F495003
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1603 | 591 | 3206 | 226 |
Family's Representative Sequence
| Representative Sequence | 3300025913|Ga0207695_10000107|Ga0207695_1000010741 |
| Length | 259 |
| Sequence | MVSCEWRMALRSIRLFAIRYSPLTICHSMLILAIDTALEACAAAVLDTDAGELLAQEQLLMKRGHAEALMPMIARVMQSADLAFTALDRIAVTVGPGSFTGLRVGISAARGLALAAGRPAIGLSTLSAYAAAIVGQSGPAPVISAIDARHDHVYFQIVGGDGRQLERPKIAPIDEAIAASQFGAPHLVGNAAKILAERWPKDAPQPVAVDAQPAPDINWVAWLGAAADPGTNPARPFYLKAPDAKPAAQPLFAAQAATS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 5 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 7 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 8 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 11 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 12 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 13 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 14 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 15 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 16 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 17 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 18 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 19 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 20 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 21 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 22 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 25 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 71 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 79 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 87 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 89 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 90 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 91 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 93 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 94 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 95 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 96 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 97 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 98 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 99 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 100 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 101 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 102 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 103 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 104 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 105 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 106 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 107 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 109 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 110 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 111 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 112 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 113 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 115 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 116 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 117 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 118 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 119 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 120 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 122 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 123 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 124 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 125 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 126 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 127 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 128 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 129 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 130 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 131 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 133 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 134 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 148 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 151 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 163 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 167 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 250 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 252 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 253 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 257 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 258 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 259 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 260 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 261 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 262 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 263 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 264 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 265 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 266 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 267 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 268 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 269 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 270 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 271 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 272 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 273 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 274 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 275 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 276 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 277 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 278 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 279 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 280 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 281 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 282 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 283 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 284 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 285 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 286 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 287 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 288 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 289 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 291 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 292 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 293 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 294 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 295 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 296 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 297 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 298 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 299 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 300 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 301 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 302 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 303 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 304 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 305 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 306 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 307 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 308 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 309 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 310 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 311 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 312 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 313 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 314 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 315 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 316 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 317 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 318 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 319 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 320 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 321 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 322 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 323 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 324 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 325 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 326 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 327 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 328 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 329 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 330 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 331 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 332 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 333 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 334 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 335 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 416 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 417 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 418 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 419 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 420 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 421 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 422 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 423 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 424 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 425 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 426 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 427 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 428 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 429 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 430 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 431 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 432 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 433 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 434 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 435 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 436 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 437 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 438 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 439 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 465 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 466 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 467 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 468 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 469 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 470 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 471 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 472 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 480 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 481 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 482 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 488 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 489 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 490 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 491 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 492 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 493 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 494 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 495 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 496 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 497 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 498 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 499 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 501 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 502 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 503 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 504 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 505 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 506 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 507 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 508 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 509 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 510 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 511 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 512 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 513 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 514 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 515 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 516 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 517 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 518 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 519 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 520 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 521 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 522 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 523 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 524 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 525 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 526 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 527 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 528 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 529 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 530 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 531 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 532 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 533 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 534 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 535 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 536 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 537 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 538 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 539 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 540 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 541 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 542 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 543 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 544 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 545 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 546 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 547 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 548 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 549 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 550 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 551 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 552 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 553 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 554 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 555 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 556 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 557 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 558 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 559 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 560 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 561 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 562 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 563 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 564 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 565 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 566 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 567 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 568 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 569 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 570 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 571 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 572 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 573 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 574 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 575 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 576 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 577 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 578 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 579 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 580 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 581 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 582 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 583 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 584 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 585 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 586 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 587 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 588 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 589 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 590 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 591 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.39 |
| Metatranscriptomes | 0.06 |
| Isolates | 5.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.74 |
| Nodule | 4.62 |
| Rhizoplane | 8.92 |
| Rhizosphere | 80.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207695_10000107 | 3300025913 | Bacteria | 252606 |
| 2 | 2214756331 | 2209111006 | Bacteria | 3114 |
| 3 | ARcpr5yngRDRAFT_c000052 | 3300000043 | Bacteria | 18395 |
| 4 | ARSoilOldRDRAFT_c000001 | 3300000044 | Bacteria | 104759 |
| 5 | ARCol0oldRDRAFT_c00112 | 3300000045 | Bacteria | 7027 |
| 6 | ARCol0yngRDRAFT_1000001 | 3300000652 | Bacteria | 73871 |
| 7 | JGI24741J21665_1007670 | 3300001915 | Bacteria | 2081 |
| 8 | JGI24752J21851_1001356 | 3300001976 | Bacteria | 3307 |
| 9 | JGI24746J21847_1000477 | 3300001977 | Bacteria | 5976 |
| 10 | JGI24739J22299_10000177 | 3300001989 | Bacteria | 21227 |
| 11 | JGI24737J22298_10000967 | 3300001990 | Bacteria | 10195 |
| 12 | JGI24737J22298_10006515 | 3300001990 | Bacteria | 3985 |
| 13 | JGI24743J22301_10001361 | 3300001991 | Bacteria | 3357 |
| 14 | JGI24750J21931_1000547 | 3300002070 | Bacteria | 5778 |
| 15 | JGI24750J21931_1003185 | 3300002070 | Bacteria | 1968 |
| 16 | JGI24745J21846_1001306 | 3300002073 | Bacteria | 2404 |
| 17 | JGI24748J21848_1000209 | 3300002074 | Bacteria | 7317 |
| 18 | JGI24738J21930_10000256 | 3300002075 | Bacteria | 14438 |
| 19 | JGI24738J21930_10000437 | 3300002075 | Bacteria | 11794 |
| 20 | JGI24749J21850_1000857 | 3300002076 | Bacteria | 4387 |
| 21 | JGI24744J21845_10000555 | 3300002077 | Bacteria | 6730 |
| 22 | JGI24744J21845_10001216 | 3300002077 | Bacteria | 5049 |
| 23 | JGI24035J26624_1000009 | 3300002126 | Bacteria | 13802 |
| 24 | JGI24034J26672_10000760 | 3300002239 | Bacteria | 4166 |
| 25 | JGI24742J22300_10001007 | 3300002244 | Bacteria | 4339 |
| 26 | JGI25153J46596_10007997 | 3300003215 | Bacteria | 5116 |
| 27 | Ga0055531_10004894 | 3300003794 | Bacteria | 7975 |
| 28 | JGI25405J52794_10028701 | 3300003911 | Bacteria | 1149 |
| 29 | Ga0055543_1022841 | 3300004625 | Bacteria | 1132 |
| 30 | Ga0065165_1006357 | 3300005262 | Bacteria | 6230 |
| 31 | Ga0065165_1020376 | 3300005262 | Bacteria | 2334 |
| 32 | Ga0065704_10160483 | 3300005289 | Bacteria | 1358 |
| 33 | Ga0065712_10082879 | 3300005290 | Bacteria | 2878 |
| 34 | Ga0065715_10001850 | 3300005293 | Bacteria | 10231 |
| 35 | Ga0065715_10100237 | 3300005293 | Bacteria | 3324 |
| 36 | Ga0070676_10000076 | 3300005328 | Bacteria | 33400 |
| 37 | Ga0070676_10022801 | 3300005328 | Bacteria | 3513 |
| 38 | Ga0070676_10024250 | 3300005328 | Bacteria | 3416 |
| 39 | Ga0070676_10031130 | 3300005328 | Bacteria | 3046 |
| 40 | Ga0070683_100002997 | 3300005329 | Bacteria | 13548 |
| 41 | Ga0070683_100067661 | 3300005329 | Bacteria | 3327 |
| 42 | Ga0070690_100002546 | 3300005330 | Bacteria | 9809 |
| 43 | Ga0070690_100003545 | 3300005330 | Bacteria | 8557 |
| 44 | Ga0070690_100022196 | 3300005330 | Bacteria | 3881 |
| 45 | Ga0070690_100194638 | 3300005330 | Bacteria | 1407 |
| 46 | Ga0070690_100218798 | 3300005330 | Bacteria | 1333 |
| 47 | Ga0070690_100313120 | 3300005330 | Bacteria | 1129 |
| 48 | Ga0070690_100551954 | 3300005330 | Unclassified | 869 |
| 49 | Ga0070670_100001544 | 3300005331 | Bacteria | 18563 |
| 50 | Ga0070670_100005236 | 3300005331 | Bacteria | 10920 |
| 51 | Ga0070670_100154002 | 3300005331 | Bacteria | 1990 |
| 52 | Ga0070670_100812982 | 3300005331 | Bacteria | 844 |
| 53 | Ga0070677_10000038 | 3300005333 | Bacteria | 40055 |
| 54 | Ga0070677_10016774 | 3300005333 | Bacteria | 2612 |
| 55 | Ga0070677_10029474 | 3300005333 | Bacteria | 2081 |
| 56 | Ga0070677_10104839 | 3300005333 | Bacteria | 1253 |
| 57 | Ga0068869_100000054 | 3300005334 | Bacteria | 49952 |
| 58 | Ga0068869_100169330 | 3300005334 | Bacteria | 1706 |
| 59 | Ga0068869_100450057 | 3300005334 | Bacteria | 1067 |
| 60 | Ga0068869_100650715 | 3300005334 | Bacteria | 895 |
| 61 | Ga0070666_10046576 | 3300005335 | Bacteria | 2909 |
| 62 | Ga0070666_10127785 | 3300005335 | Bacteria | 1765 |
| 63 | Ga0070666_10139406 | 3300005335 | Bacteria | 1689 |
| 64 | Ga0070680_100004742 | 3300005336 | Bacteria | 10235 |
| 65 | Ga0070680_100191245 | 3300005336 | Bacteria | 1724 |
| 66 | Ga0070682_100000181 | 3300005337 | Bacteria | 47168 |
| 67 | Ga0070682_100083595 | 3300005337 | Bacteria | 2072 |
| 68 | Ga0070682_100091649 | 3300005337 | Bacteria | 1990 |
| 69 | Ga0070682_100123788 | 3300005337 | Bacteria | 1740 |
| 70 | Ga0068868_100002127 | 3300005338 | Bacteria | 13663 |
| 71 | Ga0068868_100003086 | 3300005338 | Bacteria | 11592 |
| 72 | Ga0068868_100087352 | 3300005338 | Bacteria | 2507 |
| 73 | Ga0068868_100171033 | 3300005338 | Bacteria | 1799 |
| 74 | Ga0068868_100181563 | 3300005338 | Bacteria | 1746 |
| 75 | Ga0070660_100000660 | 3300005339 | Bacteria | 22766 |
| 76 | Ga0070660_100062555 | 3300005339 | Bacteria | 2892 |
| 77 | Ga0070660_100064473 | 3300005339 | Bacteria | 2850 |
| 78 | Ga0070660_100278485 | 3300005339 | Bacteria | 1368 |
| 79 | Ga0070660_100452990 | 3300005339 | Bacteria | 1065 |
| 80 | Ga0070689_100003434 | 3300005340 | Bacteria | 10545 |
| 81 | Ga0070689_100003508 | 3300005340 | Bacteria | 10425 |
| 82 | Ga0070689_100004183 | 3300005340 | Bacteria | 9729 |
| 83 | Ga0070689_100025050 | 3300005340 | Bacteria | 4480 |
| 84 | Ga0070689_100029697 | 3300005340 | Bacteria | 4141 |
| 85 | Ga0070689_100182206 | 3300005340 | Bacteria | 1706 |
| 86 | Ga0070691_10000491 | 3300005341 | Bacteria | 14859 |
| 87 | Ga0070691_10109721 | 3300005341 | Bacteria | 1379 |
| 88 | Ga0070687_100000358 | 3300005343 | Bacteria | 15563 |
| 89 | Ga0070687_100011228 | 3300005343 | Bacteria | 3911 |
| 90 | Ga0070687_100011387 | 3300005343 | Bacteria | 3889 |
| 91 | Ga0070687_100034735 | 3300005343 | Bacteria | 2498 |
| 92 | Ga0070687_100064142 | 3300005343 | Bacteria | 1951 |
| 93 | Ga0070687_100118747 | 3300005343 | Bacteria | 1509 |
| 94 | Ga0070687_100148142 | 3300005343 | Bacteria | 1375 |
| 95 | Ga0070687_100595184 | 3300005343 | Bacteria | 759 |
| 96 | Ga0070661_100000797 | 3300005344 | Bacteria | 22658 |
| 97 | Ga0070661_100047671 | 3300005344 | Bacteria | 3136 |
| 98 | Ga0070661_100091588 | 3300005344 | Bacteria | 2252 |
| 99 | Ga0070661_100321610 | 3300005344 | Bacteria | 1208 |
| 100 | Ga0070661_100488577 | 3300005344 | Bacteria | 984 |
| 101 | Ga0070692_10000320 | 3300005345 | Bacteria | 13809 |
| 102 | Ga0070692_10008804 | 3300005345 | Bacteria | 4517 |
| 103 | Ga0070692_10038825 | 3300005345 | Bacteria | 2429 |
| 104 | Ga0070668_100004777 | 3300005347 | Bacteria | 10049 |
| 105 | Ga0070668_100044390 | 3300005347 | Bacteria | 3410 |
| 106 | Ga0070668_100123028 | 3300005347 | Bacteria | 2076 |
| 107 | Ga0070669_100001643 | 3300005353 | Bacteria | 16208 |
| 108 | Ga0070669_100027609 | 3300005353 | Bacteria | 4086 |
| 109 | Ga0070669_100353257 | 3300005353 | Bacteria | 1194 |
| 110 | Ga0070675_100005771 | 3300005354 | Bacteria | 9470 |
| 111 | Ga0070675_100111785 | 3300005354 | Bacteria | 2312 |
| 112 | Ga0070671_100003232 | 3300005355 | Bacteria | 12704 |
| 113 | Ga0070671_100031220 | 3300005355 | Bacteria | 4399 |
| 114 | Ga0070671_100041035 | 3300005355 | Bacteria | 3845 |
| 115 | Ga0070671_100089793 | 3300005355 | Bacteria | 2572 |
| 116 | Ga0070671_100555295 | 3300005355 | Bacteria | 990 |
| 117 | Ga0070671_100632121 | 3300005355 | Unclassified | 926 |
| 118 | Ga0070674_100000140 | 3300005356 | Bacteria | 33405 |
| 119 | Ga0070674_100226858 | 3300005356 | Bacteria | 1456 |
| 120 | Ga0070673_100007770 | 3300005364 | Bacteria | 7094 |
| 121 | Ga0070673_100029834 | 3300005364 | Bacteria | 4072 |
| 122 | Ga0070673_100067400 | 3300005364 | Bacteria | 2862 |
| 123 | Ga0070673_100503104 | 3300005364 | Bacteria | 1096 |
| 124 | Ga0070673_100525476 | 3300005364 | Bacteria | 1073 |
| 125 | Ga0070688_100002076 | 3300005365 | Bacteria | 10116 |
| 126 | Ga0070688_100005196 | 3300005365 | Bacteria | 6837 |
| 127 | Ga0070688_100026043 | 3300005365 | Bacteria | 3470 |
| 128 | Ga0070659_100004532 | 3300005366 | Bacteria | 9922 |
| 129 | Ga0070659_100032102 | 3300005366 | Bacteria | 4070 |
| 130 | Ga0070659_100038432 | 3300005366 | Bacteria | 3733 |
| 131 | Ga0070659_100042897 | 3300005366 | Bacteria | 3537 |
| 132 | Ga0070667_100001305 | 3300005367 | Bacteria | 22468 |
| 133 | Ga0070667_100165388 | 3300005367 | Bacteria | 1951 |
| 134 | Ga0070667_100355091 | 3300005367 | Bacteria | 1328 |
| 135 | Ga0070667_100556513 | 3300005367 | Bacteria | 1054 |
| 136 | Ga0070703_10001982 | 3300005406 | Bacteria | 6000 |
| 137 | Ga0070703_10005800 | 3300005406 | Bacteria | 3459 |
| 138 | Ga0070703_10029695 | 3300005406 | Bacteria | 1643 |
| 139 | Ga0070709_10004597 | 3300005434 | Bacteria | 7455 |
| 140 | Ga0070709_10007654 | 3300005434 | Bacteria | 5928 |
| 141 | Ga0070714_100054238 | 3300005435 | Bacteria | 3424 |
| 142 | Ga0070714_100058840 | 3300005435 | Bacteria | 3294 |
| 143 | Ga0070714_100293538 | 3300005435 | Bacteria | 1514 |
| 144 | Ga0070713_100010421 | 3300005436 | Bacteria | 6712 |
| 145 | Ga0070713_100021777 | 3300005436 | Bacteria | 4940 |
| 146 | Ga0070713_100024821 | 3300005436 | Bacteria | 4677 |
| 147 | Ga0070713_100326724 | 3300005436 | Bacteria | 1418 |
| 148 | Ga0070710_10004200 | 3300005437 | Bacteria | 6828 |
| 149 | Ga0070710_10014806 | 3300005437 | Bacteria | 3931 |
| 150 | Ga0070710_10062090 | 3300005437 | Bacteria | 2130 |
| 151 | Ga0070701_10000297 | 3300005438 | Bacteria | 16259 |
| 152 | Ga0070701_10001300 | 3300005438 | Bacteria | 9184 |
| 153 | Ga0070701_10020956 | 3300005438 | Bacteria | 3112 |
| 154 | Ga0070711_100076631 | 3300005439 | Bacteria | 2371 |
| 155 | Ga0070711_100128769 | 3300005439 | Bacteria | 1882 |
| 156 | Ga0070711_100304595 | 3300005439 | Bacteria | 1268 |
| 157 | Ga0070705_100000989 | 3300005440 | Bacteria | 15855 |
| 158 | Ga0070705_100070844 | 3300005440 | Bacteria | 2106 |
| 159 | Ga0070700_100002276 | 3300005441 | Bacteria | 9754 |
| 160 | Ga0070700_100011750 | 3300005441 | Bacteria | 4860 |
| 161 | Ga0070700_100070030 | 3300005441 | Bacteria | 2235 |
| 162 | Ga0070694_100000444 | 3300005444 | Bacteria | 22578 |
| 163 | Ga0070694_100003236 | 3300005444 | Bacteria | 9721 |
| 164 | Ga0070694_100268192 | 3300005444 | Bacteria | 1297 |
| 165 | Ga0070694_100407529 | 3300005444 | Bacteria | 1066 |
| 166 | Ga0070708_100031469 | 3300005445 | Bacteria | 4592 |
| 167 | Ga0070663_100000436 | 3300005455 | Bacteria | 22024 |
| 168 | Ga0070663_100028875 | 3300005455 | Bacteria | 3782 |
| 169 | Ga0070663_100067556 | 3300005455 | Bacteria | 2593 |
| 170 | Ga0070663_100215216 | 3300005455 | Bacteria | 1506 |
| 171 | Ga0070678_100000382 | 3300005456 | Bacteria | 20769 |
| 172 | Ga0070678_100003875 | 3300005456 | Bacteria | 8404 |
| 173 | Ga0070678_100050943 | 3300005456 | Bacteria | 2998 |
| 174 | Ga0070662_100003913 | 3300005457 | Bacteria | 9340 |
| 175 | Ga0070662_100005358 | 3300005457 | Bacteria | 8191 |
| 176 | Ga0070662_100006339 | 3300005457 | Bacteria | 7621 |
| 177 | Ga0070662_100222459 | 3300005457 | Bacteria | 1507 |
| 178 | Ga0070662_100286958 | 3300005457 | Bacteria | 1333 |
| 179 | Ga0070681_10005795 | 3300005458 | Bacteria | 11955 |
| 180 | Ga0070681_10044092 | 3300005458 | Bacteria | 4464 |
| 181 | Ga0070681_10104858 | 3300005458 | Bacteria | 2769 |
| 182 | Ga0070681_10118502 | 3300005458 | Bacteria | 2584 |
| 183 | Ga0070681_10320906 | 3300005458 | Bacteria | 1458 |
| 184 | Ga0070681_10349941 | 3300005458 | Bacteria | 1388 |
| 185 | Ga0070681_11014279 | 3300005458 | Bacteria | 750 |
| 186 | Ga0068867_100004037 | 3300005459 | Bacteria | 10325 |
| 187 | Ga0068867_100031738 | 3300005459 | Bacteria | 3816 |
| 188 | Ga0068867_100049962 | 3300005459 | Bacteria | 3080 |
| 189 | Ga0068867_100115286 | 3300005459 | Bacteria | 2069 |
| 190 | Ga0070685_10011992 | 3300005466 | Bacteria | 4544 |
| 191 | Ga0070685_10019254 | 3300005466 | Bacteria | 3680 |
| 192 | Ga0070685_10053921 | 3300005466 | Bacteria | 2331 |
| 193 | Ga0070685_10090723 | 3300005466 | Bacteria | 1849 |
| 194 | Ga0070685_10099640 | 3300005466 | Bacteria | 1772 |
| 195 | Ga0070706_100142059 | 3300005467 | Bacteria | 2241 |
| 196 | Ga0070698_100206822 | 3300005471 | Bacteria | 1898 |
| 197 | Ga0070699_100234039 | 3300005518 | Bacteria | 1638 |
| 198 | Ga0070679_100001204 | 3300005530 | Bacteria | 22768 |
| 199 | Ga0070679_100096291 | 3300005530 | Bacteria | 2947 |
| 200 | Ga0070684_100004481 | 3300005535 | Bacteria | 10635 |
| 201 | Ga0070684_100031381 | 3300005535 | Bacteria | 4523 |
| 202 | Ga0070684_100063427 | 3300005535 | Bacteria | 3239 |
| 203 | Ga0070697_100291756 | 3300005536 | Bacteria | 1401 |
| 204 | Ga0068853_100001615 | 3300005539 | Bacteria | 16456 |
| 205 | Ga0068853_100004372 | 3300005539 | Bacteria | 10934 |
| 206 | Ga0070672_100003461 | 3300005543 | Bacteria | 10231 |
| 207 | Ga0070672_100083198 | 3300005543 | Bacteria | 2568 |
| 208 | Ga0070672_100337527 | 3300005543 | Bacteria | 1283 |
| 209 | Ga0070686_100002518 | 3300005544 | Bacteria | 10097 |
| 210 | Ga0070686_100009403 | 3300005544 | Bacteria | 5495 |
| 211 | Ga0070686_100293445 | 3300005544 | Bacteria | 1203 |
| 212 | Ga0070695_100002937 | 3300005545 | Bacteria | 9928 |
| 213 | Ga0070695_100004993 | 3300005545 | Bacteria | 7823 |
| 214 | Ga0070695_100417542 | 3300005545 | Bacteria | 1021 |
| 215 | Ga0070696_100009850 | 3300005546 | Bacteria | 6392 |
| 216 | Ga0070696_100309863 | 3300005546 | Bacteria | 1212 |
| 217 | Ga0070696_100328530 | 3300005546 | Bacteria | 1179 |
| 218 | Ga0070693_100000628 | 3300005547 | Bacteria | 15686 |
| 219 | Ga0070665_100112704 | 3300005548 | Bacteria | 2722 |
| 220 | Ga0070665_100153502 | 3300005548 | Bacteria | 2305 |
| 221 | Ga0070665_100207924 | 3300005548 | Bacteria | 1958 |
| 222 | Ga0070665_100298035 | 3300005548 | Bacteria | 1615 |
| 223 | Ga0070665_100580933 | 3300005548 | Bacteria | 1133 |
| 224 | Ga0070704_100055623 | 3300005549 | Bacteria | 2806 |
| 225 | Ga0070704_100058274 | 3300005549 | Bacteria | 2750 |
| 226 | Ga0070704_100223496 | 3300005549 | Bacteria | 1532 |
| 227 | Ga0070704_100256179 | 3300005549 | Bacteria | 1439 |
| 228 | Ga0070704_100347552 | 3300005549 | Bacteria | 1251 |
| 229 | Ga0070704_100831568 | 3300005549 | Bacteria | 827 |
| 230 | Ga0068855_100023116 | 3300005563 | Bacteria | 7449 |
| 231 | Ga0068855_100095264 | 3300005563 | Bacteria | 3431 |
| 232 | Ga0068855_100380532 | 3300005563 | Bacteria | 1550 |
| 233 | Ga0070664_100004566 | 3300005564 | Bacteria | 11109 |
| 234 | Ga0070664_100063082 | 3300005564 | Bacteria | 3159 |
| 235 | Ga0070664_100085062 | 3300005564 | Bacteria | 2731 |
| 236 | Ga0070664_100382548 | 3300005564 | Unclassified | 1285 |
| 237 | Ga0070664_100598894 | 3300005564 | Bacteria | 1022 |
| 238 | Ga0070664_100676981 | 3300005564 | Bacteria | 960 |
| 239 | Ga0068857_100006169 | 3300005577 | Bacteria | 10247 |
| 240 | Ga0068857_100016920 | 3300005577 | Bacteria | 6388 |
| 241 | Ga0068857_100043816 | 3300005577 | Bacteria | 3969 |
| 242 | Ga0068857_100210605 | 3300005577 | Bacteria | 1774 |
| 243 | Ga0068854_100003262 | 3300005578 | Bacteria | 10104 |
| 244 | Ga0068854_100015505 | 3300005578 | Bacteria | 5051 |
| 245 | Ga0068854_100041635 | 3300005578 | Bacteria | 3247 |
| 246 | Ga0068854_100064618 | 3300005578 | Bacteria | 2659 |
| 247 | Ga0068854_100705520 | 3300005578 | Bacteria | 871 |
| 248 | Ga0068856_100004644 | 3300005614 | Bacteria | 13644 |
| 249 | Ga0068856_100155865 | 3300005614 | Bacteria | 2294 |
| 250 | Ga0068856_100177921 | 3300005614 | Bacteria | 2140 |
| 251 | Ga0068856_100331265 | 3300005614 | Bacteria | 1540 |
| 252 | Ga0068856_100409452 | 3300005614 | Bacteria | 1376 |
| 253 | Ga0070702_100000041 | 3300005615 | Bacteria | 34639 |
| 254 | Ga0070702_100002073 | 3300005615 | Bacteria | 8492 |
| 255 | Ga0070702_100064308 | 3300005615 | Bacteria | 2146 |
| 256 | Ga0070702_100080293 | 3300005615 | Bacteria | 1951 |
| 257 | Ga0070702_100096687 | 3300005615 | Bacteria | 1803 |
| 258 | Ga0070702_100427359 | 3300005615 | Bacteria | 955 |
| 259 | Ga0070702_100594342 | 3300005615 | Unclassified | 828 |
| 260 | Ga0068852_100038957 | 3300005616 | Bacteria | 3998 |
| 261 | Ga0068852_100109132 | 3300005616 | Bacteria | 2512 |
| 262 | Ga0068852_100214847 | 3300005616 | Bacteria | 1826 |
| 263 | Ga0068852_100384529 | 3300005616 | Bacteria | 1377 |
| 264 | Ga0068859_100014564 | 3300005617 | Bacteria | 7899 |
| 265 | Ga0068859_100046546 | 3300005617 | Bacteria | 4356 |
| 266 | Ga0068859_100058549 | 3300005617 | Bacteria | 3881 |
| 267 | Ga0068859_100063160 | 3300005617 | Bacteria | 3734 |
| 268 | Ga0068859_100538324 | 3300005617 | Bacteria | 1262 |
| 269 | Ga0068859_100635760 | 3300005617 | Bacteria | 1159 |
| 270 | Ga0068859_100825974 | 3300005617 | Bacteria | 1013 |
| 271 | Ga0068864_100000172 | 3300005618 | Bacteria | 59525 |
| 272 | Ga0068864_100005707 | 3300005618 | Bacteria | 10206 |
| 273 | Ga0068864_100038825 | 3300005618 | Bacteria | 4067 |
| 274 | Ga0068864_100146517 | 3300005618 | Bacteria | 2135 |
| 275 | Ga0068864_100596999 | 3300005618 | Unclassified | 1071 |
| 276 | Ga0068866_10000209 | 3300005718 | Bacteria | 27638 |
| 277 | Ga0068866_10044664 | 3300005718 | Bacteria | 2217 |
| 278 | Ga0068861_100001340 | 3300005719 | Bacteria | 15459 |
| 279 | Ga0068851_10193464 | 3300005834 | Bacteria | 1132 |
| 280 | Ga0068870_10000652 | 3300005840 | Bacteria | 13237 |
| 281 | Ga0068870_10002924 | 3300005840 | Bacteria | 7197 |
| 282 | Ga0068870_10503266 | 3300005840 | Bacteria | 808 |
| 283 | Ga0068863_100001541 | 3300005841 | Bacteria | 22740 |
| 284 | Ga0068863_100030974 | 3300005841 | Bacteria | 5108 |
| 285 | Ga0068863_100077872 | 3300005841 | Bacteria | 3138 |
| 286 | Ga0068858_100014295 | 3300005842 | Bacteria | 7485 |
| 287 | Ga0068858_100120659 | 3300005842 | Bacteria | 2451 |
| 288 | Ga0068858_100309409 | 3300005842 | Bacteria | 1508 |
| 289 | Ga0068858_100348362 | 3300005842 | Bacteria | 1419 |
| 290 | Ga0068860_100007995 | 3300005843 | Bacteria | 10543 |
| 291 | Ga0068860_100059288 | 3300005843 | Bacteria | 3639 |
| 292 | Ga0068860_100577100 | 3300005843 | Bacteria | 1128 |
| 293 | Ga0068860_100666320 | 3300005843 | Bacteria | 1049 |
| 294 | Ga0068862_100003247 | 3300005844 | Bacteria | 14065 |
| 295 | Ga0068862_100005613 | 3300005844 | Bacteria | 10485 |
| 296 | Ga0068862_100010836 | 3300005844 | Bacteria | 7527 |
| 297 | Ga0068862_100214860 | 3300005844 | Bacteria | 1739 |
| 298 | Ga0081455_10000002 | 3300005937 | Bacteria | 460472 |
| 299 | Ga0081455_10011036 | 3300005937 | Bacteria | 9099 |
| 300 | Ga0081455_10011972 | 3300005937 | Bacteria | 8683 |
| 301 | Ga0081455_10096499 | 3300005937 | Bacteria | 2383 |
| 302 | Ga0081538_10002134 | 3300005981 | Bacteria | 19697 |
| 303 | Ga0081540_1011265 | 3300005983 | Bacteria | 5989 |
| 304 | Ga0081539_10001661 | 3300005985 | Bacteria | 36064 |
| 305 | Ga0070717_10004108 | 3300006028 | Bacteria | 10499 |
| 306 | Ga0070717_10009760 | 3300006028 | Bacteria | 7228 |
| 307 | Ga0070717_10276089 | 3300006028 | Bacteria | 1489 |
| 308 | Ga0070717_10414929 | 3300006028 | Bacteria | 1211 |
| 309 | Ga0075365_10135490 | 3300006038 | Bacteria | 1706 |
| 310 | Ga0075365_10292781 | 3300006038 | Bacteria | 1145 |
| 311 | Ga0075368_10009240 | 3300006042 | Bacteria | 3542 |
| 312 | Ga0075363_100013123 | 3300006048 | Bacteria | 4007 |
| 313 | Ga0075363_100158075 | 3300006048 | Bacteria | 1282 |
| 314 | Ga0075363_100304050 | 3300006048 | Bacteria | 926 |
| 315 | Ga0075364_10408328 | 3300006051 | Bacteria | 927 |
| 316 | Ga0075432_10049484 | 3300006058 | Bacteria | 1481 |
| 317 | Ga0070715_10000720 | 3300006163 | Bacteria | 8912 |
| 318 | Ga0070715_10117210 | 3300006163 | Bacteria | 1264 |
| 319 | Ga0070716_100010508 | 3300006173 | Bacteria | 4642 |
| 320 | Ga0070716_100328235 | 3300006173 | Bacteria | 1075 |
| 321 | Ga0070712_100000460 | 3300006175 | Bacteria | 23354 |
| 322 | Ga0070712_100070971 | 3300006175 | Bacteria | 2490 |
| 323 | Ga0070712_100158873 | 3300006175 | Bacteria | 1744 |
| 324 | Ga0070712_100177873 | 3300006175 | Bacteria | 1656 |
| 325 | Ga0070712_100211580 | 3300006175 | Bacteria | 1529 |
| 326 | Ga0075362_10021323 | 3300006177 | Bacteria | 2717 |
| 327 | Ga0075367_10019074 | 3300006178 | Bacteria | 3797 |
| 328 | Ga0075367_10267614 | 3300006178 | Bacteria | 1073 |
| 329 | Ga0075369_10011405 | 3300006186 | Bacteria | 3496 |
| 330 | Ga0075366_10010047 | 3300006195 | Bacteria | 5305 |
| 331 | Ga0075366_10012444 | 3300006195 | Bacteria | 4826 |
| 332 | Ga0097621_100000565 | 3300006237 | Bacteria | 25981 |
| 333 | Ga0097621_100385545 | 3300006237 | Bacteria | 1252 |
| 334 | Ga0075370_10077261 | 3300006353 | Bacteria | 1910 |
| 335 | Ga0075370_10409502 | 3300006353 | Unclassified | 814 |
| 336 | Ga0068871_100000303 | 3300006358 | Bacteria | 34296 |
| 337 | Ga0068871_100005491 | 3300006358 | Bacteria | 8893 |
| 338 | Ga0068871_100074783 | 3300006358 | Bacteria | 2795 |
| 339 | Ga0075428_100030184 | 3300006844 | Bacteria | 5997 |
| 340 | Ga0075428_100325676 | 3300006844 | Bacteria | 1651 |
| 341 | Ga0075428_100396918 | 3300006844 | Bacteria | 1478 |
| 342 | Ga0075428_100592657 | 3300006844 | Bacteria | 1184 |
| 343 | Ga0075430_100000492 | 3300006846 | Bacteria | 29679 |
| 344 | Ga0075430_100013197 | 3300006846 | Bacteria | 7039 |
| 345 | Ga0075430_100156711 | 3300006846 | Bacteria | 1896 |
| 346 | Ga0075430_100204326 | 3300006846 | Bacteria | 1640 |
| 347 | Ga0075431_100040575 | 3300006847 | Bacteria | 4798 |
| 348 | Ga0075431_100116984 | 3300006847 | Bacteria | 2751 |
| 349 | Ga0075431_100220767 | 3300006847 | Bacteria | 1933 |
| 350 | Ga0075433_10053274 | 3300006852 | Bacteria | 3527 |
| 351 | Ga0075433_10554797 | 3300006852 | Unclassified | 1010 |
| 352 | Ga0075434_100000412 | 3300006871 | Bacteria | 31664 |
| 353 | Ga0075434_100032747 | 3300006871 | Bacteria | 5126 |
| 354 | Ga0075434_100033742 | 3300006871 | Bacteria | 5052 |
| 355 | Ga0075434_100050156 | 3300006871 | Bacteria | 4146 |
| 356 | Ga0075434_100098202 | 3300006871 | Bacteria | 2934 |
| 357 | Ga0075434_100103939 | 3300006871 | Bacteria | 2849 |
| 358 | Ga0075434_100156042 | 3300006871 | Bacteria | 2302 |
| 359 | Ga0075434_100240904 | 3300006871 | Bacteria | 1829 |
| 360 | Ga0075434_100253868 | 3300006871 | Bacteria | 1777 |
| 361 | Ga0075434_100267351 | 3300006871 | Bacteria | 1729 |
| 362 | Ga0075434_100716376 | 3300006871 | Bacteria | 1018 |
| 363 | Ga0075429_100099929 | 3300006880 | Bacteria | 2532 |
| 364 | Ga0068865_100000682 | 3300006881 | Bacteria | 19141 |
| 365 | Ga0068865_100069839 | 3300006881 | Bacteria | 2487 |
| 366 | Ga0068865_100182153 | 3300006881 | Bacteria | 1618 |
| 367 | Ga0075436_100070943 | 3300006914 | Bacteria | 2408 |
| 368 | Ga0097620_100014563 | 3300006931 | Bacteria | 7899 |
| 369 | Ga0097620_100046544 | 3300006931 | Bacteria | 4356 |
| 370 | Ga0097620_100058549 | 3300006931 | Bacteria | 3881 |
| 371 | Ga0097620_100063160 | 3300006931 | Bacteria | 3734 |
| 372 | Ga0097620_100538302 | 3300006931 | Bacteria | 1262 |
| 373 | Ga0097620_100635779 | 3300006931 | Bacteria | 1159 |
| 374 | Ga0097620_100825969 | 3300006931 | Bacteria | 1013 |
| 375 | Ga0075435_100040717 | 3300007076 | Bacteria | 3711 |
| 376 | Ga0075435_100102310 | 3300007076 | Bacteria | 2374 |
| 377 | Ga0075435_100280083 | 3300007076 | Bacteria | 1423 |
| 378 | Ga0075435_100736870 | 3300007076 | Bacteria | 857 |
| 379 | Ga0099794_10038823 | 3300007265 | Bacteria | 2257 |
| 380 | Ga0105251_10137861 | 3300009011 | Bacteria | 1104 |
| 381 | Ga0105240_10056226 | 3300009093 | Bacteria | 4924 |
| 382 | Ga0105240_10069601 | 3300009093 | Bacteria | 4355 |
| 383 | Ga0105240_10239587 | 3300009093 | Bacteria | 2104 |
| 384 | Ga0105240_10249173 | 3300009093 | Bacteria | 2055 |
| 385 | Ga0105240_10798219 | 3300009093 | Bacteria | 1023 |
| 386 | Ga0111539_10002657 | 3300009094 | Bacteria | 23686 |
| 387 | Ga0111539_10002897 | 3300009094 | Bacteria | 22777 |
| 388 | Ga0111539_10108622 | 3300009094 | Bacteria | 3256 |
| 389 | Ga0111539_10132079 | 3300009094 | Bacteria | 2923 |
| 390 | Ga0111539_10183045 | 3300009094 | Bacteria | 2447 |
| 391 | Ga0111539_10201052 | 3300009094 | Bacteria | 2324 |
| 392 | Ga0111539_10507741 | 3300009094 | Bacteria | 1404 |
| 393 | Ga0111539_10683689 | 3300009094 | Bacteria | 1195 |
| 394 | Ga0105245_10000882 | 3300009098 | Bacteria | 27254 |
| 395 | Ga0105245_10037434 | 3300009098 | Bacteria | 4313 |
| 396 | Ga0105245_10106664 | 3300009098 | Bacteria | 2600 |
| 397 | Ga0105245_10271015 | 3300009098 | Bacteria | 1656 |
| 398 | Ga0105247_10001969 | 3300009101 | Bacteria | 14264 |
| 399 | Ga0105247_10004828 | 3300009101 | Bacteria | 8579 |
| 400 | Ga0105247_10289542 | 3300009101 | Bacteria | 1132 |
| 401 | Ga0114129_10008610 | 3300009147 | Bacteria | 14548 |
| 402 | Ga0114129_10021090 | 3300009147 | Bacteria | 9252 |
| 403 | Ga0114129_10061242 | 3300009147 | Bacteria | 5259 |
| 404 | Ga0114129_10095382 | 3300009147 | Bacteria | 4120 |
| 405 | Ga0114129_10104552 | 3300009147 | Bacteria | 3913 |
| 406 | Ga0114129_10157533 | 3300009147 | Bacteria | 3104 |
| 407 | Ga0114129_10586182 | 3300009147 | Bacteria | 1446 |
| 408 | Ga0114129_10605105 | 3300009147 | Bacteria | 1419 |
| 409 | Ga0114129_11902180 | 3300009147 | Unclassified | 721 |
| 410 | Ga0105243_10001029 | 3300009148 | Bacteria | 25692 |
| 411 | Ga0105243_10009289 | 3300009148 | Bacteria | 7502 |
| 412 | Ga0105243_10023731 | 3300009148 | Bacteria | 4675 |
| 413 | Ga0105243_10230935 | 3300009148 | Bacteria | 1641 |
| 414 | Ga0105243_10262535 | 3300009148 | Bacteria | 1547 |
| 415 | Ga0105243_10428274 | 3300009148 | Bacteria | 1236 |
| 416 | Ga0105241_10006660 | 3300009174 | Bacteria | 8501 |
| 417 | Ga0105241_10181648 | 3300009174 | Bacteria | 1746 |
| 418 | Ga0105241_10350024 | 3300009174 | Bacteria | 1282 |
| 419 | Ga0105241_10427289 | 3300009174 | Bacteria | 1167 |
| 420 | Ga0105241_10725696 | 3300009174 | Bacteria | 909 |
| 421 | Ga0105242_10002177 | 3300009176 | Bacteria | 15458 |
| 422 | Ga0105242_10027348 | 3300009176 | Bacteria | 4527 |
| 423 | Ga0105242_10294895 | 3300009176 | Bacteria | 1478 |
| 424 | Ga0105248_10002945 | 3300009177 | Bacteria | 18879 |
| 425 | Ga0105248_10012305 | 3300009177 | Bacteria | 9437 |
| 426 | Ga0105248_10014996 | 3300009177 | Bacteria | 8532 |
| 427 | Ga0105248_10074990 | 3300009177 | Bacteria | 3802 |
| 428 | Ga0105248_10074998 | 3300009177 | Bacteria | 3801 |
| 429 | Ga0105248_10097925 | 3300009177 | Bacteria | 3305 |
| 430 | Ga0105237_10003304 | 3300009545 | Bacteria | 19235 |
| 431 | Ga0105237_10063614 | 3300009545 | Bacteria | 3687 |
| 432 | Ga0105237_10112977 | 3300009545 | Bacteria | 2708 |
| 433 | Ga0105237_10208332 | 3300009545 | Bacteria | 1955 |
| 434 | Ga0105237_10341732 | 3300009545 | Bacteria | 1501 |
| 435 | Ga0105238_10066156 | 3300009551 | Bacteria | 3616 |
| 436 | Ga0105238_10171734 | 3300009551 | Bacteria | 2144 |
| 437 | Ga0105238_10282647 | 3300009551 | Bacteria | 1641 |
| 438 | Ga0105238_10644735 | 3300009551 | Unclassified | 1069 |
| 439 | Ga0105249_10006632 | 3300009553 | Bacteria | 10072 |
| 440 | Ga0105249_10028570 | 3300009553 | Bacteria | 5034 |
| 441 | Ga0105249_10032153 | 3300009553 | Bacteria | 4745 |
| 442 | Ga0105249_10175965 | 3300009553 | Bacteria | 2078 |
| 443 | Ga0099796_10005397 | 3300010159 | Bacteria | 3188 |
| 444 | Ga0105239_10021993 | 3300010375 | Bacteria | 7030 |
| 445 | Ga0105239_10032680 | 3300010375 | Bacteria | 5717 |
| 446 | Ga0105239_10094993 | 3300010375 | Bacteria | 3293 |
| 447 | Ga0105239_10132130 | 3300010375 | Bacteria | 2777 |
| 448 | Ga0105239_10207875 | 3300010375 | Bacteria | 2193 |
| 449 | Ga0105239_10329989 | 3300010375 | Bacteria | 1721 |
| 450 | Ga0105246_10000463 | 3300011119 | Bacteria | 21809 |
| 451 | Ga0105246_10033093 | 3300011119 | Bacteria | 3433 |
| 452 | Ga0105246_10048040 | 3300011119 | Bacteria | 2917 |
| 453 | Ga0105246_10399843 | 3300011119 | Bacteria | 1140 |
| 454 | Ga0105246_10541243 | 3300011119 | Bacteria | 996 |
| 455 | Ga0157313_1000926 | 3300012503 | Bacteria | 1471 |
| 456 | Ga0157373_10015583 | 3300013100 | Bacteria | 5555 |
| 457 | Ga0157371_10115937 | 3300013102 | Bacteria | 1903 |
| 458 | Ga0157370_10173108 | 3300013104 | Bacteria | 2006 |
| 459 | Ga0157370_10256887 | 3300013104 | Bacteria | 1615 |
| 460 | Ga0157369_10427420 | 3300013105 | Bacteria | 1373 |
| 461 | Ga0157374_10000614 | 3300013296 | Bacteria | 31520 |
| 462 | Ga0157374_10065462 | 3300013296 | Bacteria | 3413 |
| 463 | Ga0157374_10495888 | 3300013296 | Bacteria | 1225 |
| 464 | Ga0157374_11165826 | 3300013296 | Bacteria | 791 |
| 465 | Ga0157378_10000701 | 3300013297 | Bacteria | 31354 |
| 466 | Ga0157378_10027642 | 3300013297 | Bacteria | 5003 |
| 467 | Ga0157378_10154419 | 3300013297 | Bacteria | 2141 |
| 468 | Ga0157378_10415059 | 3300013297 | Bacteria | 1329 |
| 469 | Ga0157378_10472828 | 3300013297 | Bacteria | 1247 |
| 470 | Ga0163162_10008098 | 3300013306 | Bacteria | 10258 |
| 471 | Ga0163162_10108282 | 3300013306 | Bacteria | 2875 |
| 472 | Ga0163162_10186391 | 3300013306 | Bacteria | 2202 |
| 473 | Ga0163162_10458816 | 3300013306 | Bacteria | 1406 |
| 474 | Ga0163162_10722294 | 3300013306 | Bacteria | 1117 |
| 475 | Ga0157372_10016291 | 3300013307 | Bacteria | 7979 |
| 476 | Ga0157372_10098111 | 3300013307 | Bacteria | 3342 |
| 477 | Ga0157372_10140711 | 3300013307 | Bacteria | 2779 |
| 478 | Ga0157372_10594965 | 3300013307 | Bacteria | 1289 |
| 479 | Ga0157375_10005857 | 3300013308 | Bacteria | 10698 |
| 480 | Ga0157375_10022311 | 3300013308 | Bacteria | 5825 |
| 481 | Ga0163163_10004757 | 3300014325 | Bacteria | 11644 |
| 482 | Ga0163163_10017614 | 3300014325 | Bacteria | 6668 |
| 483 | Ga0163163_10053547 | 3300014325 | Bacteria | 3984 |
| 484 | Ga0163163_10063537 | 3300014325 | Bacteria | 3661 |
| 485 | Ga0163163_10135712 | 3300014325 | Bacteria | 2502 |
| 486 | Ga0163163_10183790 | 3300014325 | Bacteria | 2138 |
| 487 | Ga0163163_11085892 | 3300014325 | Unclassified | 863 |
| 488 | Ga0157380_10001646 | 3300014326 | Bacteria | 14707 |
| 489 | Ga0157380_10069598 | 3300014326 | Bacteria | 2840 |
| 490 | Ga0157380_10165606 | 3300014326 | Bacteria | 1926 |
| 491 | Ga0182008_10166078 | 3300014497 | Bacteria | 1113 |
| 492 | Ga0157377_10000514 | 3300014745 | Bacteria | 16439 |
| 493 | Ga0157379_10000792 | 3300014968 | Bacteria | 25616 |
| 494 | Ga0157379_10010974 | 3300014968 | Bacteria | 7901 |
| 495 | Ga0157379_10057501 | 3300014968 | Bacteria | 3475 |
| 496 | Ga0157379_10072154 | 3300014968 | Bacteria | 3089 |
| 497 | Ga0157379_10096732 | 3300014968 | Bacteria | 2650 |
| 498 | Ga0157379_10293592 | 3300014968 | Bacteria | 1481 |
| 499 | Ga0157379_10983242 | 3300014968 | Bacteria | 804 |
| 500 | Ga0157376_10000352 | 3300014969 | Bacteria | 30620 |
| 501 | Ga0157376_10063069 | 3300014969 | Bacteria | 3121 |
| 502 | Ga0157376_10211676 | 3300014969 | Bacteria | 1790 |
| 503 | Ga0157376_10511043 | 3300014969 | Bacteria | 1182 |
| 504 | Ga0157376_10827550 | 3300014969 | Bacteria | 940 |
| 505 | Ga0182005_1087240 | 3300015265 | Bacteria | 865 |
| 506 | Ga0163161_10000956 | 3300017792 | Bacteria | 22176 |
| 507 | Ga0163161_10079514 | 3300017792 | Bacteria | 2411 |
| 508 | Ga0163161_10089657 | 3300017792 | Bacteria | 2274 |
| 509 | Ga0163161_10143176 | 3300017792 | Bacteria | 1811 |
| 510 | Ga0206353_10376412 | 3300020082 | Bacteria | 3399 |
| 511 | Ga0207666_1000043 | 3300025271 | Bacteria | 24939 |
| 512 | Ga0207673_1000044 | 3300025290 | Bacteria | 9940 |
| 513 | Ga0209758_1000182 | 3300025297 | Bacteria | 140630 |
| 514 | Ga0209758_1000293 | 3300025297 | Bacteria | 98643 |
| 515 | Ga0209758_1019701 | 3300025297 | Bacteria | 3237 |
| 516 | Ga0209758_1056344 | 3300025297 | Bacteria | 1328 |
| 517 | Ga0207426_1007081 | 3300025302 | Bacteria | 4746 |
| 518 | Ga0207426_1031401 | 3300025302 | Bacteria | 1733 |
| 519 | Ga0209257_1000390 | 3300025304 | Bacteria | 87532 |
| 520 | Ga0207697_10001136 | 3300025315 | Bacteria | 14657 |
| 521 | Ga0207697_10012548 | 3300025315 | Bacteria | 3551 |
| 522 | Ga0207656_10038144 | 3300025321 | Bacteria | 2025 |
| 523 | Ga0207656_10077332 | 3300025321 | Bacteria | 1490 |
| 524 | Ga0207655_1061275 | 3300025728 | Unclassified | 1453 |
| 525 | Ga0207682_10000021 | 3300025893 | Bacteria | 63904 |
| 526 | Ga0207682_10000660 | 3300025893 | Bacteria | 16114 |
| 527 | Ga0207682_10203212 | 3300025893 | Bacteria | 912 |
| 528 | Ga0207692_10002654 | 3300025898 | Bacteria | 6883 |
| 529 | Ga0207692_10008133 | 3300025898 | Bacteria | 4330 |
| 530 | Ga0207642_10000623 | 3300025899 | Bacteria | 10867 |
| 531 | Ga0207642_10046441 | 3300025899 | Bacteria | 1935 |
| 532 | Ga0207642_10100529 | 3300025899 | Bacteria | 1451 |
| 533 | Ga0207642_10141871 | 3300025899 | Bacteria | 1268 |
| 534 | Ga0207710_10001214 | 3300025900 | Bacteria | 13078 |
| 535 | Ga0207710_10020661 | 3300025900 | Bacteria | 2817 |
| 536 | Ga0207710_10025361 | 3300025900 | Bacteria | 2558 |
| 537 | Ga0207688_10000949 | 3300025901 | Bacteria | 14704 |
| 538 | Ga0207688_10002814 | 3300025901 | Bacteria | 9448 |
| 539 | Ga0207688_10071997 | 3300025901 | Bacteria | 1963 |
| 540 | Ga0207688_10131402 | 3300025901 | Bacteria | 1468 |
| 541 | Ga0207688_10179547 | 3300025901 | Bacteria | 1262 |
| 542 | Ga0207680_10003232 | 3300025903 | Bacteria | 7665 |
| 543 | Ga0207680_10077406 | 3300025903 | Bacteria | 2080 |
| 544 | Ga0207680_10110291 | 3300025903 | Bacteria | 1783 |
| 545 | Ga0207680_10111466 | 3300025903 | Bacteria | 1775 |
| 546 | Ga0207680_10131464 | 3300025903 | Bacteria | 1650 |
| 547 | Ga0207647_10007234 | 3300025904 | Bacteria | 8037 |
| 548 | Ga0207647_10011184 | 3300025904 | Bacteria | 6305 |
| 549 | Ga0207647_10046289 | 3300025904 | Bacteria | 2711 |
| 550 | Ga0207647_10122033 | 3300025904 | Bacteria | 1536 |
| 551 | Ga0207685_10011541 | 3300025905 | Bacteria | 2660 |
| 552 | Ga0207685_10045199 | 3300025905 | Bacteria | 1669 |
| 553 | Ga0207685_10055572 | 3300025905 | Bacteria | 1546 |
| 554 | Ga0207699_10020713 | 3300025906 | Bacteria | 3530 |
| 555 | Ga0207699_10045331 | 3300025906 | Bacteria | 2566 |
| 556 | Ga0207699_10152742 | 3300025906 | Bacteria | 1529 |
| 557 | Ga0207645_10002488 | 3300025907 | Bacteria | 14456 |
| 558 | Ga0207645_10002945 | 3300025907 | Bacteria | 13153 |
| 559 | Ga0207645_10023617 | 3300025907 | Bacteria | 3992 |
| 560 | Ga0207645_10045340 | 3300025907 | Bacteria | 2810 |
| 561 | Ga0207645_10063944 | 3300025907 | Bacteria | 2351 |
| 562 | Ga0207643_10000108 | 3300025908 | Bacteria | 56497 |
| 563 | Ga0207643_10002845 | 3300025908 | Bacteria | 9348 |
| 564 | Ga0207643_10014351 | 3300025908 | Bacteria | 4301 |
| 565 | Ga0207684_10002963 | 3300025910 | Bacteria | 16822 |
| 566 | Ga0207654_10002719 | 3300025911 | Bacteria | 8977 |
| 567 | Ga0207654_10011794 | 3300025911 | Bacteria | 4463 |
| 568 | Ga0207654_10235793 | 3300025911 | Bacteria | 1220 |
| 569 | Ga0207707_10000691 | 3300025912 | Bacteria | 33408 |
| 570 | Ga0207707_10040215 | 3300025912 | Bacteria | 4083 |
| 571 | Ga0207707_10128051 | 3300025912 | Bacteria | 2220 |
| 572 | Ga0207695_10039943 | 3300025913 | Bacteria | 5038 |
| 573 | Ga0207671_10003167 | 3300025914 | Bacteria | 16626 |
| 574 | Ga0207671_10086869 | 3300025914 | Bacteria | 2351 |
| 575 | Ga0207671_10100478 | 3300025914 | Bacteria | 2190 |
| 576 | Ga0207671_10295710 | 3300025914 | Bacteria | 1279 |
| 577 | Ga0207693_10000825 | 3300025915 | Bacteria | 27536 |
| 578 | Ga0207693_10007085 | 3300025915 | Bacteria | 9254 |
| 579 | Ga0207693_10009090 | 3300025915 | Bacteria | 8110 |
| 580 | Ga0207693_10021699 | 3300025915 | Bacteria | 5104 |
| 581 | Ga0207693_10115971 | 3300025915 | Bacteria | 2103 |
| 582 | Ga0207693_10147296 | 3300025915 | Bacteria | 1851 |
| 583 | Ga0207693_10203547 | 3300025915 | Bacteria | 1556 |
| 584 | Ga0207663_10022199 | 3300025916 | Bacteria | 3625 |
| 585 | Ga0207660_10000014 | 3300025917 | Bacteria | 79328 |
| 586 | Ga0207660_10293877 | 3300025917 | Bacteria | 1292 |
| 587 | Ga0207662_10006062 | 3300025918 | Bacteria | 6501 |
| 588 | Ga0207662_10008927 | 3300025918 | Bacteria | 5499 |
| 589 | Ga0207662_10019625 | 3300025918 | Bacteria | 3850 |
| 590 | Ga0207662_10096544 | 3300025918 | Bacteria | 1826 |
| 591 | Ga0207662_10202160 | 3300025918 | Bacteria | 1286 |
| 592 | Ga0207662_10231465 | 3300025918 | Bacteria | 1207 |
| 593 | Ga0207657_10037081 | 3300025919 | Bacteria | 4359 |
| 594 | Ga0207657_10046349 | 3300025919 | Bacteria | 3808 |
| 595 | Ga0207657_10046352 | 3300025919 | Bacteria | 3808 |
| 596 | Ga0207657_10077327 | 3300025919 | Bacteria | 2805 |
| 597 | Ga0207657_10228097 | 3300025919 | Bacteria | 1490 |
| 598 | Ga0207649_10000086 | 3300025920 | Bacteria | 79546 |
| 599 | Ga0207649_10043035 | 3300025920 | Bacteria | 2758 |
| 600 | Ga0207649_10076337 | 3300025920 | Bacteria | 2156 |
| 601 | Ga0207649_10086928 | 3300025920 | Bacteria | 2038 |
| 602 | Ga0207652_10000255 | 3300025921 | Bacteria | 55415 |
| 603 | Ga0207652_10044044 | 3300025921 | Bacteria | 3801 |
| 604 | Ga0207652_10161000 | 3300025921 | Bacteria | 2012 |
| 605 | Ga0207652_10398264 | 3300025921 | Bacteria | 1242 |
| 606 | Ga0207681_10000024 | 3300025923 | Bacteria | 206607 |
| 607 | Ga0207694_10361708 | 3300025924 | Bacteria | 1203 |
| 608 | Ga0207650_10002572 | 3300025925 | Bacteria | 12563 |
| 609 | Ga0207650_10012030 | 3300025925 | Bacteria | 5965 |
| 610 | Ga0207650_10119105 | 3300025925 | Bacteria | 2053 |
| 611 | Ga0207650_10140734 | 3300025925 | Bacteria | 1897 |
| 612 | Ga0207650_10174839 | 3300025925 | Bacteria | 1708 |
| 613 | Ga0207650_10414781 | 3300025925 | Bacteria | 1116 |
| 614 | Ga0207659_10000034 | 3300025926 | Bacteria | 108227 |
| 615 | Ga0207659_10018147 | 3300025926 | Bacteria | 4608 |
| 616 | Ga0207659_10047389 | 3300025926 | Bacteria | 3040 |
| 617 | Ga0207687_10000110 | 3300025927 | Bacteria | 58672 |
| 618 | Ga0207687_10008628 | 3300025927 | Bacteria | 6663 |
| 619 | Ga0207687_10119758 | 3300025927 | Bacteria | 1967 |
| 620 | Ga0207700_10035453 | 3300025928 | Bacteria | 3594 |
| 621 | Ga0207700_10068719 | 3300025928 | Bacteria | 2716 |
| 622 | Ga0207700_10090236 | 3300025928 | Bacteria | 2418 |
| 623 | Ga0207700_10133338 | 3300025928 | Bacteria | 2031 |
| 624 | Ga0207700_10151584 | 3300025928 | Bacteria | 1916 |
| 625 | Ga0207700_10303672 | 3300025928 | Bacteria | 1379 |
| 626 | Ga0207700_10324076 | 3300025928 | Bacteria | 1336 |
| 627 | Ga0207664_10007232 | 3300025929 | Bacteria | 7689 |
| 628 | Ga0207664_10023737 | 3300025929 | Bacteria | 4599 |
| 629 | Ga0207664_10027533 | 3300025929 | Bacteria | 4310 |
| 630 | Ga0207644_10000642 | 3300025931 | Bacteria | 22154 |
| 631 | Ga0207644_10003006 | 3300025931 | Bacteria | 10851 |
| 632 | Ga0207644_10047247 | 3300025931 | Bacteria | 3070 |
| 633 | Ga0207644_10112084 | 3300025931 | Bacteria | 2064 |
| 634 | Ga0207690_10000270 | 3300025932 | Bacteria | 36976 |
| 635 | Ga0207690_10022682 | 3300025932 | Bacteria | 3907 |
| 636 | Ga0207690_10051466 | 3300025932 | Bacteria | 2754 |
| 637 | Ga0207690_10168676 | 3300025932 | Bacteria | 1638 |
| 638 | Ga0207690_10189827 | 3300025932 | Bacteria | 1553 |
| 639 | Ga0207706_10001336 | 3300025933 | Bacteria | 24661 |
| 640 | Ga0207706_10005854 | 3300025933 | Bacteria | 11434 |
| 641 | Ga0207706_10007295 | 3300025933 | Bacteria | 10222 |
| 642 | Ga0207706_10007337 | 3300025933 | Bacteria | 10195 |
| 643 | Ga0207706_10108352 | 3300025933 | Bacteria | 2445 |
| 644 | Ga0207706_10109295 | 3300025933 | Bacteria | 2433 |
| 645 | Ga0207706_10341353 | 3300025933 | Bacteria | 1303 |
| 646 | Ga0207706_10403529 | 3300025933 | Bacteria | 1185 |
| 647 | Ga0207706_10479894 | 3300025933 | Bacteria | 1074 |
| 648 | Ga0207686_10000214 | 3300025934 | Bacteria | 44245 |
| 649 | Ga0207686_10044726 | 3300025934 | Bacteria | 2721 |
| 650 | Ga0207686_10275477 | 3300025934 | Bacteria | 1240 |
| 651 | Ga0207709_10000344 | 3300025935 | Bacteria | 48058 |
| 652 | Ga0207709_10003540 | 3300025935 | Bacteria | 9237 |
| 653 | Ga0207709_10165987 | 3300025935 | Bacteria | 1545 |
| 654 | Ga0207670_10000461 | 3300025936 | Bacteria | 22671 |
| 655 | Ga0207670_10002631 | 3300025936 | Bacteria | 9445 |
| 656 | Ga0207670_10111337 | 3300025936 | Bacteria | 1973 |
| 657 | Ga0207670_10151846 | 3300025936 | Bacteria | 1720 |
| 658 | Ga0207670_10243822 | 3300025936 | Unclassified | 1386 |
| 659 | Ga0207669_10000295 | 3300025937 | Bacteria | 22936 |
| 660 | Ga0207669_10001111 | 3300025937 | Bacteria | 11514 |
| 661 | Ga0207669_10029074 | 3300025937 | Bacteria | 3051 |
| 662 | Ga0207704_10000343 | 3300025938 | Bacteria | 21644 |
| 663 | Ga0207704_10052137 | 3300025938 | Bacteria | 2478 |
| 664 | Ga0207704_10060299 | 3300025938 | Bacteria | 2347 |
| 665 | Ga0207665_10001068 | 3300025939 | Bacteria | 18420 |
| 666 | Ga0207665_10003817 | 3300025939 | Bacteria | 10071 |
| 667 | Ga0207665_10109985 | 3300025939 | Bacteria | 1935 |
| 668 | Ga0207665_10129375 | 3300025939 | Bacteria | 1790 |
| 669 | Ga0207691_10000635 | 3300025940 | Bacteria | 34764 |
| 670 | Ga0207691_10003768 | 3300025940 | Bacteria | 14723 |
| 671 | Ga0207691_10012880 | 3300025940 | Bacteria | 8006 |
| 672 | Ga0207711_10007313 | 3300025941 | Bacteria | 9244 |
| 673 | Ga0207711_10093487 | 3300025941 | Bacteria | 2649 |
| 674 | Ga0207711_10186767 | 3300025941 | Bacteria | 1887 |
| 675 | Ga0207711_10223596 | 3300025941 | Bacteria | 1723 |
| 676 | Ga0207689_10002655 | 3300025942 | Bacteria | 16537 |
| 677 | Ga0207689_10003641 | 3300025942 | Bacteria | 14070 |
| 678 | Ga0207689_10024648 | 3300025942 | Bacteria | 5045 |
| 679 | Ga0207689_10043531 | 3300025942 | Bacteria | 3711 |
| 680 | Ga0207689_10213810 | 3300025942 | Bacteria | 1593 |
| 681 | Ga0207661_10000036 | 3300025944 | Bacteria | 149720 |
| 682 | Ga0207661_10135662 | 3300025944 | Bacteria | 2113 |
| 683 | Ga0207661_10672300 | 3300025944 | Bacteria | 952 |
| 684 | Ga0207679_10000025 | 3300025945 | Bacteria | 203699 |
| 685 | Ga0207679_10014282 | 3300025945 | Bacteria | 5216 |
| 686 | Ga0207679_10082518 | 3300025945 | Bacteria | 2461 |
| 687 | Ga0207679_10374527 | 3300025945 | Bacteria | 1247 |
| 688 | Ga0207679_10556082 | 3300025945 | Bacteria | 1030 |
| 689 | Ga0207679_10823092 | 3300025945 | Bacteria | 847 |
| 690 | Ga0207667_10007960 | 3300025949 | Bacteria | 12642 |
| 691 | Ga0207667_10463367 | 3300025949 | Bacteria | 1287 |
| 692 | Ga0207651_10000028 | 3300025960 | Bacteria | 68962 |
| 693 | Ga0207651_10013440 | 3300025960 | Bacteria | 4686 |
| 694 | Ga0207651_10053292 | 3300025960 | Bacteria | 2764 |
| 695 | Ga0207651_10153312 | 3300025960 | Bacteria | 1797 |
| 696 | Ga0207651_10224029 | 3300025960 | Bacteria | 1522 |
| 697 | Ga0207651_10441443 | 3300025960 | Bacteria | 1115 |
| 698 | Ga0207712_10000558 | 3300025961 | Bacteria | 30161 |
| 699 | Ga0207712_10002399 | 3300025961 | Bacteria | 12137 |
| 700 | Ga0207712_10089239 | 3300025961 | Bacteria | 2266 |
| 701 | Ga0207712_10372855 | 3300025961 | Bacteria | 1192 |
| 702 | Ga0207668_10000538 | 3300025972 | Bacteria | 23787 |
| 703 | Ga0207668_10013637 | 3300025972 | Bacteria | 5013 |
| 704 | Ga0207668_10031104 | 3300025972 | Bacteria | 3512 |
| 705 | Ga0207640_10006541 | 3300025981 | Bacteria | 6398 |
| 706 | Ga0207640_10041977 | 3300025981 | Bacteria | 2913 |
| 707 | Ga0207640_10043342 | 3300025981 | Bacteria | 2875 |
| 708 | Ga0207640_10170042 | 3300025981 | Bacteria | 1623 |
| 709 | Ga0207640_10691598 | 3300025981 | Bacteria | 873 |
| 710 | Ga0207640_10804095 | 3300025981 | Bacteria | 815 |
| 711 | Ga0207658_10000795 | 3300025986 | Bacteria | 26521 |
| 712 | Ga0207658_10046077 | 3300025986 | Bacteria | 3182 |
| 713 | Ga0207658_10197400 | 3300025986 | Bacteria | 1677 |
| 714 | Ga0207658_10370139 | 3300025986 | Bacteria | 1252 |
| 715 | Ga0207677_10001822 | 3300026023 | Bacteria | 11259 |
| 716 | Ga0207677_10015703 | 3300026023 | Bacteria | 4463 |
| 717 | Ga0207677_10043555 | 3300026023 | Bacteria | 2985 |
| 718 | Ga0207677_10099423 | 3300026023 | Bacteria | 2136 |
| 719 | Ga0207703_10008768 | 3300026035 | Bacteria | 7975 |
| 720 | Ga0207703_10012768 | 3300026035 | Bacteria | 6549 |
| 721 | Ga0207703_10041098 | 3300026035 | Bacteria | 3703 |
| 722 | Ga0207703_10401509 | 3300026035 | Bacteria | 1272 |
| 723 | Ga0207703_10556570 | 3300026035 | Bacteria | 1082 |
| 724 | Ga0207703_11072959 | 3300026035 | Bacteria | 773 |
| 725 | Ga0207639_10000925 | 3300026041 | Bacteria | 19873 |
| 726 | Ga0207639_10018222 | 3300026041 | Bacteria | 4986 |
| 727 | Ga0207639_10045906 | 3300026041 | Bacteria | 3293 |
| 728 | Ga0207639_10238405 | 3300026041 | Bacteria | 1580 |
| 729 | Ga0207639_10276924 | 3300026041 | Bacteria | 1474 |
| 730 | Ga0207639_10316368 | 3300026041 | Bacteria | 1385 |
| 731 | Ga0207678_10003256 | 3300026067 | Bacteria | 14657 |
| 732 | Ga0207678_10004902 | 3300026067 | Bacteria | 12024 |
| 733 | Ga0207678_10006940 | 3300026067 | Bacteria | 10052 |
| 734 | Ga0207678_10010341 | 3300026067 | Bacteria | 8190 |
| 735 | Ga0207678_10016580 | 3300026067 | Bacteria | 6470 |
| 736 | Ga0207678_10248247 | 3300026067 | Bacteria | 1524 |
| 737 | Ga0207708_10004521 | 3300026075 | Bacteria | 10234 |
| 738 | Ga0207708_10019050 | 3300026075 | Bacteria | 5168 |
| 739 | Ga0207708_10037218 | 3300026075 | Bacteria | 3707 |
| 740 | Ga0207702_10004638 | 3300026078 | Bacteria | 12166 |
| 741 | Ga0207702_10065787 | 3300026078 | Bacteria | 3105 |
| 742 | Ga0207702_10069314 | 3300026078 | Bacteria | 3032 |
| 743 | Ga0207702_10073820 | 3300026078 | Bacteria | 2942 |
| 744 | Ga0207641_10001294 | 3300026088 | Bacteria | 24893 |
| 745 | Ga0207648_10003105 | 3300026089 | Bacteria | 17542 |
| 746 | Ga0207648_10004307 | 3300026089 | Bacteria | 14659 |
| 747 | Ga0207648_10011750 | 3300026089 | Bacteria | 8232 |
| 748 | Ga0207648_10076986 | 3300026089 | Bacteria | 2908 |
| 749 | Ga0207648_10553353 | 3300026089 | Bacteria | 1057 |
| 750 | Ga0207676_10000640 | 3300026095 | Bacteria | 28116 |
| 751 | Ga0207676_10024382 | 3300026095 | Bacteria | 4475 |
| 752 | Ga0207676_10042058 | 3300026095 | Bacteria | 3513 |
| 753 | Ga0207676_10313281 | 3300026095 | Bacteria | 1437 |
| 754 | Ga0207674_10005795 | 3300026116 | Bacteria | 14657 |
| 755 | Ga0207674_10074975 | 3300026116 | Bacteria | 3394 |
| 756 | Ga0207674_10104935 | 3300026116 | Bacteria | 2804 |
| 757 | Ga0207674_10253632 | 3300026116 | Bacteria | 1706 |
| 758 | Ga0207674_10489740 | 3300026116 | Bacteria | 1188 |
| 759 | Ga0207675_100003849 | 3300026118 | Bacteria | 14589 |
| 760 | Ga0207675_100004255 | 3300026118 | Bacteria | 13848 |
| 761 | Ga0207683_10000001 | 3300026121 | Bacteria | 352047 |
| 762 | Ga0207683_10004806 | 3300026121 | Bacteria | 11633 |
| 763 | Ga0207683_10007077 | 3300026121 | Bacteria | 9617 |
| 764 | Ga0207683_10023723 | 3300026121 | Bacteria | 5278 |
| 765 | Ga0207683_10044817 | 3300026121 | Bacteria | 3867 |
| 766 | Ga0207698_10014590 | 3300026142 | Bacteria | 5230 |
| 767 | Ga0207698_10026697 | 3300026142 | Bacteria | 4088 |
| 768 | Ga0207698_10127971 | 3300026142 | Bacteria | 2164 |
| 769 | Ga0207698_10291971 | 3300026142 | Bacteria | 1513 |
| 770 | Ga0207698_10458495 | 3300026142 | Bacteria | 1232 |
| 771 | Ga0207698_10996118 | 3300026142 | Bacteria | 848 |
| 772 | Ga0209995_1017210 | 3300027471 | Bacteria | 1189 |
| 773 | Ga0209179_1029153 | 3300027512 | Bacteria | 1122 |
| 774 | Ga0209968_1030175 | 3300027526 | Bacteria | 905 |
| 775 | Ga0209982_1002600 | 3300027552 | Bacteria | 2541 |
| 776 | Ga0209970_1012282 | 3300027614 | Bacteria | 1415 |
| 777 | Ga0210002_1001810 | 3300027617 | Bacteria | 3044 |
| 778 | Ga0209983_1035560 | 3300027665 | Bacteria | 1069 |
| 779 | Ga0209971_1037950 | 3300027682 | Bacteria | 1160 |
| 780 | Ga0209966_1001479 | 3300027695 | Bacteria | 4079 |
| 781 | Ga0209966_1001617 | 3300027695 | Bacteria | 3849 |
| 782 | Ga0209998_10001115 | 3300027717 | Bacteria | 6677 |
| 783 | Ga0209998_10001190 | 3300027717 | Bacteria | 6421 |
| 784 | Ga0209813_10001830 | 3300027866 | Bacteria | 4791 |
| 785 | Ga0209974_10000991 | 3300027876 | Bacteria | 9982 |
| 786 | Ga0209974_10123482 | 3300027876 | Bacteria | 919 |
| 787 | Ga0207428_10000823 | 3300027907 | Bacteria | 34987 |
| 788 | Ga0207428_10001512 | 3300027907 | Bacteria | 24323 |
| 789 | Ga0207428_10105356 | 3300027907 | Bacteria | 2175 |
| 790 | Ga0265357_1001253 | 3300028023 | Bacteria | 1813 |
| 791 | Ga0268266_10026518 | 3300028379 | Bacteria | 4930 |
| 792 | Ga0268266_10135900 | 3300028379 | Bacteria | 2202 |
| 793 | Ga0268266_10153292 | 3300028379 | Bacteria | 2079 |
| 794 | Ga0268266_10167713 | 3300028379 | Bacteria | 1991 |
| 795 | Ga0268266_10311633 | 3300028379 | Bacteria | 1471 |
| 796 | Ga0268265_10001288 | 3300028380 | Bacteria | 21569 |
| 797 | Ga0268265_10086490 | 3300028380 | Bacteria | 2491 |
| 798 | Ga0268265_10555025 | 3300028380 | Bacteria | 1091 |
| 799 | Ga0268264_10000456 | 3300028381 | Bacteria | 55761 |
| 800 | Ga0268264_10005325 | 3300028381 | Bacteria | 10898 |
| 801 | Ga0268264_10074026 | 3300028381 | Bacteria | 2892 |
| 802 | Ga0268264_10128105 | 3300028381 | Bacteria | 2246 |
| 803 | Ga0268264_10354635 | 3300028381 | Bacteria | 1397 |
| 804 | Ga0268264_10559966 | 3300028381 | Bacteria | 1122 |
| 805 | Ga0265318_10004032 | 3300028577 | Bacteria | 7212 |
| 806 | Ga0265330_10007771 | 3300031235 | Bacteria | 5206 |
| 807 | Ga0265330_10053496 | 3300031235 | Bacteria | 1767 |
| 808 | Ga0265332_10012389 | 3300031238 | Bacteria | 3785 |
| 809 | Ga0265320_10018493 | 3300031240 | Bacteria | 3834 |
| 810 | Ga0265325_10004992 | 3300031241 | Bacteria | 8267 |
| 811 | Ga0265329_10012587 | 3300031242 | Bacteria | 3036 |
| 812 | Ga0265340_10004865 | 3300031247 | Bacteria | 7472 |
| 813 | Ga0265340_10020868 | 3300031247 | Bacteria | 3362 |
| 814 | Ga0265339_10004645 | 3300031249 | Bacteria | 9336 |
| 815 | Ga0265339_10013807 | 3300031249 | Bacteria | 4887 |
| 816 | Ga0265331_10012924 | 3300031250 | Bacteria | 4501 |
| 817 | Ga0265331_10051231 | 3300031250 | Bacteria | 1976 |
| 818 | Ga0265316_10025046 | 3300031344 | Bacteria | 4984 |
| 819 | Ga0265316_10070106 | 3300031344 | Bacteria | 2704 |
| 820 | Ga0265316_10129850 | 3300031344 | Bacteria | 1898 |
| 821 | Ga0307513_10115927 | 3300031456 | Bacteria | 2660 |
| 822 | Ga0265313_10022841 | 3300031595 | Bacteria | 3383 |
| 823 | Ga0265314_10008306 | 3300031711 | Bacteria | 8906 |
| 824 | Ga0265342_10000092 | 3300031712 | Bacteria | 99040 |
| 825 | Ga0265342_10014308 | 3300031712 | Bacteria | 5271 |
| 826 | Ga0307410_10730951 | 3300031852 | Bacteria | 837 |
| 827 | Ga0316583_10000594 | 3300032133 | Bacteria | 10995 |
| 828 | Ga0307510_10192420 | 3300033180 | Bacteria | 1586 |
| 829 | Ga0373930_0000196 | 3300034816 | Bacteria | 7356 |
| 830 | Ga0373948_0000861 | 3300034817 | Bacteria | 4040 |
| 831 | Ga0373948_0001041 | 3300034817 | Bacteria | 3733 |
| 832 | Ga0373948_0001761 | 3300034817 | Bacteria | 3079 |
| 833 | Ga0373950_0000297 | 3300034818 | Bacteria | 6238 |
| 834 | Ga0373950_0005679 | 3300034818 | Bacteria | 1872 |
| 835 | Ga0373958_0002061 | 3300034819 | Bacteria | 2777 |
| 836 | Ga0373958_0006709 | 3300034819 | Bacteria | 1806 |
| 837 | Ga0373958_0008200 | 3300034819 | Bacteria | 1686 |
| 838 | Ga0373959_0001177 | 3300034820 | Bacteria | 4225 |
| 839 | Ga0373959_0002292 | 3300034820 | Bacteria | 3042 |
| 840 | Ga0373938_0000046 | 3300034957 | Bacteria | 16304 |
| 841 | Ga0373938_0002402 | 3300034957 | Bacteria | 3017 |
| 842 | Ga0373938_0020342 | 3300034957 | Bacteria | 1336 |
| 843 | Ga0373926_0021975 | 3300035083 | Bacteria | 2212 |
| 844 | Ga0373926_0046822 | 3300035083 | Bacteria | 1552 |
| 845 | Ga0373928_0001726 | 3300035084 | Bacteria | 4244 |
| 846 | Ga0373928_0046076 | 3300035084 | Unclassified | 1016 |
| 847 | Ga0373929_0000284 | 3300035085 | Bacteria | 9427 |
| 848 | Ga0373929_0002711 | 3300035085 | Bacteria | 3232 |
| 849 | Ga0373934_0022290 | 3300035086 | Bacteria | 2443 |
| 850 | Ga0373934_0076615 | 3300035086 | Bacteria | 1341 |
| 851 | Ga0373940_0001045 | 3300035088 | Bacteria | 4772 |
| 852 | Ga0373940_0001289 | 3300035088 | Bacteria | 4460 |
| 853 | Ga0373944_0003559 | 3300035089 | Bacteria | 4028 |
| 854 | Ga0373944_0005088 | 3300035089 | Bacteria | 3453 |
| 855 | Ga0373944_0040433 | 3300035089 | Bacteria | 1439 |
| 856 | Ga0373949_0000546 | 3300035090 | Bacteria | 12423 |
| 857 | Ga0373949_0001599 | 3300035090 | Bacteria | 6378 |
| 858 | Ga0373949_0024744 | 3300035090 | Bacteria | 1397 |
| 859 | Ga0373951_0000608 | 3300035091 | Bacteria | 9852 |
| 860 | Ga0373951_0001694 | 3300035091 | Bacteria | 5757 |
| 861 | Ga0373951_0020605 | 3300035091 | Bacteria | 1510 |
| 862 | Ga0373952_0000574 | 3300035092 | Bacteria | 6477 |
| 863 | Ga0373952_0004003 | 3300035092 | Bacteria | 2662 |
| 864 | Ga0373923_0016264 | 3300035111 | Bacteria | 2823 |
| 865 | Ga0373923_0066038 | 3300035111 | Bacteria | 1545 |
| 866 | Ga0373923_0094372 | 3300035111 | Bacteria | 1312 |
| 867 | Ga0373932_0000577 | 3300035112 | Bacteria | 11181 |
| 868 | Ga0373932_0001670 | 3300035112 | Bacteria | 6058 |
| 869 | Ga0373932_0011388 | 3300035112 | Bacteria | 2172 |
| 870 | Ga0373936_0005473 | 3300035113 | Bacteria | 4790 |
| 871 | Ga0373936_0122148 | 3300035113 | Bacteria | 1113 |
| 872 | Ga0373939_0000691 | 3300035114 | Bacteria | 8369 |
| 873 | Ga0373939_0001452 | 3300035114 | Bacteria | 5734 |
| 874 | Ga0373939_0002354 | 3300035114 | Bacteria | 4469 |
| 875 | Ga0373941_0003673 | 3300035115 | Bacteria | 3493 |
| 876 | Ga0373941_0007450 | 3300035115 | Bacteria | 2677 |
| 877 | Ga0373945_0021266 | 3300035116 | Bacteria | 2228 |
| 878 | Ga0373945_0021839 | 3300035116 | Bacteria | 2202 |
| 879 | Ga0373945_0036414 | 3300035116 | Bacteria | 1763 |
| 880 | Ga0373945_0095753 | 3300035116 | Bacteria | 1155 |
| 881 | Ga0373945_0134297 | 3300035116 | Bacteria | 994 |
| 882 | Ga0373953_0007986 | 3300035117 | Bacteria | 3573 |
| 883 | Ga0373953_0014564 | 3300035117 | Bacteria | 2832 |
| 884 | Ga0373953_0105645 | 3300035117 | Bacteria | 1188 |
| 885 | Ga0373954_0004076 | 3300035118 | Bacteria | 6261 |
| 886 | Ga0373954_0128019 | 3300035118 | Bacteria | 1235 |
| 887 | Ga0373956_0001739 | 3300035119 | Bacteria | 8964 |
| 888 | Ga0373956_0001917 | 3300035119 | Bacteria | 8598 |
| 889 | Ga0373956_0024511 | 3300035119 | Bacteria | 2600 |
| 890 | Ga0373957_0006573 | 3300035120 | Bacteria | 3671 |
| 891 | Ga0373957_0006843 | 3300035120 | Bacteria | 3614 |
| 892 | Ga0373960_0000587 | 3300035121 | Bacteria | 7449 |
| 893 | Ga0373960_0011868 | 3300035121 | Bacteria | 2155 |
| 894 | Ga0373960_0058946 | 3300035121 | Unclassified | 1159 |
| 895 | Ga0373943_0002330 | 3300035170 | Bacteria | 8635 |
| 896 | Ga0373943_0011524 | 3300035170 | Bacteria | 3979 |
| 897 | Ga0373943_0084121 | 3300035170 | Bacteria | 1636 |
| 898 | Ga0373946_0008539 | 3300035171 | Bacteria | 3759 |
| 899 | Ga0373946_0011321 | 3300035171 | Bacteria | 3325 |
| 900 | Ga0373946_0036676 | 3300035171 | Bacteria | 1989 |
| 901 | Ga0373955_0001883 | 3300035172 | Bacteria | 9050 |
| 902 | Ga0373955_0021582 | 3300035172 | Bacteria | 3253 |
| 903 | Ga0373955_0150546 | 3300035172 | Bacteria | 1369 |
| 904 | Ga0373955_0416613 | 3300035172 | Bacteria | 817 |
| 905 | Ga0373955_0440854 | 3300035172 | Bacteria | 793 |
| 906 | Ga0373942_0001465 | 3300035207 | Bacteria | 6062 |
| 907 | Ga0373942_0004097 | 3300035207 | Bacteria | 3396 |
| 908 | Ga0373942_0010473 | 3300035207 | Bacteria | 2182 |
| 909 | Ga0373961_0000385 | 3300035241 | Bacteria | 18617 |
| 910 | Ga0373961_0000869 | 3300035241 | Bacteria | 10181 |
| 911 | Ga0373961_0051776 | 3300035241 | Bacteria | 1220 |
| 912 | Ga0373961_0054494 | 3300035241 | Bacteria | 1196 |
| 913 | Ga0373962_0003613 | 3300035242 | Bacteria | 3718 |
| 914 | Ga0373962_0006217 | 3300035242 | Bacteria | 2888 |
| 915 | Ga0373962_0062480 | 3300035242 | Bacteria | 1096 |
| 916 | Ga0373962_0073279 | 3300035242 | Bacteria | 1027 |
| 917 | Ga0373924_0223256 | 3300035410 | Bacteria | 832 |
| 918 | Ga0373931_0001882 | 3300035691 | Bacteria | 9166 |
| 919 | Ga0373931_0003354 | 3300035691 | Bacteria | 7175 |
| 920 | Ga0373931_0012617 | 3300035691 | Bacteria | 4097 |
| 921 | Ga0373935_0002676 | 3300035692 | Bacteria | 10246 |
| 922 | Ga0373935_0257719 | 3300035692 | Bacteria | 1222 |
| 923 | Ga0373927_0010750 | 3300035695 | Bacteria | 6096 |
| 924 | Ga0373927_0122790 | 3300035695 | Bacteria | 1695 |
| 925 | Ga0373927_0179285 | 3300035695 | Bacteria | 1389 |
| 926 | Ga0373933_0000125 | 3300035724 | Bacteria | 49268 |
| 927 | Ga0373933_0002112 | 3300035724 | Bacteria | 11410 |
| 928 | Ga0373933_0010711 | 3300035724 | Bacteria | 5029 |
| 929 | Ga0373933_0017319 | 3300035724 | Bacteria | 4041 |
| 930 | Ga0373947_0001553 | 3300035725 | Bacteria | 14063 |
| 931 | Ga0373947_0080026 | 3300035725 | Bacteria | 2020 |
| 932 | Ga0373947_0170067 | 3300035725 | Bacteria | 1414 |
| 933 | Ga0373947_0436927 | 3300035725 | Bacteria | 885 |
| 934 | Ga0373937_0002048 | 3300036401 | Bacteria | 16856 |
| 935 | Ga0373937_0188820 | 3300036401 | Bacteria | 1936 |
| 936 | Ga0373937_0223998 | 3300036401 | Bacteria | 1770 |
| 937 | Ga0373937_0511460 | 3300036401 | Bacteria | 1141 |
| 938 | Ga0373925_0008896 | 3300037068 | Bacteria | 7316 |
| 939 | Ga0373925_0033160 | 3300037068 | Bacteria | 3806 |
| 940 | Ga0373925_0125619 | 3300037068 | Bacteria | 1995 |
| 941 | Ga0373925_0256122 | 3300037068 | Bacteria | 1405 |
| 942 | Ga0373925_0640801 | 3300037068 | Bacteria | 875 |
| 943 | Ga0395899_0097748 | 3300037312 | Bacteria | 2122 |
| 944 | Ga0395900_0003627 | 3300037418 | Bacteria | 16600 |
| 945 | Ga0395898_0174352 | 3300037466 | Bacteria | 2055 |
| 946 | Ga0395898_0931075 | 3300037466 | Bacteria | 806 |
| 947 | Ga0395905_0014986 | 3300037471 | Bacteria | 7393 |
| 948 | Ga0436364_0794080 | 3300037853 | Bacteria | 1792 |
| 949 | Ga0395901_0040521 | 3300038443 | Bacteria | 4825 |
| 950 | Ga0395901_0048746 | 3300038443 | Bacteria | 4399 |
| 951 | Ga0395901_0152787 | 3300038443 | Bacteria | 2425 |
| 952 | Ga0242420_015440 | 3300038996 | Unclassified | 1320 |
| 953 | Ga0436365_0657686 | 3300039437 | Bacteria | 27042 |
| 954 | Ga0436365_1898637 | 3300039437 | Bacteria | 5776 |
| 955 | Ga0436361_0256491 | 3300039447 | Bacteria | 1036 |
| 956 | Ga0436361_0950726 | 3300039447 | Bacteria | 11725 |
| 957 | Ga0436362_0287115 | 3300039453 | Bacteria | 1021 |
| 958 | Ga0436362_1090515 | 3300039453 | Bacteria | 1191 |
| 959 | Ga0439453_0001852 | 3300041408 | Bacteria | 2812 |
| 960 | Ga0439435_0015895 | 3300042436 | Bacteria | 1879 |
| 961 | Ga0439464_0021214 | 3300042439 | Bacteria | 1783 |
| 962 | Ga0451577_0297987 | 3300042876 | Bacteria | 1461 |
| 963 | Ga0466972_0052403 | 3300044658 | Bacteria | 1967 |
| 964 | Ga0466965_0052201 | 3300044683 | Bacteria | 2030 |
| 965 | Ga0466965_0148285 | 3300044683 | Bacteria | 1225 |
| 966 | Ga0466965_0205969 | 3300044683 | Bacteria | 1045 |
| 967 | Ga0466963_0009295 | 3300044694 | Bacteria | 5920 |
| 968 | Ga0466968_0059735 | 3300044735 | Bacteria | 1642 |
| 969 | Ga0466968_0078596 | 3300044735 | Bacteria | 1446 |
| 970 | Ga0466960_0126038 | 3300044901 | Bacteria | 1346 |
| 971 | Ga0466959_0433853 | 3300045049 | Bacteria | 891 |
| 972 | Ga0451576_0021183 | 3300045051 | Bacteria | 7067 |
| 973 | Ga0466967_0076147 | 3300045976 | Bacteria | 3017 |
| 974 | Ga0495617_076952 | 3300046452 | Bacteria | 1094 |
| 975 | Ga0495592_0004699 | 3300046454 | Bacteria | 10018 |
| 976 | Ga0495592_0014796 | 3300046454 | Bacteria | 5923 |
| 977 | Ga0495592_0041714 | 3300046454 | Bacteria | 3439 |
| 978 | Ga0495592_0156492 | 3300046454 | Bacteria | 1571 |
| 979 | Ga0495592_0192099 | 3300046454 | Bacteria | 1383 |
| 980 | Ga0495603_0025855 | 3300046455 | Bacteria | 3548 |
| 981 | Ga0495603_0082710 | 3300046455 | Bacteria | 1880 |
| 982 | Ga0495629_0003044 | 3300046459 | Bacteria | 12743 |
| 983 | Ga0495629_0014934 | 3300046459 | Bacteria | 5580 |
| 984 | Ga0495629_0142612 | 3300046459 | Bacteria | 1666 |
| 985 | Ga0495629_0157088 | 3300046459 | Bacteria | 1580 |
| 986 | Ga0495629_0188613 | 3300046459 | Bacteria | 1427 |
| 987 | Ga0495638_0046393 | 3300046460 | Bacteria | 2729 |
| 988 | Ga0495641_0016811 | 3300046461 | Bacteria | 3839 |
| 989 | Ga0495641_0036035 | 3300046461 | Bacteria | 2327 |
| 990 | Ga0495641_0084391 | 3300046461 | Bacteria | 1422 |
| 991 | Ga0495651_0002035 | 3300046462 | Bacteria | 15618 |
| 992 | Ga0495651_0010719 | 3300046462 | Bacteria | 7049 |
| 993 | Ga0495651_0036349 | 3300046462 | Bacteria | 3835 |
| 994 | Ga0495651_0098800 | 3300046462 | Bacteria | 2177 |
| 995 | Ga0495651_0164118 | 3300046462 | Bacteria | 1588 |
| 996 | Ga0495653_0035187 | 3300046463 | Bacteria | 3954 |
| 997 | Ga0495653_0065475 | 3300046463 | Bacteria | 2735 |
| 998 | Ga0495653_0089810 | 3300046463 | Bacteria | 2250 |
| 999 | Ga0495653_0223012 | 3300046463 | Bacteria | 1266 |
| 1000 | Ga0495653_0359077 | 3300046463 | Bacteria | 935 |
| 1001 | Ga0495580_0152763 | 3300046472 | Bacteria | 1599 |
| 1002 | Ga0495580_0199102 | 3300046472 | Bacteria | 1380 |
| 1003 | Ga0495582_0003239 | 3300046473 | Bacteria | 9143 |
| 1004 | Ga0495582_0028856 | 3300046473 | Bacteria | 3046 |
| 1005 | Ga0495582_0084807 | 3300046473 | Bacteria | 1761 |
| 1006 | Ga0495582_0104126 | 3300046473 | Bacteria | 1590 |
| 1007 | Ga0495605_0035609 | 3300046474 | Bacteria | 2515 |
| 1008 | Ga0495639_0121074 | 3300046475 | Bacteria | 1248 |
| 1009 | Ga0495662_0048090 | 3300046476 | Bacteria | 2059 |
| 1010 | Ga0495662_0107218 | 3300046476 | Bacteria | 1368 |
| 1011 | Ga0495664_0016212 | 3300046477 | Bacteria | 4244 |
| 1012 | Ga0495664_0030072 | 3300046477 | Bacteria | 3180 |
| 1013 | Ga0495664_0101108 | 3300046477 | Bacteria | 1737 |
| 1014 | Ga0495664_0110833 | 3300046477 | Bacteria | 1656 |
| 1015 | Ga0495584_0007023 | 3300046491 | Bacteria | 5881 |
| 1016 | Ga0495584_0018261 | 3300046491 | Bacteria | 3566 |
| 1017 | Ga0495584_0111683 | 3300046491 | Bacteria | 1383 |
| 1018 | Ga0495584_0177029 | 3300046491 | Bacteria | 1084 |
| 1019 | Ga0495585_0000856 | 3300046492 | Bacteria | 26041 |
| 1020 | Ga0495585_0007417 | 3300046492 | Bacteria | 6716 |
| 1021 | Ga0495585_0028456 | 3300046492 | Bacteria | 3188 |
| 1022 | Ga0495585_0111422 | 3300046492 | Bacteria | 1455 |
| 1023 | Ga0495594_0008038 | 3300046499 | Bacteria | 5424 |
| 1024 | Ga0495594_0011796 | 3300046499 | Bacteria | 4544 |
| 1025 | Ga0495594_0096793 | 3300046499 | Bacteria | 1658 |
| 1026 | Ga0495594_0110433 | 3300046499 | Bacteria | 1550 |
| 1027 | Ga0495607_0027202 | 3300046501 | Bacteria | 3540 |
| 1028 | Ga0495607_0195196 | 3300046501 | Bacteria | 1006 |
| 1029 | Ga0495606_0009508 | 3300046507 | Bacteria | 8211 |
| 1030 | Ga0495606_0134135 | 3300046507 | Bacteria | 1468 |
| 1031 | Ga0495608_0000915 | 3300046511 | Bacteria | 20676 |
| 1032 | Ga0495608_0050572 | 3300046511 | Bacteria | 2757 |
| 1033 | Ga0495608_0058533 | 3300046511 | Bacteria | 2540 |
| 1034 | Ga0495608_0066508 | 3300046511 | Bacteria | 2359 |
| 1035 | Ga0495608_0076902 | 3300046511 | Bacteria | 2173 |
| 1036 | Ga0495610_0053992 | 3300046512 | Bacteria | 1943 |
| 1037 | Ga0495618_0052960 | 3300046514 | Bacteria | 2566 |
| 1038 | Ga0495628_0008958 | 3300046516 | Bacteria | 8558 |
| 1039 | Ga0495628_0032827 | 3300046516 | Bacteria | 4187 |
| 1040 | Ga0495628_0082672 | 3300046516 | Bacteria | 2494 |
| 1041 | Ga0495628_0112489 | 3300046516 | Bacteria | 2093 |
| 1042 | Ga0495628_0184642 | 3300046516 | Bacteria | 1576 |
| 1043 | Ga0495630_0126393 | 3300046517 | Bacteria | 1940 |
| 1044 | Ga0495630_0130219 | 3300046517 | Bacteria | 1911 |
| 1045 | Ga0495630_0238275 | 3300046517 | Bacteria | 1390 |
| 1046 | Ga0495630_0541043 | 3300046517 | Bacteria | 893 |
| 1047 | Ga0495630_0659536 | 3300046517 | Bacteria | 801 |
| 1048 | Ga0495630_1022742 | 3300046517 | Bacteria | 628 |
| 1049 | Ga0495631_0094340 | 3300046518 | Bacteria | 1288 |
| 1050 | Ga0495637_0044734 | 3300046520 | Bacteria | 1883 |
| 1051 | Ga0495637_0113199 | 3300046520 | Bacteria | 1050 |
| 1052 | Ga0495644_0011268 | 3300046523 | Bacteria | 3444 |
| 1053 | Ga0495644_0033593 | 3300046523 | Bacteria | 1937 |
| 1054 | Ga0495648_0002380 | 3300046524 | Bacteria | 17465 |
| 1055 | Ga0495663_0021146 | 3300046525 | Bacteria | 1873 |
| 1056 | Ga0495666_0014396 | 3300046526 | Bacteria | 3938 |
| 1057 | Ga0495666_0018752 | 3300046526 | Bacteria | 3437 |
| 1058 | Ga0495666_0136415 | 3300046526 | Bacteria | 1145 |
| 1059 | Ga0495642_0167641 | 3300046528 | Bacteria | 954 |
| 1060 | Ga0495652_0005789 | 3300046529 | Bacteria | 11570 |
| 1061 | Ga0495652_0020937 | 3300046529 | Bacteria | 5812 |
| 1062 | Ga0495652_0063623 | 3300046529 | Bacteria | 3105 |
| 1063 | Ga0495652_0076458 | 3300046529 | Bacteria | 2777 |
| 1064 | Ga0495652_0261233 | 3300046529 | Bacteria | 1278 |
| 1065 | Ga0495652_0352001 | 3300046529 | Bacteria | 1055 |
| 1066 | Ga0495665_0061258 | 3300046531 | Bacteria | 1987 |
| 1067 | Ga0495665_0082559 | 3300046531 | Bacteria | 1690 |
| 1068 | Ga0495665_0097718 | 3300046531 | Bacteria | 1541 |
| 1069 | Ga0495640_0071044 | 3300046533 | Bacteria | 2336 |
| 1070 | Ga0495640_0101573 | 3300046533 | Bacteria | 1887 |
| 1071 | Ga0495640_0209888 | 3300046533 | Bacteria | 1231 |
| 1072 | Ga0495640_0348910 | 3300046533 | Bacteria | 914 |
| 1073 | Ga0495640_0486745 | 3300046533 | Bacteria | 751 |
| 1074 | Ga0495586_0075875 | 3300046535 | Bacteria | 1841 |
| 1075 | Ga0495587_0001734 | 3300046536 | Bacteria | 14559 |
| 1076 | Ga0495587_0018262 | 3300046536 | Bacteria | 4351 |
| 1077 | Ga0495587_0076892 | 3300046536 | Bacteria | 1938 |
| 1078 | Ga0495587_0116350 | 3300046536 | Bacteria | 1533 |
| 1079 | Ga0495598_0000233 | 3300046537 | Bacteria | 9950 |
| 1080 | Ga0495598_0020531 | 3300046537 | Bacteria | 1745 |
| 1081 | Ga0495609_0039144 | 3300046538 | Bacteria | 2135 |
| 1082 | Ga0495621_0008367 | 3300046539 | Bacteria | 3100 |
| 1083 | Ga0495621_0050241 | 3300046539 | Bacteria | 1490 |
| 1084 | Ga0495621_0091691 | 3300046539 | Bacteria | 1146 |
| 1085 | Ga0495645_0011672 | 3300046543 | Bacteria | 6184 |
| 1086 | Ga0495645_0086453 | 3300046543 | Bacteria | 2244 |
| 1087 | Ga0495622_0024440 | 3300046557 | Bacteria | 2821 |
| 1088 | Ga0495622_0141676 | 3300046557 | Bacteria | 1091 |
| 1089 | Ga0495633_0017034 | 3300046558 | Bacteria | 3727 |
| 1090 | Ga0495667_0000259 | 3300046559 | Bacteria | 34280 |
| 1091 | Ga0495667_0018366 | 3300046559 | Bacteria | 4723 |
| 1092 | Ga0495667_0070601 | 3300046559 | Bacteria | 2278 |
| 1093 | Ga0495656_0000215 | 3300046615 | Bacteria | 20636 |
| 1094 | Ga0495668_0039909 | 3300046616 | Bacteria | 2620 |
| 1095 | Ga0495668_0046683 | 3300046616 | Bacteria | 2406 |
| 1096 | Ga0495634_0008814 | 3300046642 | Bacteria | 7480 |
| 1097 | Ga0495634_0180235 | 3300046642 | Bacteria | 1323 |
| 1098 | Ga0495611_0003842 | 3300046648 | Bacteria | 6552 |
| 1099 | Ga0495611_0078575 | 3300046648 | Bacteria | 1515 |
| 1100 | Ga0495611_0277951 | 3300046648 | Bacteria | 774 |
| 1101 | Ga0495625_0017744 | 3300046660 | Bacteria | 5567 |
| 1102 | Ga0495635_0010301 | 3300046663 | Bacteria | 6538 |
| 1103 | Ga0495635_0015969 | 3300046663 | Bacteria | 5243 |
| 1104 | Ga0495635_0026638 | 3300046663 | Bacteria | 4021 |
| 1105 | Ga0495635_0445479 | 3300046663 | Bacteria | 856 |
| 1106 | Ga0495635_0523152 | 3300046663 | Bacteria | 779 |
| 1107 | Ga0495659_0002574 | 3300046664 | Bacteria | 5848 |
| 1108 | Ga0495659_0054558 | 3300046664 | Bacteria | 1462 |
| 1109 | Ga0495661_0063130 | 3300046665 | Bacteria | 2191 |
| 1110 | Ga0495661_0222522 | 3300046665 | Bacteria | 977 |
| 1111 | Ga0495588_0020179 | 3300046674 | Bacteria | 3272 |
| 1112 | Ga0495588_0131939 | 3300046674 | Bacteria | 1318 |
| 1113 | Ga0495588_0243427 | 3300046674 | Bacteria | 948 |
| 1114 | Ga0495657_0015814 | 3300046675 | Bacteria | 5511 |
| 1115 | Ga0495657_0091756 | 3300046675 | Bacteria | 1947 |
| 1116 | Ga0495599_0002681 | 3300046678 | Bacteria | 10394 |
| 1117 | Ga0495599_0017056 | 3300046678 | Bacteria | 4512 |
| 1118 | Ga0495599_0042653 | 3300046678 | Bacteria | 2847 |
| 1119 | Ga0495599_0115730 | 3300046678 | Bacteria | 1668 |
| 1120 | Ga0495623_0020755 | 3300046679 | Bacteria | 4245 |
| 1121 | Ga0495623_0064743 | 3300046679 | Bacteria | 2287 |
| 1122 | Ga0495623_0132012 | 3300046679 | Bacteria | 1494 |
| 1123 | Ga0495646_0010194 | 3300046680 | Bacteria | 5975 |
| 1124 | Ga0495646_0026632 | 3300046680 | Bacteria | 3629 |
| 1125 | Ga0495646_0059772 | 3300046680 | Bacteria | 2275 |
| 1126 | Ga0495647_0020437 | 3300046681 | Bacteria | 2376 |
| 1127 | Ga0495658_0000360 | 3300046683 | Bacteria | 25675 |
| 1128 | Ga0495658_0005781 | 3300046683 | Bacteria | 6071 |
| 1129 | Ga0495658_0094433 | 3300046683 | Bacteria | 1776 |
| 1130 | Ga0495613_0006693 | 3300046689 | Bacteria | 8606 |
| 1131 | Ga0495613_0027827 | 3300046689 | Bacteria | 4207 |
| 1132 | Ga0495613_0033307 | 3300046689 | Bacteria | 3829 |
| 1133 | Ga0495613_0065362 | 3300046689 | Bacteria | 2658 |
| 1134 | Ga0495613_0207131 | 3300046689 | Bacteria | 1380 |
| 1135 | Ga0495624_0155778 | 3300046690 | Bacteria | 1396 |
| 1136 | Ga0495624_0227022 | 3300046690 | Bacteria | 1131 |
| 1137 | Ga0495624_0240543 | 3300046690 | Bacteria | 1095 |
| 1138 | Ga0495624_0256231 | 3300046690 | Bacteria | 1058 |
| 1139 | Ga0495624_0260707 | 3300046690 | Bacteria | 1047 |
| 1140 | Ga0495670_0000213 | 3300046691 | Bacteria | 26531 |
| 1141 | Ga0495670_0033566 | 3300046691 | Bacteria | 2553 |
| 1142 | Ga0495670_0144478 | 3300046691 | Bacteria | 1246 |
| 1143 | Ga0495671_0062082 | 3300046692 | Bacteria | 1842 |
| 1144 | Ga0495671_0301809 | 3300046692 | Bacteria | 770 |
| 1145 | Ga0495649_0040385 | 3300046694 | Bacteria | 2555 |
| 1146 | Ga0495649_0368703 | 3300046694 | Bacteria | 724 |
| 1147 | Ga0495600_0006046 | 3300046809 | Bacteria | 7331 |
| 1148 | Ga0495600_0025897 | 3300046809 | Bacteria | 3782 |
| 1149 | Ga0495600_0052146 | 3300046809 | Bacteria | 2671 |
| 1150 | Ga0495600_0280197 | 3300046809 | Bacteria | 1055 |
| 1151 | Ga0495581_0049437 | 3300047315 | Bacteria | 2428 |
| 1152 | Ga0495581_0057033 | 3300047315 | Bacteria | 2254 |
| 1153 | Ga0495581_0059837 | 3300047315 | Bacteria | 2201 |
| 1154 | Ga0495581_0064661 | 3300047315 | Bacteria | 2114 |
| 1155 | Ga0495604_0002294 | 3300047317 | Bacteria | 15322 |
| 1156 | Ga0495604_0006070 | 3300047317 | Bacteria | 9587 |
| 1157 | Ga0495604_0009049 | 3300047317 | Bacteria | 7879 |
| 1158 | Ga0495604_0057607 | 3300047317 | Bacteria | 2987 |
| 1159 | Ga0495604_0215008 | 3300047317 | Bacteria | 1326 |
| 1160 | Ga0495636_0138265 | 3300047318 | Bacteria | 1087 |
| 1161 | Ga0495674_0116513 | 3300047319 | Bacteria | 2260 |
| 1162 | Ga0495674_0138581 | 3300047319 | Bacteria | 2046 |
| 1163 | Ga0495674_0252836 | 3300047319 | Bacteria | 1450 |
| 1164 | Ga0495674_0338640 | 3300047319 | Bacteria | 1223 |
| 1165 | Ga0495674_0371609 | 3300047319 | Bacteria | 1158 |
| 1166 | Ga0495674_0627891 | 3300047319 | Bacteria | 849 |
| 1167 | Ga0495676_0103110 | 3300047321 | Bacteria | 2107 |
| 1168 | Ga0495676_0142975 | 3300047321 | Bacteria | 1712 |
| 1169 | Ga0495680_0002446 | 3300047322 | Bacteria | 19009 |
| 1170 | Ga0495680_0004222 | 3300047322 | Bacteria | 13790 |
| 1171 | Ga0495680_0006606 | 3300047322 | Bacteria | 10758 |
| 1172 | Ga0495680_0012206 | 3300047322 | Bacteria | 7577 |
| 1173 | Ga0495680_0018853 | 3300047322 | Bacteria | 5846 |
| 1174 | Ga0495683_0102690 | 3300047323 | Bacteria | 1373 |
| 1175 | Ga0495683_0107894 | 3300047323 | Bacteria | 1332 |
| 1176 | Ga0495675_0000147 | 3300047444 | Bacteria | 49274 |
| 1177 | Ga0495675_0001653 | 3300047444 | Bacteria | 13342 |
| 1178 | Ga0495675_0156734 | 3300047444 | Bacteria | 1404 |
| 1179 | Ga0495675_0226208 | 3300047444 | Bacteria | 1130 |
| 1180 | Ga0495673_0089310 | 3300047469 | Bacteria | 1262 |
| 1181 | Ga0495684_0028528 | 3300047471 | Bacteria | 4284 |
| 1182 | Ga0495684_0047645 | 3300047471 | Bacteria | 3278 |
| 1183 | Ga0495684_0133969 | 3300047471 | Bacteria | 1859 |
| 1184 | Ga0495686_0108062 | 3300047472 | Bacteria | 1671 |
| 1185 | Ga0495593_0014970 | 3300047673 | Bacteria | 4403 |
| 1186 | Ga0495593_0039262 | 3300047673 | Bacteria | 2553 |
| 1187 | Ga0495593_0050848 | 3300047673 | Bacteria | 2194 |
| 1188 | Ga0495593_0059876 | 3300047673 | Bacteria | 1994 |
| 1189 | Ga0495593_0090251 | 3300047673 | Bacteria | 1578 |
| 1190 | Ga0495593_0091642 | 3300047673 | Bacteria | 1565 |
| 1191 | Ga0495602_0017376 | 3300048088 | Bacteria | 7212 |
| 1192 | Ga0495602_0017828 | 3300048088 | Bacteria | 7109 |
| 1193 | Ga0495602_0021291 | 3300048088 | Bacteria | 6387 |
| 1194 | Ga0495602_0032133 | 3300048088 | Bacteria | 4947 |
| 1195 | Ga0495602_0371326 | 3300048088 | Bacteria | 1027 |
| 1196 | Ga0495614_0016270 | 3300048089 | Bacteria | 3239 |
| 1197 | Ga0495614_0103831 | 3300048089 | Bacteria | 1244 |
| 1198 | Ga0495614_0162082 | 3300048089 | Bacteria | 1001 |
| 1199 | Ga0495615_0052303 | 3300048090 | Bacteria | 1055 |
| 1200 | Ga0495626_0096330 | 3300048091 | Bacteria | 1295 |
| 1201 | Ga0495626_0155680 | 3300048091 | Bacteria | 961 |
| 1202 | Ga0495626_0185251 | 3300048091 | Bacteria | 861 |
| 1203 | Ga0496100_0006594 | 3300048903 | Bacteria | 6342 |
| 1204 | Ga0496100_0013961 | 3300048903 | Bacteria | 4650 |
| 1205 | Ga0496100_0017287 | 3300048903 | Bacteria | 4254 |
| 1206 | Ga0496100_0019150 | 3300048903 | Bacteria | 4077 |
| 1207 | Ga0496100_0027597 | 3300048903 | Bacteria | 3493 |
| 1208 | Ga0496100_0055392 | 3300048903 | Bacteria | 2590 |
| 1209 | Ga0496100_0155297 | 3300048903 | Bacteria | 1636 |
| 1210 | Ga0496100_0654765 | 3300048903 | Bacteria | 818 |
| 1211 | Ga0496101_0000079 | 3300048904 | Bacteria | 107673 |
| 1212 | Ga0496101_0008107 | 3300048904 | Bacteria | 6853 |
| 1213 | Ga0496101_0040176 | 3300048904 | Bacteria | 3331 |
| 1214 | Ga0496101_0042859 | 3300048904 | Bacteria | 3231 |
| 1215 | Ga0496101_0207438 | 3300048904 | Unclassified | 1517 |
| 1216 | Ga0496101_0494469 | 3300048904 | Bacteria | 966 |
| 1217 | Ga0496102_0000942 | 3300048905 | Bacteria | 27472 |
| 1218 | Ga0496102_0008860 | 3300048905 | Bacteria | 8634 |
| 1219 | Ga0496102_0032833 | 3300048905 | Bacteria | 4664 |
| 1220 | Ga0496102_0045286 | 3300048905 | Bacteria | 3994 |
| 1221 | Ga0496102_0058807 | 3300048905 | Bacteria | 3513 |
| 1222 | Ga0496102_0062689 | 3300048905 | Bacteria | 3404 |
| 1223 | Ga0496102_0065998 | 3300048905 | Bacteria | 3317 |
| 1224 | Ga0496102_0240279 | 3300048905 | Bacteria | 1708 |
| 1225 | Ga0496102_0484428 | 3300048905 | Bacteria | 1158 |
| 1226 | Ga0496102_0570034 | 3300048905 | Bacteria | 1055 |
| 1227 | Ga0496102_0634479 | 3300048905 | Bacteria | 991 |
| 1228 | Ga0496103_0002375 | 3300048906 | Bacteria | 11868 |
| 1229 | Ga0496103_0003062 | 3300048906 | Bacteria | 10279 |
| 1230 | Ga0496103_0003997 | 3300048906 | Bacteria | 8957 |
| 1231 | Ga0496103_0019249 | 3300048906 | Bacteria | 4099 |
| 1232 | Ga0496103_0127351 | 3300048906 | Bacteria | 1624 |
| 1233 | Ga0496103_0181710 | 3300048906 | Bacteria | 1352 |
| 1234 | Ga0496104_0000431 | 3300048907 | Bacteria | 36365 |
| 1235 | Ga0496104_0001836 | 3300048907 | Bacteria | 18358 |
| 1236 | Ga0496104_0004143 | 3300048907 | Bacteria | 12587 |
| 1237 | Ga0496104_0004191 | 3300048907 | Bacteria | 12522 |
| 1238 | Ga0496104_0004953 | 3300048907 | Bacteria | 11622 |
| 1239 | Ga0496104_0048661 | 3300048907 | Bacteria | 3996 |
| 1240 | Ga0496104_0057612 | 3300048907 | Bacteria | 3676 |
| 1241 | Ga0496104_0119489 | 3300048907 | Bacteria | 2530 |
| 1242 | Ga0496104_0121646 | 3300048907 | Bacteria | 2506 |
| 1243 | Ga0496105_0003143 | 3300048908 | Bacteria | 12154 |
| 1244 | Ga0496105_0010944 | 3300048908 | Bacteria | 7147 |
| 1245 | Ga0496105_0023618 | 3300048908 | Bacteria | 4989 |
| 1246 | Ga0496105_0030941 | 3300048908 | Bacteria | 4387 |
| 1247 | Ga0496105_0106414 | 3300048908 | Bacteria | 2315 |
| 1248 | Ga0496105_0198022 | 3300048908 | Bacteria | 1640 |
| 1249 | Ga0496105_0269708 | 3300048908 | Bacteria | 1375 |
| 1250 | Ga0496105_0482244 | 3300048908 | Bacteria | 975 |
| 1251 | Ga0496106_0001143 | 3300048909 | Bacteria | 19671 |
| 1252 | Ga0496106_0003554 | 3300048909 | Bacteria | 11610 |
| 1253 | Ga0496106_0005844 | 3300048909 | Bacteria | 9101 |
| 1254 | Ga0496106_0006633 | 3300048909 | Bacteria | 8570 |
| 1255 | Ga0496106_0020095 | 3300048909 | Bacteria | 4953 |
| 1256 | Ga0496106_0025502 | 3300048909 | Bacteria | 4400 |
| 1257 | Ga0496106_0045494 | 3300048909 | Bacteria | 3296 |
| 1258 | Ga0496106_0161002 | 3300048909 | Bacteria | 1775 |
| 1259 | Ga0496106_0210718 | 3300048909 | Bacteria | 1548 |
| 1260 | Ga0496106_0243728 | 3300048909 | Bacteria | 1436 |
| 1261 | Ga0496106_0263203 | 3300048909 | Bacteria | 1380 |
| 1262 | Ga0496107_0000359 | 3300048910 | Bacteria | 24907 |
| 1263 | Ga0496107_0000436 | 3300048910 | Bacteria | 22636 |
| 1264 | Ga0496107_0001363 | 3300048910 | Bacteria | 15012 |
| 1265 | Ga0496107_0015236 | 3300048910 | Bacteria | 5387 |
| 1266 | Ga0496107_0031502 | 3300048910 | Bacteria | 3784 |
| 1267 | Ga0496107_0070373 | 3300048910 | Bacteria | 2540 |
| 1268 | Ga0496107_0426888 | 3300048910 | Bacteria | 985 |
| 1269 | Ga0496107_0641522 | 3300048910 | Bacteria | 783 |
| 1270 | Ga0496108_0002867 | 3300048911 | Bacteria | 13838 |
| 1271 | Ga0496108_0004006 | 3300048911 | Bacteria | 11815 |
| 1272 | Ga0496108_0005147 | 3300048911 | Bacteria | 10572 |
| 1273 | Ga0496108_0009582 | 3300048911 | Bacteria | 7848 |
| 1274 | Ga0496108_0014038 | 3300048911 | Bacteria | 6535 |
| 1275 | Ga0496108_0026663 | 3300048911 | Bacteria | 4768 |
| 1276 | Ga0496108_0049594 | 3300048911 | Bacteria | 3511 |
| 1277 | Ga0496108_0070596 | 3300048911 | Bacteria | 2948 |
| 1278 | Ga0496108_0539247 | 3300048911 | Bacteria | 1018 |
| 1279 | Ga0496109_0000223 | 3300048912 | Bacteria | 56008 |
| 1280 | Ga0496109_0000404 | 3300048912 | Bacteria | 38842 |
| 1281 | Ga0496109_0003116 | 3300048912 | Bacteria | 13828 |
| 1282 | Ga0496109_0003557 | 3300048912 | Bacteria | 13009 |
| 1283 | Ga0496109_0011617 | 3300048912 | Bacteria | 7572 |
| 1284 | Ga0496109_0018871 | 3300048912 | Bacteria | 6069 |
| 1285 | Ga0496109_0032437 | 3300048912 | Bacteria | 4695 |
| 1286 | Ga0496109_0043419 | 3300048912 | Bacteria | 4074 |
| 1287 | Ga0496109_0062763 | 3300048912 | Bacteria | 3398 |
| 1288 | Ga0496109_0129345 | 3300048912 | Bacteria | 2356 |
| 1289 | Ga0496109_0160862 | 3300048912 | Bacteria | 2104 |
| 1290 | Ga0496109_0353838 | 3300048912 | Bacteria | 1387 |
| 1291 | Ga0496109_0433724 | 3300048912 | Bacteria | 1241 |
| 1292 | Ga0496110_0001910 | 3300048913 | Bacteria | 15419 |
| 1293 | Ga0496110_0002394 | 3300048913 | Bacteria | 14052 |
| 1294 | Ga0496110_0003653 | 3300048913 | Bacteria | 11834 |
| 1295 | Ga0496110_0016589 | 3300048913 | Bacteria | 6151 |
| 1296 | Ga0496110_0018162 | 3300048913 | Bacteria | 5892 |
| 1297 | Ga0496110_0021793 | 3300048913 | Bacteria | 5431 |
| 1298 | Ga0496110_0156603 | 3300048913 | Bacteria | 2064 |
| 1299 | Ga0496110_0216741 | 3300048913 | Bacteria | 1741 |
| 1300 | Ga0496110_0224907 | 3300048913 | Bacteria | 1707 |
| 1301 | Ga0496110_0352580 | 3300048913 | Bacteria | 1340 |
| 1302 | Ga0496110_0382159 | 3300048913 | Bacteria | 1283 |
| 1303 | Ga0496110_0393332 | 3300048913 | Unclassified | 1263 |
| 1304 | Ga0496111_0001774 | 3300048914 | Bacteria | 12653 |
| 1305 | Ga0496111_0002312 | 3300048914 | Bacteria | 11466 |
| 1306 | Ga0496111_0010932 | 3300048914 | Bacteria | 6105 |
| 1307 | Ga0496111_0019333 | 3300048914 | Bacteria | 4729 |
| 1308 | Ga0496111_0031701 | 3300048914 | Bacteria | 3765 |
| 1309 | Ga0496111_0042841 | 3300048914 | Bacteria | 3251 |
| 1310 | Ga0496111_0052032 | 3300048914 | Bacteria | 2957 |
| 1311 | Ga0496111_0224552 | 3300048914 | Bacteria | 1395 |
| 1312 | Ga0496112_0002963 | 3300048915 | Bacteria | 13850 |
| 1313 | Ga0496112_0003601 | 3300048915 | Bacteria | 12888 |
| 1314 | Ga0496112_0011928 | 3300048915 | Bacteria | 7962 |
| 1315 | Ga0496112_0013071 | 3300048915 | Bacteria | 7658 |
| 1316 | Ga0496112_0016019 | 3300048915 | Bacteria | 7009 |
| 1317 | Ga0496112_0033447 | 3300048915 | Bacteria | 4998 |
| 1318 | Ga0496112_0041430 | 3300048915 | Bacteria | 4506 |
| 1319 | Ga0496112_0067614 | 3300048915 | Bacteria | 3527 |
| 1320 | Ga0496112_0153304 | 3300048915 | Bacteria | 2271 |
| 1321 | Ga0496112_0421394 | 3300048915 | Bacteria | 1274 |
| 1322 | Ga0496112_0961166 | 3300048915 | Bacteria | 775 |
| 1323 | Ga0496112_0991408 | 3300048915 | Bacteria | 760 |
| 1324 | Ga0496113_0000624 | 3300048916 | Bacteria | 17779 |
| 1325 | Ga0496113_0001396 | 3300048916 | Bacteria | 13436 |
| 1326 | Ga0496113_0001735 | 3300048916 | Bacteria | 12339 |
| 1327 | Ga0496113_0019330 | 3300048916 | Bacteria | 4763 |
| 1328 | Ga0496113_0024186 | 3300048916 | Bacteria | 4314 |
| 1329 | Ga0496113_0055173 | 3300048916 | Bacteria | 2977 |
| 1330 | Ga0496113_0084102 | 3300048916 | Bacteria | 2443 |
| 1331 | Ga0496113_0179025 | 3300048916 | Bacteria | 1680 |
| 1332 | Ga0496113_0183840 | 3300048916 | Bacteria | 1657 |
| 1333 | Ga0496113_0194380 | 3300048916 | Bacteria | 1611 |
| 1334 | Ga0496113_0466813 | 3300048916 | Bacteria | 1014 |
| 1335 | Ga0496113_0553775 | 3300048916 | Bacteria | 922 |
| 1336 | Ga0496114_0003222 | 3300048917 | Bacteria | 12516 |
| 1337 | Ga0496114_0003326 | 3300048917 | Bacteria | 12354 |
| 1338 | Ga0496114_0026647 | 3300048917 | Bacteria | 4734 |
| 1339 | Ga0496114_0030663 | 3300048917 | Bacteria | 4425 |
| 1340 | Ga0496114_0104819 | 3300048917 | Bacteria | 2418 |
| 1341 | Ga0496115_0000547 | 3300048918 | Bacteria | 29281 |
| 1342 | Ga0496115_0008495 | 3300048918 | Bacteria | 7594 |
| 1343 | Ga0496115_0011806 | 3300048918 | Bacteria | 6561 |
| 1344 | Ga0496115_0269700 | 3300048918 | Bacteria | 1398 |
| 1345 | Ga0496115_0616009 | 3300048918 | Unclassified | 861 |
| 1346 | Ga0496116_0244215 | 3300048919 | Bacteria | 899 |
| 1347 | Ga0496118_0158767 | 3300048921 | Bacteria | 1402 |
| 1348 | Ga0496119_0004123 | 3300048922 | Bacteria | 14637 |
| 1349 | Ga0496119_0044953 | 3300048922 | Bacteria | 2774 |
| 1350 | Ga0496120_0006519 | 3300048923 | Bacteria | 8945 |
| 1351 | Ga0496120_0051081 | 3300048923 | Bacteria | 2364 |
| 1352 | Ga0496121_0041733 | 3300048924 | Bacteria | 4005 |
| 1353 | Ga0496122_0081141 | 3300048925 | Bacteria | 2259 |
| 1354 | Ga0496125_0033107 | 3300048928 | Bacteria | 4580 |
| 1355 | Ga0496126_0040330 | 3300048929 | Bacteria | 4328 |
| 1356 | Ga0501033_0076983 | 3300049570 | Bacteria | 2448 |
| 1357 | Ga0501034_0112807 | 3300049571 | Bacteria | 2708 |
| 1358 | Ga0501034_0418822 | 3300049571 | Bacteria | 1261 |
| 1359 | Ga0501034_0485901 | 3300049571 | Bacteria | 1150 |
| 1360 | Ga0501036_0027820 | 3300049572 | Bacteria | 4779 |
| 1361 | Ga0501036_0364034 | 3300049572 | Bacteria | 1207 |
| 1362 | Ga0501038_0196245 | 3300049574 | Bacteria | 1622 |
| 1363 | Ga0501038_0285339 | 3300049574 | Bacteria | 1298 |
| 1364 | Ga0501039_0092711 | 3300049575 | Bacteria | 2354 |
| 1365 | Ga0501039_0435483 | 3300049575 | Bacteria | 1030 |
| 1366 | Ga0501039_0517843 | 3300049575 | Bacteria | 936 |
| 1367 | Ga0501040_0100563 | 3300049576 | Bacteria | 2016 |
| 1368 | Ga0501042_0248800 | 3300049578 | Bacteria | 1283 |
| 1369 | Ga0501043_0017209 | 3300049579 | Bacteria | 5670 |
| 1370 | Ga0501047_0038971 | 3300049581 | Bacteria | 4596 |
| 1371 | Ga0501047_0252772 | 3300049581 | Bacteria | 1611 |
| 1372 | Ga0501047_0534621 | 3300049581 | Bacteria | 997 |
| 1373 | Ga0501048_0165489 | 3300049582 | Bacteria | 1566 |
| 1374 | Ga0501068_0015903 | 3300049584 | Bacteria | 4333 |
| 1375 | Ga0501068_0297176 | 3300049584 | Bacteria | 1033 |
| 1376 | Ga0501070_0019024 | 3300049586 | Bacteria | 5760 |
| 1377 | Ga0501070_0084044 | 3300049586 | Bacteria | 2635 |
| 1378 | Ga0501071_0049958 | 3300049587 | Bacteria | 3012 |
| 1379 | Ga0501071_0285310 | 3300049587 | Bacteria | 1250 |
| 1380 | Ga0501072_0002712 | 3300049588 | Bacteria | 13291 |
| 1381 | Ga0501072_0004481 | 3300049588 | Bacteria | 10608 |
| 1382 | Ga0501072_0334990 | 3300049588 | Bacteria | 1202 |
| 1383 | Ga0501073_0033637 | 3300049589 | Bacteria | 3649 |
| 1384 | Ga0501073_0135204 | 3300049589 | Bacteria | 1709 |
| 1385 | Ga0501075_0083915 | 3300049591 | Bacteria | 2413 |
| 1386 | Ga0501076_0062530 | 3300049592 | Bacteria | 2965 |
| 1387 | Ga0501077_0018282 | 3300049593 | Bacteria | 4436 |
| 1388 | Ga0501077_0342582 | 3300049593 | Bacteria | 953 |
| 1389 | Ga0501079_0087588 | 3300049741 | Bacteria | 2410 |
| 1390 | Ga0501079_0152376 | 3300049741 | Bacteria | 1802 |
| 1391 | Ga0501079_0195043 | 3300049741 | Bacteria | 1581 |
| 1392 | Ga0501079_0232621 | 3300049741 | Bacteria | 1440 |
| 1393 | Ga0501079_0872822 | 3300049741 | Bacteria | 708 |
| 1394 | Ga0501080_0235329 | 3300049742 | Bacteria | 1673 |
| 1395 | Ga0501080_0239470 | 3300049742 | Bacteria | 1656 |
| 1396 | Ga0501080_0266948 | 3300049742 | Bacteria | 1558 |
| 1397 | Ga0501081_0050631 | 3300049743 | Bacteria | 2861 |
| 1398 | Ga0501081_0245361 | 3300049743 | Unclassified | 1306 |
| 1399 | Ga0501083_0185812 | 3300049744 | Bacteria | 1357 |
| 1400 | Ga0501083_0290466 | 3300049744 | Bacteria | 1063 |
| 1401 | Ga0501035_0001940 | 3300049822 | Bacteria | 20709 |
| 1402 | Ga0501035_0061568 | 3300049822 | Bacteria | 3340 |
| 1403 | Ga0501044_0063861 | 3300049823 | Bacteria | 3759 |
| 1404 | Ga0501044_0065573 | 3300049823 | Bacteria | 3703 |
| 1405 | Ga0501044_0145089 | 3300049823 | Bacteria | 2360 |
| 1406 | Ga0501044_0387481 | 3300049823 | Bacteria | 1312 |
| 1407 | Ga0501045_0212135 | 3300049824 | Bacteria | 1442 |
| 1408 | Ga0501045_0341272 | 3300049824 | Unclassified | 1115 |
| 1409 | nmdc:mga03683_14084_c2 | 3300050489 | Bacteria | 1938 |
| 1410 | nmdc:mga03683_29136_c1 | 3300050489 | Bacteria | 2199 |
| 1411 | nmdc:mga03n38_20855_c1 | 3300050490 | Bacteria | 2628 |
| 1412 | nmdc:mga03n38_29865_c1 | 3300050490 | Bacteria | 2286 |
| 1413 | nmdc:mga00v17_135626_c1 | 3300050491 | Bacteria | 1575 |
| 1414 | nmdc:mga00v17_23425_c1 | 3300050491 | Bacteria | 3571 |
| 1415 | nmdc:mga00v17_52949_c1 | 3300050491 | Bacteria | 2472 |
| 1416 | nmdc:mga0yw44_1437_c1 | 3300050492 | Bacteria | 9099 |
| 1417 | nmdc:mga0yw44_480014_c1 | 3300050492 | Bacteria | 843 |
| 1418 | nmdc:mga0yw44_9426_c1 | 3300050492 | Bacteria | 4936 |
| 1419 | nmdc:mga0k408_2858_c1 | 3300050493 | Bacteria | 9168 |
| 1420 | nmdc:mga0k408_8431_c1 | 3300050493 | Bacteria | 5532 |
| 1421 | nmdc:mga06z11_23264_c1 | 3300050494 | Bacteria | 2908 |
| 1422 | nmdc:mga06z11_25302_c1 | 3300050494 | Bacteria | 2811 |
| 1423 | nmdc:mga04h51_8211_c1 | 3300050495 | Bacteria | 2787 |
| 1424 | nmdc:mga07m45_23396_c1 | 3300050496 | Bacteria | 3377 |
| 1425 | nmdc:mga07m45_5426_c1 | 3300050496 | Bacteria | 6346 |
| 1426 | nmdc:mga05p37_14557_c1 | 3300050507 | Bacteria | 9445 |
| 1427 | nmdc:mga05p37_210565_c1 | 3300050507 | Bacteria | 2350 |
| 1428 | nmdc:mga05p37_31120_c1 | 3300050507 | Bacteria | 6517 |
| 1429 | nmdc:mga05p37_36596_c1 | 3300050507 | Bacteria | 6020 |
| 1430 | nmdc:mga05p37_775316_c1 | 3300050507 | Bacteria | 1053 |
| 1431 | nmdc:mga05p37_884548_c1 | 3300050507 | Bacteria | 965 |
| 1432 | nmdc:mga09592_84725_c1 | 3300050508 | Bacteria | 2703 |
| 1433 | nmdc:mga0qj67_150426_c1 | 3300050509 | Bacteria | 1888 |
| 1434 | nmdc:mga0qj67_18_c1 | 3300050509 | Bacteria | 120268 |
| 1435 | nmdc:mga0qj67_563395_c1 | 3300050509 | Bacteria | 913 |
| 1436 | nmdc:mga06r32_100936_c1 | 3300050510 | Bacteria | 2831 |
| 1437 | nmdc:mga06r32_40585_c1 | 3300050510 | Bacteria | 4419 |
| 1438 | nmdc:mga06r32_64510_c1 | 3300050510 | Bacteria | 3532 |
| 1439 | nmdc:mga08y16_110772_c1 | 3300050511 | Bacteria | 2859 |
| 1440 | nmdc:mga08y16_133176_c1 | 3300050511 | Bacteria | 2584 |
| 1441 | nmdc:mga08y16_226164_c1 | 3300050511 | Bacteria | 1936 |
| 1442 | nmdc:mga08y16_319526_c1 | 3300050511 | Unclassified | 1599 |
| 1443 | nmdc:mga08y16_468887_c1 | 3300050511 | Bacteria | 1282 |
| 1444 | nmdc:mga08y16_939725_c1 | 3300050511 | Bacteria | 848 |
| 1445 | nmdc:mga0n895_1039522_c1 | 3300050512 | Unclassified | 799 |
| 1446 | nmdc:mga0n895_225470_c1 | 3300050512 | Bacteria | 1902 |
| 1447 | nmdc:mga0n895_280338_c1 | 3300050512 | Bacteria | 1690 |
| 1448 | nmdc:mga0n895_330737_c1 | 3300050512 | Bacteria | 1544 |
| 1449 | nmdc:mga0n895_35380_c1 | 3300050512 | Bacteria | 4815 |
| 1450 | nmdc:mga0n895_52081_c1 | 3300050512 | Bacteria | 4017 |
| 1451 | nmdc:mga0n895_622_c1 | 3300050512 | Bacteria | 24660 |
| 1452 | nmdc:mga0n895_64950_c2 | 3300050512 | Bacteria | 1635 |
| 1453 | nmdc:mga0n895_94521_c1 | 3300050512 | Bacteria | 2993 |
| 1454 | nmdc:mga0n895_946020_c1 | 3300050512 | Bacteria | 845 |
| 1455 | nmdc:mga0rr50_221431_c1 | 3300050513 | Bacteria | 1563 |
| 1456 | nmdc:mga0rr50_259688_c1 | 3300050513 | Bacteria | 1445 |
| 1457 | nmdc:mga0rr50_50061_c1 | 3300050513 | Bacteria | 3094 |
| 1458 | nmdc:mga0rr50_68530_c1 | 3300050513 | Bacteria | 2698 |
| 1459 | nmdc:mga0rr50_711847_c1 | 3300050513 | Bacteria | 857 |
| 1460 | nmdc:mga0rr50_79217_c1 | 3300050513 | Bacteria | 2530 |
| 1461 | nmdc:mga08x19_38629_c1 | 3300050514 | Bacteria | 3032 |
| 1462 | nmdc:mga0a205_27052_c1 | 3300050515 | Bacteria | 5476 |
| 1463 | nmdc:mga0a205_368579_c1 | 3300050515 | Bacteria | 1302 |
| 1464 | nmdc:mga0a205_7768_c1 | 3300050515 | Bacteria | 9737 |
| 1465 | nmdc:mga0sz30_12769_c1 | 3300050516 | Bacteria | 3273 |
| 1466 | nmdc:mga0sz30_96175_c1 | 3300050516 | Bacteria | 1291 |
| 1467 | Ga0495601_0001750 | 3300053077 | Bacteria | 12016 |
| 1468 | Ga0495601_0002382 | 3300053077 | Bacteria | 10661 |
| 1469 | Ga0495601_0017376 | 3300053077 | Bacteria | 4365 |
| 1470 | Ga0495601_0025698 | 3300053077 | Bacteria | 3632 |
| 1471 | Ga0495601_0063960 | 3300053077 | Bacteria | 2338 |
| 1472 | Ga0495601_0120741 | 3300053077 | Bacteria | 1702 |
| 1473 | Ga0495601_0153457 | 3300053077 | Bacteria | 1504 |
| 1474 | Ga0495612_0008869 | 3300053078 | Bacteria | 4073 |
| 1475 | Ga0495612_0010274 | 3300053078 | Bacteria | 3787 |
| 1476 | Ga0495612_0043535 | 3300053078 | Bacteria | 1835 |
| 1477 | Ga0495612_0064139 | 3300053078 | Bacteria | 1524 |
| 1478 | Ga0495655_0003016 | 3300053083 | Bacteria | 2733 |
| 1479 | Ga0495655_0008381 | 3300053083 | Bacteria | 1961 |
| 1480 | Ga0495655_0019962 | 3300053083 | Bacteria | 1497 |
| 1481 | Ga0495595_0000576 | 3300053084 | Bacteria | 14034 |
| 1482 | Ga0495595_0004751 | 3300053084 | Bacteria | 5466 |
| 1483 | Ga0495595_0032435 | 3300053084 | Bacteria | 2353 |
| 1484 | Ga0495595_0037073 | 3300053084 | Bacteria | 2215 |
| 1485 | Ga0495595_0090029 | 3300053084 | Bacteria | 1471 |
| 1486 | Ga0495619_0000132 | 3300053085 | Bacteria | 55452 |
| 1487 | Ga0495619_0000178 | 3300053085 | Bacteria | 46773 |
| 1488 | Ga0495619_0011281 | 3300053085 | Bacteria | 5621 |
| 1489 | Ga0495619_0031232 | 3300053085 | Bacteria | 3450 |
| 1490 | Ga0495619_0037425 | 3300053085 | Bacteria | 3161 |
| 1491 | Ga0495619_0037480 | 3300053085 | Bacteria | 3159 |
| 1492 | Ga0495619_0055466 | 3300053085 | Bacteria | 2624 |
| 1493 | Ga0495619_0249010 | 3300053085 | Bacteria | 1231 |
| 1494 | Ga0500646_0039137 | 3300053090 | Bacteria | 1329 |
| 1495 | Ga0500647_0077257 | 3300053091 | Bacteria | 1597 |
| 1496 | Ga0500641_0024406 | 3300053096 | Bacteria | 2331 |
| 1497 | Ga0500654_074863 | 3300053099 | Bacteria | 1623 |
| 1498 | Ga0500557_000012 | 3300053105 | Bacteria | 115728 |
| 1499 | Ga0500595_014887 | 3300053119 | Bacteria | 2938 |
| 1500 | Ga0500614_064498 | 3300053123 | Bacteria | 992 |
| 1501 | Ga0500642_0000232 | 3300053130 | Bacteria | 21724 |
| 1502 | Ga0500568_0098276 | 3300053139 | Bacteria | 1100 |
| 1503 | Ga0500590_182758 | 3300053148 | Bacteria | 908 |
| 1504 | Ga0500604_0232428 | 3300053151 | Unclassified | 637 |
| 1505 | Ga0500625_028959 | 3300053729 | Bacteria | 2628 |
| 1506 | Ga0501084_0170578 | 3300054114 | Bacteria | 1836 |
| 1507 | Ga0501084_0336545 | 3300054114 | Bacteria | 1275 |
| 1508 | Ga0500661_004079 | 3300055283 | Bacteria | 2730 |
| 1509 | Ga0501082_0000145 | 3300060353 | Bacteria | 58967 |
| 1510 | Ga0501082_0077631 | 3300060353 | Bacteria | 2864 |
| 1511 | Ga0501082_0155815 | 3300060353 | Bacteria | 1985 |
| 1512 | Ga0501082_0156230 | 3300060353 | Bacteria | 1982 |
| 1513 | Ga0501082_0259839 | 3300060353 | Bacteria | 1510 |
| 1514 | Ga0530510_0340487 | 3300061734 | Bacteria | 1126 |
| 1515 | 2507505059 | 2507262055 | Bacteria | 8048963 |
| 1516 | 2508538995 | 2508501009 | Bacteria | 7784016 |
| 1517 | 2508695310 | 2508501042 | Bacteria | 8719808 |
| 1518 | 2513639744 | 2513237094 | Bacteria | 8789602 |
| 1519 | 2513647769 | 2513237095 | Bacteria | 8976980 |
| 1520 | 2513873717 | 2513237139 | Bacteria | 8737671 |
| 1521 | 2514015235 | 2513237161 | Bacteria | 8871253 |
| 1522 | 2515625673 | 2515154112 | Bacteria | 8294334 |
| 1523 | 2517102161 | 2517093001 | Bacteria | 9002274 |
| 1524 | 2793064970 | 2791355196 | Bacteria | 7323613 |
| 1525 | 2805915800 | 2802429603 | Bacteria | 8777136 |
| 1526 | 2818237476 | 2816332527 | Bacteria | 8933356 |
| 1527 | 2824608313 | 2824600985 | Bacteria | 8488197 |
| 1528 | 2824617217 | 2824609381 | Bacteria | 8672835 |
| 1529 | 2824660117 | 2824653114 | Bacteria | 8493680 |
| 1530 | 2824677769 | 2824671348 | Bacteria | 8369588 |
| 1531 | 2824692046 | 2824687955 | Bacteria | 8360029 |
| 1532 | 2824700583 | 2824696289 | Bacteria | 8335049 |
| 1533 | 2824772602 | 2824763712 | Bacteria | 9792355 |
| 1534 | 2838124323 | 2838122688 | Bacteria | 8803140 |
| 1535 | 2841948865 | 2841941048 | Bacteria | 8688029 |
| 1536 | 2841951801 | 2841949485 | Bacteria | 8680857 |
| 1537 | 2841973822 | 2841966195 | Bacteria | 8673214 |
| 1538 | 2841980148 | 2841974524 | Bacteria | 8931498 |
| 1539 | 2841985331 | 2841983080 | Bacteria | 8395090 |
| 1540 | 2842043684 | 2842038055 | Bacteria | 8002051 |
| 1541 | 2842052326 | 2842045827 | Bacteria | 8006841 |
| 1542 | 2847941954 | 2847939898 | Bacteria | 8606328 |
| 1543 | 2849082864 | 2849076700 | Bacteria | 7039503 |
| 1544 | 2874597058 | 2874590934 | Bacteria | 8299676 |
| 1545 | 2874624606 | 2874620515 | Bacteria | 8290088 |
| 1546 | 2874648094 | 2874645413 | Bacteria | 8214782 |
| 1547 | 2876777522 | 2876771140 | Bacteria | 8287509 |
| 1548 | 2876825604 | 2876818435 | Bacteria | 8274608 |
| 1549 | 2879077782 | 2879074833 | Bacteria | 8279565 |
| 1550 | 2879127856 | 2879127579 | Bacteria | 8294491 |
| 1551 | 2879148877 | 2879142872 | Bacteria | 8267021 |
| 1552 | 2881365853 | 2881364244 | Bacteria | 7710352 |
| 1553 | 2885371215 | 2885366525 | Bacteria | 8326213 |
| 1554 | 2888420491 | 2888419890 | Bacteria | 7857137 |
| 1555 | 2904672055 | 2904666416 | Bacteria | 8226587 |
| 1556 | 2904715762 | 2904711408 | Bacteria | 9771557 |
| 1557 | 2932794500 | 2932794094 | Bacteria | 7915132 |
| 1558 | 2932806781 | 2932801729 | Bacteria | 7987968 |
| 1559 | 2935615366 | 2935608549 | Bacteria | 8203142 |
| 1560 | 2935654813 | 2935648319 | Bacteria | 8801166 |
| 1561 | 2935663754 | 2935656913 | Bacteria | 8965014 |
| 1562 | 2935773427 | 2935769743 | Bacteria | 7878163 |
| 1563 | 2935782301 | 2935777560 | Bacteria | 8077691 |
| 1564 | 2935789253 | 2935785616 | Bacteria | 7962367 |
| 1565 | 2935797190 | 2935793552 | Bacteria | 8012592 |
| 1566 | 2935825256 | 2935819856 | Bacteria | 8261050 |
| 1567 | 2935853090 | 2935847175 | Bacteria | 8228321 |
| 1568 | 2935888552 | 2935883170 | Bacteria | 7964738 |
| 1569 | 2935910162 | 2935908558 | Bacteria | 8568796 |
| 1570 | 2935918541 | 2935916978 | Bacteria | 9113783 |
| 1571 | 2935927927 | 2935926038 | Bacteria | 8601059 |
| 1572 | 2935936201 | 2935934488 | Bacteria | 8602579 |
| 1573 | 2935944246 | 2935942939 | Bacteria | 8599779 |
| 1574 | 2935952683 | 2935951376 | Bacteria | 8602333 |
| 1575 | 2935969523 | 2935967501 | Bacteria | 8603075 |
| 1576 | 2935977715 | 2935975950 | Bacteria | 8347125 |
| 1577 | 2935984968 | 2935984226 | Bacteria | 8302647 |
| 1578 | 2936017849 | 2936011229 | Bacteria | 8801034 |
| 1579 | 2936026352 | 2936019824 | Bacteria | 8804134 |
| 1580 | 2936031600 | 2936028420 | Bacteria | 8965941 |
| 1581 | 2936053386 | 2936046547 | Bacteria | 8903709 |
| 1582 | 2936056137 | 2936055302 | Bacteria | 8785755 |
| 1583 | 2941532513 | 2941531003 | Bacteria | 7653939 |
| 1584 | 3005710820 | 3005710791 | Bacteria | 7622528 |
| 1585 | 8016525954 | 8016522445 | Bacteria | 8156687 |
| 1586 | 8016557871 | 8016557553 | Bacteria | 8154380 |
| 1587 | 8016569251 | 8016566248 | Bacteria | 8158151 |
| 1588 | 8016581886 | 8016575299 | Bacteria | 8154085 |
| 1589 | 8016595890 | 8016595262 | Bacteria | 8149947 |
| 1590 | 8016618659 | 8016613128 | Bacteria | 8794220 |
| 1591 | 8016623402 | 8016622563 | Bacteria | 7999408 |
| 1592 | 8016635860 | 8016630954 | Bacteria | 9217207 |
| 1593 | 8019530838 | 8019530166 | Bacteria | 8155624 |
| 1594 | 8019540744 | 8019538911 | Bacteria | 7872763 |
| 1595 | 8019622772 | 8019619141 | Bacteria | 9218857 |
| 1596 | 8019630334 | 8019629233 | Bacteria | 8687553 |
| 1597 | 8019640278 | 8019638758 | Bacteria | 9062356 |
| 1598 | 8019652671 | 8019648815 | Bacteria | 10014479 |
| 1599 | 8019667163 | 8019659431 | Bacteria | 8577854 |
| 1600 | 8019676948 | 8019668869 | Bacteria | 8791617 |
| 1601 | 8019679040 | 8019678201 | Bacteria | 8863603 |
| 1602 | 8019696486 | 8019687851 | Bacteria | 8712826 |
| 1603 | 8056971101 | 8056967851 | Bacteria | 9038162 |
| 1604 | Ga0207695_10000107 | |||
| 1605 | 2214756331 | |||
| 1606 | ARcpr5yngRDRAFT_c000052 | |||
| 1607 | ARSoilOldRDRAFT_c000001 | |||
| 1608 | ARCol0oldRDRAFT_c00112 | |||
| 1609 | ARCol0yngRDRAFT_1000001 | |||
| 1610 | JGI24741J21665_1007670 | |||
| 1611 | JGI24752J21851_1001356 | |||
| 1612 | JGI24746J21847_1000477 | |||
| 1613 | JGI24739J22299_10000177 | |||
| 1614 | JGI24737J22298_10000967 | |||
| 1615 | JGI24737J22298_10006515 | |||
| 1616 | JGI24743J22301_10001361 | |||
| 1617 | JGI24750J21931_1000547 | |||
| 1618 | JGI24750J21931_1003185 | |||
| 1619 | JGI24745J21846_1001306 | |||
| 1620 | JGI24748J21848_1000209 | |||
| 1621 | JGI24738J21930_10000256 | |||
| 1622 | JGI24738J21930_10000437 | |||
| 1623 | JGI24749J21850_1000857 | |||
| 1624 | JGI24744J21845_10000555 | |||
| 1625 | JGI24744J21845_10001216 | |||
| 1626 | JGI24035J26624_1000009 | |||
| 1627 | JGI24034J26672_10000760 | |||
| 1628 | JGI24742J22300_10001007 | |||
| 1629 | JGI25153J46596_10007997 | |||
| 1630 | Ga0055531_10004894 | |||
| 1631 | JGI25405J52794_10028701 | |||
| 1632 | Ga0055543_1022841 | |||
| 1633 | Ga0065165_1006357 | |||
| 1634 | Ga0065165_1020376 | |||
| 1635 | Ga0065704_10160483 | |||
| 1636 | Ga0065712_10082879 | |||
| 1637 | Ga0065715_10001850 | |||
| 1638 | Ga0065715_10100237 | |||
| 1639 | Ga0070676_10000076 | |||
| 1640 | Ga0070676_10022801 | |||
| 1641 | Ga0070676_10024250 | |||
| 1642 | Ga0070676_10031130 | |||
| 1643 | Ga0070683_100002997 | |||
| 1644 | Ga0070683_100067661 | |||
| 1645 | Ga0070690_100002546 | |||
| 1646 | Ga0070690_100003545 | |||
| 1647 | Ga0070690_100022196 | |||
| 1648 | Ga0070690_100194638 | |||
| 1649 | Ga0070690_100218798 | |||
| 1650 | Ga0070690_100313120 | |||
| 1651 | Ga0070690_100551954 | |||
| 1652 | Ga0070670_100001544 | |||
| 1653 | Ga0070670_100005236 | |||
| 1654 | Ga0070670_100154002 | |||
| 1655 | Ga0070670_100812982 | |||
| 1656 | Ga0070677_10000038 | |||
| 1657 | Ga0070677_10016774 | |||
| 1658 | Ga0070677_10029474 | |||
| 1659 | Ga0070677_10104839 | |||
| 1660 | Ga0068869_100000054 | |||
| 1661 | Ga0068869_100169330 | |||
| 1662 | Ga0068869_100450057 | |||
| 1663 | Ga0068869_100650715 | |||
| 1664 | Ga0070666_10046576 | |||
| 1665 | Ga0070666_10127785 | |||
| 1666 | Ga0070666_10139406 | |||
| 1667 | Ga0070680_100004742 | |||
| 1668 | Ga0070680_100191245 | |||
| 1669 | Ga0070682_100000181 | |||
| 1670 | Ga0070682_100083595 | |||
| 1671 | Ga0070682_100091649 | |||
| 1672 | Ga0070682_100123788 | |||
| 1673 | Ga0068868_100002127 | |||
| 1674 | Ga0068868_100003086 | |||
| 1675 | Ga0068868_100087352 | |||
| 1676 | Ga0068868_100171033 | |||
| 1677 | Ga0068868_100181563 | |||
| 1678 | Ga0070660_100000660 | |||
| 1679 | Ga0070660_100062555 | |||
| 1680 | Ga0070660_100064473 | |||
| 1681 | Ga0070660_100278485 | |||
| 1682 | Ga0070660_100452990 | |||
| 1683 | Ga0070689_100003434 | |||
| 1684 | Ga0070689_100003508 | |||
| 1685 | Ga0070689_100004183 | |||
| 1686 | Ga0070689_100025050 | |||
| 1687 | Ga0070689_100029697 | |||
| 1688 | Ga0070689_100182206 | |||
| 1689 | Ga0070691_10000491 | |||
| 1690 | Ga0070691_10109721 | |||
| 1691 | Ga0070687_100000358 | |||
| 1692 | Ga0070687_100011228 | |||
| 1693 | Ga0070687_100011387 | |||
| 1694 | Ga0070687_100034735 | |||
| 1695 | Ga0070687_100064142 | |||
| 1696 | Ga0070687_100118747 | |||
| 1697 | Ga0070687_100148142 | |||
| 1698 | Ga0070687_100595184 | |||
| 1699 | Ga0070661_100000797 | |||
| 1700 | Ga0070661_100047671 | |||
| 1701 | Ga0070661_100091588 | |||
| 1702 | Ga0070661_100321610 | |||
| 1703 | Ga0070661_100488577 | |||
| 1704 | Ga0070692_10000320 | |||
| 1705 | Ga0070692_10008804 | |||
| 1706 | Ga0070692_10038825 | |||
| 1707 | Ga0070668_100004777 | |||
| 1708 | Ga0070668_100044390 | |||
| 1709 | Ga0070668_100123028 | |||
| 1710 | Ga0070669_100001643 | |||
| 1711 | Ga0070669_100027609 | |||
| 1712 | Ga0070669_100353257 | |||
| 1713 | Ga0070675_100005771 | |||
| 1714 | Ga0070675_100111785 | |||
| 1715 | Ga0070671_100003232 | |||
| 1716 | Ga0070671_100031220 | |||
| 1717 | Ga0070671_100041035 | |||
| 1718 | Ga0070671_100089793 | |||
| 1719 | Ga0070671_100555295 | |||
| 1720 | Ga0070671_100632121 | |||
| 1721 | Ga0070674_100000140 | |||
| 1722 | Ga0070674_100226858 | |||
| 1723 | Ga0070673_100007770 | |||
| 1724 | Ga0070673_100029834 | |||
| 1725 | Ga0070673_100067400 | |||
| 1726 | Ga0070673_100503104 | |||
| 1727 | Ga0070673_100525476 | |||
| 1728 | Ga0070688_100002076 | |||
| 1729 | Ga0070688_100005196 | |||
| 1730 | Ga0070688_100026043 | |||
| 1731 | Ga0070659_100004532 | |||
| 1732 | Ga0070659_100032102 | |||
| 1733 | Ga0070659_100038432 | |||
| 1734 | Ga0070659_100042897 | |||
| 1735 | Ga0070667_100001305 | |||
| 1736 | Ga0070667_100165388 | |||
| 1737 | Ga0070667_100355091 | |||
| 1738 | Ga0070667_100556513 | |||
| 1739 | Ga0070703_10001982 | |||
| 1740 | Ga0070703_10005800 | |||
| 1741 | Ga0070703_10029695 | |||
| 1742 | Ga0070709_10004597 | |||
| 1743 | Ga0070709_10007654 | |||
| 1744 | Ga0070714_100054238 | |||
| 1745 | Ga0070714_100058840 | |||
| 1746 | Ga0070714_100293538 | |||
| 1747 | Ga0070713_100010421 | |||
| 1748 | Ga0070713_100021777 | |||
| 1749 | Ga0070713_100024821 | |||
| 1750 | Ga0070713_100326724 | |||
| 1751 | Ga0070710_10004200 | |||
| 1752 | Ga0070710_10014806 | |||
| 1753 | Ga0070710_10062090 | |||
| 1754 | Ga0070701_10000297 | |||
| 1755 | Ga0070701_10001300 | |||
| 1756 | Ga0070701_10020956 | |||
| 1757 | Ga0070711_100076631 | |||
| 1758 | Ga0070711_100128769 | |||
| 1759 | Ga0070711_100304595 | |||
| 1760 | Ga0070705_100000989 | |||
| 1761 | Ga0070705_100070844 | |||
| 1762 | Ga0070700_100002276 | |||
| 1763 | Ga0070700_100011750 | |||
| 1764 | Ga0070700_100070030 | |||
| 1765 | Ga0070694_100000444 | |||
| 1766 | Ga0070694_100003236 | |||
| 1767 | Ga0070694_100268192 | |||
| 1768 | Ga0070694_100407529 | |||
| 1769 | Ga0070708_100031469 | |||
| 1770 | Ga0070663_100000436 | |||
| 1771 | Ga0070663_100028875 | |||
| 1772 | Ga0070663_100067556 | |||
| 1773 | Ga0070663_100215216 | |||
| 1774 | Ga0070678_100000382 | |||
| 1775 | Ga0070678_100003875 | |||
| 1776 | Ga0070678_100050943 | |||
| 1777 | Ga0070662_100003913 | |||
| 1778 | Ga0070662_100005358 | |||
| 1779 | Ga0070662_100006339 | |||
| 1780 | Ga0070662_100222459 | |||
| 1781 | Ga0070662_100286958 | |||
| 1782 | Ga0070681_10005795 | |||
| 1783 | Ga0070681_10044092 | |||
| 1784 | Ga0070681_10104858 | |||
| 1785 | Ga0070681_10118502 | |||
| 1786 | Ga0070681_10320906 | |||
| 1787 | Ga0070681_10349941 | |||
| 1788 | Ga0070681_11014279 | |||
| 1789 | Ga0068867_100004037 | |||
| 1790 | Ga0068867_100031738 | |||
| 1791 | Ga0068867_100049962 | |||
| 1792 | Ga0068867_100115286 | |||
| 1793 | Ga0070685_10011992 | |||
| 1794 | Ga0070685_10019254 | |||
| 1795 | Ga0070685_10053921 | |||
| 1796 | Ga0070685_10090723 | |||
| 1797 | Ga0070685_10099640 | |||
| 1798 | Ga0070706_100142059 | |||
| 1799 | Ga0070698_100206822 | |||
| 1800 | Ga0070699_100234039 | |||
| 1801 | Ga0070679_100001204 | |||
| 1802 | Ga0070679_100096291 | |||
| 1803 | Ga0070684_100004481 | |||
| 1804 | Ga0070684_100031381 | |||
| 1805 | Ga0070684_100063427 | |||
| 1806 | Ga0070697_100291756 | |||
| 1807 | Ga0068853_100001615 | |||
| 1808 | Ga0068853_100004372 | |||
| 1809 | Ga0070672_100003461 | |||
| 1810 | Ga0070672_100083198 | |||
| 1811 | Ga0070672_100337527 | |||
| 1812 | Ga0070686_100002518 | |||
| 1813 | Ga0070686_100009403 | |||
| 1814 | Ga0070686_100293445 | |||
| 1815 | Ga0070695_100002937 | |||
| 1816 | Ga0070695_100004993 | |||
| 1817 | Ga0070695_100417542 | |||
| 1818 | Ga0070696_100009850 | |||
| 1819 | Ga0070696_100309863 | |||
| 1820 | Ga0070696_100328530 | |||
| 1821 | Ga0070693_100000628 | |||
| 1822 | Ga0070665_100112704 | |||
| 1823 | Ga0070665_100153502 | |||
| 1824 | Ga0070665_100207924 | |||
| 1825 | Ga0070665_100298035 | |||
| 1826 | Ga0070665_100580933 | |||
| 1827 | Ga0070704_100055623 | |||
| 1828 | Ga0070704_100058274 | |||
| 1829 | Ga0070704_100223496 | |||
| 1830 | Ga0070704_100256179 | |||
| 1831 | Ga0070704_100347552 | |||
| 1832 | Ga0070704_100831568 | |||
| 1833 | Ga0068855_100023116 | |||
| 1834 | Ga0068855_100095264 | |||
| 1835 | Ga0068855_100380532 | |||
| 1836 | Ga0070664_100004566 | |||
| 1837 | Ga0070664_100063082 | |||
| 1838 | Ga0070664_100085062 | |||
| 1839 | Ga0070664_100382548 | |||
| 1840 | Ga0070664_100598894 | |||
| 1841 | Ga0070664_100676981 | |||
| 1842 | Ga0068857_100006169 | |||
| 1843 | Ga0068857_100016920 | |||
| 1844 | Ga0068857_100043816 | |||
| 1845 | Ga0068857_100210605 | |||
| 1846 | Ga0068854_100003262 | |||
| 1847 | Ga0068854_100015505 | |||
| 1848 | Ga0068854_100041635 | |||
| 1849 | Ga0068854_100064618 | |||
| 1850 | Ga0068854_100705520 | |||
| 1851 | Ga0068856_100004644 | |||
| 1852 | Ga0068856_100155865 | |||
| 1853 | Ga0068856_100177921 | |||
| 1854 | Ga0068856_100331265 | |||
| 1855 | Ga0068856_100409452 | |||
| 1856 | Ga0070702_100000041 | |||
| 1857 | Ga0070702_100002073 | |||
| 1858 | Ga0070702_100064308 | |||
| 1859 | Ga0070702_100080293 | |||
| 1860 | Ga0070702_100096687 | |||
| 1861 | Ga0070702_100427359 | |||
| 1862 | Ga0070702_100594342 | |||
| 1863 | Ga0068852_100038957 | |||
| 1864 | Ga0068852_100109132 | |||
| 1865 | Ga0068852_100214847 | |||
| 1866 | Ga0068852_100384529 | |||
| 1867 | Ga0068859_100014564 | |||
| 1868 | Ga0068859_100046546 | |||
| 1869 | Ga0068859_100058549 | |||
| 1870 | Ga0068859_100063160 | |||
| 1871 | Ga0068859_100538324 | |||
| 1872 | Ga0068859_100635760 | |||
| 1873 | Ga0068859_100825974 | |||
| 1874 | Ga0068864_100000172 | |||
| 1875 | Ga0068864_100005707 | |||
| 1876 | Ga0068864_100038825 | |||
| 1877 | Ga0068864_100146517 | |||
| 1878 | Ga0068864_100596999 | |||
| 1879 | Ga0068866_10000209 | |||
| 1880 | Ga0068866_10044664 | |||
| 1881 | Ga0068861_100001340 | |||
| 1882 | Ga0068851_10193464 | |||
| 1883 | Ga0068870_10000652 | |||
| 1884 | Ga0068870_10002924 | |||
| 1885 | Ga0068870_10503266 | |||
| 1886 | Ga0068863_100001541 | |||
| 1887 | Ga0068863_100030974 | |||
| 1888 | Ga0068863_100077872 | |||
| 1889 | Ga0068858_100014295 | |||
| 1890 | Ga0068858_100120659 | |||
| 1891 | Ga0068858_100309409 | |||
| 1892 | Ga0068858_100348362 | |||
| 1893 | Ga0068860_100007995 | |||
| 1894 | Ga0068860_100059288 | |||
| 1895 | Ga0068860_100577100 | |||
| 1896 | Ga0068860_100666320 | |||
| 1897 | Ga0068862_100003247 | |||
| 1898 | Ga0068862_100005613 | |||
| 1899 | Ga0068862_100010836 | |||
| 1900 | Ga0068862_100214860 | |||
| 1901 | Ga0081455_10000002 | |||
| 1902 | Ga0081455_10011036 | |||
| 1903 | Ga0081455_10011972 | |||
| 1904 | Ga0081455_10096499 | |||
| 1905 | Ga0081538_10002134 | |||
| 1906 | Ga0081540_1011265 | |||
| 1907 | Ga0081539_10001661 | |||
| 1908 | Ga0070717_10004108 | |||
| 1909 | Ga0070717_10009760 | |||
| 1910 | Ga0070717_10276089 | |||
| 1911 | Ga0070717_10414929 | |||
| 1912 | Ga0075365_10135490 | |||
| 1913 | Ga0075365_10292781 | |||
| 1914 | Ga0075368_10009240 | |||
| 1915 | Ga0075363_100013123 | |||
| 1916 | Ga0075363_100158075 | |||
| 1917 | Ga0075363_100304050 | |||
| 1918 | Ga0075364_10408328 | |||
| 1919 | Ga0075432_10049484 | |||
| 1920 | Ga0070715_10000720 | |||
| 1921 | Ga0070715_10117210 | |||
| 1922 | Ga0070716_100010508 | |||
| 1923 | Ga0070716_100328235 | |||
| 1924 | Ga0070712_100000460 | |||
| 1925 | Ga0070712_100070971 | |||
| 1926 | Ga0070712_100158873 | |||
| 1927 | Ga0070712_100177873 | |||
| 1928 | Ga0070712_100211580 | |||
| 1929 | Ga0075362_10021323 | |||
| 1930 | Ga0075367_10019074 | |||
| 1931 | Ga0075367_10267614 | |||
| 1932 | Ga0075369_10011405 | |||
| 1933 | Ga0075366_10010047 | |||
| 1934 | Ga0075366_10012444 | |||
| 1935 | Ga0097621_100000565 | |||
| 1936 | Ga0097621_100385545 | |||
| 1937 | Ga0075370_10077261 | |||
| 1938 | Ga0075370_10409502 | |||
| 1939 | Ga0068871_100000303 | |||
| 1940 | Ga0068871_100005491 | |||
| 1941 | Ga0068871_100074783 | |||
| 1942 | Ga0075428_100030184 | |||
| 1943 | Ga0075428_100325676 | |||
| 1944 | Ga0075428_100396918 | |||
| 1945 | Ga0075428_100592657 | |||
| 1946 | Ga0075430_100000492 | |||
| 1947 | Ga0075430_100013197 | |||
| 1948 | Ga0075430_100156711 | |||
| 1949 | Ga0075430_100204326 | |||
| 1950 | Ga0075431_100040575 | |||
| 1951 | Ga0075431_100116984 | |||
| 1952 | Ga0075431_100220767 | |||
| 1953 | Ga0075433_10053274 | |||
| 1954 | Ga0075433_10554797 | |||
| 1955 | Ga0075434_100000412 | |||
| 1956 | Ga0075434_100032747 | |||
| 1957 | Ga0075434_100033742 | |||
| 1958 | Ga0075434_100050156 | |||
| 1959 | Ga0075434_100098202 | |||
| 1960 | Ga0075434_100103939 | |||
| 1961 | Ga0075434_100156042 | |||
| 1962 | Ga0075434_100240904 | |||
| 1963 | Ga0075434_100253868 | |||
| 1964 | Ga0075434_100267351 | |||
| 1965 | Ga0075434_100716376 | |||
| 1966 | Ga0075429_100099929 | |||
| 1967 | Ga0068865_100000682 | |||
| 1968 | Ga0068865_100069839 | |||
| 1969 | Ga0068865_100182153 | |||
| 1970 | Ga0075436_100070943 | |||
| 1971 | Ga0097620_100014563 | |||
| 1972 | Ga0097620_100046544 | |||
| 1973 | Ga0097620_100058549 | |||
| 1974 | Ga0097620_100063160 | |||
| 1975 | Ga0097620_100538302 | |||
| 1976 | Ga0097620_100635779 | |||
| 1977 | Ga0097620_100825969 | |||
| 1978 | Ga0075435_100040717 | |||
| 1979 | Ga0075435_100102310 | |||
| 1980 | Ga0075435_100280083 | |||
| 1981 | Ga0075435_100736870 | |||
| 1982 | Ga0099794_10038823 | |||
| 1983 | Ga0105251_10137861 | |||
| 1984 | Ga0105240_10056226 | |||
| 1985 | Ga0105240_10069601 | |||
| 1986 | Ga0105240_10239587 | |||
| 1987 | Ga0105240_10249173 | |||
| 1988 | Ga0105240_10798219 | |||
| 1989 | Ga0111539_10002657 | |||
| 1990 | Ga0111539_10002897 | |||
| 1991 | Ga0111539_10108622 | |||
| 1992 | Ga0111539_10132079 | |||
| 1993 | Ga0111539_10183045 | |||
| 1994 | Ga0111539_10201052 | |||
| 1995 | Ga0111539_10507741 | |||
| 1996 | Ga0111539_10683689 | |||
| 1997 | Ga0105245_10000882 | |||
| 1998 | Ga0105245_10037434 | |||
| 1999 | Ga0105245_10106664 | |||
| 2000 | Ga0105245_10271015 | |||
| 2001 | Ga0105247_10001969 | |||
| 2002 | Ga0105247_10004828 | |||
| 2003 | Ga0105247_10289542 | |||
| 2004 | Ga0114129_10008610 | |||
| 2005 | Ga0114129_10021090 | |||
| 2006 | Ga0114129_10061242 | |||
| 2007 | Ga0114129_10095382 | |||
| 2008 | Ga0114129_10104552 | |||
| 2009 | Ga0114129_10157533 | |||
| 2010 | Ga0114129_10586182 | |||
| 2011 | Ga0114129_10605105 | |||
| 2012 | Ga0114129_11902180 | |||
| 2013 | Ga0105243_10001029 | |||
| 2014 | Ga0105243_10009289 | |||
| 2015 | Ga0105243_10023731 | |||
| 2016 | Ga0105243_10230935 | |||
| 2017 | Ga0105243_10262535 | |||
| 2018 | Ga0105243_10428274 | |||
| 2019 | Ga0105241_10006660 | |||
| 2020 | Ga0105241_10181648 | |||
| 2021 | Ga0105241_10350024 | |||
| 2022 | Ga0105241_10427289 | |||
| 2023 | Ga0105241_10725696 | |||
| 2024 | Ga0105242_10002177 | |||
| 2025 | Ga0105242_10027348 | |||
| 2026 | Ga0105242_10294895 | |||
| 2027 | Ga0105248_10002945 | |||
| 2028 | Ga0105248_10012305 | |||
| 2029 | Ga0105248_10014996 | |||
| 2030 | Ga0105248_10074990 | |||
| 2031 | Ga0105248_10074998 | |||
| 2032 | Ga0105248_10097925 | |||
| 2033 | Ga0105237_10003304 | |||
| 2034 | Ga0105237_10063614 | |||
| 2035 | Ga0105237_10112977 | |||
| 2036 | Ga0105237_10208332 | |||
| 2037 | Ga0105237_10341732 | |||
| 2038 | Ga0105238_10066156 | |||
| 2039 | Ga0105238_10171734 | |||
| 2040 | Ga0105238_10282647 | |||
| 2041 | Ga0105238_10644735 | |||
| 2042 | Ga0105249_10006632 | |||
| 2043 | Ga0105249_10028570 | |||
| 2044 | Ga0105249_10032153 | |||
| 2045 | Ga0105249_10175965 | |||
| 2046 | Ga0099796_10005397 | |||
| 2047 | Ga0105239_10021993 | |||
| 2048 | Ga0105239_10032680 | |||
| 2049 | Ga0105239_10094993 | |||
| 2050 | Ga0105239_10132130 | |||
| 2051 | Ga0105239_10207875 | |||
| 2052 | Ga0105239_10329989 | |||
| 2053 | Ga0105246_10000463 | |||
| 2054 | Ga0105246_10033093 | |||
| 2055 | Ga0105246_10048040 | |||
| 2056 | Ga0105246_10399843 | |||
| 2057 | Ga0105246_10541243 | |||
| 2058 | Ga0157313_1000926 | |||
| 2059 | Ga0157373_10015583 | |||
| 2060 | Ga0157371_10115937 | |||
| 2061 | Ga0157370_10173108 | |||
| 2062 | Ga0157370_10256887 | |||
| 2063 | Ga0157369_10427420 | |||
| 2064 | Ga0157374_10000614 | |||
| 2065 | Ga0157374_10065462 | |||
| 2066 | Ga0157374_10495888 | |||
| 2067 | Ga0157374_11165826 | |||
| 2068 | Ga0157378_10000701 | |||
| 2069 | Ga0157378_10027642 | |||
| 2070 | Ga0157378_10154419 | |||
| 2071 | Ga0157378_10415059 | |||
| 2072 | Ga0157378_10472828 | |||
| 2073 | Ga0163162_10008098 | |||
| 2074 | Ga0163162_10108282 | |||
| 2075 | Ga0163162_10186391 | |||
| 2076 | Ga0163162_10458816 | |||
| 2077 | Ga0163162_10722294 | |||
| 2078 | Ga0157372_10016291 | |||
| 2079 | Ga0157372_10098111 | |||
| 2080 | Ga0157372_10140711 | |||
| 2081 | Ga0157372_10594965 | |||
| 2082 | Ga0157375_10005857 | |||
| 2083 | Ga0157375_10022311 | |||
| 2084 | Ga0163163_10004757 | |||
| 2085 | Ga0163163_10017614 | |||
| 2086 | Ga0163163_10053547 | |||
| 2087 | Ga0163163_10063537 | |||
| 2088 | Ga0163163_10135712 | |||
| 2089 | Ga0163163_10183790 | |||
| 2090 | Ga0163163_11085892 | |||
| 2091 | Ga0157380_10001646 | |||
| 2092 | Ga0157380_10069598 | |||
| 2093 | Ga0157380_10165606 | |||
| 2094 | Ga0182008_10166078 | |||
| 2095 | Ga0157377_10000514 | |||
| 2096 | Ga0157379_10000792 | |||
| 2097 | Ga0157379_10010974 | |||
| 2098 | Ga0157379_10057501 | |||
| 2099 | Ga0157379_10072154 | |||
| 2100 | Ga0157379_10096732 | |||
| 2101 | Ga0157379_10293592 | |||
| 2102 | Ga0157379_10983242 | |||
| 2103 | Ga0157376_10000352 | |||
| 2104 | Ga0157376_10063069 | |||
| 2105 | Ga0157376_10211676 | |||
| 2106 | Ga0157376_10511043 | |||
| 2107 | Ga0157376_10827550 | |||
| 2108 | Ga0182005_1087240 | |||
| 2109 | Ga0163161_10000956 | |||
| 2110 | Ga0163161_10079514 | |||
| 2111 | Ga0163161_10089657 | |||
| 2112 | Ga0163161_10143176 | |||
| 2113 | Ga0206353_10376412 | |||
| 2114 | Ga0207666_1000043 | |||
| 2115 | Ga0207673_1000044 | |||
| 2116 | Ga0209758_1000182 | |||
| 2117 | Ga0209758_1000293 | |||
| 2118 | Ga0209758_1019701 | |||
| 2119 | Ga0209758_1056344 | |||
| 2120 | Ga0207426_1007081 | |||
| 2121 | Ga0207426_1031401 | |||
| 2122 | Ga0209257_1000390 | |||
| 2123 | Ga0207697_10001136 | |||
| 2124 | Ga0207697_10012548 | |||
| 2125 | Ga0207656_10038144 | |||
| 2126 | Ga0207656_10077332 | |||
| 2127 | Ga0207655_1061275 | |||
| 2128 | Ga0207682_10000021 | |||
| 2129 | Ga0207682_10000660 | |||
| 2130 | Ga0207682_10203212 | |||
| 2131 | Ga0207692_10002654 | |||
| 2132 | Ga0207692_10008133 | |||
| 2133 | Ga0207642_10000623 | |||
| 2134 | Ga0207642_10046441 | |||
| 2135 | Ga0207642_10100529 | |||
| 2136 | Ga0207642_10141871 | |||
| 2137 | Ga0207710_10001214 | |||
| 2138 | Ga0207710_10020661 | |||
| 2139 | Ga0207710_10025361 | |||
| 2140 | Ga0207688_10000949 | |||
| 2141 | Ga0207688_10002814 | |||
| 2142 | Ga0207688_10071997 | |||
| 2143 | Ga0207688_10131402 | |||
| 2144 | Ga0207688_10179547 | |||
| 2145 | Ga0207680_10003232 | |||
| 2146 | Ga0207680_10077406 | |||
| 2147 | Ga0207680_10110291 | |||
| 2148 | Ga0207680_10111466 | |||
| 2149 | Ga0207680_10131464 | |||
| 2150 | Ga0207647_10007234 | |||
| 2151 | Ga0207647_10011184 | |||
| 2152 | Ga0207647_10046289 | |||
| 2153 | Ga0207647_10122033 | |||
| 2154 | Ga0207685_10011541 | |||
| 2155 | Ga0207685_10045199 | |||
| 2156 | Ga0207685_10055572 | |||
| 2157 | Ga0207699_10020713 | |||
| 2158 | Ga0207699_10045331 | |||
| 2159 | Ga0207699_10152742 | |||
| 2160 | Ga0207645_10002488 | |||
| 2161 | Ga0207645_10002945 | |||
| 2162 | Ga0207645_10023617 | |||
| 2163 | Ga0207645_10045340 | |||
| 2164 | Ga0207645_10063944 | |||
| 2165 | Ga0207643_10000108 | |||
| 2166 | Ga0207643_10002845 | |||
| 2167 | Ga0207643_10014351 | |||
| 2168 | Ga0207684_10002963 | |||
| 2169 | Ga0207654_10002719 | |||
| 2170 | Ga0207654_10011794 | |||
| 2171 | Ga0207654_10235793 | |||
| 2172 | Ga0207707_10000691 | |||
| 2173 | Ga0207707_10040215 | |||
| 2174 | Ga0207707_10128051 | |||
| 2175 | Ga0207695_10039943 | |||
| 2176 | Ga0207671_10003167 | |||
| 2177 | Ga0207671_10086869 | |||
| 2178 | Ga0207671_10100478 | |||
| 2179 | Ga0207671_10295710 | |||
| 2180 | Ga0207693_10000825 | |||
| 2181 | Ga0207693_10007085 | |||
| 2182 | Ga0207693_10009090 | |||
| 2183 | Ga0207693_10021699 | |||
| 2184 | Ga0207693_10115971 | |||
| 2185 | Ga0207693_10147296 | |||
| 2186 | Ga0207693_10203547 | |||
| 2187 | Ga0207663_10022199 | |||
| 2188 | Ga0207660_10000014 | |||
| 2189 | Ga0207660_10293877 | |||
| 2190 | Ga0207662_10006062 | |||
| 2191 | Ga0207662_10008927 | |||
| 2192 | Ga0207662_10019625 | |||
| 2193 | Ga0207662_10096544 | |||
| 2194 | Ga0207662_10202160 | |||
| 2195 | Ga0207662_10231465 | |||
| 2196 | Ga0207657_10037081 | |||
| 2197 | Ga0207657_10046349 | |||
| 2198 | Ga0207657_10046352 | |||
| 2199 | Ga0207657_10077327 | |||
| 2200 | Ga0207657_10228097 | |||
| 2201 | Ga0207649_10000086 | |||
| 2202 | Ga0207649_10043035 | |||
| 2203 | Ga0207649_10076337 | |||
| 2204 | Ga0207649_10086928 | |||
| 2205 | Ga0207652_10000255 | |||
| 2206 | Ga0207652_10044044 | |||
| 2207 | Ga0207652_10161000 | |||
| 2208 | Ga0207652_10398264 | |||
| 2209 | Ga0207681_10000024 | |||
| 2210 | Ga0207694_10361708 | |||
| 2211 | Ga0207650_10002572 | |||
| 2212 | Ga0207650_10012030 | |||
| 2213 | Ga0207650_10119105 | |||
| 2214 | Ga0207650_10140734 | |||
| 2215 | Ga0207650_10174839 | |||
| 2216 | Ga0207650_10414781 | |||
| 2217 | Ga0207659_10000034 | |||
| 2218 | Ga0207659_10018147 | |||
| 2219 | Ga0207659_10047389 | |||
| 2220 | Ga0207687_10000110 | |||
| 2221 | Ga0207687_10008628 | |||
| 2222 | Ga0207687_10119758 | |||
| 2223 | Ga0207700_10035453 | |||
| 2224 | Ga0207700_10068719 | |||
| 2225 | Ga0207700_10090236 | |||
| 2226 | Ga0207700_10133338 | |||
| 2227 | Ga0207700_10151584 | |||
| 2228 | Ga0207700_10303672 | |||
| 2229 | Ga0207700_10324076 | |||
| 2230 | Ga0207664_10007232 | |||
| 2231 | Ga0207664_10023737 | |||
| 2232 | Ga0207664_10027533 | |||
| 2233 | Ga0207644_10000642 | |||
| 2234 | Ga0207644_10003006 | |||
| 2235 | Ga0207644_10047247 | |||
| 2236 | Ga0207644_10112084 | |||
| 2237 | Ga0207690_10000270 | |||
| 2238 | Ga0207690_10022682 | |||
| 2239 | Ga0207690_10051466 | |||
| 2240 | Ga0207690_10168676 | |||
| 2241 | Ga0207690_10189827 | |||
| 2242 | Ga0207706_10001336 | |||
| 2243 | Ga0207706_10005854 | |||
| 2244 | Ga0207706_10007295 | |||
| 2245 | Ga0207706_10007337 | |||
| 2246 | Ga0207706_10108352 | |||
| 2247 | Ga0207706_10109295 | |||
| 2248 | Ga0207706_10341353 | |||
| 2249 | Ga0207706_10403529 | |||
| 2250 | Ga0207706_10479894 | |||
| 2251 | Ga0207686_10000214 | |||
| 2252 | Ga0207686_10044726 | |||
| 2253 | Ga0207686_10275477 | |||
| 2254 | Ga0207709_10000344 | |||
| 2255 | Ga0207709_10003540 | |||
| 2256 | Ga0207709_10165987 | |||
| 2257 | Ga0207670_10000461 | |||
| 2258 | Ga0207670_10002631 | |||
| 2259 | Ga0207670_10111337 | |||
| 2260 | Ga0207670_10151846 | |||
| 2261 | Ga0207670_10243822 | |||
| 2262 | Ga0207669_10000295 | |||
| 2263 | Ga0207669_10001111 | |||
| 2264 | Ga0207669_10029074 | |||
| 2265 | Ga0207704_10000343 | |||
| 2266 | Ga0207704_10052137 | |||
| 2267 | Ga0207704_10060299 | |||
| 2268 | Ga0207665_10001068 | |||
| 2269 | Ga0207665_10003817 | |||
| 2270 | Ga0207665_10109985 | |||
| 2271 | Ga0207665_10129375 | |||
| 2272 | Ga0207691_10000635 | |||
| 2273 | Ga0207691_10003768 | |||
| 2274 | Ga0207691_10012880 | |||
| 2275 | Ga0207711_10007313 | |||
| 2276 | Ga0207711_10093487 | |||
| 2277 | Ga0207711_10186767 | |||
| 2278 | Ga0207711_10223596 | |||
| 2279 | Ga0207689_10002655 | |||
| 2280 | Ga0207689_10003641 | |||
| 2281 | Ga0207689_10024648 | |||
| 2282 | Ga0207689_10043531 | |||
| 2283 | Ga0207689_10213810 | |||
| 2284 | Ga0207661_10000036 | |||
| 2285 | Ga0207661_10135662 | |||
| 2286 | Ga0207661_10672300 | |||
| 2287 | Ga0207679_10000025 | |||
| 2288 | Ga0207679_10014282 | |||
| 2289 | Ga0207679_10082518 | |||
| 2290 | Ga0207679_10374527 | |||
| 2291 | Ga0207679_10556082 | |||
| 2292 | Ga0207679_10823092 | |||
| 2293 | Ga0207667_10007960 | |||
| 2294 | Ga0207667_10463367 | |||
| 2295 | Ga0207651_10000028 | |||
| 2296 | Ga0207651_10013440 | |||
| 2297 | Ga0207651_10053292 | |||
| 2298 | Ga0207651_10153312 | |||
| 2299 | Ga0207651_10224029 | |||
| 2300 | Ga0207651_10441443 | |||
| 2301 | Ga0207712_10000558 | |||
| 2302 | Ga0207712_10002399 | |||
| 2303 | Ga0207712_10089239 | |||
| 2304 | Ga0207712_10372855 | |||
| 2305 | Ga0207668_10000538 | |||
| 2306 | Ga0207668_10013637 | |||
| 2307 | Ga0207668_10031104 | |||
| 2308 | Ga0207640_10006541 | |||
| 2309 | Ga0207640_10041977 | |||
| 2310 | Ga0207640_10043342 | |||
| 2311 | Ga0207640_10170042 | |||
| 2312 | Ga0207640_10691598 | |||
| 2313 | Ga0207640_10804095 | |||
| 2314 | Ga0207658_10000795 | |||
| 2315 | Ga0207658_10046077 | |||
| 2316 | Ga0207658_10197400 | |||
| 2317 | Ga0207658_10370139 | |||
| 2318 | Ga0207677_10001822 | |||
| 2319 | Ga0207677_10015703 | |||
| 2320 | Ga0207677_10043555 | |||
| 2321 | Ga0207677_10099423 | |||
| 2322 | Ga0207703_10008768 | |||
| 2323 | Ga0207703_10012768 | |||
| 2324 | Ga0207703_10041098 | |||
| 2325 | Ga0207703_10401509 | |||
| 2326 | Ga0207703_10556570 | |||
| 2327 | Ga0207703_11072959 | |||
| 2328 | Ga0207639_10000925 | |||
| 2329 | Ga0207639_10018222 | |||
| 2330 | Ga0207639_10045906 | |||
| 2331 | Ga0207639_10238405 | |||
| 2332 | Ga0207639_10276924 | |||
| 2333 | Ga0207639_10316368 | |||
| 2334 | Ga0207678_10003256 | |||
| 2335 | Ga0207678_10004902 | |||
| 2336 | Ga0207678_10006940 | |||
| 2337 | Ga0207678_10010341 | |||
| 2338 | Ga0207678_10016580 | |||
| 2339 | Ga0207678_10248247 | |||
| 2340 | Ga0207708_10004521 | |||
| 2341 | Ga0207708_10019050 | |||
| 2342 | Ga0207708_10037218 | |||
| 2343 | Ga0207702_10004638 | |||
| 2344 | Ga0207702_10065787 | |||
| 2345 | Ga0207702_10069314 | |||
| 2346 | Ga0207702_10073820 | |||
| 2347 | Ga0207641_10001294 | |||
| 2348 | Ga0207648_10003105 | |||
| 2349 | Ga0207648_10004307 | |||
| 2350 | Ga0207648_10011750 | |||
| 2351 | Ga0207648_10076986 | |||
| 2352 | Ga0207648_10553353 | |||
| 2353 | Ga0207676_10000640 | |||
| 2354 | Ga0207676_10024382 | |||
| 2355 | Ga0207676_10042058 | |||
| 2356 | Ga0207676_10313281 | |||
| 2357 | Ga0207674_10005795 | |||
| 2358 | Ga0207674_10074975 | |||
| 2359 | Ga0207674_10104935 | |||
| 2360 | Ga0207674_10253632 | |||
| 2361 | Ga0207674_10489740 | |||
| 2362 | Ga0207675_100003849 | |||
| 2363 | Ga0207675_100004255 | |||
| 2364 | Ga0207683_10000001 | |||
| 2365 | Ga0207683_10004806 | |||
| 2366 | Ga0207683_10007077 | |||
| 2367 | Ga0207683_10023723 | |||
| 2368 | Ga0207683_10044817 | |||
| 2369 | Ga0207698_10014590 | |||
| 2370 | Ga0207698_10026697 | |||
| 2371 | Ga0207698_10127971 | |||
| 2372 | Ga0207698_10291971 | |||
| 2373 | Ga0207698_10458495 | |||
| 2374 | Ga0207698_10996118 | |||
| 2375 | Ga0209995_1017210 | |||
| 2376 | Ga0209179_1029153 | |||
| 2377 | Ga0209968_1030175 | |||
| 2378 | Ga0209982_1002600 | |||
| 2379 | Ga0209970_1012282 | |||
| 2380 | Ga0210002_1001810 | |||
| 2381 | Ga0209983_1035560 | |||
| 2382 | Ga0209971_1037950 | |||
| 2383 | Ga0209966_1001479 | |||
| 2384 | Ga0209966_1001617 | |||
| 2385 | Ga0209998_10001115 | |||
| 2386 | Ga0209998_10001190 | |||
| 2387 | Ga0209813_10001830 | |||
| 2388 | Ga0209974_10000991 | |||
| 2389 | Ga0209974_10123482 | |||
| 2390 | Ga0207428_10000823 | |||
| 2391 | Ga0207428_10001512 | |||
| 2392 | Ga0207428_10105356 | |||
| 2393 | Ga0265357_1001253 | |||
| 2394 | Ga0268266_10026518 | |||
| 2395 | Ga0268266_10135900 | |||
| 2396 | Ga0268266_10153292 | |||
| 2397 | Ga0268266_10167713 | |||
| 2398 | Ga0268266_10311633 | |||
| 2399 | Ga0268265_10001288 | |||
| 2400 | Ga0268265_10086490 | |||
| 2401 | Ga0268265_10555025 | |||
| 2402 | Ga0268264_10000456 | |||
| 2403 | Ga0268264_10005325 | |||
| 2404 | Ga0268264_10074026 | |||
| 2405 | Ga0268264_10128105 | |||
| 2406 | Ga0268264_10354635 | |||
| 2407 | Ga0268264_10559966 | |||
| 2408 | Ga0265318_10004032 | |||
| 2409 | Ga0265330_10007771 | |||
| 2410 | Ga0265330_10053496 | |||
| 2411 | Ga0265332_10012389 | |||
| 2412 | Ga0265320_10018493 | |||
| 2413 | Ga0265325_10004992 | |||
| 2414 | Ga0265329_10012587 | |||
| 2415 | Ga0265340_10004865 | |||
| 2416 | Ga0265340_10020868 | |||
| 2417 | Ga0265339_10004645 | |||
| 2418 | Ga0265339_10013807 | |||
| 2419 | Ga0265331_10012924 | |||
| 2420 | Ga0265331_10051231 | |||
| 2421 | Ga0265316_10025046 | |||
| 2422 | Ga0265316_10070106 | |||
| 2423 | Ga0265316_10129850 | |||
| 2424 | Ga0307513_10115927 | |||
| 2425 | Ga0265313_10022841 | |||
| 2426 | Ga0265314_10008306 | |||
| 2427 | Ga0265342_10000092 | |||
| 2428 | Ga0265342_10014308 | |||
| 2429 | Ga0307410_10730951 | |||
| 2430 | Ga0316583_10000594 | |||
| 2431 | Ga0307510_10192420 | |||
| 2432 | Ga0373930_0000196 | |||
| 2433 | Ga0373948_0000861 | |||
| 2434 | Ga0373948_0001041 | |||
| 2435 | Ga0373948_0001761 | |||
| 2436 | Ga0373950_0000297 | |||
| 2437 | Ga0373950_0005679 | |||
| 2438 | Ga0373958_0002061 | |||
| 2439 | Ga0373958_0006709 | |||
| 2440 | Ga0373958_0008200 | |||
| 2441 | Ga0373959_0001177 | |||
| 2442 | Ga0373959_0002292 | |||
| 2443 | Ga0373938_0000046 | |||
| 2444 | Ga0373938_0002402 | |||
| 2445 | Ga0373938_0020342 | |||
| 2446 | Ga0373926_0021975 | |||
| 2447 | Ga0373926_0046822 | |||
| 2448 | Ga0373928_0001726 | |||
| 2449 | Ga0373928_0046076 | |||
| 2450 | Ga0373929_0000284 | |||
| 2451 | Ga0373929_0002711 | |||
| 2452 | Ga0373934_0022290 | |||
| 2453 | Ga0373934_0076615 | |||
| 2454 | Ga0373940_0001045 | |||
| 2455 | Ga0373940_0001289 | |||
| 2456 | Ga0373944_0003559 | |||
| 2457 | Ga0373944_0005088 | |||
| 2458 | Ga0373944_0040433 | |||
| 2459 | Ga0373949_0000546 | |||
| 2460 | Ga0373949_0001599 | |||
| 2461 | Ga0373949_0024744 | |||
| 2462 | Ga0373951_0000608 | |||
| 2463 | Ga0373951_0001694 | |||
| 2464 | Ga0373951_0020605 | |||
| 2465 | Ga0373952_0000574 | |||
| 2466 | Ga0373952_0004003 | |||
| 2467 | Ga0373923_0016264 | |||
| 2468 | Ga0373923_0066038 | |||
| 2469 | Ga0373923_0094372 | |||
| 2470 | Ga0373932_0000577 | |||
| 2471 | Ga0373932_0001670 | |||
| 2472 | Ga0373932_0011388 | |||
| 2473 | Ga0373936_0005473 | |||
| 2474 | Ga0373936_0122148 | |||
| 2475 | Ga0373939_0000691 | |||
| 2476 | Ga0373939_0001452 | |||
| 2477 | Ga0373939_0002354 | |||
| 2478 | Ga0373941_0003673 | |||
| 2479 | Ga0373941_0007450 | |||
| 2480 | Ga0373945_0021266 | |||
| 2481 | Ga0373945_0021839 | |||
| 2482 | Ga0373945_0036414 | |||
| 2483 | Ga0373945_0095753 | |||
| 2484 | Ga0373945_0134297 | |||
| 2485 | Ga0373953_0007986 | |||
| 2486 | Ga0373953_0014564 | |||
| 2487 | Ga0373953_0105645 | |||
| 2488 | Ga0373954_0004076 | |||
| 2489 | Ga0373954_0128019 | |||
| 2490 | Ga0373956_0001739 | |||
| 2491 | Ga0373956_0001917 | |||
| 2492 | Ga0373956_0024511 | |||
| 2493 | Ga0373957_0006573 | |||
| 2494 | Ga0373957_0006843 | |||
| 2495 | Ga0373960_0000587 | |||
| 2496 | Ga0373960_0011868 | |||
| 2497 | Ga0373960_0058946 | |||
| 2498 | Ga0373943_0002330 | |||
| 2499 | Ga0373943_0011524 | |||
| 2500 | Ga0373943_0084121 | |||
| 2501 | Ga0373946_0008539 | |||
| 2502 | Ga0373946_0011321 | |||
| 2503 | Ga0373946_0036676 | |||
| 2504 | Ga0373955_0001883 | |||
| 2505 | Ga0373955_0021582 | |||
| 2506 | Ga0373955_0150546 | |||
| 2507 | Ga0373955_0416613 | |||
| 2508 | Ga0373955_0440854 | |||
| 2509 | Ga0373942_0001465 | |||
| 2510 | Ga0373942_0004097 | |||
| 2511 | Ga0373942_0010473 | |||
| 2512 | Ga0373961_0000385 | |||
| 2513 | Ga0373961_0000869 | |||
| 2514 | Ga0373961_0051776 | |||
| 2515 | Ga0373961_0054494 | |||
| 2516 | Ga0373962_0003613 | |||
| 2517 | Ga0373962_0006217 | |||
| 2518 | Ga0373962_0062480 | |||
| 2519 | Ga0373962_0073279 | |||
| 2520 | Ga0373924_0223256 | |||
| 2521 | Ga0373931_0001882 | |||
| 2522 | Ga0373931_0003354 | |||
| 2523 | Ga0373931_0012617 | |||
| 2524 | Ga0373935_0002676 | |||
| 2525 | Ga0373935_0257719 | |||
| 2526 | Ga0373927_0010750 | |||
| 2527 | Ga0373927_0122790 | |||
| 2528 | Ga0373927_0179285 | |||
| 2529 | Ga0373933_0000125 | |||
| 2530 | Ga0373933_0002112 | |||
| 2531 | Ga0373933_0010711 | |||
| 2532 | Ga0373933_0017319 | |||
| 2533 | Ga0373947_0001553 | |||
| 2534 | Ga0373947_0080026 | |||
| 2535 | Ga0373947_0170067 | |||
| 2536 | Ga0373947_0436927 | |||
| 2537 | Ga0373937_0002048 | |||
| 2538 | Ga0373937_0188820 | |||
| 2539 | Ga0373937_0223998 | |||
| 2540 | Ga0373937_0511460 | |||
| 2541 | Ga0373925_0008896 | |||
| 2542 | Ga0373925_0033160 | |||
| 2543 | Ga0373925_0125619 | |||
| 2544 | Ga0373925_0256122 | |||
| 2545 | Ga0373925_0640801 | |||
| 2546 | Ga0395899_0097748 | |||
| 2547 | Ga0395900_0003627 | |||
| 2548 | Ga0395898_0174352 | |||
| 2549 | Ga0395898_0931075 | |||
| 2550 | Ga0395905_0014986 | |||
| 2551 | Ga0436364_0794080 | |||
| 2552 | Ga0395901_0040521 | |||
| 2553 | Ga0395901_0048746 | |||
| 2554 | Ga0395901_0152787 | |||
| 2555 | Ga0242420_015440 | |||
| 2556 | Ga0436365_0657686 | |||
| 2557 | Ga0436365_1898637 | |||
| 2558 | Ga0436361_0256491 | |||
| 2559 | Ga0436361_0950726 | |||
| 2560 | Ga0436362_0287115 | |||
| 2561 | Ga0436362_1090515 | |||
| 2562 | Ga0439453_0001852 | |||
| 2563 | Ga0439435_0015895 | |||
| 2564 | Ga0439464_0021214 | |||
| 2565 | Ga0451577_0297987 | |||
| 2566 | Ga0466972_0052403 | |||
| 2567 | Ga0466965_0052201 | |||
| 2568 | Ga0466965_0148285 | |||
| 2569 | Ga0466965_0205969 | |||
| 2570 | Ga0466963_0009295 | |||
| 2571 | Ga0466968_0059735 | |||
| 2572 | Ga0466968_0078596 | |||
| 2573 | Ga0466960_0126038 | |||
| 2574 | Ga0466959_0433853 | |||
| 2575 | Ga0451576_0021183 | |||
| 2576 | Ga0466967_0076147 | |||
| 2577 | Ga0495617_076952 | |||
| 2578 | Ga0495592_0004699 | |||
| 2579 | Ga0495592_0014796 | |||
| 2580 | Ga0495592_0041714 | |||
| 2581 | Ga0495592_0156492 | |||
| 2582 | Ga0495592_0192099 | |||
| 2583 | Ga0495603_0025855 | |||
| 2584 | Ga0495603_0082710 | |||
| 2585 | Ga0495629_0003044 | |||
| 2586 | Ga0495629_0014934 | |||
| 2587 | Ga0495629_0142612 | |||
| 2588 | Ga0495629_0157088 | |||
| 2589 | Ga0495629_0188613 | |||
| 2590 | Ga0495638_0046393 | |||
| 2591 | Ga0495641_0016811 | |||
| 2592 | Ga0495641_0036035 | |||
| 2593 | Ga0495641_0084391 | |||
| 2594 | Ga0495651_0002035 | |||
| 2595 | Ga0495651_0010719 | |||
| 2596 | Ga0495651_0036349 | |||
| 2597 | Ga0495651_0098800 | |||
| 2598 | Ga0495651_0164118 | |||
| 2599 | Ga0495653_0035187 | |||
| 2600 | Ga0495653_0065475 | |||
| 2601 | Ga0495653_0089810 | |||
| 2602 | Ga0495653_0223012 | |||
| 2603 | Ga0495653_0359077 | |||
| 2604 | Ga0495580_0152763 | |||
| 2605 | Ga0495580_0199102 | |||
| 2606 | Ga0495582_0003239 | |||
| 2607 | Ga0495582_0028856 | |||
| 2608 | Ga0495582_0084807 | |||
| 2609 | Ga0495582_0104126 | |||
| 2610 | Ga0495605_0035609 | |||
| 2611 | Ga0495639_0121074 | |||
| 2612 | Ga0495662_0048090 | |||
| 2613 | Ga0495662_0107218 | |||
| 2614 | Ga0495664_0016212 | |||
| 2615 | Ga0495664_0030072 | |||
| 2616 | Ga0495664_0101108 | |||
| 2617 | Ga0495664_0110833 | |||
| 2618 | Ga0495584_0007023 | |||
| 2619 | Ga0495584_0018261 | |||
| 2620 | Ga0495584_0111683 | |||
| 2621 | Ga0495584_0177029 | |||
| 2622 | Ga0495585_0000856 | |||
| 2623 | Ga0495585_0007417 | |||
| 2624 | Ga0495585_0028456 | |||
| 2625 | Ga0495585_0111422 | |||
| 2626 | Ga0495594_0008038 | |||
| 2627 | Ga0495594_0011796 | |||
| 2628 | Ga0495594_0096793 | |||
| 2629 | Ga0495594_0110433 | |||
| 2630 | Ga0495607_0027202 | |||
| 2631 | Ga0495607_0195196 | |||
| 2632 | Ga0495606_0009508 | |||
| 2633 | Ga0495606_0134135 | |||
| 2634 | Ga0495608_0000915 | |||
| 2635 | Ga0495608_0050572 | |||
| 2636 | Ga0495608_0058533 | |||
| 2637 | Ga0495608_0066508 | |||
| 2638 | Ga0495608_0076902 | |||
| 2639 | Ga0495610_0053992 | |||
| 2640 | Ga0495618_0052960 | |||
| 2641 | Ga0495628_0008958 | |||
| 2642 | Ga0495628_0032827 | |||
| 2643 | Ga0495628_0082672 | |||
| 2644 | Ga0495628_0112489 | |||
| 2645 | Ga0495628_0184642 | |||
| 2646 | Ga0495630_0126393 | |||
| 2647 | Ga0495630_0130219 | |||
| 2648 | Ga0495630_0238275 | |||
| 2649 | Ga0495630_0541043 | |||
| 2650 | Ga0495630_0659536 | |||
| 2651 | Ga0495630_1022742 | |||
| 2652 | Ga0495631_0094340 | |||
| 2653 | Ga0495637_0044734 | |||
| 2654 | Ga0495637_0113199 | |||
| 2655 | Ga0495644_0011268 | |||
| 2656 | Ga0495644_0033593 | |||
| 2657 | Ga0495648_0002380 | |||
| 2658 | Ga0495663_0021146 | |||
| 2659 | Ga0495666_0014396 | |||
| 2660 | Ga0495666_0018752 | |||
| 2661 | Ga0495666_0136415 | |||
| 2662 | Ga0495642_0167641 | |||
| 2663 | Ga0495652_0005789 | |||
| 2664 | Ga0495652_0020937 | |||
| 2665 | Ga0495652_0063623 | |||
| 2666 | Ga0495652_0076458 | |||
| 2667 | Ga0495652_0261233 | |||
| 2668 | Ga0495652_0352001 | |||
| 2669 | Ga0495665_0061258 | |||
| 2670 | Ga0495665_0082559 | |||
| 2671 | Ga0495665_0097718 | |||
| 2672 | Ga0495640_0071044 | |||
| 2673 | Ga0495640_0101573 | |||
| 2674 | Ga0495640_0209888 | |||
| 2675 | Ga0495640_0348910 | |||
| 2676 | Ga0495640_0486745 | |||
| 2677 | Ga0495586_0075875 | |||
| 2678 | Ga0495587_0001734 | |||
| 2679 | Ga0495587_0018262 | |||
| 2680 | Ga0495587_0076892 | |||
| 2681 | Ga0495587_0116350 | |||
| 2682 | Ga0495598_0000233 | |||
| 2683 | Ga0495598_0020531 | |||
| 2684 | Ga0495609_0039144 | |||
| 2685 | Ga0495621_0008367 | |||
| 2686 | Ga0495621_0050241 | |||
| 2687 | Ga0495621_0091691 | |||
| 2688 | Ga0495645_0011672 | |||
| 2689 | Ga0495645_0086453 | |||
| 2690 | Ga0495622_0024440 | |||
| 2691 | Ga0495622_0141676 | |||
| 2692 | Ga0495633_0017034 | |||
| 2693 | Ga0495667_0000259 | |||
| 2694 | Ga0495667_0018366 | |||
| 2695 | Ga0495667_0070601 | |||
| 2696 | Ga0495656_0000215 | |||
| 2697 | Ga0495668_0039909 | |||
| 2698 | Ga0495668_0046683 | |||
| 2699 | Ga0495634_0008814 | |||
| 2700 | Ga0495634_0180235 | |||
| 2701 | Ga0495611_0003842 | |||
| 2702 | Ga0495611_0078575 | |||
| 2703 | Ga0495611_0277951 | |||
| 2704 | Ga0495625_0017744 | |||
| 2705 | Ga0495635_0010301 | |||
| 2706 | Ga0495635_0015969 | |||
| 2707 | Ga0495635_0026638 | |||
| 2708 | Ga0495635_0445479 | |||
| 2709 | Ga0495635_0523152 | |||
| 2710 | Ga0495659_0002574 | |||
| 2711 | Ga0495659_0054558 | |||
| 2712 | Ga0495661_0063130 | |||
| 2713 | Ga0495661_0222522 | |||
| 2714 | Ga0495588_0020179 | |||
| 2715 | Ga0495588_0131939 | |||
| 2716 | Ga0495588_0243427 | |||
| 2717 | Ga0495657_0015814 | |||
| 2718 | Ga0495657_0091756 | |||
| 2719 | Ga0495599_0002681 | |||
| 2720 | Ga0495599_0017056 | |||
| 2721 | Ga0495599_0042653 | |||
| 2722 | Ga0495599_0115730 | |||
| 2723 | Ga0495623_0020755 | |||
| 2724 | Ga0495623_0064743 | |||
| 2725 | Ga0495623_0132012 | |||
| 2726 | Ga0495646_0010194 | |||
| 2727 | Ga0495646_0026632 | |||
| 2728 | Ga0495646_0059772 | |||
| 2729 | Ga0495647_0020437 | |||
| 2730 | Ga0495658_0000360 | |||
| 2731 | Ga0495658_0005781 | |||
| 2732 | Ga0495658_0094433 | |||
| 2733 | Ga0495613_0006693 | |||
| 2734 | Ga0495613_0027827 | |||
| 2735 | Ga0495613_0033307 | |||
| 2736 | Ga0495613_0065362 | |||
| 2737 | Ga0495613_0207131 | |||
| 2738 | Ga0495624_0155778 | |||
| 2739 | Ga0495624_0227022 | |||
| 2740 | Ga0495624_0240543 | |||
| 2741 | Ga0495624_0256231 | |||
| 2742 | Ga0495624_0260707 | |||
| 2743 | Ga0495670_0000213 | |||
| 2744 | Ga0495670_0033566 | |||
| 2745 | Ga0495670_0144478 | |||
| 2746 | Ga0495671_0062082 | |||
| 2747 | Ga0495671_0301809 | |||
| 2748 | Ga0495649_0040385 | |||
| 2749 | Ga0495649_0368703 | |||
| 2750 | Ga0495600_0006046 | |||
| 2751 | Ga0495600_0025897 | |||
| 2752 | Ga0495600_0052146 | |||
| 2753 | Ga0495600_0280197 | |||
| 2754 | Ga0495581_0049437 | |||
| 2755 | Ga0495581_0057033 | |||
| 2756 | Ga0495581_0059837 | |||
| 2757 | Ga0495581_0064661 | |||
| 2758 | Ga0495604_0002294 | |||
| 2759 | Ga0495604_0006070 | |||
| 2760 | Ga0495604_0009049 | |||
| 2761 | Ga0495604_0057607 | |||
| 2762 | Ga0495604_0215008 | |||
| 2763 | Ga0495636_0138265 | |||
| 2764 | Ga0495674_0116513 | |||
| 2765 | Ga0495674_0138581 | |||
| 2766 | Ga0495674_0252836 | |||
| 2767 | Ga0495674_0338640 | |||
| 2768 | Ga0495674_0371609 | |||
| 2769 | Ga0495674_0627891 | |||
| 2770 | Ga0495676_0103110 | |||
| 2771 | Ga0495676_0142975 | |||
| 2772 | Ga0495680_0002446 | |||
| 2773 | Ga0495680_0004222 | |||
| 2774 | Ga0495680_0006606 | |||
| 2775 | Ga0495680_0012206 | |||
| 2776 | Ga0495680_0018853 | |||
| 2777 | Ga0495683_0102690 | |||
| 2778 | Ga0495683_0107894 | |||
| 2779 | Ga0495675_0000147 | |||
| 2780 | Ga0495675_0001653 | |||
| 2781 | Ga0495675_0156734 | |||
| 2782 | Ga0495675_0226208 | |||
| 2783 | Ga0495673_0089310 | |||
| 2784 | Ga0495684_0028528 | |||
| 2785 | Ga0495684_0047645 | |||
| 2786 | Ga0495684_0133969 | |||
| 2787 | Ga0495686_0108062 | |||
| 2788 | Ga0495593_0014970 | |||
| 2789 | Ga0495593_0039262 | |||
| 2790 | Ga0495593_0050848 | |||
| 2791 | Ga0495593_0059876 | |||
| 2792 | Ga0495593_0090251 | |||
| 2793 | Ga0495593_0091642 | |||
| 2794 | Ga0495602_0017376 | |||
| 2795 | Ga0495602_0017828 | |||
| 2796 | Ga0495602_0021291 | |||
| 2797 | Ga0495602_0032133 | |||
| 2798 | Ga0495602_0371326 | |||
| 2799 | Ga0495614_0016270 | |||
| 2800 | Ga0495614_0103831 | |||
| 2801 | Ga0495614_0162082 | |||
| 2802 | Ga0495615_0052303 | |||
| 2803 | Ga0495626_0096330 | |||
| 2804 | Ga0495626_0155680 | |||
| 2805 | Ga0495626_0185251 | |||
| 2806 | Ga0496100_0006594 | |||
| 2807 | Ga0496100_0013961 | |||
| 2808 | Ga0496100_0017287 | |||
| 2809 | Ga0496100_0019150 | |||
| 2810 | Ga0496100_0027597 | |||
| 2811 | Ga0496100_0055392 | |||
| 2812 | Ga0496100_0155297 | |||
| 2813 | Ga0496100_0654765 | |||
| 2814 | Ga0496101_0000079 | |||
| 2815 | Ga0496101_0008107 | |||
| 2816 | Ga0496101_0040176 | |||
| 2817 | Ga0496101_0042859 | |||
| 2818 | Ga0496101_0207438 | |||
| 2819 | Ga0496101_0494469 | |||
| 2820 | Ga0496102_0000942 | |||
| 2821 | Ga0496102_0008860 | |||
| 2822 | Ga0496102_0032833 | |||
| 2823 | Ga0496102_0045286 | |||
| 2824 | Ga0496102_0058807 | |||
| 2825 | Ga0496102_0062689 | |||
| 2826 | Ga0496102_0065998 | |||
| 2827 | Ga0496102_0240279 | |||
| 2828 | Ga0496102_0484428 | |||
| 2829 | Ga0496102_0570034 | |||
| 2830 | Ga0496102_0634479 | |||
| 2831 | Ga0496103_0002375 | |||
| 2832 | Ga0496103_0003062 | |||
| 2833 | Ga0496103_0003997 | |||
| 2834 | Ga0496103_0019249 | |||
| 2835 | Ga0496103_0127351 | |||
| 2836 | Ga0496103_0181710 | |||
| 2837 | Ga0496104_0000431 | |||
| 2838 | Ga0496104_0001836 | |||
| 2839 | Ga0496104_0004143 | |||
| 2840 | Ga0496104_0004191 | |||
| 2841 | Ga0496104_0004953 | |||
| 2842 | Ga0496104_0048661 | |||
| 2843 | Ga0496104_0057612 | |||
| 2844 | Ga0496104_0119489 | |||
| 2845 | Ga0496104_0121646 | |||
| 2846 | Ga0496105_0003143 | |||
| 2847 | Ga0496105_0010944 | |||
| 2848 | Ga0496105_0023618 | |||
| 2849 | Ga0496105_0030941 | |||
| 2850 | Ga0496105_0106414 | |||
| 2851 | Ga0496105_0198022 | |||
| 2852 | Ga0496105_0269708 | |||
| 2853 | Ga0496105_0482244 | |||
| 2854 | Ga0496106_0001143 | |||
| 2855 | Ga0496106_0003554 | |||
| 2856 | Ga0496106_0005844 | |||
| 2857 | Ga0496106_0006633 | |||
| 2858 | Ga0496106_0020095 | |||
| 2859 | Ga0496106_0025502 | |||
| 2860 | Ga0496106_0045494 | |||
| 2861 | Ga0496106_0161002 | |||
| 2862 | Ga0496106_0210718 | |||
| 2863 | Ga0496106_0243728 | |||
| 2864 | Ga0496106_0263203 | |||
| 2865 | Ga0496107_0000359 | |||
| 2866 | Ga0496107_0000436 | |||
| 2867 | Ga0496107_0001363 | |||
| 2868 | Ga0496107_0015236 | |||
| 2869 | Ga0496107_0031502 | |||
| 2870 | Ga0496107_0070373 | |||
| 2871 | Ga0496107_0426888 | |||
| 2872 | Ga0496107_0641522 | |||
| 2873 | Ga0496108_0002867 | |||
| 2874 | Ga0496108_0004006 | |||
| 2875 | Ga0496108_0005147 | |||
| 2876 | Ga0496108_0009582 | |||
| 2877 | Ga0496108_0014038 | |||
| 2878 | Ga0496108_0026663 | |||
| 2879 | Ga0496108_0049594 | |||
| 2880 | Ga0496108_0070596 | |||
| 2881 | Ga0496108_0539247 | |||
| 2882 | Ga0496109_0000223 | |||
| 2883 | Ga0496109_0000404 | |||
| 2884 | Ga0496109_0003116 | |||
| 2885 | Ga0496109_0003557 | |||
| 2886 | Ga0496109_0011617 | |||
| 2887 | Ga0496109_0018871 | |||
| 2888 | Ga0496109_0032437 | |||
| 2889 | Ga0496109_0043419 | |||
| 2890 | Ga0496109_0062763 | |||
| 2891 | Ga0496109_0129345 | |||
| 2892 | Ga0496109_0160862 | |||
| 2893 | Ga0496109_0353838 | |||
| 2894 | Ga0496109_0433724 | |||
| 2895 | Ga0496110_0001910 | |||
| 2896 | Ga0496110_0002394 | |||
| 2897 | Ga0496110_0003653 | |||
| 2898 | Ga0496110_0016589 | |||
| 2899 | Ga0496110_0018162 | |||
| 2900 | Ga0496110_0021793 | |||
| 2901 | Ga0496110_0156603 | |||
| 2902 | Ga0496110_0216741 | |||
| 2903 | Ga0496110_0224907 | |||
| 2904 | Ga0496110_0352580 | |||
| 2905 | Ga0496110_0382159 | |||
| 2906 | Ga0496110_0393332 | |||
| 2907 | Ga0496111_0001774 | |||
| 2908 | Ga0496111_0002312 | |||
| 2909 | Ga0496111_0010932 | |||
| 2910 | Ga0496111_0019333 | |||
| 2911 | Ga0496111_0031701 | |||
| 2912 | Ga0496111_0042841 | |||
| 2913 | Ga0496111_0052032 | |||
| 2914 | Ga0496111_0224552 | |||
| 2915 | Ga0496112_0002963 | |||
| 2916 | Ga0496112_0003601 | |||
| 2917 | Ga0496112_0011928 | |||
| 2918 | Ga0496112_0013071 | |||
| 2919 | Ga0496112_0016019 | |||
| 2920 | Ga0496112_0033447 | |||
| 2921 | Ga0496112_0041430 | |||
| 2922 | Ga0496112_0067614 | |||
| 2923 | Ga0496112_0153304 | |||
| 2924 | Ga0496112_0421394 | |||
| 2925 | Ga0496112_0961166 | |||
| 2926 | Ga0496112_0991408 | |||
| 2927 | Ga0496113_0000624 | |||
| 2928 | Ga0496113_0001396 | |||
| 2929 | Ga0496113_0001735 | |||
| 2930 | Ga0496113_0019330 | |||
| 2931 | Ga0496113_0024186 | |||
| 2932 | Ga0496113_0055173 | |||
| 2933 | Ga0496113_0084102 | |||
| 2934 | Ga0496113_0179025 | |||
| 2935 | Ga0496113_0183840 | |||
| 2936 | Ga0496113_0194380 | |||
| 2937 | Ga0496113_0466813 | |||
| 2938 | Ga0496113_0553775 | |||
| 2939 | Ga0496114_0003222 | |||
| 2940 | Ga0496114_0003326 | |||
| 2941 | Ga0496114_0026647 | |||
| 2942 | Ga0496114_0030663 | |||
| 2943 | Ga0496114_0104819 | |||
| 2944 | Ga0496115_0000547 | |||
| 2945 | Ga0496115_0008495 | |||
| 2946 | Ga0496115_0011806 | |||
| 2947 | Ga0496115_0269700 | |||
| 2948 | Ga0496115_0616009 | |||
| 2949 | Ga0496116_0244215 | |||
| 2950 | Ga0496118_0158767 | |||
| 2951 | Ga0496119_0004123 | |||
| 2952 | Ga0496119_0044953 | |||
| 2953 | Ga0496120_0006519 | |||
| 2954 | Ga0496120_0051081 | |||
| 2955 | Ga0496121_0041733 | |||
| 2956 | Ga0496122_0081141 | |||
| 2957 | Ga0496125_0033107 | |||
| 2958 | Ga0496126_0040330 | |||
| 2959 | Ga0501033_0076983 | |||
| 2960 | Ga0501034_0112807 | |||
| 2961 | Ga0501034_0418822 | |||
| 2962 | Ga0501034_0485901 | |||
| 2963 | Ga0501036_0027820 | |||
| 2964 | Ga0501036_0364034 | |||
| 2965 | Ga0501038_0196245 | |||
| 2966 | Ga0501038_0285339 | |||
| 2967 | Ga0501039_0092711 | |||
| 2968 | Ga0501039_0435483 | |||
| 2969 | Ga0501039_0517843 | |||
| 2970 | Ga0501040_0100563 | |||
| 2971 | Ga0501042_0248800 | |||
| 2972 | Ga0501043_0017209 | |||
| 2973 | Ga0501047_0038971 | |||
| 2974 | Ga0501047_0252772 | |||
| 2975 | Ga0501047_0534621 | |||
| 2976 | Ga0501048_0165489 | |||
| 2977 | Ga0501068_0015903 | |||
| 2978 | Ga0501068_0297176 | |||
| 2979 | Ga0501070_0019024 | |||
| 2980 | Ga0501070_0084044 | |||
| 2981 | Ga0501071_0049958 | |||
| 2982 | Ga0501071_0285310 | |||
| 2983 | Ga0501072_0002712 | |||
| 2984 | Ga0501072_0004481 | |||
| 2985 | Ga0501072_0334990 | |||
| 2986 | Ga0501073_0033637 | |||
| 2987 | Ga0501073_0135204 | |||
| 2988 | Ga0501075_0083915 | |||
| 2989 | Ga0501076_0062530 | |||
| 2990 | Ga0501077_0018282 | |||
| 2991 | Ga0501077_0342582 | |||
| 2992 | Ga0501079_0087588 | |||
| 2993 | Ga0501079_0152376 | |||
| 2994 | Ga0501079_0195043 | |||
| 2995 | Ga0501079_0232621 | |||
| 2996 | Ga0501079_0872822 | |||
| 2997 | Ga0501080_0235329 | |||
| 2998 | Ga0501080_0239470 | |||
| 2999 | Ga0501080_0266948 | |||
| 3000 | Ga0501081_0050631 | |||
| 3001 | Ga0501081_0245361 | |||
| 3002 | Ga0501083_0185812 | |||
| 3003 | Ga0501083_0290466 | |||
| 3004 | Ga0501035_0001940 | |||
| 3005 | Ga0501035_0061568 | |||
| 3006 | Ga0501044_0063861 | |||
| 3007 | Ga0501044_0065573 | |||
| 3008 | Ga0501044_0145089 | |||
| 3009 | Ga0501044_0387481 | |||
| 3010 | Ga0501045_0212135 | |||
| 3011 | Ga0501045_0341272 | |||
| 3012 | nmdc:mga03683_14084_c2 | |||
| 3013 | nmdc:mga03683_29136_c1 | |||
| 3014 | nmdc:mga03n38_20855_c1 | |||
| 3015 | nmdc:mga03n38_29865_c1 | |||
| 3016 | nmdc:mga00v17_135626_c1 | |||
| 3017 | nmdc:mga00v17_23425_c1 | |||
| 3018 | nmdc:mga00v17_52949_c1 | |||
| 3019 | nmdc:mga0yw44_1437_c1 | |||
| 3020 | nmdc:mga0yw44_480014_c1 | |||
| 3021 | nmdc:mga0yw44_9426_c1 | |||
| 3022 | nmdc:mga0k408_2858_c1 | |||
| 3023 | nmdc:mga0k408_8431_c1 | |||
| 3024 | nmdc:mga06z11_23264_c1 | |||
| 3025 | nmdc:mga06z11_25302_c1 | |||
| 3026 | nmdc:mga04h51_8211_c1 | |||
| 3027 | nmdc:mga07m45_23396_c1 | |||
| 3028 | nmdc:mga07m45_5426_c1 | |||
| 3029 | nmdc:mga05p37_14557_c1 | |||
| 3030 | nmdc:mga05p37_210565_c1 | |||
| 3031 | nmdc:mga05p37_31120_c1 | |||
| 3032 | nmdc:mga05p37_36596_c1 | |||
| 3033 | nmdc:mga05p37_775316_c1 | |||
| 3034 | nmdc:mga05p37_884548_c1 | |||
| 3035 | nmdc:mga09592_84725_c1 | |||
| 3036 | nmdc:mga0qj67_150426_c1 | |||
| 3037 | nmdc:mga0qj67_18_c1 | |||
| 3038 | nmdc:mga0qj67_563395_c1 | |||
| 3039 | nmdc:mga06r32_100936_c1 | |||
| 3040 | nmdc:mga06r32_40585_c1 | |||
| 3041 | nmdc:mga06r32_64510_c1 | |||
| 3042 | nmdc:mga08y16_110772_c1 | |||
| 3043 | nmdc:mga08y16_133176_c1 | |||
| 3044 | nmdc:mga08y16_226164_c1 | |||
| 3045 | nmdc:mga08y16_319526_c1 | |||
| 3046 | nmdc:mga08y16_468887_c1 | |||
| 3047 | nmdc:mga08y16_939725_c1 | |||
| 3048 | nmdc:mga0n895_1039522_c1 | |||
| 3049 | nmdc:mga0n895_225470_c1 | |||
| 3050 | nmdc:mga0n895_280338_c1 | |||
| 3051 | nmdc:mga0n895_330737_c1 | |||
| 3052 | nmdc:mga0n895_35380_c1 | |||
| 3053 | nmdc:mga0n895_52081_c1 | |||
| 3054 | nmdc:mga0n895_622_c1 | |||
| 3055 | nmdc:mga0n895_64950_c2 | |||
| 3056 | nmdc:mga0n895_94521_c1 | |||
| 3057 | nmdc:mga0n895_946020_c1 | |||
| 3058 | nmdc:mga0rr50_221431_c1 | |||
| 3059 | nmdc:mga0rr50_259688_c1 | |||
| 3060 | nmdc:mga0rr50_50061_c1 | |||
| 3061 | nmdc:mga0rr50_68530_c1 | |||
| 3062 | nmdc:mga0rr50_711847_c1 | |||
| 3063 | nmdc:mga0rr50_79217_c1 | |||
| 3064 | nmdc:mga08x19_38629_c1 | |||
| 3065 | nmdc:mga0a205_27052_c1 | |||
| 3066 | nmdc:mga0a205_368579_c1 | |||
| 3067 | nmdc:mga0a205_7768_c1 | |||
| 3068 | nmdc:mga0sz30_12769_c1 | |||
| 3069 | nmdc:mga0sz30_96175_c1 | |||
| 3070 | Ga0495601_0001750 | |||
| 3071 | Ga0495601_0002382 | |||
| 3072 | Ga0495601_0017376 | |||
| 3073 | Ga0495601_0025698 | |||
| 3074 | Ga0495601_0063960 | |||
| 3075 | Ga0495601_0120741 | |||
| 3076 | Ga0495601_0153457 | |||
| 3077 | Ga0495612_0008869 | |||
| 3078 | Ga0495612_0010274 | |||
| 3079 | Ga0495612_0043535 | |||
| 3080 | Ga0495612_0064139 | |||
| 3081 | Ga0495655_0003016 | |||
| 3082 | Ga0495655_0008381 | |||
| 3083 | Ga0495655_0019962 | |||
| 3084 | Ga0495595_0000576 | |||
| 3085 | Ga0495595_0004751 | |||
| 3086 | Ga0495595_0032435 | |||
| 3087 | Ga0495595_0037073 | |||
| 3088 | Ga0495595_0090029 | |||
| 3089 | Ga0495619_0000132 | |||
| 3090 | Ga0495619_0000178 | |||
| 3091 | Ga0495619_0011281 | |||
| 3092 | Ga0495619_0031232 | |||
| 3093 | Ga0495619_0037425 | |||
| 3094 | Ga0495619_0037480 | |||
| 3095 | Ga0495619_0055466 | |||
| 3096 | Ga0495619_0249010 | |||
| 3097 | Ga0500646_0039137 | |||
| 3098 | Ga0500647_0077257 | |||
| 3099 | Ga0500641_0024406 | |||
| 3100 | Ga0500654_074863 | |||
| 3101 | Ga0500557_000012 | |||
| 3102 | Ga0500595_014887 | |||
| 3103 | Ga0500614_064498 | |||
| 3104 | Ga0500642_0000232 | |||
| 3105 | Ga0500568_0098276 | |||
| 3106 | Ga0500590_182758 | |||
| 3107 | Ga0500604_0232428 | |||
| 3108 | Ga0500625_028959 | |||
| 3109 | Ga0501084_0170578 | |||
| 3110 | Ga0501084_0336545 | |||
| 3111 | Ga0500661_004079 | |||
| 3112 | Ga0501082_0000145 | |||
| 3113 | Ga0501082_0077631 | |||
| 3114 | Ga0501082_0155815 | |||
| 3115 | Ga0501082_0156230 | |||
| 3116 | Ga0501082_0259839 | |||
| 3117 | Ga0530510_0340487 | |||
| 3118 | 2507505059 | |||
| 3119 | 2508538995 | |||
| 3120 | 2508695310 | |||
| 3121 | 2513639744 | |||
| 3122 | 2513647769 | |||
| 3123 | 2513873717 | |||
| 3124 | 2514015235 | |||
| 3125 | 2515625673 | |||
| 3126 | 2517102161 | |||
| 3127 | 2793064970 | |||
| 3128 | 2805915800 | |||
| 3129 | 2818237476 | |||
| 3130 | 2824608313 | |||
| 3131 | 2824617217 | |||
| 3132 | 2824660117 | |||
| 3133 | 2824677769 | |||
| 3134 | 2824692046 | |||
| 3135 | 2824700583 | |||
| 3136 | 2824772602 | |||
| 3137 | 2838124323 | |||
| 3138 | 2841948865 | |||
| 3139 | 2841951801 | |||
| 3140 | 2841973822 | |||
| 3141 | 2841980148 | |||
| 3142 | 2841985331 | |||
| 3143 | 2842043684 | |||
| 3144 | 2842052326 | |||
| 3145 | 2847941954 | |||
| 3146 | 2849082864 | |||
| 3147 | 2874597058 | |||
| 3148 | 2874624606 | |||
| 3149 | 2874648094 | |||
| 3150 | 2876777522 | |||
| 3151 | 2876825604 | |||
| 3152 | 2879077782 | |||
| 3153 | 2879127856 | |||
| 3154 | 2879148877 | |||
| 3155 | 2881365853 | |||
| 3156 | 2885371215 | |||
| 3157 | 2888420491 | |||
| 3158 | 2904672055 | |||
| 3159 | 2904715762 | |||
| 3160 | 2932794500 | |||
| 3161 | 2932806781 | |||
| 3162 | 2935615366 | |||
| 3163 | 2935654813 | |||
| 3164 | 2935663754 | |||
| 3165 | 2935773427 | |||
| 3166 | 2935782301 | |||
| 3167 | 2935789253 | |||
| 3168 | 2935797190 | |||
| 3169 | 2935825256 | |||
| 3170 | 2935853090 | |||
| 3171 | 2935888552 | |||
| 3172 | 2935910162 | |||
| 3173 | 2935918541 | |||
| 3174 | 2935927927 | |||
| 3175 | 2935936201 | |||
| 3176 | 2935944246 | |||
| 3177 | 2935952683 | |||
| 3178 | 2935969523 | |||
| 3179 | 2935977715 | |||
| 3180 | 2935984968 | |||
| 3181 | 2936017849 | |||
| 3182 | 2936026352 | |||
| 3183 | 2936031600 | |||
| 3184 | 2936053386 | |||
| 3185 | 2936056137 | |||
| 3186 | 2941532513 | |||
| 3187 | 3005710820 | |||
| 3188 | 8016525954 | |||
| 3189 | 8016557871 | |||
| 3190 | 8016569251 | |||
| 3191 | 8016581886 | |||
| 3192 | 8016595890 | |||
| 3193 | 8016618659 | |||
| 3194 | 8016623402 | |||
| 3195 | 8016635860 | |||
| 3196 | 8019530838 | |||
| 3197 | 8019540744 | |||
| 3198 | 8019622772 | |||
| 3199 | 8019630334 | |||
| 3200 | 8019640278 | |||
| 3201 | 8019652671 | |||
| 3202 | 8019667163 | |||
| 3203 | 8019676948 | |||
| 3204 | 8019679040 | |||
| 3205 | 8019696486 | |||
| 3206 | 8056971101 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6nak-assembly1.cif.gz_C | bacterial protein complex tm bde complex | 0.8642 | 1 | 198 |
| 2a6a-assembly1.cif.gz_A | crystal structure of glycoprotein endopeptidase (tm0874) from thermotoga maritima at 2.50 a resolution | 0.858 | 1 | 198 |
| 3r6m-assembly2.cif.gz_C | crystal structure of vibrio parahaemolyticus yeaz | 0.8432 | 1 | 198 |
| 4y0w-assembly1.cif.gz_D-2 | yeaz from pseudomonas aeruginosa | 0.8207 | 1 | 198 |
| 4y0w-assembly1.cif.gz_E-2 | yeaz from pseudomonas aeruginosa | 0.8176 | 1 | 210 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76256_2_102_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9396 | 2 | 97 | 3.30.420.40 |
| 5br9C01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9391 | 2 | 96 | 3.30.420.40 |
| af_Q2FWL0_1_92_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9254 | 1 | 94 | 3.30.420.40 |
| af_Q2FWL0_1_92_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9159 | 1 | 94 | 3.30.420.40 |
| 3zeuB01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9139 | 1 | 100 | 3.30.420.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382ESK2-F1-model_v4 | Gcp-like domain-containing protein | 0.9452 | 1 | 97 |
GO:0002949
GO:0005829 |
| AF-A0A7Y3ELP6-F1-model_v4 | tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB | 0.9389 | 1 | 100 |
GO:0002949
GO:0005829 GO:0016740 |
| AF-A0A5E6NHC8-F1-model_v4 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaB (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaB) | 0.9369 | 1 | 96 |
GO:0002949
|
| AF-A0A1Q6UYR5-F1-model_v4 | tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB | 0.9347 | 1 | 98 |
GO:0002949
GO:0005829 GO:0016740 |
| AF-A0A4V5SEI4-F1-model_v4 | deleted | 0.9341 | 1 | 96 |
|