ga0265325_10160877 | 3300031241 | Bacteria | 1056 |
| 564 | Ga0265329_10000059 | 3300031242 | Bacteria | 48321 |
| 565 | Ga0265329_10001427 | 3300031242 | Bacteria | 11542 |
| 566 | Ga0265329_10001667 | 3300031242 | Bacteria | 10644 |
| 567 | Ga0265329_10001674 | 3300031242 | Bacteria | 10614 |
| 568 | Ga0265329_10011734 | 3300031242 | Bacteria | 3175 |
| 569 | Ga0265329_10014035 | 3300031242 | Bacteria | 2838 |
| 570 | Ga0265329_10014042 | 3300031242 | Bacteria | 2837 |
| 571 | Ga0265329_10021672 | 3300031242 | Bacteria | 2156 |
| 572 | Ga0265340_10000044 | 3300031247 | Bacteria | 56454 |
| 573 | Ga0265340_10000882 | 3300031247 | Bacteria | 16980 |
| 574 | Ga0265340_10002279 | 3300031247 | Bacteria | 10963 |
| 575 | Ga0265340_10010569 | 3300031247 | Bacteria | 4933 |
| 576 | Ga0265340_10012413 | 3300031247 | Bacteria | 4500 |
| 577 | Ga0265340_10091168 | 3300031247 | Bacteria | 1425 |
| 578 | Ga0265339_10000001 | 3300031249 | Bacteria | 613713 |
| 579 | Ga0265339_10000004 | 3300031249 | Bacteria | 269533 |
| 580 | Ga0265339_10000018 | 3300031249 | Bacteria | 181364 |
| 581 | Ga0265339_10001637 | 3300031249 | Bacteria | 16530 |
| 582 | Ga0265339_10003001 | 3300031249 | Bacteria | 11897 |
| 583 | Ga0265339_10003717 | 3300031249 | Bacteria | 10642 |
| 584 | Ga0265339_10004363 | 3300031249 | Bacteria | 9654 |
| 585 | Ga0265339_10036307 | 3300031249 | Bacteria | 2759 |
| 586 | Ga0265339_10070381 | 3300031249 | Bacteria | 1866 |
| 587 | Ga0265339_10072546 | 3300031249 | Bacteria | 1832 |
| 588 | Ga0265339_10085234 | 3300031249 | Bacteria | 1664 |
| 589 | Ga0265331_10000036 | 3300031250 | Bacteria | 199058 |
| 590 | Ga0265331_10000108 | 3300031250 | Bacteria | 110148 |
| 591 | Ga0265331_10000145 | 3300031250 | Bacteria | 92545 |
| 592 | Ga0265331_10000591 | 3300031250 | Bacteria | 32363 |
| 593 | Ga0265331_10001957 | 3300031250 | Bacteria | 14384 |
| 594 | Ga0265331_10002644 | 3300031250 | Bacteria | 12006 |
| 595 | Ga0265331_10012348 | 3300031250 | Bacteria | 4630 |
| 596 | Ga0265331_10047240 | 3300031250 | Bacteria | 2072 |
| 597 | Ga0265331_10063883 | 3300031250 | Bacteria | 1733 |
| 598 | Ga0265331_10068261 | 3300031250 | Bacteria | 1667 |
| 599 | Ga0265331_10107964 | 3300031250 | Bacteria | 1278 |
| 600 | Ga0265331_10113555 | 3300031250 | Bacteria | 1241 |
| 601 | Ga0265327_10000008 | 3300031251 | Bacteria | 658870 |
| 602 | Ga0265327_10000213 | 3300031251 | Bacteria | 121151 |
| 603 | Ga0265327_10000229 | 3300031251 | Bacteria | 113907 |
| 604 | Ga0265327_10000503 | 3300031251 | Bacteria | 67795 |
| 605 | Ga0265327_10004005 | 3300031251 | Bacteria | 13426 |
| 606 | Ga0265327_10004822 | 3300031251 | Bacteria | 11700 |
| 607 | Ga0265327_10007133 | 3300031251 | Bacteria | 8718 |
| 608 | Ga0265327_10007583 | 3300031251 | Bacteria | 8333 |
| 609 | Ga0265327_10019468 | 3300031251 | Bacteria | 4169 |
| 610 | Ga0265316_10000011 | 3300031344 | Bacteria | 227018 |
| 611 | Ga0265316_10000731 | 3300031344 | Bacteria | 36246 |
| 612 | Ga0265316_10000847 | 3300031344 | Bacteria | 33692 |
| 613 | Ga0265316_10001116 | 3300031344 | Bacteria | 29109 |
| 614 | Ga0265316_10001265 | 3300031344 | Bacteria | 27129 |
| 615 | Ga0265316_10002090 | 3300031344 | Bacteria | 21001 |
| 616 | Ga0265316_10002305 | 3300031344 | Bacteria | 19950 |
| 617 | Ga0265316_10002945 | 3300031344 | Bacteria | 17419 |
| 618 | Ga0265316_10003493 | 3300031344 | Bacteria | 15863 |
| 619 | Ga0265316_10008374 | 3300031344 | Bacteria | 9602 |
| 620 | Ga0265316_10012518 | 3300031344 | Bacteria | 7600 |
| 621 | Ga0265316_10013282 | 3300031344 | Bacteria | 7325 |
| 622 | Ga0265316_10029280 | 3300031344 | Bacteria | 4529 |
| 623 | Ga0265316_10030608 | 3300031344 | Bacteria | 4409 |
| 624 | Ga0265316_10044714 | 3300031344 | Bacteria | 3520 |
| 625 | Ga0265316_10055363 | 3300031344 | Bacteria | 3102 |
| 626 | Ga0265316_10085315 | 3300031344 | Bacteria | 2417 |
| 627 | Ga0265316_10150442 | 3300031344 | Bacteria | 1744 |
| 628 | Ga0265316_10151517 | 3300031344 | Bacteria | 1737 |
| 629 | Ga0265316_10170975 | 3300031344 | Bacteria | 1621 |
| 630 | Ga0265316_10208700 | 3300031344 | Bacteria | 1445 |
| 631 | Ga0265316_10221885 | 3300031344 | Bacteria | 1394 |
| 632 | Ga0265316_10227276 | 3300031344 | Bacteria | 1375 |
| 633 | Ga0265316_10229035 | 3300031344 | Bacteria | 1369 |
| 634 | Ga0265316_10277884 | 3300031344 | Bacteria | 1224 |
| 635 | Ga0265316_10287086 | 3300031344 | Bacteria | 1201 |
| 636 | Ga0265316_10338294 | 3300031344 | Bacteria | 1091 |
| 637 | Ga0307509_10274381 | 3300031507 | Bacteria | 1452 |
| 638 | Ga0307408_100000178 | 3300031548 | Bacteria | 71389 |
| 639 | Ga0307408_100011056 | 3300031548 | Bacteria | 5958 |
| 640 | Ga0307408_100020260 | 3300031548 | Bacteria | 4486 |
| 641 | Ga0265313_10000056 | 3300031595 | Bacteria | 109106 |
| 642 | Ga0265313_10001373 | 3300031595 | Bacteria | 22850 |
| 643 | Ga0265313_10018959 | 3300031595 | Bacteria | 3847 |
| 644 | Ga0265313_10040724 | 3300031595 | Bacteria | 2294 |
| 645 | Ga0265313_10058884 | 3300031595 | Bacteria | 1809 |
| 646 | Ga0316579_10061196 | 3300031691 | Bacteria | 1772 |
| 647 | Ga0265314_10000007 | 3300031711 | Bacteria | 491737 |
| 648 | Ga0265314_10000271 | 3300031711 | Bacteria | 76021 |
| 649 | Ga0265314_10000933 | 3300031711 | Bacteria | 34474 |
| 650 | Ga0265314_10001549 | 3300031711 | Bacteria | 25351 |
| 651 | Ga0265314_10002364 | 3300031711 | Bacteria | 19452 |
| 652 | Ga0265314_10003597 | 3300031711 | Bacteria | 14919 |
| 653 | Ga0265314_10003642 | 3300031711 | Bacteria | 14820 |
| 654 | Ga0265314_10005145 | 3300031711 | Bacteria | 11889 |
| 655 | Ga0265314_10017132 | 3300031711 | Bacteria | 5695 |
| 656 | Ga0265314_10033095 | 3300031711 | Bacteria | 3795 |
| 657 | Ga0265314_10035236 | 3300031711 | Bacteria | 3650 |
| 658 | Ga0265314_10137277 | 3300031711 | Bacteria | 1517 |
| 659 | Ga0265314_10139318 | 3300031711 | Bacteria | 1502 |
| 660 | Ga0265342_10000058 | 3300031712 | Bacteria | 118791 |
| 661 | Ga0265342_10000472 | 3300031712 | Bacteria | 43635 |
| 662 | Ga0265342_10000619 | 3300031712 | Bacteria | 37353 |
| 663 | Ga0265342_10000762 | 3300031712 | Bacteria | 32881 |
| 664 | Ga0265342_10000924 | 3300031712 | Bacteria | 29168 |
| 665 | Ga0265342_10001136 | 3300031712 | Bacteria | 25428 |
| 666 | Ga0265342_10001742 | 3300031712 | Bacteria | 19865 |
| 667 | Ga0265342_10007313 | 3300031712 | Bacteria | 8102 |
| 668 | Ga0265342_10007898 | 3300031712 | Bacteria | 7714 |
| 669 | Ga0265342_10012661 | 3300031712 | Bacteria | 5706 |
| 670 | Ga0265342_10014722 | 3300031712 | Bacteria | 5182 |
| 671 | Ga0265342_10019789 | 3300031712 | Bacteria | 4331 |
| 672 | Ga0265342_10021895 | 3300031712 | Bacteria | 4073 |
| 673 | Ga0265342_10166351 | 3300031712 | Bacteria | 1216 |
| 674 | Ga0316576_10017817 | 3300031727 | Bacteria | 4836 |
| 675 | Ga0316576_10028196 | 3300031727 | Bacteria | 3955 |
| 676 | Ga0316576_10043506 | 3300031727 | Bacteria | 3240 |
| 677 | Ga0316576_10070843 | 3300031727 | Bacteria | 2571 |
| 678 | Ga0316576_10265500 | 3300031727 | Bacteria | 1287 |
| 679 | Ga0316578_10008951 | 3300031728 | Bacteria | 5121 |
| 680 | Ga0316578_10079635 | 3300031728 | Bacteria | 1948 |
| 681 | Ga0316578_10102627 | 3300031728 | Bacteria | 1715 |
| 682 | Ga0307516_10000202 | 3300031730 | Bacteria | 77604 |
| 683 | Ga0307405_10020411 | 3300031731 | Bacteria | 3701 |
| 684 | Ga0316577_10076069 | 3300031733 | Bacteria | 1874 |
| 685 | Ga0316577_10140008 | 3300031733 | Bacteria | 1363 |
| 686 | Ga0307413_10010098 | 3300031824 | Bacteria | 4558 |
| 687 | Ga0307406_10013085 | 3300031901 | Bacteria | 4744 |
| 688 | Ga0307406_10051967 | 3300031901 | Bacteria | 2604 |
| 689 | Ga0307406_10054623 | 3300031901 | Bacteria | 2549 |
| 690 | Ga0307407_10026019 | 3300031903 | Bacteria | 3093 |
| 691 | Ga0307412_10004978 | 3300031911 | Bacteria | 7425 |
| 692 | Ga0307412_10010098 | 3300031911 | Bacteria | 5430 |
| 693 | Ga0307412_10011635 | 3300031911 | Bacteria | 5101 |
| 694 | Ga0307409_100041096 | 3300031995 | Bacteria | 3450 |
| 695 | Ga0307414_10010683 | 3300032004 | Bacteria | 5344 |
| 696 | Ga0307414_10056920 | 3300032004 | Bacteria | 2745 |
| 697 | Ga0307411_10004175 | 3300032005 | Bacteria | 6866 |
| 698 | Ga0316593_10037039 | 3300032168 | Bacteria | 1611 |
| 699 | Ga0316593_10067502 | 3300032168 | Bacteria | 1232 |
| 700 | Ga0316593_10071261 | 3300032168 | Bacteria | 1202 |
| 701 | Ga0316596_1042114 | 3300033541 | Bacteria | 1201 |
| 702 | Ga0373926_0007884 | 3300035083 | Bacteria | 3548 |
| 703 | Ga0373926_0008882 | 3300035083 | Bacteria | 3349 |
| 704 | Ga0373934_0003185 | 3300035086 | Bacteria | 5999 |
| 705 | Ga0373934_0016862 | 3300035086 | Bacteria | 2781 |
| 706 | Ga0373932_0009979 | 3300035112 | Bacteria | 2291 |
| 707 | Ga0373936_0066099 | 3300035113 | Bacteria | 1484 |
| 708 | Ga0373945_0106995 | 3300035116 | Bacteria | 1100 |
| 709 | Ga0373953_0011245 | 3300035117 | Bacteria | 3138 |
| 710 | Ga0373953_0021778 | 3300035117 | Bacteria | 2409 |
| 711 | Ga0373954_0014791 | 3300035118 | Bacteria | 3482 |
| 712 | Ga0373954_0044561 | 3300035118 | Bacteria | 2071 |
| 713 | Ga0373956_0001217 | 3300035119 | Bacteria | 10658 |
| 714 | Ga0373957_0042689 | 3300035120 | Bacteria | 1712 |
| 715 | Ga0373955_0114834 | 3300035172 | Bacteria | 1560 |
| 716 | Ga0373955_0174821 | 3300035172 | Bacteria | 1272 |
| 717 | Ga0316574_0004307 | 3300035398 | Bacteria | 7433 |
| 718 | Ga0316574_0020761 | 3300035398 | Bacteria | 3891 |
| 719 | Ga0316574_0096617 | 3300035398 | Bacteria | 1888 |
| 720 | Ga0316574_0241945 | 3300035398 | Bacteria | 1153 |
| 721 | Ga0316574_0243127 | 3300035398 | Bacteria | 1150 |
| 722 | Ga0373931_0167068 | 3300035691 | Bacteria | 1294 |
| 723 | Ga0373935_0133566 | 3300035692 | Bacteria | 1670 |
| 724 | Ga0373935_0145989 | 3300035692 | Bacteria | 1602 |
| 725 | Ga0373927_0001539 | 3300035695 | Bacteria | 17343 |
| 726 | Ga0373927_0002742 | 3300035695 | Bacteria | 12842 |
| 727 | Ga0373927_0009722 | 3300035695 | Bacteria | 6446 |
| 728 | Ga0373927_0063083 | 3300035695 | Bacteria | 2397 |
| 729 | Ga0373927_0118306 | 3300035695 | Bacteria | 1729 |
| 730 | Ga0373927_0301155 | 3300035695 | Bacteria | 1055 |
| 731 | Ga0373933_0073672 | 3300035724 | Bacteria | 2081 |
| 732 | Ga0373933_0095320 | 3300035724 | Bacteria | 1841 |
| 733 | Ga0373947_0000740 | 3300035725 | Bacteria | 19574 |
| 734 | Ga0373947_0099937 | 3300035725 | Bacteria | 1822 |
| 735 | Ga0373937_0007741 | 3300036401 | Bacteria | 9312 |
| 736 | Ga0373937_0019221 | 3300036401 | Bacteria | 6116 |
| 737 | Ga0373937_0035160 | 3300036401 | Bacteria | 4559 |
| 738 | Ga0373937_0227032 | 3300036401 | Bacteria | 1758 |
| 739 | Ga0373937_0315761 | 3300036401 | Bacteria | 1478 |
| 740 | Ga0373937_0339483 | 3300036401 | Bacteria | 1422 |
| 741 | Ga0373937_0576904 | 3300036401 | Bacteria | 1068 |
| 742 | Ga0316582_0036189 | 3300036647 | Bacteria | 3053 |
| 743 | Ga0316582_0133884 | 3300036647 | Bacteria | 1667 |
| 744 | Ga0316582_0205402 | 3300036647 | Bacteria | 1345 |
| 745 | Ga0316584_0009600 | 3300036712 | Bacteria | 6726 |
| 746 | Ga0316584_0024907 | 3300036712 | Bacteria | 4384 |
| 747 | Ga0316584_0114947 | 3300036712 | Bacteria | 2013 |
| 748 | Ga0373925_0000099 | 3300037068 | Bacteria | 93726 |
| 749 | Ga0373925_0005608 | 3300037068 | Bacteria | 9345 |
| 750 | Ga0373925_0015028 | 3300037068 | Bacteria | 5596 |
| 751 | Ga0373925_0058578 | 3300037068 | Bacteria | 2888 |
| 752 | Ga0373925_0076615 | 3300037068 | Bacteria | 2537 |
| 753 | Ga0373925_0169322 | 3300037068 | Bacteria | 1724 |
| 754 | Ga0395900_0025210 | 3300037418 | Bacteria | 6088 |
| 755 | Ga0395900_0070182 | 3300037418 | Bacteria | 3602 |
| 756 | Ga0395905_0003402 | 3300037471 | Bacteria | 17035 |
| 757 | Ga0395905_0172075 | 3300037471 | Bacteria | 2034 |
| 758 | Ga0436364_0176175 | 3300037853 | Bacteria | 4885 |
| 759 | Ga0436364_0366372 | 3300037853 | Bacteria | 231753 |
| 760 | Ga0436364_0514524 | 3300037853 | Bacteria | 1248 |
| 761 | Ga0436364_0748631 | 3300037853 | Bacteria | 1323 |
| 762 | Ga0436364_0807765 | 3300037853 | Bacteria | 7401 |
| 763 | Ga0436364_0853204 | 3300037853 | Bacteria | 6229 |
| 764 | Ga0436364_1151958 | 3300037853 | Bacteria | 3445 |
| 765 | Ga0436364_1386202 | 3300037853 | Bacteria | 3656 |
| 766 | Ga0436364_1410728 | 3300037853 | Bacteria | 4621 |
| 767 | Ga0436364_1414125 | 3300037853 | Bacteria | 18149 |
| 768 | Ga0436364_1489063 | 3300037853 | Bacteria | 6681 |
| 769 | Ga0436364_1501586 | 3300037853 | Bacteria | 1905 |
| 770 | Ga0400490_10431 | 3300038726 | Bacteria | 21033 |
| 771 | Ga0400486_10993 | 3300038742 | Bacteria | 2242 |
| 772 | Ga0400483_030371 | 3300039062 | Bacteria | 16130 |
| 773 | Ga0400489_59676 | 3300039093 | Bacteria | 4698 |
| 774 | Ga0436365_0139104 | 3300039437 | Bacteria | 12303 |
| 775 | Ga0436365_0497797 | 3300039437 | Bacteria | 2851 |
| 776 | Ga0436365_0721041 | 3300039437 | Bacteria | 3132 |
| 777 | Ga0436365_1100189 | 3300039437 | Bacteria | 3446 |
| 778 | Ga0436365_1490124 | 3300039437 | Bacteria | 4606 |
| 779 | Ga0436360_0328545 | 3300039438 | Bacteria | 2166 |
| 780 | Ga0436360_0378330 | 3300039438 | Bacteria | 8772 |
| 781 | Ga0436360_1032306 | 3300039438 | Bacteria | 2846 |
| 782 | Ga0436360_1333063 | 3300039438 | Bacteria | 2341 |
| 783 | Ga0436361_0269507 | 3300039447 | Bacteria | 102308 |
| 784 | Ga0436361_0285134 | 3300039447 | Bacteria | 3111 |
| 785 | Ga0436361_0567168 | 3300039447 | Bacteria | 164343 |
| 786 | Ga0436361_0682766 | 3300039447 | Bacteria | 3159 |
| 787 | Ga0436363_1560073 | 3300039450 | Bacteria | 10797 |
| 788 | Ga0436362_0084096 | 3300039453 | Bacteria | 5279 |
| 789 | Ga0436362_0297328 | 3300039453 | Bacteria | 1754 |
| 790 | Ga0439436_0007650 | 3300041404 | Bacteria | 3324 |
| 791 | Ga0439438_000002 | 3300041405 | Bacteria | 618223 |
| 792 | Ga0439438_000442 | 3300041405 | Bacteria | 18697 |
| 793 | Ga0439438_003869 | 3300041405 | Bacteria | 5904 |
| 794 | Ga0439438_004424 | 3300041405 | Bacteria | 5397 |
| 795 | Ga0439438_012015 | 3300041405 | Bacteria | 2672 |
| 796 | Ga0439438_013815 | 3300041405 | Bacteria | 2421 |
| 797 | Ga0439447_001496 | 3300041407 | Bacteria | 8564 |
| 798 | Ga0439447_002909 | 3300041407 | Bacteria | 6128 |
| 799 | Ga0439447_003162 | 3300041407 | Bacteria | 5866 |
| 800 | Ga0439447_008240 | 3300041407 | Bacteria | 3241 |
| 801 | Ga0439466_0005969 | 3300041411 | Bacteria | 4638 |
| 802 | Ga0439466_0006786 | 3300041411 | Bacteria | 4343 |
| 803 | Ga0439466_0015267 | 3300041411 | Bacteria | 2790 |
| 804 | Ga0439465_0006145 | 3300041413 | Bacteria | 3819 |
| 805 | Ga0451855_1019283 | 3300041511 | Bacteria | 1912 |
| 806 | Ga0439432_001052 | 3300042006 | Bacteria | 10485 |
| 807 | Ga0439432_001239 | 3300042006 | Bacteria | 9653 |
| 808 | Ga0439432_002018 | 3300042006 | Bacteria | 7686 |
| 809 | Ga0439432_002789 | 3300042006 | Bacteria | 6512 |
| 810 | Ga0439432_003342 | 3300042006 | Bacteria | 5957 |
| 811 | Ga0439451_001638 | 3300042009 | Bacteria | 4446 |
| 812 | Ga0439451_003813 | 3300042009 | Bacteria | 3061 |
| 813 | Ga0439452_000003 | 3300042010 | Bacteria | 942815 |
| 814 | Ga0439452_009904 | 3300042010 | Bacteria | 2792 |
| 815 | Ga0439452_022042 | 3300042010 | Bacteria | 1653 |
| 816 | Ga0439456_000271 | 3300042013 | Bacteria | 12605 |
| 817 | Ga0439456_008922 | 3300042013 | Bacteria | 2070 |
| 818 | Ga0450911_000002 | 3300042115 | Bacteria | 277703 |
| 819 | Ga0450911_001193 | 3300042115 | Bacteria | 6338 |
| 820 | Ga0450919_000614 | 3300042121 | Bacteria | 4509 |
| 821 | Ga0450890_000186 | 3300042127 | Bacteria | 9401 |
| 822 | Ga0450902_001984 | 3300042137 | Bacteria | 2862 |
| 823 | Ga0450903_001828 | 3300042138 | Bacteria | 3879 |
| 824 | Ga0450903_002098 | 3300042138 | Bacteria | 3585 |
| 825 | Ga0450905_000029 | 3300042142 | Bacteria | 11982 |
| 826 | Ga0450906_000658 | 3300042145 | Bacteria | 7392 |
| 827 | Ga0450907_000132 | 3300042146 | Bacteria | 28311 |
| 828 | Ga0450907_002076 | 3300042146 | Bacteria | 3972 |
| 829 | Ga0439446_0008405 | 3300042156 | Bacteria | 2739 |
| 830 | Ga0439446_0017328 | 3300042156 | Bacteria | 2012 |
| 831 | Ga0450908_005178 | 3300042184 | Bacteria | 2500 |
| 832 | Ga0450909_002104 | 3300042185 | Bacteria | 2810 |
| 833 | Ga0439434_0000469 | 3300042435 | Bacteria | 11490 |
| 834 | Ga0439464_0002709 | 3300042439 | Bacteria | 4394 |
| 835 | Ga0439464_0009344 | 3300042439 | Bacteria | 2580 |
| 836 | Ga0439460_0001104 | 3300042461 | Bacteria | 6297 |
| 837 | Ga0439460_0005590 | 3300042461 | Bacteria | 3091 |
| 838 | Ga0451577_0000035 | 3300042876 | Bacteria | 373467 |
| 839 | Ga0451577_0000127 | 3300042876 | Bacteria | 168002 |
| 840 | Ga0451577_0000644 | 3300042876 | Bacteria | 55517 |
| 841 | Ga0451577_0001119 | 3300042876 | Bacteria | 38024 |
| 842 | Ga0451577_0001484 | 3300042876 | Bacteria | 31087 |
| 843 | Ga0451577_0003259 | 3300042876 | Bacteria | 18253 |
| 844 | Ga0451577_0003915 | 3300042876 | Bacteria | 16080 |
| 845 | Ga0451577_0008660 | 3300042876 | Bacteria | 9881 |
| 846 | Ga0451577_0013211 | 3300042876 | Bacteria | 7736 |
| 847 | Ga0451577_0015851 | 3300042876 | Bacteria | 6993 |
| 848 | Ga0451577_0016891 | 3300042876 | Bacteria | 6749 |
| 849 | Ga0451577_0026629 | 3300042876 | Bacteria | 5237 |
| 850 | Ga0451577_0032932 | 3300042876 | Bacteria | 4671 |
| 851 | Ga0451577_0034763 | 3300042876 | Bacteria | 4542 |
| 852 | Ga0451577_0055642 | 3300042876 | Bacteria | 3529 |
| 853 | Ga0451577_0065739 | 3300042876 | Bacteria | 3234 |
| 854 | Ga0451577_0074573 | 3300042876 | Bacteria | 3026 |
| 855 | Ga0451577_0081767 | 3300042876 | Bacteria | 2881 |
| 856 | Ga0451577_0088449 | 3300042876 | Bacteria | 2764 |
| 857 | Ga0451577_0095159 | 3300042876 | Bacteria | 2660 |
| 858 | Ga0451577_0103585 | 3300042876 | Bacteria | 2543 |
| 859 | Ga0451577_0161923 | 3300042876 | Bacteria | 2015 |
| 860 | Ga0451577_0190718 | 3300042876 | Bacteria | 1849 |
| 861 | Ga0451577_0392613 | 3300042876 | Bacteria | 1259 |
| 862 | Ga0439440_0003112 | 3300042993 | Bacteria | 3173 |
| 863 | Ga0439440_0009520 | 3300042993 | Bacteria | 2013 |
| 864 | Ga0453683_0000001 | 3300044673 | Bacteria | 1384965 |
| 865 | Ga0453683_0000009 | 3300044673 | Bacteria | 491115 |
| 866 | Ga0453683_0000018 | 3300044673 | Bacteria | 309212 |
| 867 | Ga0453683_0000233 | 3300044673 | Bacteria | 73679 |
| 868 | Ga0453683_0004304 | 3300044673 | Bacteria | 10144 |
| 869 | Ga0453683_0004940 | 3300044673 | Bacteria | 9370 |
| 870 | Ga0453683_0006674 | 3300044673 | Bacteria | 7897 |
| 871 | Ga0453683_0028839 | 3300044673 | Bacteria | 3512 |
| 872 | Ga0453683_0065747 | 3300044673 | Bacteria | 2267 |
| 873 | Ga0453683_0074008 | 3300044673 | Bacteria | 2132 |
| 874 | Ga0453683_0171101 | 3300044673 | Bacteria | 1376 |
| 875 | Ga0453683_0254441 | 3300044673 | Bacteria | 1120 |
| 876 | Ga0453684_0000048 | 3300044712 | Bacteria | 559743 |
| 877 | Ga0453684_0000097 | 3300044712 | Bacteria | 377772 |
| 878 | Ga0453684_0000115 | 3300044712 | Bacteria | 355501 |
| 879 | Ga0453684_0000221 | 3300044712 | Bacteria | 249908 |
| 880 | Ga0453684_0000242 | 3300044712 | Bacteria | 234895 |
| 881 | Ga0453684_0000499 | 3300044712 | Bacteria | 153532 |
| 882 | Ga0453684_0000539 | 3300044712 | Bacteria | 143526 |
| 883 | Ga0453684_0000555 | 3300044712 | Bacteria | 140770 |
| 884 | Ga0453684_0000941 | 3300044712 | Bacteria | 96005 |
| 885 | Ga0453684_0001135 | 3300044712 | Bacteria | 83367 |
| 886 | Ga0453684_0001752 | 3300044712 | Bacteria | 58035 |
| 887 | Ga0453684_0002408 | 3300044712 | Bacteria | 45598 |
| 888 | Ga0453684_0002894 | 3300044712 | Bacteria | 40256 |
| 889 | Ga0453684_0003084 | 3300044712 | Bacteria | 38484 |
| 890 | Ga0453684_0004632 | 3300044712 | Bacteria | 28590 |
| 891 | Ga0453684_0005926 | 3300044712 | Bacteria | 23699 |
| 892 | Ga0453684_0007878 | 3300044712 | Bacteria | 19352 |
| 893 | Ga0453684_0007938 | 3300044712 | Bacteria | 19252 |
| 894 | Ga0453684_0013644 | 3300044712 | Bacteria | 13164 |
| 895 | Ga0453684_0016279 | 3300044712 | Bacteria | 11645 |
| 896 | Ga0453684_0019676 | 3300044712 | Bacteria | 10253 |
| 897 | Ga0453684_0021899 | 3300044712 | Bacteria | 9513 |
| 898 | Ga0453684_0030419 | 3300044712 | Bacteria | 7629 |
| 899 | Ga0453684_0046636 | 3300044712 | Bacteria | 5761 |
| 900 | Ga0453684_0048265 | 3300044712 | Bacteria | 5633 |
| 901 | Ga0453684_0055436 | 3300044712 | Bacteria | 5153 |
| 902 | Ga0453684_0057574 | 3300044712 | Bacteria | 5029 |
| 903 | Ga0453684_0069986 | 3300044712 | Bacteria | 4447 |
| 904 | Ga0453684_0070696 | 3300044712 | Bacteria | 4418 |
| 905 | Ga0453684_0087668 | 3300044712 | Bacteria | 3856 |
| 906 | Ga0453684_0097761 | 3300044712 | Bacteria | 3602 |
| 907 | Ga0453684_0112724 | 3300044712 | Bacteria | 3301 |
| 908 | Ga0453684_0134239 | 3300044712 | Bacteria | 2966 |
| 909 | Ga0453684_0142404 | 3300044712 | Bacteria | 2861 |
| 910 | Ga0453684_0152488 | 3300044712 | Bacteria | 2744 |
| 911 | Ga0453684_0162295 | 3300044712 | Bacteria | 2642 |
| 912 | Ga0453684_0167310 | 3300044712 | Bacteria | 2594 |
| 913 | Ga0453684_0209441 | 3300044712 | Bacteria | 2267 |
| 914 | Ga0453684_0352507 | 3300044712 | Bacteria | 1659 |
| 915 | Ga0453684_0485017 | 3300044712 | Bacteria | 1371 |
| 916 | Ga0453684_0504267 | 3300044712 | Bacteria | 1339 |
| 917 | Ga0451576_0000488 | 3300045051 | Bacteria | 87699 |
| 918 | Ga0451576_0000897 | 3300045051 | Bacteria | 56638 |
| 919 | Ga0451576_0001625 | 3300045051 | Bacteria | 37674 |
| 920 | Ga0451576_0002883 | 3300045051 | Bacteria | 24561 |
| 921 | Ga0451576_0003235 | 3300045051 | Bacteria | 22666 |
| 922 | Ga0451576_0007599 | 3300045051 | Bacteria | 12911 |
| 923 | Ga0451576_0010023 | 3300045051 | Bacteria | 10916 |
| 924 | Ga0451576_0017004 | 3300045051 | Bacteria | 8007 |
| 925 | Ga0451576_0018382 | 3300045051 | Bacteria | 7664 |
| 926 | Ga0451576_0029987 | 3300045051 | Bacteria | 5817 |
| 927 | Ga0451576_0059407 | 3300045051 | Bacteria | 3991 |
| 928 | Ga0451576_0083463 | 3300045051 | Bacteria | 3324 |
| 929 | Ga0451576_0084574 | 3300045051 | Bacteria | 3300 |
| 930 | Ga0451576_0091231 | 3300045051 | Bacteria | 3169 |
| 931 | Ga0451576_0131379 | 3300045051 | Bacteria | 2610 |
| 932 | Ga0451576_0145838 | 3300045051 | Bacteria | 2468 |
| 933 | Ga0451576_0148525 | 3300045051 | Bacteria | 2444 |
| 934 | Ga0451576_0217205 | 3300045051 | Bacteria | 1996 |
| 935 | Ga0451576_0249655 | 3300045051 | Bacteria | 1854 |
| 936 | Ga0451576_0396624 | 3300045051 | Bacteria | 1446 |
| 937 | Ga0451576_0400895 | 3300045051 | Bacteria | 1438 |
| 938 | Ga0451576_0431901 | 3300045051 | Bacteria | 1382 |
| 939 | Ga0451576_0441847 | 3300045051 | Bacteria | 1365 |
| 940 | Ga0451576_0741327 | 3300045051 | Bacteria | 1032 |
| 941 | Ga0495617_000327 | 3300046452 | Bacteria | 26705 |
| 942 | Ga0495627_000044 | 3300046453 | Bacteria | 182964 |
| 943 | Ga0495627_000143 | 3300046453 | Bacteria | 85459 |
| 944 | Ga0495627_001530 | 3300046453 | Bacteria | 13262 |
| 945 | Ga0495627_005662 | 3300046453 | Bacteria | 4992 |
| 946 | Ga0495627_005817 | 3300046453 | Bacteria | 4906 |
| 947 | Ga0495592_0014490 | 3300046454 | Bacteria | 5983 |
| 948 | Ga0495603_0019488 | 3300046455 | Bacteria | 4105 |
| 949 | Ga0495590_0003015 | 3300046457 | Bacteria | 6901 |
| 950 | Ga0495590_0026310 | 3300046457 | Bacteria | 2043 |
| 951 | Ga0495590_0026839 | 3300046457 | Bacteria | 2021 |
| 952 | Ga0495591_000023 | 3300046458 | Bacteria | 191598 |
| 953 | Ga0495591_003647 | 3300046458 | Bacteria | 7836 |
| 954 | Ga0495591_004045 | 3300046458 | Bacteria | 7325 |
| 955 | Ga0495591_004793 | 3300046458 | Bacteria | 6466 |
| 956 | Ga0495591_005488 | 3300046458 | Bacteria | 5861 |
| 957 | Ga0495591_006035 | 3300046458 | Bacteria | 5459 |
| 958 | Ga0495591_009042 | 3300046458 | Bacteria | 4003 |
| 959 | Ga0495591_010786 | 3300046458 | Bacteria | 3511 |
| 960 | Ga0495638_0032805 | 3300046460 | Bacteria | 3324 |
| 961 | Ga0495651_0007664 | 3300046462 | Bacteria | 8253 |
| 962 | Ga0495651_0053021 | 3300046462 | Bacteria | 3124 |
| 963 | Ga0495653_0061150 | 3300046463 | Bacteria | 2850 |
| 964 | Ga0495653_0111964 | 3300046463 | Bacteria | 1960 |
| 965 | Ga0495650_0000065 | 3300046471 | Bacteria | 275124 |
| 966 | Ga0495650_0000620 | 3300046471 | Bacteria | 48027 |
| 967 | Ga0495650_0006361 | 3300046471 | Bacteria | 7378 |
| 968 | Ga0495650_0009633 | 3300046471 | Bacteria | 5476 |
| 969 | Ga0495580_0011408 | 3300046472 | Bacteria | 6875 |
| 970 | Ga0495580_0017429 | 3300046472 | Bacteria | 5372 |
| 971 | Ga0495580_0037314 | 3300046472 | Bacteria | 3489 |
| 972 | Ga0495580_0108737 | 3300046472 | Bacteria | 1925 |
| 973 | Ga0495605_0000048 | 3300046474 | Bacteria | 170182 |
| 974 | Ga0495605_0000094 | 3300046474 | Bacteria | 112717 |
| 975 | Ga0495605_0000330 | 3300046474 | Bacteria | 47649 |
| 976 | Ga0495605_0000486 | 3300046474 | Bacteria | 34396 |
| 977 | Ga0495605_0001320 | 3300046474 | Bacteria | 16426 |
| 978 | Ga0495605_0005925 | 3300046474 | Bacteria | 7065 |
| 979 | Ga0495605_0006308 | 3300046474 | Bacteria | 6834 |
| 980 | Ga0495605_0042442 | 3300046474 | Bacteria | 2260 |
| 981 | Ga0495605_0108899 | 3300046474 | Bacteria | 1266 |
| 982 | Ga0495639_0000714 | 3300046475 | Bacteria | 15193 |
| 983 | Ga0495664_0003394 | 3300046477 | Bacteria | 8652 |
| 984 | Ga0495664_0224992 | 3300046477 | Bacteria | 1136 |
| 985 | Ga0495584_0001356 | 3300046491 | Bacteria | 14814 |
| 986 | Ga0495584_0004349 | 3300046491 | Bacteria | 7629 |
| 987 | Ga0495584_0004438 | 3300046491 | Bacteria | 7549 |
| 988 | Ga0495584_0020003 | 3300046491 | Bacteria | 3400 |
| 989 | Ga0495585_0005478 | 3300046492 | Bacteria | 7990 |
| 990 | Ga0495585_0022896 | 3300046492 | Bacteria | 3585 |
| 991 | Ga0495594_0003631 | 3300046499 | Bacteria | 7933 |
| 992 | Ga0495594_0188393 | 3300046499 | Bacteria | 1175 |
| 993 | Ga0495596_0012119 | 3300046500 | Bacteria | 3699 |
| 994 | Ga0495607_0000349 | 3300046501 | Bacteria | 47780 |
| 995 | Ga0495607_0000396 | 3300046501 | Bacteria | 44362 |
| 996 | Ga0495607_0001009 | 3300046501 | Bacteria | 25910 |
| 997 | Ga0495607_0001535 | 3300046501 | Bacteria | 20312 |
| 998 | Ga0495607_0003645 | 3300046501 | Bacteria | 11690 |
| 999 | Ga0495607_0005366 | 3300046501 | Bacteria | 9203 |
| 1000 | Ga0495607_0006278 | 3300046501 | Bacteria | 8378 |
| 1001 | Ga0495607_0021862 | 3300046501 | Bacteria | 4022 |
| 1002 | Ga0495607_0047000 | 3300046501 | Bacteria | 2530 |
| 1003 | Ga0495607_0059081 | 3300046501 | Bacteria | 2188 |
| 1004 | Ga0495607_0102701 | 3300046501 | Bacteria | 1528 |
| 1005 | Ga0495583_0000096 | 3300046506 | Bacteria | 151090 |
| 1006 | Ga0495583_0001432 | 3300046506 | Bacteria | 24231 |
| 1007 | Ga0495583_0006317 | 3300046506 | Bacteria | 7780 |
| 1008 | Ga0495583_0010134 | 3300046506 | Bacteria | 5533 |
| 1009 | Ga0495583_0010743 | 3300046506 | Bacteria | 5309 |
| 1010 | Ga0495583_0017557 | 3300046506 | Bacteria | 3794 |
| 1011 | Ga0495583_0050576 | 3300046506 | Bacteria | 1898 |
| 1012 | Ga0495606_0001112 | 3300046507 | Bacteria | 38418 |
| 1013 | Ga0495606_0002582 | 3300046507 | Bacteria | 20733 |
| 1014 | Ga0495606_0004094 | 3300046507 | Bacteria | 14816 |
| 1015 | Ga0495606_0008803 | 3300046507 | Bacteria | 8665 |
| 1016 | Ga0495606_0015513 | 3300046507 | Bacteria | 5864 |
| 1017 | Ga0495606_0016101 | 3300046507 | Bacteria | 5723 |
| 1018 | Ga0495608_0053847 | 3300046511 | Bacteria | 2661 |
| 1019 | Ga0495610_0000021 | 3300046512 | Bacteria | 336300 |
| 1020 | Ga0495610_0012081 | 3300046512 | Bacteria | 5222 |
| 1021 | Ga0495610_0034270 | 3300046512 | Bacteria | 2616 |
| 1022 | Ga0495616_0004161 | 3300046513 | Bacteria | 9170 |
| 1023 | Ga0495616_0025122 | 3300046513 | Bacteria | 3186 |
| 1024 | Ga0495616_0059646 | 3300046513 | Bacteria | 1876 |
| 1025 | Ga0495620_0000001 | 3300046515 | Bacteria | 386508 |
| 1026 | Ga0495620_0000002 | 3300046515 | Bacteria | 373737 |
| 1027 | Ga0495620_0000757 | 3300046515 | Bacteria | 19829 |
| 1028 | Ga0495620_0001337 | 3300046515 | Bacteria | 14977 |
| 1029 | Ga0495620_0004859 | 3300046515 | Bacteria | 7538 |
| 1030 | Ga0495628_0012932 | 3300046516 | Bacteria | 7028 |
| 1031 | Ga0495628_0180534 | 3300046516 | Bacteria | 1597 |
| 1032 | Ga0495630_0001621 | 3300046517 | Bacteria | 15640 |
| 1033 | Ga0495630_0024426 | 3300046517 | Bacteria | 4469 |
| 1034 | Ga0495631_0001469 | 3300046518 | Bacteria | 14301 |
| 1035 | Ga0495631_0014162 | 3300046518 | Bacteria | 3854 |
| 1036 | Ga0495631_0014537 | 3300046518 | Bacteria | 3796 |
| 1037 | Ga0495631_0032838 | 3300046518 | Bacteria | 2337 |
| 1038 | Ga0495632_0002507 | 3300046519 | Bacteria | 13918 |
| 1039 | Ga0495632_0004158 | 3300046519 | Bacteria | 9921 |
| 1040 | Ga0495632_0004287 | 3300046519 | Bacteria | 9736 |
| 1041 | Ga0495632_0023780 | 3300046519 | Bacteria | 3266 |
| 1042 | Ga0495632_0024047 | 3300046519 | Bacteria | 3243 |
| 1043 | Ga0495637_0000630 | 3300046520 | Bacteria | 24850 |
| 1044 | Ga0495637_0001225 | 3300046520 | Bacteria | 15558 |
| 1045 | Ga0495637_0001699 | 3300046520 | Bacteria | 12710 |
| 1046 | Ga0495637_0005266 | 3300046520 | Bacteria | 6619 |
| 1047 | Ga0495637_0018833 | 3300046520 | Bacteria | 3198 |
| 1048 | Ga0495643_0000303 | 3300046522 | Bacteria | 68802 |
| 1049 | Ga0495643_0000560 | 3300046522 | Bacteria | 45977 |
| 1050 | Ga0495643_0001685 | 3300046522 | Bacteria | 19270 |
| 1051 | Ga0495643_0002672 | 3300046522 | Bacteria | 13791 |
| 1052 | Ga0495643_0013070 | 3300046522 | Bacteria | 4986 |
| 1053 | Ga0495643_0015736 | 3300046522 | Bacteria | 4461 |
| 1054 | Ga0495643_0018964 | 3300046522 | Bacteria | 3984 |
| 1055 | Ga0495644_0003708 | 3300046523 | Bacteria | 6012 |
| 1056 | Ga0495644_0006504 | 3300046523 | Bacteria | 4525 |
| 1057 | Ga0495648_0000521 | 3300046524 | Bacteria | 41448 |
| 1058 | Ga0495648_0001868 | 3300046524 | Bacteria | 20138 |
| 1059 | Ga0495648_0008904 | 3300046524 | Bacteria | 7843 |
| 1060 | Ga0495648_0009937 | 3300046524 | Bacteria | 7303 |
| 1061 | Ga0495648_0020975 | 3300046524 | Bacteria | 4540 |
| 1062 | Ga0495648_0024807 | 3300046524 | Bacteria | 4072 |
| 1063 | Ga0495648_0025968 | 3300046524 | Bacteria | 3954 |
| 1064 | Ga0495648_0037701 | 3300046524 | Bacteria | 3102 |
| 1065 | Ga0495648_0093676 | 3300046524 | Bacteria | 1674 |
| 1066 | Ga0495666_0003007 | 3300046526 | Bacteria | 8461 |
| 1067 | Ga0495642_0001462 | 3300046528 | Bacteria | 10574 |
| 1068 | Ga0495642_0003590 | 3300046528 | Bacteria | 6101 |
| 1069 | Ga0495642_0003766 | 3300046528 | Bacteria | 5936 |
| 1070 | Ga0495652_0008745 | 3300046529 | Bacteria | 9218 |
| 1071 | Ga0495652_0056581 | 3300046529 | Bacteria | 3330 |
| 1072 | Ga0495652_0351409 | 3300046529 | Bacteria | 1056 |
| 1073 | Ga0495654_0000096 | 3300046530 | Bacteria | 99777 |
| 1074 | Ga0495654_0000102 | 3300046530 | Bacteria | 96991 |
| 1075 | Ga0495654_0000588 | 3300046530 | Bacteria | 29030 |
| 1076 | Ga0495654_0005166 | 3300046530 | Bacteria | 7614 |
| 1077 | Ga0495654_0007690 | 3300046530 | Bacteria | 5997 |
| 1078 | Ga0495654_0010751 | 3300046530 | Bacteria | 4971 |
| 1079 | Ga0495654_0013991 | 3300046530 | Bacteria | 4279 |
| 1080 | Ga0495654_0104304 | 3300046530 | Bacteria | 1301 |
| 1081 | Ga0495665_0021153 | 3300046531 | Bacteria | 3495 |
| 1082 | Ga0495640_0110106 | 3300046533 | Bacteria | 1800 |
| 1083 | Ga0495587_0001493 | 3300046536 | Bacteria | 15596 |
| 1084 | Ga0495587_0004848 | 3300046536 | Bacteria | 8828 |
| 1085 | Ga0495609_0000012 | 3300046538 | Bacteria | 333994 |
| 1086 | Ga0495609_0000079 | 3300046538 | Bacteria | 118997 |
| 1087 | Ga0495609_0001254 | 3300046538 | Bacteria | 17456 |
| 1088 | Ga0495609_0003270 | 3300046538 | Bacteria | 9357 |
| 1089 | Ga0495609_0005619 | 3300046538 | Bacteria | 6538 |
| 1090 | Ga0495609_0009678 | 3300046538 | Bacteria | 4652 |
| 1091 | Ga0495609_0057899 | 3300046538 | Bacteria | 1714 |
| 1092 | Ga0495597_0000016 | 3300046542 | Bacteria | 167456 |
| 1093 | Ga0495597_0021120 | 3300046542 | Bacteria | 3028 |
| 1094 | Ga0495645_0037723 | 3300046543 | Bacteria | 3524 |
| 1095 | Ga0495645_0131099 | 3300046543 | Bacteria | 1756 |
| 1096 | Ga0495645_0167920 | 3300046543 | Bacteria | 1512 |
| 1097 | Ga0495622_0000809 | 3300046557 | Bacteria | 17316 |
| 1098 | Ga0495622_0001364 | 3300046557 | Bacteria | 12491 |
| 1099 | Ga0495622_0029990 | 3300046557 | Bacteria | 2541 |
| 1100 | Ga0495633_0000034 | 3300046558 | Bacteria | 185552 |
| 1101 | Ga0495633_0031235 | 3300046558 | Bacteria | 2584 |
| 1102 | Ga0495667_0060055 | 3300046559 | Bacteria | 2494 |
| 1103 | Ga0495667_0118620 | 3300046559 | Bacteria | 1709 |
| 1104 | Ga0495667_0194558 | 3300046559 | Bacteria | 1299 |
| 1105 | Ga0495656_0001632 | 3300046615 | Bacteria | 7338 |
| 1106 | Ga0495668_0065953 | 3300046616 | Bacteria | 1992 |
| 1107 | Ga0495634_0000967 | 3300046642 | Bacteria | 27121 |
| 1108 | Ga0495611_0000656 | 3300046648 | Bacteria | 19743 |
| 1109 | Ga0495611_0016202 | 3300046648 | Bacteria | 3186 |
| 1110 | Ga0495611_0036628 | 3300046648 | Bacteria | 2178 |
| 1111 | Ga0495625_0000076 | 3300046660 | Bacteria | 163580 |
| 1112 | Ga0495625_0047649 | 3300046660 | Bacteria | 3089 |
| 1113 | Ga0495635_0000752 | 3300046663 | Bacteria | 21018 |
| 1114 | Ga0495635_0089474 | 3300046663 | Bacteria | 2106 |
| 1115 | Ga0495659_0001347 | 3300046664 | Bacteria | 8436 |
| 1116 | Ga0495659_0017477 | 3300046664 | Bacteria | 2377 |
| 1117 | Ga0495661_0000004 | 3300046665 | Bacteria | 555340 |
| 1118 | Ga0495661_0000099 | 3300046665 | Bacteria | 106462 |
| 1119 | Ga0495661_0000146 | 3300046665 | Bacteria | 82292 |
| 1120 | Ga0495661_0000773 | 3300046665 | Bacteria | 30663 |
| 1121 | Ga0495661_0025579 | 3300046665 | Bacteria | 3811 |
| 1122 | Ga0495661_0030918 | 3300046665 | Bacteria | 3404 |
| 1123 | Ga0495661_0042222 | 3300046665 | Bacteria | 2812 |
| 1124 | Ga0495661_0110881 | 3300046665 | Bacteria | 1529 |
| 1125 | Ga0495588_0004580 | 3300046674 | Bacteria | 6111 |
| 1126 | Ga0495599_0002296 | 3300046678 | Bacteria | 11119 |
| 1127 | Ga0495599_0015207 | 3300046678 | Bacteria | 4773 |
| 1128 | Ga0495623_0001889 | 3300046679 | Bacteria | 14069 |
| 1129 | Ga0495623_0006999 | 3300046679 | Bacteria | 7328 |
| 1130 | Ga0495646_0011937 | 3300046680 | Bacteria | 5525 |
| 1131 | Ga0495646_0037210 | 3300046680 | Bacteria | 3012 |
| 1132 | Ga0495669_0016103 | 3300046684 | Bacteria | 3201 |
| 1133 | Ga0495670_0002495 | 3300046691 | Bacteria | 9090 |
| 1134 | Ga0495670_0023981 | 3300046691 | Bacteria | 3012 |
| 1135 | Ga0495670_0034984 | 3300046691 | Bacteria | 2502 |
| 1136 | Ga0495671_0000024 | 3300046692 | Bacteria | 246812 |
| 1137 | Ga0495671_0000908 | 3300046692 | Bacteria | 21076 |
| 1138 | Ga0495671_0002113 | 3300046692 | Bacteria | 12706 |
| 1139 | Ga0495671_0002880 | 3300046692 | Bacteria | 10758 |
| 1140 | Ga0495671_0003585 | 3300046692 | Bacteria | 9480 |
| 1141 | Ga0495671_0004322 | 3300046692 | Bacteria | 8540 |
| 1142 | Ga0495671_0010611 | 3300046692 | Bacteria | 5094 |
| 1143 | Ga0495671_0018765 | 3300046692 | Bacteria | 3666 |
| 1144 | Ga0495649_0001633 | 3300046694 | Bacteria | 16680 |
| 1145 | Ga0495649_0003386 | 3300046694 | Bacteria | 10781 |
| 1146 | Ga0495649_0003919 | 3300046694 | Bacteria | 9844 |
| 1147 | Ga0495649_0008042 | 3300046694 | Bacteria | 6370 |
| 1148 | Ga0495649_0010145 | 3300046694 | Bacteria | 5567 |
| 1149 | Ga0495649_0049172 | 3300046694 | Bacteria | 2290 |
| 1150 | Ga0495589_0000003 | 3300046794 | Bacteria | 453448 |
| 1151 | Ga0495589_0000194 | 3300046794 | Bacteria | 53082 |
| 1152 | Ga0495589_0008684 | 3300046794 | Bacteria | 5291 |
| 1153 | Ga0495589_0024274 | 3300046794 | Bacteria | 3082 |
| 1154 | Ga0495589_0089809 | 3300046794 | Bacteria | 1492 |
| 1155 | Ga0495600_0046810 | 3300046809 | Bacteria | 2821 |
| 1156 | Ga0495660_0000017 | 3300046810 | Bacteria | 320655 |
| 1157 | Ga0495660_0000824 | 3300046810 | Bacteria | 23044 |
| 1158 | Ga0495660_0012602 | 3300046810 | Bacteria | 4906 |
| 1159 | Ga0495660_0020560 | 3300046810 | Bacteria | 3783 |
| 1160 | Ga0495660_0022401 | 3300046810 | Bacteria | 3607 |
| 1161 | Ga0495660_0023907 | 3300046810 | Bacteria | 3482 |
| 1162 | Ga0495604_0069019 | 3300047317 | Bacteria | 2680 |
| 1163 | Ga0495604_0081857 | 3300047317 | Bacteria | 2415 |
| 1164 | Ga0495604_0163470 | 3300047317 | Bacteria | 1571 |
| 1165 | Ga0495636_0000764 | 3300047318 | Bacteria | 11844 |
| 1166 | Ga0495674_0005437 | 3300047319 | Bacteria | 12235 |
| 1167 | Ga0495674_0007240 | 3300047319 | Bacteria | 10618 |
| 1168 | Ga0495674_0044383 | 3300047319 | Bacteria | 3953 |
| 1169 | Ga0495672_0000001 | 3300047320 | Bacteria | 1458820 |
| 1170 | Ga0495672_0004429 | 3300047320 | Bacteria | 11506 |
| 1171 | Ga0495672_0005100 | 3300047320 | Bacteria | 10485 |
| 1172 | Ga0495672_0008463 | 3300047320 | Bacteria | 7588 |
| 1173 | Ga0495672_0077988 | 3300047320 | Bacteria | 1854 |
| 1174 | Ga0495676_0000016 | 3300047321 | Bacteria | 196310 |
| 1175 | Ga0495680_0018000 | 3300047322 | Bacteria | 6011 |
| 1176 | Ga0495680_0038892 | 3300047322 | Bacteria | 3799 |
| 1177 | Ga0495680_0130297 | 3300047322 | Bacteria | 1849 |
| 1178 | Ga0495683_0000034 | 3300047323 | Bacteria | 148959 |
| 1179 | Ga0495683_0015091 | 3300047323 | Bacteria | 4022 |
| 1180 | Ga0495683_0036322 | 3300047323 | Bacteria | 2501 |
| 1181 | Ga0495683_0125868 | 3300047323 | Bacteria | 1212 |
| 1182 | Ga0495687_006222 | 3300047443 | Bacteria | 7365 |
| 1183 | Ga0495675_0033821 | 3300047444 | Bacteria | 3263 |
| 1184 | Ga0495675_0068006 | 3300047444 | Bacteria | 2251 |
| 1185 | Ga0495675_0273848 | 3300047444 | Bacteria | 1008 |
| 1186 | Ga0495677_0003900 | 3300047445 | Bacteria | 5768 |
| 1187 | Ga0495679_000087 | 3300047446 | Bacteria | 85691 |
| 1188 | Ga0495679_000377 | 3300047446 | Bacteria | 34132 |
| 1189 | Ga0495679_012040 | 3300047446 | Bacteria | 3313 |
| 1190 | Ga0495673_0000019 | 3300047469 | Bacteria | 554389 |
| 1191 | Ga0495673_0001933 | 3300047469 | Bacteria | 15387 |
| 1192 | Ga0495673_0002323 | 3300047469 | Bacteria | 13555 |
| 1193 | Ga0495673_0009651 | 3300047469 | Bacteria | 5321 |
| 1194 | Ga0495673_0015126 | 3300047469 | Bacteria | 3986 |
| 1195 | Ga0495673_0015438 | 3300047469 | Bacteria | 3935 |
| 1196 | Ga0495673_0027991 | 3300047469 | Bacteria | 2674 |
| 1197 | Ga0495673_0043729 | 3300047469 | Bacteria | 2002 |
| 1198 | Ga0495673_0097623 | 3300047469 | Bacteria | 1192 |
| 1199 | Ga0495681_0016581 | 3300047470 | Bacteria | 4121 |
| 1200 | Ga0495684_0000398 | 3300047471 | Bacteria | 35517 |
| 1201 | Ga0495684_0040686 | 3300047471 | Bacteria | 3563 |
| 1202 | Ga0495684_0195055 | 3300047471 | Bacteria | 1495 |
| 1203 | Ga0495686_0016655 | 3300047472 | Bacteria | 4977 |
| 1204 | Ga0495686_0075906 | 3300047472 | Bacteria | 2060 |
| 1205 | Ga0495593_0045035 | 3300047673 | Bacteria | 2356 |
| 1206 | Ga0495602_0015186 | 3300048088 | Bacteria | 7783 |
| 1207 | Ga0495602_0186702 | 3300048088 | Bacteria | 1593 |
| 1208 | Ga0495602_0194688 | 3300048088 | Bacteria | 1551 |
| 1209 | Ga0495615_0002290 | 3300048090 | Bacteria | 3049 |
| 1210 | Ga0495626_0000098 | 3300048091 | Bacteria | 113821 |
| 1211 | Ga0495626_0004696 | 3300048091 | Bacteria | 8284 |
| 1212 | Ga0495626_0006801 | 3300048091 | Bacteria | 6463 |
| 1213 | Ga0495626_0033602 | 3300048091 | Bacteria | 2457 |
| 1214 | Ga0495626_0038730 | 3300048091 | Bacteria | 2258 |
| 1215 | Ga0496102_0000991 | 3300048905 | Bacteria | 26693 |
| 1216 | Ga0496102_0034926 | 3300048905 | Bacteria | 4525 |
| 1217 | Ga0496103_0000997 | 3300048906 | Bacteria | 19928 |
| 1218 | Ga0496103_0048117 | 3300048906 | Bacteria | 2635 |
| 1219 | Ga0496104_0000260 | 3300048907 | Bacteria | 46567 |
| 1220 | Ga0496104_0148724 | 3300048907 | Bacteria | 2249 |
| 1221 | Ga0496104_0404671 | 3300048907 | Bacteria | 1277 |
| 1222 | Ga0496105_0000156 | 3300048908 | Bacteria | 45175 |
| 1223 | Ga0496105_0163634 | 3300048908 | Bacteria | 1826 |
| 1224 | Ga0496110_0009694 | 3300048913 | Bacteria | 7799 |
| 1225 | Ga0496110_0048656 | 3300048913 | Bacteria | 3717 |
| 1226 | Ga0496110_0056893 | 3300048913 | Bacteria | 3441 |
| 1227 | Ga0496110_0136059 | 3300048913 | Bacteria | 2220 |
| 1228 | Ga0496111_0126132 | 3300048914 | Bacteria | 1892 |
| 1229 | Ga0496112_0006585 | 3300048915 | Bacteria | 10224 |
| 1230 | Ga0496113_0173044 | 3300048916 | Bacteria | 1710 |
| 1231 | Ga0496114_0003707 | 3300048917 | Bacteria | 11759 |
| 1232 | Ga0496114_0061464 | 3300048917 | Bacteria | 3142 |
| 1233 | Ga0496115_0007686 | 3300048918 | Bacteria | 7946 |
| 1234 | Ga0496115_0024949 | 3300048918 | Bacteria | 4651 |
| 1235 | Ga0496115_0287935 | 3300048918 | Bacteria | 1348 |
| 1236 | Ga0496116_0000007 | 3300048919 | Bacteria | 795464 |
| 1237 | Ga0496116_0010359 | 3300048919 | Bacteria | 7826 |
| 1238 | Ga0496116_0045906 | 3300048919 | Bacteria | 2953 |
| 1239 | Ga0496117_0001323 | 3300048920 | Bacteria | 36451 |
| 1240 | Ga0496117_0001620 | 3300048920 | Bacteria | 31800 |
| 1241 | Ga0496117_0002783 | 3300048920 | Bacteria | 21400 |
| 1242 | Ga0496117_0003088 | 3300048920 | Bacteria | 19934 |
| 1243 | Ga0496117_0006308 | 3300048920 | Bacteria | 12062 |
| 1244 | Ga0496117_0012255 | 3300048920 | Bacteria | 7580 |
| 1245 | Ga0496117_0018402 | 3300048920 | Bacteria | 5786 |
| 1246 | Ga0496118_0002712 | 3300048921 | Bacteria | 23338 |
| 1247 | Ga0496118_0002985 | 3300048921 | Bacteria | 21881 |
| 1248 | Ga0496118_0006537 | 3300048921 | Bacteria | 12752 |
| 1249 | Ga0496118_0036587 | 3300048921 | Bacteria | 3965 |
| 1250 | Ga0496118_0052475 | 3300048921 | Bacteria | 3109 |
| 1251 | Ga0496119_0000612 | 3300048922 | Bacteria | 48284 |
| 1252 | Ga0496120_0001054 | 3300048923 | Bacteria | 36515 |
| 1253 | Ga0496120_0008485 | 3300048923 | Bacteria | 7452 |
| 1254 | Ga0496121_0007202 | 3300048924 | Bacteria | 13471 |
| 1255 | Ga0496121_0030502 | 3300048924 | Bacteria | 4951 |
| 1256 | Ga0496121_0034409 | 3300048924 | Bacteria | 4560 |
| 1257 | Ga0496121_0094533 | 3300048924 | Bacteria | 2325 |
| 1258 | Ga0496122_0001943 | 3300048925 | Bacteria | 31037 |
| 1259 | Ga0496122_0002404 | 3300048925 | Bacteria | 26680 |
| 1260 | Ga0496122_0007083 | 3300048925 | Bacteria | 12597 |
| 1261 | Ga0496122_0019738 | 3300048925 | Bacteria | 6141 |
| 1262 | Ga0496122_0022598 | 3300048925 | Bacteria | 5583 |
| 1263 | Ga0496123_0000439 | 3300048926 | Bacteria | 74838 |
| 1264 | Ga0496123_0001575 | 3300048926 | Bacteria | 31163 |
| 1265 | Ga0496123_0014417 | 3300048926 | Bacteria | 6553 |
| 1266 | Ga0496123_0026678 | 3300048926 | Bacteria | 4320 |
| 1267 | Ga0496123_0054519 | 3300048926 | Bacteria | 2631 |
| 1268 | Ga0496123_0058743 | 3300048926 | Bacteria | 2492 |
| 1269 | Ga0496124_0000132 | 3300048927 | Bacteria | 155405 |
| 1270 | Ga0496124_0001693 | 3300048927 | Bacteria | 31219 |
| 1271 | Ga0496124_0002023 | 3300048927 | Bacteria | 27562 |
| 1272 | Ga0496124_0006195 | 3300048927 | Bacteria | 13110 |
| 1273 | Ga0496124_0006210 | 3300048927 | Bacteria | 13091 |
| 1274 | Ga0496124_0015103 | 3300048927 | Bacteria | 7424 |
| 1275 | Ga0496124_0038452 | 3300048927 | Bacteria | 4155 |
| 1276 | Ga0496124_0045902 | 3300048927 | Bacteria | 3744 |
| 1277 | Ga0496124_0059474 | 3300048927 | Bacteria | 3210 |
| 1278 | Ga0496124_0060348 | 3300048927 | Bacteria | 3181 |
| 1279 | Ga0496124_0173557 | 3300048927 | Bacteria | 1666 |
| 1280 | Ga0496125_0000380 | 3300048928 | Bacteria | 82955 |
| 1281 | Ga0496125_0001691 | 3300048928 | Bacteria | 30828 |
| 1282 | Ga0496125_0004712 | 3300048928 | Bacteria | 15545 |
| 1283 | Ga0496125_0024615 | 3300048928 | Bacteria | 5530 |
| 1284 | Ga0496125_0038928 | 3300048928 | Bacteria | 4105 |
| 1285 | Ga0496125_0099344 | 3300048928 | Bacteria | 2150 |
| 1286 | Ga0496126_0000101 | 3300048929 | Bacteria | 201606 |
| 1287 | Ga0496126_0097180 | 3300048929 | Bacteria | 2581 |
| 1288 | Ga0496126_0154973 | 3300048929 | Bacteria | 1961 |
| 1289 | Ga0496126_0339330 | 3300048929 | Bacteria | 1231 |
| 1290 | Ga0496126_0388229 | 3300048929 | Bacteria | 1135 |
| 1291 | Ga0495678_000049 | 3300049459 | Bacteria | 163929 |
| 1292 | Ga0495678_000579 | 3300049459 | Bacteria | 34743 |
| 1293 | Ga0495678_002688 | 3300049459 | Bacteria | 11735 |
| 1294 | Ga0495678_006374 | 3300049459 | Bacteria | 6291 |
| 1295 | Ga0495678_008976 | 3300049459 | Bacteria | 4993 |
| 1296 | Ga0495678_039896 | 3300049459 | Bacteria | 1890 |
| 1297 | Ga0495678_080824 | 3300049459 | Bacteria | 1167 |
| 1298 | Ga0495682_0000011 | 3300049460 | Bacteria | 278474 |
| 1299 | Ga0495682_0000128 | 3300049460 | Bacteria | 65703 |
| 1300 | Ga0495682_0001668 | 3300049460 | Bacteria | 11355 |
| 1301 | Ga0495682_0017012 | 3300049460 | Bacteria | 2749 |
| 1302 | Ga0495682_0019899 | 3300049460 | Bacteria | 2521 |
| 1303 | Ga0501031_0011752 | 3300049568 | Bacteria | 5711 |
| 1304 | Ga0501031_0030930 | 3300049568 | Bacteria | 3493 |
| 1305 | Ga0501032_0001038 | 3300049569 | Bacteria | 22303 |
| 1306 | Ga0501032_0001256 | 3300049569 | Bacteria | 20363 |
| 1307 | Ga0501032_0006131 | 3300049569 | Bacteria | 8855 |
| 1308 | Ga0501032_0009678 | 3300049569 | Bacteria | 6982 |
| 1309 | Ga0501033_0003841 | 3300049570 | Bacteria | 12212 |
| 1310 | Ga0501033_0007400 | 3300049570 | Bacteria | 8549 |
| 1311 | Ga0501033_0009063 | 3300049570 | Bacteria | 7677 |
| 1312 | Ga0501033_0016351 | 3300049570 | Bacteria | 5619 |
| 1313 | Ga0501034_0000041 | 3300049571 | Bacteria | 229264 |
| 1314 | Ga0501034_0002365 | 3300049571 | Bacteria | 22914 |
| 1315 | Ga0501034_0008207 | 3300049571 | Bacteria | 11064 |
| 1316 | Ga0501034_0020051 | 3300049571 | Bacteria | 6828 |
| 1317 | Ga0501034_0030857 | 3300049571 | Bacteria | 5447 |
| 1318 | Ga0501034_0127735 | 3300049571 | Bacteria | 2527 |
| 1319 | Ga0501034_0324523 | 3300049571 | Bacteria | 1472 |
| 1320 | Ga0501036_0000583 | 3300049572 | Bacteria | 26372 |
| 1321 | Ga0501036_0000764 | 3300049572 | Bacteria | 23858 |
| 1322 | Ga0501037_0002333 | 3300049573 | Bacteria | 13707 |
| 1323 | Ga0501037_0014890 | 3300049573 | Bacteria | 5721 |
| 1324 | Ga0501037_0040016 | 3300049573 | Bacteria | 3450 |
| 1325 | Ga0501037_0124890 | 3300049573 | Bacteria | 1848 |
| 1326 | Ga0501037_0134521 | 3300049573 | Bacteria | 1771 |
| 1327 | Ga0501038_0003064 | 3300049574 | Bacteria | 15576 |
| 1328 | Ga0501038_0007027 | 3300049574 | Bacteria | 10398 |
| 1329 | Ga0501038_0007681 | 3300049574 | Bacteria | 9943 |
| 1330 | Ga0501038_0020808 | 3300049574 | Bacteria | 5896 |
| 1331 | Ga0501038_0157567 | 3300049574 | Bacteria | 1848 |
| 1332 | Ga0501039_0004609 | 3300049575 | Bacteria | 10423 |
| 1333 | Ga0501039_0011648 | 3300049575 | Bacteria | 6697 |
| 1334 | Ga0501039_0171108 | 3300049575 | Bacteria | 1708 |
| 1335 | Ga0501040_0009107 | 3300049576 | Bacteria | 6463 |
| 1336 | Ga0501040_0106982 | 3300049576 | Bacteria | 1954 |
| 1337 | Ga0501042_0003284 | 3300049578 | Bacteria | 10121 |
| 1338 | Ga0501042_0142376 | 3300049578 | Bacteria | 1729 |
| 1339 | Ga0501043_0004581 | 3300049579 | Bacteria | 11214 |
| 1340 | Ga0501043_0005319 | 3300049579 | Bacteria | 10404 |
| 1341 | Ga0501043_0006282 | 3300049579 | Bacteria | 9537 |
| 1342 | Ga0501043_0035508 | 3300049579 | Bacteria | 3921 |
| 1343 | Ga0501043_0139463 | 3300049579 | Bacteria | 1899 |
| 1344 | Ga0501046_0000889 | 3300049580 | Bacteria | 29096 |
| 1345 | Ga0501046_0001127 | 3300049580 | Bacteria | 26110 |
| 1346 | Ga0501046_0050465 | 3300049580 | Bacteria | 3287 |
| 1347 | Ga0501047_0002434 | 3300049581 | Bacteria | 17788 |
| 1348 | Ga0501048_0005502 | 3300049582 | Bacteria | 9636 |
| 1349 | Ga0501048_0031545 | 3300049582 | Bacteria | 3833 |
| 1350 | Ga0501067_0012770 | 3300049583 | Bacteria | 4653 |
| 1351 | Ga0501068_0011869 | 3300049584 | Bacteria | 4925 |
| 1352 | Ga0501068_0129193 | 3300049584 | Bacteria | 1579 |
| 1353 | Ga0501069_0000937 | 3300049585 | Bacteria | 13931 |
| 1354 | Ga0501070_0030461 | 3300049586 | Bacteria | 4521 |
| 1355 | Ga0501072_0011524 | 3300049588 | Bacteria | 6757 |
| 1356 | Ga0501073_0026765 | 3300049589 | Bacteria | 4129 |
| 1357 | Ga0501076_0205757 | 3300049592 | Bacteria | 1608 |
| 1358 | Ga0501077_0004163 | 3300049593 | Bacteria | 8737 |
| 1359 | Ga0501079_0028748 | 3300049741 | Bacteria | 4267 |
| 1360 | Ga0501080_0145730 | 3300049742 | Bacteria | 2189 |
| 1361 | Ga0501081_0181438 | 3300049743 | Bacteria | 1523 |
| 1362 | Ga0501083_0002458 | 3300049744 | Bacteria | 12688 |
| 1363 | Ga0501083_0007866 | 3300049744 | Bacteria | 7552 |
| 1364 | Ga0501035_0000158 | 3300049822 | Bacteria | 82890 |
| 1365 | Ga0501035_0003883 | 3300049822 | Bacteria | 14259 |
| 1366 | Ga0501035_0006972 | 3300049822 | Bacteria | 10552 |
| 1367 | Ga0501035_0191013 | 3300049822 | Bacteria | 1761 |
| 1368 | Ga0501044_0000190 | 3300049823 | Bacteria | 77415 |
| 1369 | Ga0501044_0015234 | 3300049823 | Bacteria | 8282 |
| 1370 | Ga0501044_0028814 | 3300049823 | Bacteria | 5857 |
| 1371 | Ga0501044_0084786 | 3300049823 | Bacteria | 3201 |
| 1372 | Ga0501044_0126007 | 3300049823 | Bacteria | 2559 |
| 1373 | Ga0501044_0164704 | 3300049823 | Bacteria | 2192 |
| 1374 | Ga0501044_0253119 | 3300049823 | Bacteria | 1701 |
| 1375 | Ga0501045_0001759 | 3300049824 | Bacteria | 14603 |
| 1376 | Ga0501226_000007 | 3300049853 | Bacteria | 227827 |
| 1377 | nmdc:mga05p37_2980_c1 | 3300050507 | Bacteria | 19673 |
| 1378 | nmdc:mga06r32_274823_c1 | 3300050510 | Bacteria | 1672 |
| 1379 | nmdc:mga08y16_181967_c1 | 3300050511 | Bacteria | 2182 |
| 1380 | nmdc:mga08y16_6325_c1 | 3300050511 | Bacteria | 12421 |
| 1381 | nmdc:mga08y16_95630_c1 | 3300050511 | Bacteria | 3094 |
| 1382 | nmdc:mga08x19_624_c1 | 3300050514 | Bacteria | 22809 |
| 1383 | Ga0495601_0021931 | 3300053077 | Bacteria | 3917 |
| 1384 | Ga0495601_0248421 | 3300053077 | Bacteria | 1162 |
| 1385 | Ga0495612_0024226 | 3300053078 | Bacteria | 2437 |
| 1386 | Ga0500595_007403 | 3300053119 | Bacteria | 4556 |
| 1387 | Ga0500618_005360 | 3300053125 | Bacteria | 3913 |
| 1388 | Ga0500621_000005 | 3300053126 | Bacteria | 320383 |
| 1389 | Ga0500659_0035137 | 3300053135 | Bacteria | 2731 |
| 1390 | Ga0500564_013234 | 3300053138 | Bacteria | 3688 |
| 1391 | Ga0500568_0005172 | 3300053139 | Bacteria | 6802 |
| 1392 | Ga0500604_0053869 | 3300053151 | Bacteria | 1248 |
| 1393 | Ga0500616_0035421 | 3300053153 | Bacteria | 2714 |
| 1394 | Ga0501084_0001126 | 3300054114 | Bacteria | 20857 |
| 1395 | Ga0501084_0019920 | 3300054114 | Bacteria | 5592 |
| 1396 | Ga0590071_005287 | 3300059421 | Bacteria | 3112 |
| 1397 | Ga0501082_0005501 | 3300060353 | Bacteria | 10993 |
| 1398 | 640488419 | 640427133 | Bacteria | 4567418 |
| 1399 | 2506579725 | 2506520007 | Bacteria | 5442880 |
| 1400 | 2506584864 | 2506520008 | Bacteria | 5443009 |
| 1401 | 2508853525 | 2508501071 | Bacteria | 5454741 |
| 1402 | 2510285074 | 2510065053 | Bacteria | 5005518 |
| 1403 | 2511254484 | 2511231004 | Bacteria | 6669789 |
| 1404 | 2511269701 | 2511231007 | Bacteria | 6306603 |
| 1405 | 2511298767 | 2511231011 | Bacteria | 6149768 |
| 1406 | 2511329179 | 2511231016 | Bacteria | 6704427 |
| 1407 | 2511341334 | 2511231018 | Bacteria | 6436256 |
| 1408 | 2511347513 | 2511231019 | Bacteria | 6520662 |
| 1409 | 2511360643 | 2511231022 | Bacteria | 6719296 |
| 1410 | 2511374796 | 2511231024 | Bacteria | 5835885 |
| 1411 | 2528203243 | 2527291627 | Bacteria | 5309833 |
| 1412 | 2528214404 | 2527291629 | Bacteria | 5267418 |
| 1413 | 2538426471 | 2537561728 | Bacteria | 5149301 |
| 1414 | 2546947887 | 2546825537 | Bacteria | 5389291 |
| 1415 | 2547373094 | 2547132103 | Bacteria | 5115736 |
| 1416 | 2548846078 | 2547132512 | Bacteria | 3416496 |
| 1417 | 2552746416 | 2551306352 | Bacteria | 3873115 |
| 1418 | 2555246088 | 2554235231 | Bacteria | 5215788 |
| 1419 | 2566034961 | 2565956521 | Bacteria | 4468993 |
| 1420 | 2579749772 | 2576861822 | Bacteria | 5004595 |
| 1421 | 2579858337 | 2579778521 | Bacteria | 7624758 |
| 1422 | 2597862830 | 2597489888 | Bacteria | 6179543 |
| 1423 | 2597868631 | 2597489889 | Bacteria | 6297495 |
| 1424 | 2599328570 | 2599185155 | Bacteria | 5827168 |
| 1425 | 2599396608 | 2599185167 | Bacteria | 6353609 |
| 1426 | 2599453332 | 2599185179 | Bacteria | 6611171 |
| 1427 | 2599503933 | 2599185188 | Bacteria | 6164180 |
| 1428 | 2599507589 | 2599185189 | Bacteria | 5862825 |
| 1429 | 2599514664 | 2599185190 | Bacteria | 6285678 |
| 1430 | 2599517405 | 2599185191 | Bacteria | 6297582 |
| 1431 | 2599772729 | 2599185248 | Bacteria | 6696816 |
| 1432 | 2599889226 | 2599185289 | Bacteria | 6778765 |
| 1433 | 2599894071 | 2599185290 | Bacteria | 6289611 |
| 1434 | 2599896547 | 2599185291 | Bacteria | 6775623 |
| 1435 | 2599926649 | 2599185299 | Bacteria | 4854625 |
| 1436 | 2599931901 | 2599185300 | Bacteria | 6062622 |
| 1437 | 2599945551 | 2599185302 | Bacteria | 5954930 |
| 1438 | 2599956669 | 2599185304 | Bacteria | 5951361 |
| 1439 | 2599962622 | 2599185305 | Bacteria | 6748700 |
| 1440 | 2599965242 | 2599185306 | Bacteria | 6637356 |
| 1441 | 2599973907 | 2599185307 | Bacteria | 6194719 |
| 1442 | 2599978788 | 2599185308 | Bacteria | 6621546 |
| 1443 | 2599985409 | 2599185309 | Bacteria | 5969593 |
| 1444 | 2599991840 | 2599185310 | Bacteria | 6014457 |
| 1445 | 2599996561 | 2599185311 | Bacteria | 6354990 |
| 1446 | 2600002363 | 2599185312 | Bacteria | 5912071 |
| 1447 | 2600006884 | 2599185313 | Bacteria | 6658188 |
| 1448 | 2600010474 | 2599185314 | Bacteria | 6621749 |
| 1449 | 2600021397 | 2599185315 | Bacteria | 6771107 |
| 1450 | 2600026382 | 2599185316 | Bacteria | 6320029 |
| 1451 | 2600032463 | 2599185317 | Bacteria | 6435722 |
| 1452 | 2600036318 | 2599185318 | Bacteria | 6961590 |
| 1453 | 2600043615 | 2599185319 | Bacteria | 6637840 |
| 1454 | 2600049896 | 2599185320 | Bacteria | 5963263 |
| 1455 | 2600053523 | 2599185321 | Bacteria | 6764560 |
| 1456 | 2600061461 | 2599185322 | Bacteria | 6763055 |
| 1457 | 2600067385 | 2599185323 | Bacteria | 6688755 |
| 1458 | 2600070392 | 2599185324 | Bacteria | 6590677 |
| 1459 | 2600080220 | 2599185325 | Bacteria | 6324919 |
| 1460 | 2600362025 | 2600254930 | Bacteria | 6431253 |
| 1461 | 2601626537 | 2600255283 | Bacteria | 6061572 |
| 1462 | 2601691366 | 2600255296 | Bacteria | 5784754 |
| 1463 | 2624493752 | 2623620446 | Bacteria | 6500345 |
| 1464 | 2626635872 | 2626541554 | Bacteria | 7741902 |
| 1465 | 2644187584 | 2643221633 | Bacteria | 6733554 |
| 1466 | 2644283634 | 2643221650 | Bacteria | 7029547 |
| 1467 | 2644625113 | 2643221713 | Bacteria | 6554480 |
| 1468 | 2649121677 | 2648501241 | Bacteria | 5312320 |
| 1469 | 2652547489 | 2651869719 | Bacteria | 6047974 |
| 1470 | 2652975972 | 2651869818 | Bacteria | 5864031 |
| 1471 | 2656276837 | 2654587920 | Bacteria | 5475511 |
| 1472 | 2671090423 | 2667528170 | Bacteria | 6786960 |
| 1473 | 2671130395 | 2667528176 | Bacteria | 6724917 |
| 1474 | 2677896682 | 2675903420 | Bacteria | 6247433 |
| 1475 | 2678229663 | 2675903507 | Bacteria | 3737791 |
| 1476 | 2678262380 | 2675903515 | Bacteria | 6580491 |
| 1477 | 2686356135 | 2684622997 | Bacteria | 4624240 |
| 1478 | 2686541628 | 2684623036 | Bacteria | 5199090 |
| 1479 | 2687238447 | 2684623219 | Bacteria | 8442773 |
| 1480 | 2687239187 | 2684623219 | Bacteria | 8442773 |
| 1481 | 2688393533 | 2687453341 | Bacteria | 6534136 |
| 1482 | 2688394040 | 2687453341 | Bacteria | 6534136 |
| 1483 | 2689446254 | 2687453601 | Bacteria | 5546041 |
| 1484 | 2707100223 | 2706794495 | Bacteria | 4536932 |
| 1485 | 2710604992 | 2710264753 | Bacteria | 5455564 |
| 1486 | 2723247659 | 2721755607 | Bacteria | 5841722 |
| 1487 | 2729147406 | 2728369097 | Bacteria | 4333476 |
| 1488 | 2738691410 | 2738541271 | Bacteria | 5657310 |
| 1489 | 2739267185 | 2738543016 | Bacteria | 5657564 |
| 1490 | 2739290022 | 2738543020 | Bacteria | 5718238 |
| 1491 | 2739295334 | 2738543021 | Bacteria | 5718241 |
| 1492 | 2745008726 | 2744054620 | Bacteria | 6551379 |
| 1493 | 2745162055 | 2744054655 | Bacteria | 3552603 |
| 1494 | 2765582576 | 2765235841 | Bacteria | 6137024 |
| 1495 | 2772440165 | 2772190666 | Bacteria | 5117644 |
| 1496 | 2774121349 | 2773857670 | Bacteria | 6407454 |
| 1497 | 2774135982 | 2773857673 | Bacteria | 6513460 |
| 1498 | 2774391356 | 2773857761 | Bacteria | 3837365 |
| 1499 | 2774436090 | 2773857770 | Bacteria | 3911866 |
| 1500 | 2774864360 | 2773857924 | Bacteria | 5256821 |
| 1501 | 2784259992 | 2784132063 | Bacteria | 6262788 |
| 1502 | 2784317308 | 2784132072 | Bacteria | 6596533 |
| 1503 | 2794596176 | 2791355520 | Bacteria | 5948615 |
| 1504 | 2807409656 | 2806310737 | Bacteria | 5751088 |
| 1505 | 2807457957 | 2806310745 | Bacteria | 5742165 |
| 1506 | 2808858227 | 2808606361 | Bacteria | 6136259 |
| 1507 | 2808904563 | 2808606373 | Bacteria | 4423627 |
| 1508 | 2808924150 | 2808606376 | Bacteria | 6248667 |
| 1509 | 2808938384 | 2808606378 | Bacteria | 6177535 |
| 1510 | 2808941811 | 2808606379 | Bacteria | 5022697 |
| 1511 | 2808946091 | 2808606380 | Bacteria | 6248705 |
| 1512 | 2808957514 | 2808606382 | Bacteria | 6841132 |
| 1513 | 2808966712 | 2808606383 | Bacteria | 6138645 |
| 1514 | 2809001542 | 2808606389 | Bacteria | 6138126 |
| 1515 | 2809125354 | 2808606414 | Bacteria | 4917181 |
| 1516 | 2812367911 | 2811994881 | Bacteria | 6298475 |
| 1517 | 2813727714 | 2811995292 | Bacteria | 5303342 |
| 1518 | 2819654504 | 2818991456 | Bacteria | 6123676 |
| 1519 | 2825653259 | 2825651385 | Bacteria | 6715909 |
| 1520 | 2826584468 | 2826581358 | Bacteria | 5963467 |
| 1521 | 2842810088 | 2842805378 | Bacteria | 5385175 |
| 1522 | 2842818035 | 2842815866 | Bacteria | 5947510 |
| 1523 | 2842840061 | 2842837860 | Bacteria | 6066181 |
| 1524 | 2842849342 | 2842849001 | Bacteria | 5924277 |
| 1525 | 2842858989 | 2842854478 | Bacteria | 6143501 |
| 1526 | 2843691833 | 2843690924 | Bacteria | 5169057 |
| 1527 | 2846041089 | 2846037992 | Bacteria | 4526407 |
| 1528 | 2846542270 | 2846540461 | Bacteria | 5471451 |
| 1529 | 2852107147 | 2852103415 | Bacteria | 5193810 |
| 1530 | 2852658718 | 2852657418 | Bacteria | 6472974 |
| 1531 | 2854605894 | 2854601825 | Bacteria | 4797592 |
| 1532 | 2855196988 | 2855195626 | Bacteria | 4927512 |
| 1533 | 2858467416 | 2858466076 | Bacteria | 4722413 |
| 1534 | 2860340223 | 2860339153 | Bacteria | 6846989 |
| 1535 | 2869555603 | 2869551831 | Bacteria | 5474685 |
| 1536 | 2871273881 | 2871272651 | Bacteria | 5042015 |
| 1537 | 2871283649 | 2871282230 | Bacteria | 4917173 |
| 1538 | 2880232108 | 2880230671 | Bacteria | 6140320 |
| 1539 | 2887631791 | 2887630918 | Bacteria | 3239855 |
| 1540 | 2888370254 | 2888366609 | Bacteria | 5155009 |
| 1541 | 2888377233 | 2888373701 | Bacteria | 5098052 |
| 1542 | 2900054533 | 2900051742 | Bacteria | 4985156 |
| 1543 | 2904522362 | 2904518522 | Bacteria | 6068986 |
| 1544 | 2912965141 | 2912963787 | Bacteria | 5646108 |
| 1545 | 2913038352 | 2913036834 | Bacteria | 6704877 |
| 1546 | 2916182991 | 2916178963 | Bacteria | 5265078 |
| 1547 | 2916702311 | 2916699645 | Bacteria | 3568996 |
| 1548 | 2919160059 | 2919155634 | Bacteria | 4860545 |
| 1549 | 2919185239 | 2919182534 | Bacteria | 3907101 |
| 1550 | 2919481620 | 2919481497 | Bacteria | 6907839 |
| 1551 | 2919496615 | 2919493220 | Bacteria | 4598500 |
| 1552 | 2919500817 | 2919497567 | Bacteria | 4408621 |
| 1553 | 2919509235 | 2919506607 | Bacteria | 3392955 |
| 1554 | 2919547101 | 2919543075 | Bacteria | 4728703 |
| 1555 | 2919700339 | 2919697872 | Bacteria | 6553725 |
| 1556 | 2923521962 | 2923519811 | Bacteria | 6298479 |
| 1557 | 2923529294 | 2923525760 | Bacteria | 4472324 |
| 1558 | 2923587523 | 2923586266 | Bacteria | 6565975 |
| 1559 | 2929145797 | 2929144301 | Bacteria | 6622272 |
| 1560 | 2931370863 | 2931369376 | Bacteria | 6847892 |
| 1561 | 2931392496 | 2931390751 | Bacteria | 6273349 |
| 1562 | 2931399874 | 2931396565 | Bacteria | 7251677 |
| 1563 | 2932410748 | 2932406140 | Bacteria | 5134491 |
| 1564 | 2937968796 | 2937967321 | Bacteria | 5094075 |
| 1565 | 2939582212 | 2939577877 | Bacteria | 5132791 |
| 1566 | 2939653501 | 2939651529 | Bacteria | 5895393 |
| 1567 | 2945929108 | 2945928738 | Bacteria | 6053221 |
| 1568 | 2945961817 | 2945961074 | Bacteria | 7342064 |
| 1569 | 2946011338 | 2946006987 | Bacteria | 6705746 |
| 1570 | 2984569470 | 2984568884 | Bacteria | 3884413 |
| 1571 | 2988733332 | 2988728565 | Bacteria | 6124362 |
| 1572 | 3007256756 | 3007252601 | Bacteria | 4559114 |
| 1573 | 3007319005 | 3007315729 | Bacteria | 5076637 |
| 1574 | 3007421130 | 3007419365 | Bacteria | 7026924 |
| 1575 | 3007512825 | 3007511990 | Bacteria | 6481491 |
| 1576 | 3007806354 | 3007803356 | Bacteria | 5931491 |
| 1577 | 3007867986 | 3007866637 | Bacteria | 5899198 |
| 1578 | 3007876025 | 3007872151 | Bacteria | 5268868 |
| 1579 | 637879757 | 637000116 | Bacteria | 5433628 |
| 1580 | 640939000 | 640753048 | Bacteria | 5495657 |
| 1581 | 651176454 | 651053060 | Bacteria | 4689946 |
| 1582 | 8002317854 | 8002317523 | Bacteria | 8051857 |
| 1583 | 8002746318 | 8002745576 | Bacteria | 4840272 |
| 1584 | 8004596328 | 8004592986 | Bacteria | 5122074 |
| 1585 | 8015397568 | 8015394850 | Bacteria | 5064660 |
| 1586 | 8019776994 | 8019775933 | Bacteria | 6858656 |
| 1587 | 8052498645 | 8052494512 | Bacteria | 5765634 |
| 1588 | 8054351917 | 8054347763 | Bacteria | 5901107 |
| 1589 | 8054914687 | 8054913762 | Bacteria | 7713009 |
| 1590 | 8054933913 | 8054929484 | Bacteria | 5599761 |
| 1591 | 8055695288 | 8055693939 | Bacteria | 4772047 |
| 1592 | 8055819527 | 8055817908 | Bacteria | 6609162 |
| 1593 | 8055880244 | 8055878733 | Bacteria | 5907058 |
| 1594 | 8056119958 | 8056115690 | Bacteria | 5527654 |
| 1595 | 8056122118 | 8056120720 | Bacteria | 5758328 |
| 1596 | 8056141600 | 8056137416 | Bacteria | 6147080 |
| 1597 | 8056147478 | 8056143049 | Bacteria | 6307666 |
| 1598 | 8056159314 | 8056155041 | Bacteria | 6486948 |
| 1599 | 8056164810 | 8056161164 | Bacteria | 6106669 |
| 1600 | MRS2a_Contig_6404 | |||
| 1601 | MRS2a_Contig_914 | |||
| 1602 | SwRhRL2b_contig_2277002 | |||
| 1603 | JGI25162J39368_1000100 | |||
| 1604 | JGI25163J39215_1000894 | |||
| 1605 | JGI25164J39214_1000079 | |||
| 1606 | JGI25165J46597_1000183 | |||
| 1607 | Ga0055538_1000078 | |||
| 1608 | Ga0055539_1000119 | |||
| 1609 | Ga0055533_1000127 | |||
| 1610 | Ga0055532_1000068 | |||
| 1611 | Ga0055525_1000163 | |||
| 1612 | Ga0055536_1016854 | |||
| 1613 | Ga0055541_1000079 | |||
| 1614 | Ga0058692_1000067 | |||
| 1615 | Ga0058692_1000911 | |||
| 1616 | Ga0058692_1017134 | |||
| 1617 | Ga0065714_10001613 | |||
| 1618 | Ga0065714_10067998 | |||
| 1619 | Ga0065704_10003637 | |||
| 1620 | Ga0065704_10006591 | |||
| 1621 | Ga0065712_10002299 | |||
| 1622 | Ga0065715_10005136 | |||
| 1623 | Ga0070658_10077856 | |||
| 1624 | Ga0070683_100022822 | |||
| 1625 | Ga0070683_100025908 | |||
| 1626 | Ga0070683_100043891 | |||
| 1627 | Ga0070683_100063164 | |||
| 1628 | Ga0070683_100065855 | |||
| 1629 | Ga0070683_100100147 | |||
| 1630 | Ga0070683_100128431 | |||
| 1631 | Ga0070683_100318770 | |||
| 1632 | Ga0070690_100190414 | |||
| 1633 | Ga0070670_100000018 | |||
| 1634 | Ga0070670_100135408 | |||
| 1635 | Ga0068869_100135873 | |||
| 1636 | Ga0070682_100039334 | |||
| 1637 | Ga0068868_100031941 | |||
| 1638 | Ga0070660_100017653 | |||
| 1639 | Ga0070691_10001552 | |||
| 1640 | Ga0070691_10012197 | |||
| 1641 | Ga0070661_100192544 | |||
| 1642 | Ga0070668_100375171 | |||
| 1643 | Ga0070669_100000954 | |||
| 1644 | Ga0070675_100092910 | |||
| 1645 | Ga0070671_100000084 | |||
| 1646 | Ga0070671_100249178 | |||
| 1647 | Ga0070688_100000916 | |||
| 1648 | Ga0070659_100012188 | |||
| 1649 | Ga0070667_100000002 | |||
| 1650 | Ga0070714_100038188 | |||
| 1651 | Ga0070714_100042300 | |||
| 1652 | Ga0070714_100047786 | |||
| 1653 | Ga0070714_100096603 | |||
| 1654 | Ga0070714_100222041 | |||
| 1655 | Ga0070713_100013534 | |||
| 1656 | Ga0070713_100017674 | |||
| 1657 | Ga0070713_100049646 | |||
| 1658 | Ga0070713_100436349 | |||
| 1659 | Ga0070710_10103815 | |||
| 1660 | Ga0070711_100016406 | |||
| 1661 | Ga0070711_100079683 | |||
| 1662 | Ga0070708_100168989 | |||
| 1663 | Ga0070708_100182915 | |||
| 1664 | Ga0070663_100328580 | |||
| 1665 | Ga0070678_100259453 | |||
| 1666 | Ga0070662_100326916 | |||
| 1667 | Ga0070681_10013442 | |||
| 1668 | Ga0070681_10031212 | |||
| 1669 | Ga0070681_10107898 | |||
| 1670 | Ga0070681_10146899 | |||
| 1671 | Ga0070685_10000009 | |||
| 1672 | Ga0070706_100001466 | |||
| 1673 | Ga0070706_100325542 | |||
| 1674 | Ga0070707_100005111 | |||
| 1675 | Ga0070707_100061755 | |||
| 1676 | Ga0070699_100184904 | |||
| 1677 | Ga0070699_100191326 | |||
| 1678 | Ga0070679_100003415 | |||
| 1679 | Ga0070679_100070265 | |||
| 1680 | Ga0070679_100198544 | |||
| 1681 | Ga0070679_100255785 | |||
| 1682 | Ga0070684_100002254 | |||
| 1683 | Ga0070684_100060988 | |||
| 1684 | Ga0070684_100079773 | |||
| 1685 | Ga0070684_100128047 | |||
| 1686 | Ga0070684_100208463 | |||
| 1687 | Ga0070684_100240764 | |||
| 1688 | Ga0068853_100013136 | |||
| 1689 | Ga0068853_100042324 | |||
| 1690 | Ga0070696_100000147 | |||
| 1691 | Ga0070696_100004865 | |||
| 1692 | Ga0070665_100004663 | |||
| 1693 | Ga0070665_100060824 | |||
| 1694 | Ga0070665_100083206 | |||
| 1695 | Ga0068855_100004962 | |||
| 1696 | Ga0068855_100015449 | |||
| 1697 | Ga0068855_100390540 | |||
| 1698 | Ga0070664_100145049 | |||
| 1699 | Ga0070664_100267301 | |||
| 1700 | Ga0068857_100000451 | |||
| 1701 | Ga0068857_100006173 | |||
| 1702 | Ga0068857_100039946 | |||
| 1703 | Ga0068856_100000957 | |||
| 1704 | Ga0068856_100045631 | |||
| 1705 | Ga0068856_100144072 | |||
| 1706 | Ga0068852_100005614 | |||
| 1707 | Ga0068852_100012657 | |||
| 1708 | Ga0068864_100000002 | |||
| 1709 | Ga0068863_100132291 | |||
| 1710 | Ga0068858_100012945 | |||
| 1711 | Ga0068858_100033049 | |||
| 1712 | Ga0068858_100117640 | |||
| 1713 | Ga0068858_100136070 | |||
| 1714 | Ga0068858_100162062 | |||
| 1715 | Ga0068860_100000499 | |||
| 1716 | Ga0068862_100005568 | |||
| 1717 | Ga0081455_10032641 | |||
| 1718 | Ga0070717_10307513 | |||
| 1719 | Ga0075366_10038768 | |||
| 1720 | Ga0097621_100061966 | |||
| 1721 | Ga0068871_100013774 | |||
| 1722 | Ga0068871_100137250 | |||
| 1723 | Ga0068871_100205207 | |||
| 1724 | Ga0075428_100050306 | |||
| 1725 | Ga0075436_100004138 | |||
| 1726 | Ga0097620_100173920 | |||
| 1727 | Ga0099823_1000074 | |||
| 1728 | Ga0099823_1063482 | |||
| 1729 | Ga0079104_1001016 | |||
| 1730 | Ga0079104_1001936 | |||
| 1731 | Ga0079104_1012482 | |||
| 1732 | Ga0079104_1029289 | |||
| 1733 | Ga0105251_10000653 | |||
| 1734 | Ga0105251_10003325 | |||
| 1735 | Ga0105251_10005450 | |||
| 1736 | Ga0105251_10013205 | |||
| 1737 | Ga0105251_10023484 | |||
| 1738 | Ga0105251_10026906 | |||
| 1739 | Ga0105251_10029981 | |||
| 1740 | Ga0105251_10033879 | |||
| 1741 | Ga0105251_10035079 | |||
| 1742 | Ga0105251_10048767 | |||
| 1743 | Ga0105244_10000248 | |||
| 1744 | Ga0105244_10000274 | |||
| 1745 | Ga0105244_10002675 | |||
| 1746 | Ga0105244_10009787 | |||
| 1747 | Ga0105244_10010093 | |||
| 1748 | Ga0105244_10015761 | |||
| 1749 | Ga0105244_10033838 | |||
| 1750 | Ga0105244_10035696 | |||
| 1751 | Ga0105244_10035795 | |||
| 1752 | Ga0105244_10035887 | |||
| 1753 | Ga0105250_10013939 | |||
| 1754 | Ga0105250_10018481 | |||
| 1755 | Ga0105250_10021791 | |||
| 1756 | Ga0105250_10022369 | |||
| 1757 | Ga0105250_10034542 | |||
| 1758 | Ga0105250_10034581 | |||
| 1759 | Ga0105240_10002636 | |||
| 1760 | Ga0105240_10003683 | |||
| 1761 | Ga0105240_10005123 | |||
| 1762 | Ga0105240_10005449 | |||
| 1763 | Ga0105240_10007191 | |||
| 1764 | Ga0105240_10026186 | |||
| 1765 | Ga0105240_10047714 | |||
| 1766 | Ga0105240_10054350 | |||
| 1767 | Ga0105240_10074490 | |||
| 1768 | Ga0105240_10184676 | |||
| 1769 | Ga0105240_10251119 | |||
| 1770 | Ga0105240_10308746 | |||
| 1771 | Ga0105240_10759923 | |||
| 1772 | Ga0111539_10008365 | |||
| 1773 | Ga0111539_10016907 | |||
| 1774 | Ga0111539_10119867 | |||
| 1775 | Ga0111539_10187945 | |||
| 1776 | Ga0105245_10000694 | |||
| 1777 | Ga0105245_10373911 | |||
| 1778 | Ga0105245_10434957 | |||
| 1779 | Ga0105245_10477401 | |||
| 1780 | Ga0105247_10000176 | |||
| 1781 | Ga0105247_10004537 | |||
| 1782 | Ga0114129_10002078 | |||
| 1783 | Ga0105243_10000263 | |||
| 1784 | Ga0105243_10023492 | |||
| 1785 | Ga0105241_10000001 | |||
| 1786 | Ga0105241_10007966 | |||
| 1787 | Ga0105241_10043069 | |||
| 1788 | Ga0105241_10091320 | |||
| 1789 | Ga0105241_10164967 | |||
| 1790 | Ga0105241_10248325 | |||
| 1791 | Ga0105242_10015261 | |||
| 1792 | Ga0105242_10026595 | |||
| 1793 | Ga0105242_10089909 | |||
| 1794 | Ga0105242_10146764 | |||
| 1795 | Ga0105242_10263249 | |||
| 1796 | Ga0105248_10006442 | |||
| 1797 | Ga0105248_10006574 | |||
| 1798 | Ga0105248_10029592 | |||
| 1799 | Ga0105248_10460787 | |||
| 1800 | Ga0105248_10739221 | |||
| 1801 | Ga0105237_10008345 | |||
| 1802 | Ga0105237_10008700 | |||
| 1803 | Ga0105237_10016948 | |||
| 1804 | Ga0105237_10149607 | |||
| 1805 | Ga0105238_10000238 | |||
| 1806 | Ga0105238_10001852 | |||
| 1807 | Ga0105238_10006092 | |||
| 1808 | Ga0105238_10008661 | |||
| 1809 | Ga0105238_10091092 | |||
| 1810 | Ga0105238_10093299 | |||
| 1811 | Ga0105238_10117899 | |||
| 1812 | Ga0105238_10121358 | |||
| 1813 | Ga0105238_10181828 | |||
| 1814 | Ga0105249_10012651 | |||
| 1815 | Ga0099796_10027099 | |||
| 1816 | Ga0105246_10005750 | |||
| 1817 | Ga0105246_10025988 | |||
| 1818 | Ga0105246_10087869 | |||
| 1819 | Ga0157373_10000593 | |||
| 1820 | Ga0157373_10003913 | |||
| 1821 | Ga0157373_10016161 | |||
| 1822 | Ga0157373_10028452 | |||
| 1823 | Ga0157371_10000497 | |||
| 1824 | Ga0157371_10015917 | |||
| 1825 | Ga0157371_10078133 | |||
| 1826 | Ga0157371_10215321 | |||
| 1827 | Ga0157370_10001630 | |||
| 1828 | Ga0157370_10006826 | |||
| 1829 | Ga0157370_10007129 | |||
| 1830 | Ga0157370_10025437 | |||
| 1831 | Ga0157370_10028766 | |||
| 1832 | Ga0157370_10039334 | |||
| 1833 | Ga0157370_10093954 | |||
| 1834 | Ga0157370_10199378 | |||
| 1835 | Ga0157369_10009351 | |||
| 1836 | Ga0157369_10015015 | |||
| 1837 | Ga0157369_10032457 | |||
| 1838 | Ga0157369_10128690 | |||
| 1839 | Ga0157369_10131266 | |||
| 1840 | Ga0157369_10285226 | |||
| 1841 | Ga0157369_10487229 | |||
| 1842 | Ga0157374_10016482 | |||
| 1843 | Ga0157374_10084829 | |||
| 1844 | Ga0157374_10192967 | |||
| 1845 | Ga0157378_10376010 | |||
| 1846 | Ga0163162_10139987 | |||
| 1847 | Ga0163162_10303072 | |||
| 1848 | Ga0163162_10391986 | |||
| 1849 | Ga0157372_10000598 | |||
| 1850 | Ga0157372_10041986 | |||
| 1851 | Ga0157372_10047751 | |||
| 1852 | Ga0157372_10196571 | |||
| 1853 | Ga0157372_10266118 | |||
| 1854 | Ga0157372_10836391 | |||
| 1855 | Ga0157375_10040468 | |||
| 1856 | Ga0163163_10000627 | |||
| 1857 | Ga0163163_10031285 | |||
| 1858 | Ga0163163_10100549 | |||
| 1859 | Ga0182008_10014996 | |||
| 1860 | Ga0182008_10034069 | |||
| 1861 | Ga0157379_10158519 | |||
| 1862 | Ga0157376_10116201 | |||
| 1863 | Ga0182006_1000174 | |||
| 1864 | Ga0182006_1003543 | |||
| 1865 | Ga0182006_1009467 | |||
| 1866 | Ga0182006_1017180 | |||
| 1867 | Ga0182007_10000143 | |||
| 1868 | Ga0182005_1002054 | |||
| 1869 | Ga0163161_10000003 | |||
| 1870 | Ga0163161_10036567 | |||
| 1871 | Ga0163161_10045290 | |||
| 1872 | Ga0163161_10159843 | |||
| 1873 | Ga0163161_10261768 | |||
| 1874 | Ga0197907_10075445 | |||
| 1875 | Ga0206355_1560789 | |||
| 1876 | Ga0206351_10065214 | |||
| 1877 | Ga0206352_10666988 | |||
| 1878 | Ga0206350_10221737 | |||
| 1879 | Ga0206350_10379269 | |||
| 1880 | Ga0206350_10938216 | |||
| 1881 | Ga0206354_10594356 | |||
| 1882 | Ga0206354_11413883 | |||
| 1883 | Ga0206353_11342932 | |||
| 1884 | Ga0213872_10000050 | |||
| 1885 | Ga0213872_10000905 | |||
| 1886 | Ga0213874_10004805 | |||
| 1887 | Ga0213876_10010217 | |||
| 1888 | Ga0213876_10029263 | |||
| 1889 | Ga0213875_10000019 | |||
| 1890 | Ga0213875_10016825 | |||
| 1891 | Ga0213875_10042529 | |||
| 1892 | Ga0213875_10065563 | |||
| 1893 | Ga0213871_10034082 | |||
| 1894 | Ga0224712_10039765 | |||
| 1895 | Ga0224712_10099106 | |||
| 1896 | Ga0224712_10135246 | |||
| 1897 | Ga0209435_100837 | |||
| 1898 | Ga0209760_100052 | |||
| 1899 | Ga0209784_100015 | |||
| 1900 | Ga0209566_100012 | |||
| 1901 | Ga0209674_100027 | |||
| 1902 | Ga0209147_100019 | |||
| 1903 | Ga0209563_100031 | |||
| 1904 | Ga0207427_100029 | |||
| 1905 | Ga0209437_100009 | |||
| 1906 | Ga0209258_100381 | |||
| 1907 | Ga0209646_1000344 | |||
| 1908 | Ga0209026_1000711 | |||
| 1909 | Ga0209677_100016 | |||
| 1910 | Ga0209759_1003201 | |||
| 1911 | Ga0209759_1010992 | |||
| 1912 | Ga0209233_1000032 | |||
| 1913 | Ga0209676_1000026 | |||
| 1914 | Ga0209676_1000532 | |||
| 1915 | Ga0209025_1053028 | |||
| 1916 | Ga0209050_1010390 | |||
| 1917 | Ga0207696_1000001 | |||
| 1918 | Ga0207696_1000010 | |||
| 1919 | Ga0207696_1002599 | |||
| 1920 | Ga0207696_1003215 | |||
| 1921 | Ga0207696_1010018 | |||
| 1922 | Ga0207696_1021950 | |||
| 1923 | Ga0207696_1023146 | |||
| 1924 | Ga0207655_1000002 | |||
| 1925 | Ga0207655_1000151 | |||
| 1926 | Ga0207655_1000197 | |||
| 1927 | Ga0207655_1000262 | |||
| 1928 | Ga0207655_1001327 | |||
| 1929 | Ga0207655_1009222 | |||
| 1930 | Ga0207655_1014210 | |||
| 1931 | Ga0207655_1014306 | |||
| 1932 | Ga0207655_1014419 | |||
| 1933 | Ga0207655_1014540 | |||
| 1934 | Ga0207655_1015788 | |||
| 1935 | Ga0207713_1000070 | |||
| 1936 | Ga0207713_1000072 | |||
| 1937 | Ga0207713_1005079 | |||
| 1938 | Ga0207713_1011564 | |||
| 1939 | Ga0207713_1023540 | |||
| 1940 | Ga0207713_1028889 | |||
| 1941 | Ga0207713_1038613 | |||
| 1942 | Ga0207713_1053053 | |||
| 1943 | Ga0207710_10000051 | |||
| 1944 | Ga0207710_10000455 | |||
| 1945 | Ga0207710_10004382 | |||
| 1946 | Ga0207680_10061334 | |||
| 1947 | Ga0207699_10026412 | |||
| 1948 | Ga0207684_10003450 | |||
| 1949 | Ga0207684_10372437 | |||
| 1950 | Ga0207684_10415456 | |||
| 1951 | Ga0207654_10000004 | |||
| 1952 | Ga0207654_10083975 | |||
| 1953 | Ga0207707_10032118 | |||
| 1954 | Ga0207707_10064455 | |||
| 1955 | Ga0207707_10112455 | |||
| 1956 | Ga0207707_10224707 | |||
| 1957 | Ga0207695_10000964 | |||
| 1958 | Ga0207695_10005339 | |||
| 1959 | Ga0207695_10009140 | |||
| 1960 | Ga0207695_10031123 | |||
| 1961 | Ga0207695_10049362 | |||
| 1962 | Ga0207695_10069201 | |||
| 1963 | Ga0207695_10086193 | |||
| 1964 | Ga0207695_10134361 | |||
| 1965 | Ga0207695_10342244 | |||
| 1966 | Ga0207671_10027273 | |||
| 1967 | Ga0207671_10050164 | |||
| 1968 | Ga0207693_10018001 | |||
| 1969 | Ga0207663_10016462 | |||
| 1970 | Ga0207663_10073947 | |||
| 1971 | Ga0207660_10006888 | |||
| 1972 | Ga0207660_10053276 | |||
| 1973 | Ga0207657_10010431 | |||
| 1974 | Ga0207657_10054869 | |||
| 1975 | Ga0207652_10002345 | |||
| 1976 | Ga0207652_10071427 | |||
| 1977 | Ga0207646_10009466 | |||
| 1978 | Ga0207681_10000509 | |||
| 1979 | Ga0207694_10005299 | |||
| 1980 | Ga0207694_10021698 | |||
| 1981 | Ga0207694_10023587 | |||
| 1982 | Ga0207694_10024889 | |||
| 1983 | Ga0207694_10071687 | |||
| 1984 | Ga0207650_10000002 | |||
| 1985 | Ga0207687_10005523 | |||
| 1986 | Ga0207687_10007962 | |||
| 1987 | Ga0207687_10064122 | |||
| 1988 | Ga0207687_10276527 | |||
| 1989 | Ga0207700_10001065 | |||
| 1990 | Ga0207700_10078984 | |||
| 1991 | Ga0207700_10148524 | |||
| 1992 | Ga0207700_10150068 | |||
| 1993 | Ga0207700_10386293 | |||
| 1994 | Ga0207664_10035151 | |||
| 1995 | Ga0207664_10035512 | |||
| 1996 | Ga0207664_10179579 | |||
| 1997 | Ga0207664_10231859 | |||
| 1998 | Ga0207644_10001798 | |||
| 1999 | Ga0207644_10272376 | |||
| 2000 | Ga0207690_10016310 | |||
| 2001 | Ga0207690_10114010 | |||
| 2002 | Ga0207706_10284593 | |||
| 2003 | Ga0207686_10002054 | |||
| 2004 | Ga0207709_10000158 | |||
| 2005 | Ga0207709_10009838 | |||
| 2006 | Ga0207669_10357081 | |||
| 2007 | Ga0207691_10376693 | |||
| 2008 | Ga0207711_10000752 | |||
| 2009 | Ga0207711_10025879 | |||
| 2010 | Ga0207711_10041953 | |||
| 2011 | Ga0207711_10192714 | |||
| 2012 | Ga0207689_10157260 | |||
| 2013 | Ga0207661_10001589 | |||
| 2014 | Ga0207661_10011029 | |||
| 2015 | Ga0207661_10019484 | |||
| 2016 | Ga0207661_10077113 | |||
| 2017 | Ga0207661_10101271 | |||
| 2018 | Ga0207661_10381350 | |||
| 2019 | Ga0207661_10457424 | |||
| 2020 | Ga0207679_10124674 | |||
| 2021 | Ga0207679_10218628 | |||
| 2022 | Ga0207667_10000778 | |||
| 2023 | Ga0207667_10012222 | |||
| 2024 | Ga0207667_10018428 | |||
| 2025 | Ga0207712_10054911 | |||
| 2026 | Ga0207658_10000001 | |||
| 2027 | Ga0207677_10067902 | |||
| 2028 | Ga0207703_10008479 | |||
| 2029 | Ga0207639_10026567 | |||
| 2030 | Ga0207702_10007438 | |||
| 2031 | Ga0207702_10033061 | |||
| 2032 | Ga0207702_10051541 | |||
| 2033 | Ga0207702_10051880 | |||
| 2034 | Ga0207641_10067303 | |||
| 2035 | Ga0207641_10259950 | |||
| 2036 | Ga0207641_10404785 | |||
| 2037 | Ga0207676_10000001 | |||
| 2038 | Ga0207674_10000320 | |||
| 2039 | Ga0207674_10011685 | |||
| 2040 | Ga0207674_10049531 | |||
| 2041 | Ga0207683_10223164 | |||
| 2042 | Ga0207683_10276890 | |||
| 2043 | Ga0207683_10288828 | |||
| 2044 | Ga0207698_10445850 | |||
| 2045 | Ga0209281_1000038 | |||
| 2046 | Ga0209281_1000172 | |||
| 2047 | Ga0209281_1001784 | |||
| 2048 | Ga0209389_1000063 | |||
| 2049 | Ga0209371_1000196 | |||
| 2050 | Ga0209371_1000576 | |||
| 2051 | Ga0209371_1002233 | |||
| 2052 | Ga0209371_1003223 | |||
| 2053 | Ga0209371_1007522 | |||
| 2054 | Ga0209969_1003123 | |||
| 2055 | Ga0209984_1010318 | |||
| 2056 | Ga0209982_1005413 | |||
| 2057 | Ga0209971_1007555 | |||
| 2058 | Ga0209974_10006192 | |||
| 2059 | Ga0209974_10045407 | |||
| 2060 | Ga0207428_10175085 | |||
| 2061 | Ga0265354_1000479 | |||
| 2062 | Ga0265356_1000429 | |||
| 2063 | Ga0268266_10005113 | |||
| 2064 | Ga0268266_10007323 | |||
| 2065 | Ga0268266_10043227 | |||
| 2066 | Ga0268265_10000455 | |||
| 2067 | Ga0268265_10543460 | |||
| 2068 | Ga0268264_10000004 | |||
| 2069 | Ga0265337_1010645 | |||
| 2070 | Ga0265337_1021446 | |||
| 2071 | Ga0265326_10006844 | |||
| 2072 | Ga0265326_10007728 | |||
| 2073 | Ga0265326_10013258 | |||
| 2074 | Ga0265319_1000117 | |||
| 2075 | Ga0265334_10010142 | |||
| 2076 | Ga0265318_10000127 | |||
| 2077 | Ga0265318_10045528 | |||
| 2078 | Ga0265318_10051719 | |||
| 2079 | Ga0265318_10074020 | |||
| 2080 | Ga0265323_10000442 | |||
| 2081 | Ga0265323_10000729 | |||
| 2082 | Ga0265323_10001018 | |||
| 2083 | Ga0265323_10001673 | |||
| 2084 | Ga0265323_10015696 | |||
| 2085 | Ga0265323_10023964 | |||
| 2086 | Ga0265322_10001727 | |||
| 2087 | Ga0265322_10019771 | |||
| 2088 | Ga0265322_10026141 | |||
| 2089 | Ga0265336_10003605 | |||
| 2090 | Ga0265336_10005093 | |||
| 2091 | Ga0307517_10113040 | |||
| 2092 | Ga0265338_10004158 | |||
| 2093 | Ga0265338_10006215 | |||
| 2094 | Ga0265338_10006479 | |||
| 2095 | Ga0265338_10040825 | |||
| 2096 | Ga0265338_10049222 | |||
| 2097 | Ga0265338_10083055 | |||
| 2098 | Ga0265338_10121263 | |||
| 2099 | Ga0265338_10181457 | |||
| 2100 | Ga0265338_10263578 | |||
| 2101 | Ga0265324_10000026 | |||
| 2102 | Ga0265324_10000069 | |||
| 2103 | Ga0265324_10000093 | |||
| 2104 | Ga0265324_10000411 | |||
| 2105 | Ga0265324_10008668 | |||
| 2106 | Ga0265324_10010285 | |||
| 2107 | Ga0265324_10067460 | |||
| 2108 | Ga0268256_1000158 | |||
| 2109 | Ga0268256_1000503 | |||
| 2110 | Ga0268256_1001972 | |||
| 2111 | Ga0268256_1007753 | |||
| 2112 | Ga0316183_1015099 | |||
| 2113 | Ga0265770_1000818 | |||
| 2114 | Ga0265765_1000811 | |||
| 2115 | Ga0265760_10000954 | |||
| 2116 | Ga0265760_10029106 | |||
| 2117 | Ga0265330_10000112 | |||
| 2118 | Ga0265330_10005890 | |||
| 2119 | Ga0265330_10005891 | |||
| 2120 | Ga0265330_10007670 | |||
| 2121 | Ga0265330_10010228 | |||
| 2122 | Ga0265330_10013565 | |||
| 2123 | Ga0265330_10021605 | |||
| 2124 | Ga0265330_10024877 | |||
| 2125 | Ga0265330_10029355 | |||
| 2126 | Ga0265330_10033380 | |||
| 2127 | Ga0265330_10035564 | |||
| 2128 | Ga0265330_10050703 | |||
| 2129 | Ga0265330_10117082 | |||
| 2130 | Ga0265332_10000013 | |||
| 2131 | Ga0265332_10000052 | |||
| 2132 | Ga0265332_10000062 | |||
| 2133 | Ga0265332_10000234 | |||
| 2134 | Ga0265332_10001836 | |||
| 2135 | Ga0265332_10003905 | |||
| 2136 | Ga0265332_10010180 | |||
| 2137 | Ga0265332_10034307 | |||
| 2138 | Ga0265332_10056281 | |||
| 2139 | Ga0265332_10070650 | |||
| 2140 | Ga0265328_10000076 | |||
| 2141 | Ga0265328_10000128 | |||
| 2142 | Ga0265328_10000297 | |||
| 2143 | Ga0265328_10001141 | |||
| 2144 | Ga0265328_10002442 | |||
| 2145 | Ga0265328_10005003 | |||
| 2146 | Ga0265328_10006581 | |||
| 2147 | Ga0265328_10014488 | |||
| 2148 | Ga0265328_10022723 | |||
| 2149 | Ga0265328_10035767 | |||
| 2150 | Ga0265320_10000969 | |||
| 2151 | Ga0265320_10002060 | |||
| 2152 | Ga0265320_10004794 | |||
| 2153 | Ga0265320_10005502 | |||
| 2154 | Ga0265320_10073931 | |||
| 2155 | Ga0265325_10003074 | |||
| 2156 | Ga0265325_10006487 | |||
| 2157 | Ga0265325_10008975 | |||
| 2158 | Ga0265325_10011735 | |||
| 2159 | Ga0265325_10038411 | |||
| 2160 | Ga0265325_10053699 | |||
| 2161 | Ga0265325_10123463 | |||
| 2162 | Ga0265325_10160877 | |||
| 2163 | Ga0265329_10000059 | |||
| 2164 | Ga0265329_10001427 | |||
| 2165 | Ga0265329_10001667 | |||
| 2166 | Ga0265329_10001674 | |||
| 2167 | Ga0265329_10011734 | |||
| 2168 | Ga0265329_10014035 | |||
| 2169 | Ga0265329_10014042 | |||
| 2170 | Ga0265329_10021672 | |||
| 2171 | Ga0265340_10000044 | |||
| 2172 | Ga0265340_10000882 | |||
| 2173 | Ga0265340_10002279 | |||
| 2174 | Ga0265340_10010569 | |||
| 2175 | Ga0265340_10012413 | |||
| 2176 | Ga0265340_10091168 | |||
| 2177 | Ga0265339_10000001 | |||
| 2178 | Ga0265339_10000004 | |||
| 2179 | Ga0265339_10000018 | |||
| 2180 | Ga0265339_10001637 | |||
| 2181 | Ga0265339_10003001 | |||
| 2182 | Ga0265339_10003717 | |||
| 2183 | Ga0265339_10004363 | |||
| 2184 | Ga0265339_10036307 | |||
| 2185 | Ga0265339_10070381 | |||
| 2186 | Ga0265339_10072546 | |||
| 2187 | Ga0265339_10085234 | |||
| 2188 | Ga0265331_10000036 | |||
| 2189 | Ga0265331_10000108 | |||
| 2190 | Ga0265331_10000145 | |||
| 2191 | Ga0265331_10000591 | |||
| 2192 | Ga0265331_10001957 | |||
| 2193 | Ga0265331_10002644 | |||
| 2194 | Ga0265331_10012348 | |||
| 2195 | Ga0265331_10047240 | |||
| 2196 | Ga0265331_10063883 | |||
| 2197 | Ga0265331_10068261 | |||
| 2198 | Ga0265331_10107964 | |||
| 2199 | Ga0265331_10113555 | |||
| 2200 | Ga0265327_10000008 | |||
| 2201 | Ga0265327_10000213 | |||
| 2202 | Ga0265327_10000229 | |||
| 2203 | Ga0265327_10000503 | |||
| 2204 | Ga0265327_10004005 | |||
| 2205 | Ga0265327_10004822 | |||
| 2206 | Ga0265327_10007133 | |||
| 2207 | Ga0265327_10007583 | |||
| 2208 | Ga0265327_10019468 | |||
| 2209 | Ga0265316_10000011 | |||
| 2210 | Ga0265316_10000731 | |||
| 2211 | Ga0265316_10000847 | |||
| 2212 | Ga0265316_10001116 | |||
| 2213 | Ga0265316_10001265 | |||
| 2214 | Ga0265316_10002090 | |||
| 2215 | Ga0265316_10002305 | |||
| 2216 | Ga0265316_10002945 | |||
| 2217 | Ga0265316_10003493 | |||
| 2218 | Ga0265316_10008374 | |||
| 2219 | Ga0265316_10012518 | |||
| 2220 | Ga0265316_10013282 | |||
| 2221 | Ga0265316_10029280 | |||
| 2222 | Ga0265316_10030608 | |||
| 2223 | Ga0265316_10044714 | |||
| 2224 | Ga0265316_10055363 | |||
| 2225 | Ga0265316_10085315 | |||
| 2226 | Ga0265316_10150442 | |||
| 2227 | Ga0265316_10151517 | |||
| 2228 | Ga0265316_10170975 | |||
| 2229 | Ga0265316_10208700 | |||
| 2230 | Ga0265316_10221885 | |||
| 2231 | Ga0265316_10227276 | |||
| 2232 | Ga0265316_10229035 | |||
| 2233 | Ga0265316_10277884 | |||
| 2234 | Ga0265316_10287086 | |||
| 2235 | Ga0265316_10338294 | |||
| 2236 | Ga0307509_10274381 | |||
| 2237 | Ga0307408_100000178 | |||
| 2238 | Ga0307408_100011056 | |||
| 2239 | Ga0307408_100020260 | |||
| 2240 | Ga0265313_10000056 | |||
| 2241 | Ga0265313_10001373 | |||
| 2242 | Ga0265313_10018959 | |||
| 2243 | Ga0265313_10040724 | |||
| 2244 | Ga0265313_10058884 | |||
| 2245 | Ga0316579_10061196 | |||
| 2246 | Ga0265314_10000007 | |||
| 2247 | Ga0265314_10000271 | |||
| 2248 | Ga0265314_10000933 | |||
| 2249 | Ga0265314_10001549 | |||
| 2250 | Ga0265314_10002364 | |||
| 2251 | Ga0265314_10003597 | |||
| 2252 | Ga0265314_10003642 | |||
| 2253 | Ga0265314_10005145 | |||
| 2254 | Ga0265314_10017132 | |||
| 2255 | Ga0265314_10033095 | |||
| 2256 | Ga0265314_10035236 | |||
| 2257 | Ga0265314_10137277 | |||
| 2258 | Ga0265314_10139318 | |||
| 2259 | Ga0265342_10000058 | |||
| 2260 | Ga0265342_10000472 | |||
| 2261 | Ga0265342_10000619 | |||
| 2262 | Ga0265342_10000762 | |||
| 2263 | Ga0265342_10000924 | |||
| 2264 | Ga0265342_10001136 | |||
| 2265 | Ga0265342_10001742 | |||
| 2266 | Ga0265342_10007313 | |||
| 2267 | Ga0265342_10007898 | |||
| 2268 | Ga0265342_10012661 | |||
| 2269 | Ga0265342_10014722 | |||
| 2270 | Ga0265342_10019789 | |||
| 2271 | Ga0265342_10021895 | |||
| 2272 | Ga0265342_10166351 | |||
| 2273 | Ga0316576_10017817 | |||
| 2274 | Ga0316576_10028196 | |||
| 2275 | Ga0316576_10043506 | |||
| 2276 | Ga0316576_10070843 | |||
| 2277 | Ga0316576_10265500 | |||
| 2278 | Ga0316578_10008951 | |||
| 2279 | Ga0316578_10079635 | |||
| 2280 | Ga0316578_10102627 | |||
| 2281 | Ga0307516_10000202 | |||
| 2282 | Ga0307405_10020411 | |||
| 2283 | Ga0316577_10076069 | |||
| 2284 | Ga0316577_10140008 | |||
| 2285 | Ga0307413_10010098 | |||
| 2286 | Ga0307406_10013085 | |||
| 2287 | Ga0307406_10051967 | |||
| 2288 | Ga0307406_10054623 | |||
| 2289 | Ga0307407_10026019 | |||
| 2290 | Ga0307412_10004978 | |||
| 2291 | Ga0307412_10010098 | |||
| 2292 | Ga0307412_10011635 | |||
| 2293 | Ga0307409_100041096 | |||
| 2294 | Ga0307414_10010683 | |||
| 2295 | Ga0307414_10056920 | |||
| 2296 | Ga0307411_10004175 | |||
| 2297 | Ga0316593_10037039 | |||
| 2298 | Ga0316593_10067502 | |||
| 2299 | Ga0316593_10071261 | |||
| 2300 | Ga0316596_1042114 | |||
| 2301 | Ga0373926_0007884 | |||
| 2302 | Ga0373926_0008882 | |||
| 2303 | Ga0373934_0003185 | |||
| 2304 | Ga0373934_0016862 | |||
| 2305 | Ga0373932_0009979 | |||
| 2306 | Ga0373936_0066099 | |||
| 2307 | Ga0373945_0106995 | |||
| 2308 | Ga0373953_0011245 | |||
| 2309 | Ga0373953_0021778 | |||
| 2310 | Ga0373954_0014791 | |||
| 2311 | Ga0373954_0044561 | |||
| 2312 | Ga0373956_0001217 | |||
| 2313 | Ga0373957_0042689 | |||
| 2314 | Ga0373955_0114834 | |||
| 2315 | Ga0373955_0174821 | |||
| 2316 | Ga0316574_0004307 | |||
| 2317 | Ga0316574_0020761 | |||
| 2318 | Ga0316574_0096617 | |||
| 2319 | Ga0316574_0241945 | |||
| 2320 | Ga0316574_0243127 | |||
| 2321 | Ga0373931_0167068 | |||
| 2322 | Ga0373935_0133566 | |||
| 2323 | Ga0373935_0145989 | |||
| 2324 | Ga0373927_0001539 | |||
| 2325 | Ga0373927_0002742 | |||
| 2326 | Ga0373927_0009722 | |||
| 2327 | Ga0373927_0063083 | |||
| 2328 | Ga0373927_0118306 | |||
| 2329 | Ga0373927_0301155 | |||
| 2330 | Ga0373933_0073672 | |||
| 2331 | Ga0373933_0095320 | |||
| 2332 | Ga0373947_0000740 | |||
| 2333 | Ga0373947_0099937 | |||
| 2334 | Ga0373937_0007741 | |||
| 2335 | Ga0373937_0019221 | |||
| 2336 | Ga0373937_0035160 | |||
| 2337 | Ga0373937_0227032 | |||
| 2338 | Ga0373937_0315761 | |||
| 2339 | Ga0373937_0339483 | |||
| 2340 | Ga0373937_0576904 | |||
| 2341 | Ga0316582_0036189 | |||
| 2342 | Ga0316582_0133884 | |||
| 2343 | Ga0316582_0205402 | |||
| 2344 | Ga0316584_0009600 | |||
| 2345 | Ga0316584_0024907 | |||
| 2346 | Ga0316584_0114947 | |||
| 2347 | Ga0373925_0000099 | |||
| 2348 | Ga0373925_0005608 | |||
| 2349 | Ga0373925_0015028 | |||
| 2350 | Ga0373925_0058578 | |||
| 2351 | Ga0373925_0076615 | |||
| 2352 | Ga0373925_0169322 | |||
| 2353 | Ga0395900_0025210 | |||
| 2354 | Ga0395900_0070182 | |||
| 2355 | Ga0395905_0003402 | |||
| 2356 | Ga0395905_0172075 | |||
| 2357 | Ga0436364_0176175 | |||
| 2358 | Ga0436364_0366372 | |||
| 2359 | Ga0436364_0514524 | |||
| 2360 | Ga0436364_0748631 | |||
| 2361 | Ga0436364_0807765 | |||
| 2362 | Ga0436364_0853204 | |||
| 2363 | Ga0436364_1151958 | |||
| 2364 | Ga0436364_1386202 | |||
| 2365 | Ga0436364_1410728 | |||
| 2366 | Ga0436364_1414125 | |||
| 2367 | Ga0436364_1489063 | |||
| 2368 | Ga0436364_1501586 | |||
| 2369 | Ga0400490_10431 | |||
| 2370 | Ga0400486_10993 | |||
| 2371 | Ga0400483_030371 | |||
| 2372 | Ga0400489_59676 | |||
| 2373 | Ga0436365_0139104 | |||
| 2374 | Ga0436365_0497797 | |||
| 2375 | Ga0436365_0721041 | |||
| 2376 | Ga0436365_1100189 | |||
| 2377 | Ga0436365_1490124 | |||
| 2378 | Ga0436360_0328545 | |||
| 2379 | Ga0436360_0378330 | |||
| 2380 | Ga0436360_1032306 | |||
| 2381 | Ga0436360_1333063 | |||
| 2382 | Ga0436361_0269507 | |||
| 2383 | Ga0436361_0285134 | |||
| 2384 | Ga0436361_0567168 | |||
| 2385 | Ga0436361_0682766 | |||
| 2386 | Ga0436363_1560073 | |||
| 2387 | Ga0436362_0084096 | |||
| 2388 | Ga0436362_0297328 | |||
| 2389 | Ga0439436_0007650 | |||
| 2390 | Ga0439438_000002 | |||
| 2391 | Ga0439438_000442 | |||
| 2392 | Ga0439438_003869 | |||
| 2393 | Ga0439438_004424 | |||
| 2394 | Ga0439438_012015 | |||
| 2395 | Ga0439438_013815 | |||
| 2396 | Ga0439447_001496 | |||
| 2397 | Ga0439447_002909 | |||
| 2398 | Ga0439447_003162 | |||
| 2399 | Ga0439447_008240 | |||
| 2400 | Ga0439466_0005969 | |||
| 2401 | Ga0439466_0006786 | |||
| 2402 | Ga0439466_0015267 | |||
| 2403 | Ga0439465_0006145 | |||
| 2404 | Ga0451855_1019283 | |||
| 2405 | Ga0439432_001052 | |||
| 2406 | Ga0439432_001239 | |||
| 2407 | Ga0439432_002018 | |||
| 2408 | Ga0439432_002789 | |||
| 2409 | Ga0439432_003342 | |||
| 2410 | Ga0439451_001638 | |||
| 2411 | Ga0439451_003813 | |||
| 2412 | Ga0439452_000003 | |||
| 2413 | Ga0439452_009904 | |||
| 2414 | Ga0439452_022042 | |||
| 2415 | Ga0439456_000271 | |||
| 2416 | Ga0439456_008922 | |||
| 2417 | Ga0450911_000002 | |||
| 2418 | Ga0450911_001193 | |||
| 2419 | Ga0450919_000614 | |||
| 2420 | Ga0450890_000186 | |||
| 2421 | Ga0450902_001984 | |||
| 2422 | Ga0450903_001828 | |||
| 2423 | Ga0450903_002098 | |||
| 2424 | Ga0450905_000029 | |||
| 2425 | Ga0450906_000658 | |||
| 2426 | Ga0450907_000132 | |||
| 2427 | Ga0450907_002076 | |||
| 2428 | Ga0439446_0008405 | |||
| 2429 | Ga0439446_0017328 | |||
| 2430 | Ga0450908_005178 | |||
| 2431 | Ga0450909_002104 | |||
| 2432 | Ga0439434_0000469 | |||
| 2433 | Ga0439464_0002709 | |||
| 2434 | Ga0439464_0009344 | |||
| 2435 | Ga0439460_0001104 | |||
| 2436 | Ga0439460_0005590 | |||
| 2437 | Ga0451577_0000035 | |||
| 2438 | Ga0451577_0000127 | |||
| 2439 | Ga0451577_0000644 | |||
| 2440 | Ga0451577_0001119 | |||
| 2441 | Ga0451577_0001484 | |||
| 2442 | Ga0451577_0003259 | |||
| 2443 | Ga0451577_0003915 | |||
| 2444 | Ga0451577_0008660 | |||
| 2445 | Ga0451577_0013211 | |||
| 2446 | Ga0451577_0015851 | |||
| 2447 | Ga0451577_0016891 | |||
| 2448 | Ga0451577_0026629 | |||
| 2449 | Ga0451577_0032932 | |||
| 2450 | Ga0451577_0034763 | |||
| 2451 | Ga0451577_0055642 | |||
| 2452 | Ga0451577_0065739 | |||
| 2453 | Ga0451577_0074573 | |||
| 2454 | Ga0451577_0081767 | |||
| 2455 | Ga0451577_0088449 | |||
| 2456 | Ga0451577_0095159 | |||
| 2457 | Ga0451577_0103585 | |||
| 2458 | Ga0451577_0161923 | |||
| 2459 | Ga0451577_0190718 | |||
| 2460 | Ga0451577_0392613 | |||
| 2461 | Ga0439440_0003112 | |||
| 2462 | Ga0439440_0009520 | |||
| 2463 | Ga0453683_0000001 | |||
| 2464 | Ga0453683_0000009 | |||
| 2465 | Ga0453683_0000018 | |||
| 2466 | Ga0453683_0000233 | |||
| 2467 | Ga0453683_0004304 | |||
| 2468 | Ga0453683_0004940 | |||
| 2469 | Ga0453683_0006674 | |||
| 2470 | Ga0453683_0028839 | |||
| 2471 | Ga0453683_0065747 | |||
| 2472 | Ga0453683_0074008 | |||
| 2473 | Ga0453683_0171101 | |||
| 2474 | Ga0453683_0254441 | |||
| 2475 | Ga0453684_0000048 | |||
| 2476 | Ga0453684_0000097 | |||
| 2477 | Ga0453684_0000115 | |||
| 2478 | Ga0453684_0000221 | |||
| 2479 | Ga0453684_0000242 | |||
| 2480 | Ga0453684_0000499 | |||
| 2481 | Ga0453684_0000539 | |||
| 2482 | Ga0453684_0000555 | |||
| 2483 | Ga0453684_0000941 | |||
| 2484 | Ga0453684_0001135 | |||
| 2485 | Ga0453684_0001752 | |||
| 2486 | Ga0453684_0002408 | |||
| 2487 | Ga0453684_0002894 | |||
| 2488 | Ga0453684_0003084 | |||
| 2489 | Ga0453684_0004632 | |||
| 2490 | Ga0453684_0005926 | |||
| 2491 | Ga0453684_0007878 | |||
| 2492 | Ga0453684_0007938 | |||
| 2493 | Ga0453684_0013644 | |||
| 2494 | Ga0453684_0016279 | |||
| 2495 | Ga0453684_0019676 | |||
| 2496 | Ga0453684_0021899 | |||
| 2497 | Ga0453684_0030419 | |||
| 2498 | Ga0453684_0046636 | |||
| 2499 | Ga0453684_0048265 | |||
| 2500 | Ga0453684_0055436 | |||
| 2501 | Ga0453684_0057574 | |||
| 2502 | Ga0453684_0069986 | |||
| 2503 | Ga0453684_0070696 | |||
| 2504 | Ga0453684_0087668 | |||
| 2505 | Ga0453684_0097761 | |||
| 2506 | Ga0453684_0112724 | |||
| 2507 | Ga0453684_0134239 | |||
| 2508 | Ga0453684_0142404 | |||
| 2509 | Ga0453684_0152488 | |||
| 2510 | Ga0453684_0162295 | |||
| 2511 | Ga0453684_0167310 | |||
| 2512 | Ga0453684_0209441 | |||
| 2513 | Ga0453684_0352507 | |||
| 2514 | Ga0453684_0485017 | |||
| 2515 | Ga0453684_0504267 | |||
| 2516 | Ga0451576_0000488 | |||
| 2517 | Ga0451576_0000897 | |||
| 2518 | Ga0451576_0001625 | |||
| 2519 | Ga0451576_0002883 | |||
| 2520 | Ga0451576_0003235 | |||
| 2521 | Ga0451576_0007599 | |||
| 2522 | Ga0451576_0010023 | |||
| 2523 | Ga0451576_0017004 | |||
| 2524 | Ga0451576_0018382 | |||
| 2525 | Ga0451576_0029987 | |||
| 2526 | Ga0451576_0059407 | |||
| 2527 | Ga0451576_0083463 | |||
| 2528 | Ga0451576_0084574 | |||
| 2529 | Ga0451576_0091231 | |||
| 2530 | Ga0451576_0131379 | |||
| 2531 | Ga0451576_0145838 | |||
| 2532 | Ga0451576_0148525 | |||
| 2533 | Ga0451576_0217205 | |||
| 2534 | Ga0451576_0249655 | |||
| 2535 | Ga0451576_0396624 | |||
| 2536 | Ga0451576_0400895 | |||
| 2537 | Ga0451576_0431901 | |||
| 2538 | Ga0451576_0441847 | |||
| 2539 | Ga0451576_0741327 | |||
| 2540 | Ga0495617_000327 | |||
| 2541 | Ga0495627_000044 | |||
| 2542 | Ga0495627_000143 | |||
| 2543 | Ga0495627_001530 | |||
| 2544 | Ga0495627_005662 | |||
| 2545 | Ga0495627_005817 | |||
| 2546 | Ga0495592_0014490 | |||
| 2547 | Ga0495603_0019488 | |||
| 2548 | Ga0495590_0003015 | |||
| 2549 | Ga0495590_0026310 | |||
| 2550 | Ga0495590_0026839 | |||
| 2551 | Ga0495591_000023 | |||
| 2552 | Ga0495591_003647 | |||
| 2553 | Ga0495591_004045 | |||
| 2554 | Ga0495591_004793 | |||
| 2555 | Ga0495591_005488 | |||
| 2556 | Ga0495591_006035 | |||
| 2557 | Ga0495591_009042 | |||
| 2558 | Ga0495591_010786 | |||
| 2559 | Ga0495638_0032805 | |||
| 2560 | Ga0495651_0007664 | |||
| 2561 | Ga0495651_0053021 | |||
| 2562 | Ga0495653_0061150 | |||
| 2563 | Ga0495653_0111964 | |||
| 2564 | Ga0495650_0000065 | |||
| 2565 | Ga0495650_0000620 | |||
| 2566 | Ga0495650_0006361 | |||
| 2567 | Ga0495650_0009633 | |||
| 2568 | Ga0495580_0011408 | |||
| 2569 | Ga0495580_0017429 | |||
| 2570 | Ga0495580_0037314 | |||
| 2571 | Ga0495580_0108737 | |||
| 2572 | Ga0495605_0000048 | |||
| 2573 | Ga0495605_0000094 | |||
| 2574 | Ga0495605_0000330 | |||
| 2575 | Ga0495605_0000486 | |||
| 2576 | Ga0495605_0001320 | |||
| 2577 | Ga0495605_0005925 | |||
| 2578 | Ga0495605_0006308 | |||
| 2579 | Ga0495605_0042442 | |||
| 2580 | Ga0495605_0108899 | |||
| 2581 | Ga0495639_0000714 | |||
| 2582 | Ga0495664_0003394 | |||
| 2583 | Ga0495664_0224992 | |||
| 2584 | Ga0495584_0001356 | |||
| 2585 | Ga0495584_0004349 | |||
| 2586 | Ga0495584_0004438 | |||
| 2587 | Ga0495584_0020003 | |||
| 2588 | Ga0495585_0005478 | |||
| 2589 | Ga0495585_0022896 | |||
| 2590 | Ga0495594_0003631 | |||
| 2591 | Ga0495594_0188393 | |||
| 2592 | Ga0495596_0012119 | |||
| 2593 | Ga0495607_0000349 | |||
| 2594 | Ga0495607_0000396 | |||
| 2595 | Ga0495607_0001009 | |||
| 2596 | Ga0495607_0001535 | |||
| 2597 | Ga0495607_0003645 | |||
| 2598 | Ga0495607_0005366 | |||
| 2599 | Ga0495607_0006278 | |||
| 2600 | Ga0495607_0021862 | |||
| 2601 | Ga0495607_0047000 | |||
| 2602 | Ga0495607_0059081 | |||
| 2603 | Ga0495607_0102701 | |||
| 2604 | Ga0495583_0000096 | |||
| 2605 | Ga0495583_0001432 | |||
| 2606 | Ga0495583_0006317 | |||
| 2607 | Ga0495583_0010134 | |||
| 2608 | Ga0495583_0010743 | |||
| 2609 | Ga0495583_0017557 | |||
| 2610 | Ga0495583_0050576 | |||
| 2611 | Ga0495606_0001112 | |||
| 2612 | Ga0495606_0002582 | |||
| 2613 | Ga0495606_0004094 | |||
| 2614 | Ga0495606_0008803 | |||
| 2615 | Ga0495606_0015513 | |||
| 2616 | Ga0495606_0016101 | |||
| 2617 | Ga0495608_0053847 | |||
| 2618 | Ga0495610_0000021 | |||
| 2619 | Ga0495610_0012081 | |||
| 2620 | Ga0495610_0034270 | |||
| 2621 | Ga0495616_0004161 | |||
| 2622 | Ga0495616_0025122 | |||
| 2623 | Ga0495616_0059646 | |||
| 2624 | Ga0495620_0000001 | |||
| 2625 | Ga0495620_0000002 | |||
| 2626 | Ga0495620_0000757 | |||
| 2627 | Ga0495620_0001337 | |||
| 2628 | Ga0495620_0004859 | |||
| 2629 | Ga0495628_0012932 | |||
| 2630 | Ga0495628_0180534 | |||
| 2631 | Ga0495630_0001621 | |||
| 2632 | Ga0495630_0024426 | |||
| 2633 | Ga0495631_0001469 | |||
| 2634 | Ga0495631_0014162 | |||
| 2635 | Ga0495631_0014537 | |||
| 2636 | Ga0495631_0032838 | |||
| 2637 | Ga0495632_0002507 | |||
| 2638 | Ga0495632_0004158 | |||
| 2639 | Ga0495632_0004287 | |||
| 2640 | Ga0495632_0023780 | |||
| 2641 | Ga0495632_0024047 | |||
| 2642 | Ga0495637_0000630 | |||
| 2643 | Ga0495637_0001225 | |||
| 2644 | Ga0495637_0001699 | |||
| 2645 | Ga0495637_0005266 | |||
| 2646 | Ga0495637_0018833 | |||
| 2647 | Ga0495643_0000303 | |||
| 2648 | Ga0495643_0000560 | |||
| 2649 | Ga0495643_0001685 | |||
| 2650 | Ga0495643_0002672 | |||
| 2651 | Ga0495643_0013070 | |||
| 2652 | Ga0495643_0015736 | |||
| 2653 | Ga0495643_0018964 | |||
| 2654 | Ga0495644_0003708 | |||
| 2655 | Ga0495644_0006504 | |||
| 2656 | Ga0495648_0000521 | |||
| 2657 | Ga0495648_0001868 | |||
| 2658 | Ga0495648_0008904 | |||
| 2659 | Ga0495648_0009937 | |||
| 2660 | Ga0495648_0020975 | |||
| 2661 | Ga0495648_0024807 | |||
| 2662 | Ga0495648_0025968 | |||
| 2663 | Ga0495648_0037701 | |||
| 2664 | Ga0495648_0093676 | |||
| 2665 | Ga0495666_0003007 | |||
| 2666 | Ga0495642_0001462 | |||
| 2667 | Ga0495642_0003590 | |||
| 2668 | Ga0495642_0003766 | |||
| 2669 | Ga0495652_0008745 | |||
| 2670 | Ga0495652_0056581 | |||
| 2671 | Ga0495652_0351409 | |||
| 2672 | Ga0495654_0000096 | |||
| 2673 | Ga0495654_0000102 | |||
| 2674 | Ga0495654_0000588 | |||
| 2675 | Ga0495654_0005166 | |||
| 2676 | Ga0495654_0007690 | |||
| 2677 | Ga0495654_0010751 | |||
| 2678 | Ga0495654_0013991 | |||
| 2679 | Ga0495654_0104304 | |||
| 2680 | Ga0495665_0021153 | |||
| 2681 | Ga0495640_0110106 | |||
| 2682 | Ga0495587_0001493 | |||
| 2683 | Ga0495587_0004848 | |||
| 2684 | Ga0495609_0000012 | |||
| 2685 | Ga0495609_0000079 | |||
| 2686 | Ga0495609_0001254 | |||
| 2687 | Ga0495609_0003270 | |||
| 2688 | Ga0495609_0005619 | |||
| 2689 | Ga0495609_0009678 | |||
| 2690 | Ga0495609_0057899 | |||
| 2691 | Ga0495597_0000016 | |||
| 2692 | Ga0495597_0021120 | |||
| 2693 | Ga0495645_0037723 | |||
| 2694 | Ga0495645_0131099 | |||
| 2695 | Ga0495645_0167920 | |||
| 2696 | Ga0495622_0000809 | |||
| 2697 | Ga0495622_0001364 | |||
| 2698 | Ga0495622_0029990 | |||
| 2699 | Ga0495633_0000034 | |||
| 2700 | Ga0495633_0031235 | |||
| 2701 | Ga0495667_0060055 | |||
| 2702 | Ga0495667_0118620 | |||
| 2703 | Ga0495667_0194558 | |||
| 2704 | Ga0495656_0001632 | |||
| 2705 | Ga0495668_0065953 | |||
| 2706 | Ga0495634_0000967 | |||
| 2707 | Ga0495611_0000656 | |||
| 2708 | Ga0495611_0016202 | |||
| 2709 | Ga0495611_0036628 | |||
| 2710 | Ga0495625_0000076 | |||
| 2711 | Ga0495625_0047649 | |||
| 2712 | Ga0495635_0000752 | |||
| 2713 | Ga0495635_0089474 | |||
| 2714 | Ga0495659_0001347 | |||
| 2715 | Ga0495659_0017477 | |||
| 2716 | Ga0495661_0000004 | |||
| 2717 | Ga0495661_0000099 | |||
| 2718 | Ga0495661_0000146 | |||
| 2719 | Ga0495661_0000773 | |||
| 2720 | Ga0495661_0025579 | |||
| 2721 | Ga0495661_0030918 | |||
| 2722 | Ga0495661_0042222 | |||
| 2723 | Ga0495661_0110881 | |||
| 2724 | Ga0495588_0004580 | |||
| 2725 | Ga0495599_0002296 | |||
| 2726 | Ga0495599_0015207 | |||
| 2727 | Ga0495623_0001889 | |||
| 2728 | Ga0495623_0006999 | |||
| 2729 | Ga0495646_0011937 | |||
| 2730 | Ga0495646_0037210 | |||
| 2731 | Ga0495669_0016103 | |||
| 2732 | Ga0495670_0002495 | |||
| 2733 | Ga0495670_0023981 | |||
| 2734 | Ga0495670_0034984 | |||
| 2735 | Ga0495671_0000024 | |||
| 2736 | Ga0495671_0000908 | |||
| 2737 | Ga0495671_0002113 | |||
| 2738 | Ga0495671_0002880 | |||
| 2739 | Ga0495671_0003585 | |||
| 2740 | Ga0495671_0004322 | |||
| 2741 | Ga0495671_0010611 | |||
| 2742 | Ga0495671_0018765 | |||
| 2743 | Ga0495649_0001633 | |||
| 2744 | Ga0495649_0003386 | |||
| 2745 | Ga0495649_0003919 | |||
| 2746 | Ga0495649_0008042 | |||
| 2747 | Ga0495649_0010145 | |||
| 2748 | Ga0495649_0049172 | |||
| 2749 | Ga0495589_0000003 | |||
| 2750 | Ga0495589_0000194 | |||
| 2751 | Ga0495589_0008684 | |||
| 2752 | Ga0495589_0024274 | |||
| 2753 | Ga0495589_0089809 | |||
| 2754 | Ga0495600_0046810 | |||
| 2755 | Ga0495660_0000017 | |||
| 2756 | Ga0495660_0000824 | |||
| 2757 | Ga0495660_0012602 | |||
| 2758 | Ga0495660_0020560 | |||
| 2759 | Ga0495660_0022401 | |||
| 2760 | Ga0495660_0023907 | |||
| 2761 | Ga0495604_0069019 | |||
| 2762 | Ga0495604_0081857 | |||
| 2763 | Ga0495604_0163470 | |||
| 2764 | Ga0495636_0000764 | |||
| 2765 | Ga0495674_0005437 | |||
| 2766 | Ga0495674_0007240 | |||
| 2767 | Ga0495674_0044383 | |||
| 2768 | Ga0495672_0000001 | |||
| 2769 | Ga0495672_0004429 | |||
| 2770 | Ga0495672_0005100 | |||
| 2771 | Ga0495672_0008463 | |||
| 2772 | Ga0495672_0077988 | |||
| 2773 | Ga0495676_0000016 | |||
| 2774 | Ga0495680_0018000 | |||
| 2775 | Ga0495680_0038892 | |||
| 2776 | Ga0495680_0130297 | |||
| 2777 | Ga0495683_0000034 | |||
| 2778 | Ga0495683_0015091 | |||
| 2779 | Ga0495683_0036322 | |||
| 2780 | Ga0495683_0125868 | |||
| 2781 | Ga0495687_006222 | |||
| 2782 | Ga0495675_0033821 | |||
| 2783 | Ga0495675_0068006 | |||
| 2784 | Ga0495675_0273848 | |||
| 2785 | Ga0495677_0003900 | |||
| 2786 | Ga0495679_000087 | |||
| 2787 | Ga0495679_000377 | |||
| 2788 | Ga0495679_012040 | |||
| 2789 | Ga0495673_0000019 | |||
| 2790 | Ga0495673_0001933 | |||
| 2791 | Ga0495673_0002323 | |||
| 2792 | Ga0495673_0009651 | |||
| 2793 | Ga0495673_0015126 | |||
| 2794 | Ga0495673_0015438 | |||
| 2795 | Ga0495673_0027991 | |||
| 2796 | Ga0495673_0043729 | |||
| 2797 | Ga0495673_0097623 | |||
| 2798 | Ga0495681_0016581 | |||
| 2799 | Ga0495684_0000398 | |||
| 2800 | Ga0495684_0040686 | |||
| 2801 | Ga0495684_0195055 | |||
| 2802 | Ga0495686_0016655 | |||
| 2803 | Ga0495686_0075906 | |||
| 2804 | Ga0495593_0045035 | |||
| 2805 | Ga0495602_0015186 | |||
| 2806 | Ga0495602_0186702 | |||
| 2807 | Ga0495602_0194688 | |||
| 2808 | Ga0495615_0002290 | |||
| 2809 | Ga0495626_0000098 | |||
| 2810 | Ga0495626_0004696 | |||
| 2811 | Ga0495626_0006801 | |||
| 2812 | Ga0495626_0033602 | |||
| 2813 | Ga0495626_0038730 | |||
| 2814 | Ga0496102_0000991 | |||
| 2815 | Ga0496102_0034926 | |||
| 2816 | Ga0496103_0000997 | |||
| 2817 | Ga0496103_0048117 | |||
| 2818 | Ga0496104_0000260 | |||
| 2819 | Ga0496104_0148724 | |||
| 2820 | Ga0496104_0404671 | |||
| 2821 | Ga0496105_0000156 | |||
| 2822 | Ga0496105_0163634 | |||
| 2823 | Ga0496110_0009694 | |||
| 2824 | Ga0496110_0048656 | |||
| 2825 | Ga0496110_0056893 | |||
| 2826 | Ga0496110_0136059 | |||
| 2827 | Ga0496111_0126132 | |||
| 2828 | Ga0496112_0006585 | |||
| 2829 | Ga0496113_0173044 | |||
| 2830 | Ga0496114_0003707 | |||
| 2831 | Ga0496114_0061464 | |||
| 2832 | Ga0496115_0007686 | |||
| 2833 | Ga0496115_0024949 | |||
| 2834 | Ga0496115_0287935 | |||
| 2835 | Ga0496116_0000007 | |||
| 2836 | Ga0496116_0010359 | |||
| 2837 | Ga0496116_0045906 | |||
| 2838 | Ga0496117_0001323 | |||
| 2839 | Ga0496117_0001620 | |||
| 2840 | Ga0496117_0002783 | |||
| 2841 | Ga0496117_0003088 | |||
| 2842 | Ga0496117_0006308 | |||
| 2843 | Ga0496117_0012255 | |||
| 2844 | Ga0496117_0018402 | |||
| 2845 | Ga0496118_0002712 | |||
| 2846 | Ga0496118_0002985 | |||
| 2847 | Ga0496118_0006537 | |||
| 2848 | Ga0496118_0036587 | |||
| 2849 | Ga0496118_0052475 | |||
| 2850 | Ga0496119_0000612 | |||
| 2851 | Ga0496120_0001054 | |||
| 2852 | Ga0496120_0008485 | |||
| 2853 | Ga0496121_0007202 | |||
| 2854 | Ga0496121_0030502 | |||
| 2855 | Ga0496121_0034409 | |||
| 2856 | Ga0496121_0094533 | |||
| 2857 | Ga0496122_0001943 | |||
| 2858 | Ga0496122_0002404 | |||
| 2859 | Ga0496122_0007083 | |||
| 2860 | Ga0496122_0019738 | |||
| 2861 | Ga0496122_0022598 | |||
| 2862 | Ga0496123_0000439 | |||
| 2863 | Ga0496123_0001575 | |||
| 2864 | Ga0496123_0014417 | |||
| 2865 | Ga0496123_0026678 | |||
| 2866 | Ga0496123_0054519 | |||
| 2867 | Ga0496123_0058743 | |||
| 2868 | Ga0496124_0000132 | |||
| 2869 | Ga0496124_0001693 | |||
| 2870 | Ga0496124_0002023 | |||
| 2871 | Ga0496124_0006195 | |||
| 2872 | Ga0496124_0006210 | |||
| 2873 | Ga0496124_0015103 | |||
| 2874 | Ga0496124_0038452 | |||
| 2875 | Ga0496124_0045902 | |||
| 2876 | Ga0496124_0059474 | |||
| 2877 | Ga0496124_0060348 | |||
| 2878 | Ga0496124_0173557 | |||
| 2879 | Ga0496125_0000380 | |||
| 2880 | Ga0496125_0001691 | |||
| 2881 | Ga0496125_0004712 | |||
| 2882 | Ga0496125_0024615 | |||
| 2883 | Ga0496125_0038928 | |||
| 2884 | Ga0496125_0099344 | |||
| 2885 | Ga0496126_0000101 | |||
| 2886 | Ga0496126_0097180 | |||
| 2887 | Ga0496126_0154973 | |||
| 2888 | Ga0496126_0339330 | |||
| 2889 | Ga0496126_0388229 | |||
| 2890 | Ga0495678_000049 | |||
| 2891 | Ga0495678_000579 | |||
| 2892 | Ga0495678_002688 | |||
| 2893 | Ga0495678_006374 | |||
| 2894 | Ga0495678_008976 | |||
| 2895 | Ga0495678_039896 | |||
| 2896 | Ga0495678_080824 | |||
| 2897 | Ga0495682_0000011 | |||
| 2898 | Ga0495682_0000128 | |||
| 2899 | Ga0495682_0001668 | |||
| 2900 | Ga0495682_0017012 | |||
| 2901 | Ga0495682_0019899 | |||
| 2902 | Ga0501031_0011752 | |||
| 2903 | Ga0501031_0030930 | |||
| 2904 | Ga0501032_0001038 | |||
| 2905 | Ga0501032_0001256 | |||
| 2906 | Ga0501032_0006131 | |||
| 2907 | Ga0501032_0009678 | |||
| 2908 | Ga0501033_0003841 | |||
| 2909 | Ga0501033_0007400 | |||
| 2910 | Ga0501033_0009063 | |||
| 2911 | Ga0501033_0016351 | |||
| 2912 | Ga0501034_0000041 | |||
| 2913 | Ga0501034_0002365 | |||
| 2914 | Ga0501034_0008207 | |||
| 2915 | Ga0501034_0020051 | |||
| 2916 | Ga0501034_0030857 | |||
| 2917 | Ga0501034_0127735 | |||
| 2918 | Ga0501034_0324523 | |||
| 2919 | Ga0501036_0000583 | |||
| 2920 | Ga0501036_0000764 | |||
| 2921 | Ga0501037_0002333 | |||
| 2922 | Ga0501037_0014890 | |||
| 2923 | Ga0501037_0040016 | |||
| 2924 | Ga0501037_0124890 | |||
| 2925 | Ga0501037_0134521 | |||
| 2926 | Ga0501038_0003064 | |||
| 2927 | Ga0501038_0007027 | |||
| 2928 | Ga0501038_0007681 | |||
| 2929 | Ga0501038_0020808 | |||
| 2930 | Ga0501038_0157567 | |||
| 2931 | Ga0501039_0004609 | |||
| 2932 | Ga0501039_0011648 | |||
| 2933 | Ga0501039_0171108 | |||
| 2934 | Ga0501040_0009107 | |||
| 2935 | Ga0501040_0106982 | |||
| 2936 | Ga0501042_0003284 | |||
| 2937 | Ga0501042_0142376 | |||
| 2938 | Ga0501043_0004581 | |||
| 2939 | Ga0501043_0005319 | |||
| 2940 | Ga0501043_0006282 | |||
| 2941 | Ga0501043_0035508 | |||
| 2942 | Ga0501043_0139463 | |||
| 2943 | Ga0501046_0000889 | |||
| 2944 | Ga0501046_0001127 | |||
| 2945 | Ga0501046_0050465 | |||
| 2946 | Ga0501047_0002434 | |||
| 2947 | Ga0501048_0005502 | |||
| 2948 | Ga0501048_0031545 | |||
| 2949 | Ga0501067_0012770 | |||
| 2950 | Ga0501068_0011869 | |||
| 2951 | Ga0501068_0129193 | |||
| 2952 | Ga0501069_0000937 | |||
| 2953 | Ga0501070_0030461 | |||
| 2954 | Ga0501072_0011524 | |||
| 2955 | Ga0501073_0026765 | |||
| 2956 | Ga0501076_0205757 | |||
| 2957 | Ga0501077_0004163 | |||
| 2958 | Ga0501079_0028748 | |||
| 2959 | Ga0501080_0145730 | |||
| 2960 | Ga0501081_0181438 | |||
| 2961 | Ga0501083_0002458 | |||
| 2962 | Ga0501083_0007866 | |||
| 2963 | Ga0501035_0000158 | |||
| 2964 | Ga0501035_0003883 | |||
| 2965 | Ga0501035_0006972 | |||
| 2966 | Ga0501035_0191013 | |||
| 2967 | Ga0501044_0000190 | |||
| 2968 | Ga0501044_0015234 | |||
| 2969 | Ga0501044_0028814 | |||
| 2970 | Ga0501044_0084786 | |||
| 2971 | Ga0501044_0126007 | |||
| 2972 | Ga0501044_0164704 | |||
| 2973 | Ga0501044_0253119 | |||
| 2974 | Ga0501045_0001759 | |||
| 2975 | Ga0501226_000007 | |||
| 2976 | nmdc:mga05p37_2980_c1 | |||
| 2977 | nmdc:mga06r32_274823_c1 | |||
| 2978 | nmdc:mga08y16_181967_c1 | |||
| 2979 | nmdc:mga08y16_6325_c1 | |||
| 2980 | nmdc:mga08y16_95630_c1 | |||
| 2981 | nmdc:mga08x19_624_c1 | |||
| 2982 | Ga0495601_0021931 | |||
| 2983 | Ga0495601_0248421 | |||
| 2984 | Ga0495612_0024226 | |||
| 2985 | Ga0500595_007403 | |||
| 2986 | Ga0500618_005360 | |||
| 2987 | Ga0500621_000005 | |||
| 2988 | Ga0500659_0035137 | |||
| 2989 | Ga0500564_013234 | |||
| 2990 | Ga0500568_0005172 | |||
| 2991 | Ga0500604_0053869 | |||
| 2992 | Ga0500616_0035421 | |||
| 2993 | Ga0501084_0001126 | |||
| 2994 | Ga0501084_0019920 | |||
| 2995 | Ga0590071_005287 | |||
| 2996 | Ga0501082_0005501 | |||
| 2997 | 640488419 | |||
| 2998 | 2506579725 | |||
| 2999 | 2506584864 | |||
| 3000 | 2508853525 | |||
| 3001 | 2510285074 | |||
| 3002 | 2511254484 | |||
| 3003 | 2511269701 | |||
| 3004 | 2511298767 | |||
| 3005 | 2511329179 | |||
| 3006 | 2511341334 | |||
| 3007 | 2511347513 | |||
| 3008 | 2511360643 | |||
| 3009 | 2511374796 | |||
| 3010 | 2528203243 | |||
| 3011 | 2528214404 | |||
| 3012 | 2538426471 | |||
| 3013 | 2546947887 | |||
| 3014 | 2547373094 | |||
| 3015 | 2548846078 | |||
| 3016 | 2552746416 | |||
| 3017 | 2555246088 | |||
| 3018 | 2566034961 | |||
| 3019 | 2579749772 | |||
| 3020 | 2579858337 | |||
| 3021 | 2597862830 | |||
| 3022 | 2597868631 | |||
| 3023 | 2599328570 | |||
| 3024 | 2599396608 | |||
| 3025 | 2599453332 | |||
| 3026 | 2599503933 | |||
| 3027 | 2599507589 | |||
| 3028 | 2599514664 | |||
| 3029 | 2599517405 | |||
| 3030 | 2599772729 | |||
| 3031 | 2599889226 | |||
| 3032 | 2599894071 | |||
| 3033 | 2599896547 | |||
| 3034 | 2599926649 | |||
| 3035 | 2599931901 | |||
| 3036 | 2599945551 | |||
| 3037 | 2599956669 | |||
| 3038 | 2599962622 | |||
| 3039 | 2599965242 | |||
| 3040 | 2599973907 | |||
| 3041 | 2599978788 | |||
| 3042 | 2599985409 | |||
| 3043 | 2599991840 | |||
| 3044 | 2599996561 | |||
| 3045 | 2600002363 | |||
| 3046 | 2600006884 | |||
| 3047 | 2600010474 | |||
| 3048 | 2600021397 | |||
| 3049 | 2600026382 | |||
| 3050 | 2600032463 | |||
| 3051 | 2600036318 | |||
| 3052 | 2600043615 | |||
| 3053 | 2600049896 | |||
| 3054 | 2600053523 | |||
| 3055 | 2600061461 | |||
| 3056 | 2600067385 | |||
| 3057 | 2600070392 | |||
| 3058 | 2600080220 | |||
| 3059 | 2600362025 | |||
| 3060 | 2601626537 | |||
| 3061 | 2601691366 | |||
| 3062 | 2624493752 | |||
| 3063 | 2626635872 | |||
| 3064 | 2644187584 | |||
| 3065 | 2644283634 | |||
| 3066 | 2644625113 | |||
| 3067 | 2649121677 | |||
| 3068 | 2652547489 | |||
| 3069 | 2652975972 | |||
| 3070 | 2656276837 | |||
| 3071 | 2671090423 | |||
| 3072 | 2671130395 | |||
| 3073 | 2677896682 | |||
| 3074 | 2678229663 | |||
| 3075 | 2678262380 | |||
| 3076 | 2686356135 | |||
| 3077 | 2686541628 | |||
| 3078 | 2687238447 | |||
| 3079 | 2687239187 | |||
| 3080 | 2688393533 | |||
| 3081 | 2688394040 | |||
| 3082 | 2689446254 | |||
| 3083 | 2707100223 | |||
| 3084 | 2710604992 | |||
| 3085 | 2723247659 | |||
| 3086 | 2729147406 | |||
| 3087 | 2738691410 | |||
| 3088 | 2739267185 | |||
| 3089 | 2739290022 | |||
| 3090 | 2739295334 | |||
| 3091 | 2745008726 | |||
| 3092 | 2745162055 | |||
| 3093 | 2765582576 | |||
| 3094 | 2772440165 | |||
| 3095 | 2774121349 | |||
| 3096 | 2774135982 | |||
| 3097 | 2774391356 | |||
| 3098 | 2774436090 | |||
| 3099 | 2774864360 | |||
| 3100 | 2784259992 | |||
| 3101 | 2784317308 | |||
| 3102 | 2794596176 | |||
| 3103 | 2807409656 | |||
| 3104 | 2807457957 | |||
| 3105 | 2808858227 | |||
| 3106 | 2808904563 | |||
| 3107 | 2808924150 | |||
| 3108 | 2808938384 | |||
| 3109 | 2808941811 | |||
| 3110 | 2808946091 | |||
| 3111 | 2808957514 | |||
| 3112 | 2808966712 | |||
| 3113 | 2809001542 | |||
| 3114 | 2809125354 | |||
| 3115 | 2812367911 | |||
| 3116 | 2813727714 | |||
| 3117 | 2819654504 | |||
| 3118 | 2825653259 | |||
| 3119 | 2826584468 | |||
| 3120 | 2842810088 | |||
| 3121 | 2842818035 | |||
| 3122 | 2842840061 | |||
| 3123 | 2842849342 | |||
| 3124 | 2842858989 | |||
| 3125 | 2843691833 | |||
| 3126 | 2846041089 | |||
| 3127 | 2846542270 | |||
| 3128 | 2852107147 | |||
| 3129 | 2852658718 | |||
| 3130 | 2854605894 | |||
| 3131 | 2855196988 | |||
| 3132 | 2858467416 | |||
| 3133 | 2860340223 | |||
| 3134 | 2869555603 | |||
| 3135 | 2871273881 | |||
| 3136 | 2871283649 | |||
| 3137 | 2880232108 | |||
| 3138 | 2887631791 | |||
| 3139 | 2888370254 | |||
| 3140 | 2888377233 | |||
| 3141 | 2900054533 | |||
| 3142 | 2904522362 | |||
| 3143 | 2912965141 | |||
| 3144 | 2913038352 | |||
| 3145 | 2916182991 | |||
| 3146 | 2916702311 | |||
| 3147 | 2919160059 | |||
| 3148 | 2919185239 | |||
| 3149 | 2919481620 | |||
| 3150 | 2919496615 | |||
| 3151 | 2919500817 | |||
| 3152 | 2919509235 | |||
| 3153 | 2919547101 | |||
| 3154 | 2919700339 | |||
| 3155 | 2923521962 | |||
| 3156 | 2923529294 | |||
| 3157 | 2923587523 | |||
| 3158 | 2929145797 | |||
| 3159 | 2931370863 | |||
| 3160 | 2931392496 | |||
| 3161 | 2931399874 | |||
| 3162 | 2932410748 | |||
| 3163 | 2937968796 | |||
| 3164 | 2939582212 | |||
| 3165 | 2939653501 | |||
| 3166 | 2945929108 | |||
| 3167 | 2945961817 | |||
| 3168 | 2946011338 | |||
| 3169 | 2984569470 | |||
| 3170 | 2988733332 | |||
| 3171 | 3007256756 | |||
| 3172 | 3007319005 | |||
| 3173 | 3007421130 | |||
| 3174 | 3007512825 | |||
| 3175 | 3007806354 | |||
| 3176 | 3007867986 | |||
| 3177 | 3007876025 | |||
| 3178 | 637879757 | |||
| 3179 | 640939000 | |||
| 3180 | 651176454 | |||
| 3181 | 8002317854 | |||
| 3182 | 8002746318 | |||
| 3183 | 8004596328 | |||
| 3184 | 8015397568 | |||
| 3185 | 8019776994 | |||
| 3186 | 8052498645 | |||
| 3187 | 8054351917 | |||
| 3188 | 8054914687 | |||
| 3189 | 8054933913 | |||
| 3190 | 8055695288 | |||
| 3191 | 8055819527 | |||
| 3192 | 8055880244 | |||
| 3193 | 8056119958 | |||
| 3194 | 8056122118 | |||
| 3195 | 8056141600 | |||
| 3196 | 8056147478 | |||
| 3197 | 8056159314 | |||
| 3198 | 8056164810 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7c35-assembly1.cif.gz_A-2 | crystal structure of m96a mutant of o-acetyl-l-serine sulfhydrylase from haemophilus influenzae | 0.984 | 4 | 312 |
| 7cm8-assembly1.cif.gz_A-2 | high resolution crystal structure of m92a mutant of o-acetyl-l-serine sulfhydrylase from haemophilus influenzae | 0.9828 | 4 | 312 |
| 4ore-assembly1.cif.gz_X-2 | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9812 | 4 | 312 |
| 5j43-assembly1.cif.gz_A | cdia-ct from uropathogenic escherichia coli in complex with cysk | 0.98 | 2 | 314 |
| 7yof-assembly1.cif.gz_A-2 | crystal structure of triple mutant (d67e, a68p, i88l) of o-acetyl-l-serine sulfhydrylase from haemophilus influenzae at 2.3 a | 0.98 | 4 | 312 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1d6sB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9807 | 2 | 314 | 3.40.50.1100 |
| af_I1L6I6_202_359_3.40.50.1100 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9723 | 150 | 314 | 3.40.50.1100 |
| 1d6sB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9706 | 2 | 314 | 3.40.50.1100 |
| 5xa2A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9698 | 4 | 316 | 3.40.50.1100 |
| 3vbeA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9687 | 159 | 314 | 3.40.50.1100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C6E4F2-F1-model_v4 | Pyridoxal-phosphate dependent enzyme | 0.9993 | 139 | 316 |
GO:0006534
GO:0009069 GO:0044272 |
| AF-V6AE82-F1-model_v4 | deleted | 0.9977 | 1 | 323 |
|
| AF-A0A7S1NQW6-F1-model_v4 | Tryptophan synthase beta chain-like PALP domain-containing protein | 0.9977 | 91 | 265 |
GO:0019344
|
| AF-A4VMC6-F1-model_v4 | Cysteine synthase (EC 2.5.1.47) | 0.9968 | 1 | 323 |
GO:0004124
GO:0006535 |
| AF-A0A836NXP8-F1-model_v4 | deleted | 0.9966 | 1 | 286 |
|