F495003

General Info

Members Datasets Scaffolds Average Seq Length
1603 591 3206 226

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10000107|Ga0207695_1000010741
Length 259
Sequence MVSCEWRMALRSIRLFAIRYSPLTICHSMLILAIDTALEACAAAVLDTDAGELLAQEQLLMKRGHAEALMPMIARVMQSADLAFTALDRIAVTVGPGSFTGLRVGISAARGLALAAGRPAIGLSTLSAYAAAIVGQSGPAPVISAIDARHDHVYFQIVGGDGRQLERPKIAPIDEAIAASQFGAPHLVGNAAKILAERWPKDAPQPVAVDAQPAPDINWVAWLGAAADPGTNPARPFYLKAPDAKPAAQPLFAAQAATS

Samples

Sample ID Description Type Environment
1 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
8 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
13 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
14 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
15 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
16 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
17 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
18 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
19 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
20 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
21 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
22 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
56 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
57 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
60 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
61 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
62 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
63 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
64 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
65 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
73 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
74 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
75 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
76 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
77 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
80 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
81 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
82 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
83 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
84 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
85 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
86 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
87 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
98 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
104 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
105 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
106 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
107 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
108 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
109 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
110 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
111 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
112 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
113 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
114 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
115 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
116 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
117 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
118 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
119 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
120 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
122 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
123 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
124 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
125 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
126 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
127 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
128 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
129 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
130 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
131 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
132 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
133 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
134 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
135 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
136 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
138 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
139 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
141 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
142 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
143 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
144 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
145 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
146 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
147 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
148 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
149 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
150 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
151 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
152 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
153 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
154 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
155 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
156 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
157 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
158 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
159 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
160 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
161 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
162 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
163 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
164 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
165 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
166 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
167 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
168 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
171 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
172 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
173 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
250 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
252 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
253 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
257 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
258 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
259 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
260 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
261 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
262 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
263 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
264 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
265 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
266 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
267 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
268 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
269 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
270 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
271 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
272 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
273 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
274 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
275 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
276 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
277 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
278 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
279 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
280 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
281 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
282 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
283 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
284 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
285 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
286 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
287 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
288 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
289 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
290 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
291 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
292 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
293 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
294 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
295 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
296 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
297 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
298 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
299 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
300 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
301 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
302 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
303 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
304 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
305 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
306 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
307 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
308 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
309 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
310 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
311 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
312 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
313 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
314 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
315 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
316 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
317 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
318 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
319 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
320 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
321 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
322 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
323 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
324 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
325 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
326 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
327 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
328 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
329 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
330 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
331 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
332 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
333 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
334 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
335 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
336 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
337 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
338 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
339 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
340 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
341 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
342 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
343 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
344 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
345 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
346 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
347 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
348 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
349 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
350 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
351 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
352 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
353 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
354 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
355 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
356 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
357 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
358 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
359 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
360 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
361 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
362 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
363 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
364 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
365 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
366 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
367 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
368 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
369 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
370 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
371 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
372 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
373 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
374 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
375 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
376 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
377 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
378 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
379 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
380 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
381 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
382 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
383 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
384 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
385 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
386 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
387 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
388 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
389 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
390 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
391 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
392 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
393 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
394 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
395 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
396 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
397 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
398 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
399 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
400 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
401 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
402 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
403 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
404 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
405 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
406 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
407 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
408 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
409 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
410 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
411 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
412 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
413 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
414 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
415 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
416 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
417 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
418 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
419 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
420 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
421 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
422 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
423 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
424 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
425 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
426 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
427 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
428 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
429 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
430 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
431 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
432 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
433 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
434 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
435 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
436 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
437 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
438 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
439 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
440 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
442 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
446 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
447 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
449 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
450 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
451 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
452 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
453 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
454 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
455 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
456 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
457 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
458 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
459 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
460 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
461 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
464 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
465 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
466 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
467 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
468 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
469 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
470 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
471 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
472 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
473 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
474 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
475 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
476 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
477 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
478 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
479 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
480 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
481 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
482 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
483 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
484 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
485 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
486 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
487 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
488 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
489 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
490 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
491 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
492 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
493 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
494 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
495 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
496 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
497 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
498 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
499 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
500 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
501 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
502 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
503 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
504 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
505 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
506 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
507 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
508 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
509 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
510 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
511 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
512 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
513 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
514 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
515 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
516 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
517 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
518 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
519 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
520 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
521 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
522 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
523 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
524 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
525 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
526 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
527 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
528 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
529 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
530 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
531 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
532 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
533 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
534 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
535 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
536 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
537 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
538 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
539 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
540 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
541 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
542 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
543 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
544 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
545 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
546 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
547 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
548 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
549 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
550 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
551 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
552 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
553 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
554 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
555 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
556 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
557 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
558 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
559 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
560 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
561 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
562 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
563 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
564 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
565 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
566 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
567 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
568 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
569 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
570 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
571 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
572 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
573 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
574 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
575 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
576 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
577 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
578 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
579 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
580 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
581 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
582 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
583 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
584 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
585 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
586 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
587 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
588 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
589 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
590 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
591 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.39
Metatranscriptomes 0.06
Isolates 5.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.74
Nodule 4.62
Rhizoplane 8.92
Rhizosphere 80.85
Stem 0
Stem Tuber 0
Unclassified 1.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207695_10000107 3300025913 Bacteria 252606
2 2214756331 2209111006 Bacteria 3114
3 ARcpr5yngRDRAFT_c000052 3300000043 Bacteria 18395
4 ARSoilOldRDRAFT_c000001 3300000044 Bacteria 104759
5 ARCol0oldRDRAFT_c00112 3300000045 Bacteria 7027
6 ARCol0yngRDRAFT_1000001 3300000652 Bacteria 73871
7 JGI24741J21665_1007670 3300001915 Bacteria 2081
8 JGI24752J21851_1001356 3300001976 Bacteria 3307
9 JGI24746J21847_1000477 3300001977 Bacteria 5976
10 JGI24739J22299_10000177 3300001989 Bacteria 21227
11 JGI24737J22298_10000967 3300001990 Bacteria 10195
12 JGI24737J22298_10006515 3300001990 Bacteria 3985
13 JGI24743J22301_10001361 3300001991 Bacteria 3357
14 JGI24750J21931_1000547 3300002070 Bacteria 5778
15 JGI24750J21931_1003185 3300002070 Bacteria 1968
16 JGI24745J21846_1001306 3300002073 Bacteria 2404
17 JGI24748J21848_1000209 3300002074 Bacteria 7317
18 JGI24738J21930_10000256 3300002075 Bacteria 14438
19 JGI24738J21930_10000437 3300002075 Bacteria 11794
20 JGI24749J21850_1000857 3300002076 Bacteria 4387
21 JGI24744J21845_10000555 3300002077 Bacteria 6730
22 JGI24744J21845_10001216 3300002077 Bacteria 5049
23 JGI24035J26624_1000009 3300002126 Bacteria 13802
24 JGI24034J26672_10000760 3300002239 Bacteria 4166
25 JGI24742J22300_10001007 3300002244 Bacteria 4339
26 JGI25153J46596_10007997 3300003215 Bacteria 5116
27 Ga0055531_10004894 3300003794 Bacteria 7975
28 JGI25405J52794_10028701 3300003911 Bacteria 1149
29 Ga0055543_1022841 3300004625 Bacteria 1132
30 Ga0065165_1006357 3300005262 Bacteria 6230
31 Ga0065165_1020376 3300005262 Bacteria 2334
32 Ga0065704_10160483 3300005289 Bacteria 1358
33 Ga0065712_10082879 3300005290 Bacteria 2878
34 Ga0065715_10001850 3300005293 Bacteria 10231
35 Ga0065715_10100237 3300005293 Bacteria 3324
36 Ga0070676_10000076 3300005328 Bacteria 33400
37 Ga0070676_10022801 3300005328 Bacteria 3513
38 Ga0070676_10024250 3300005328 Bacteria 3416
39 Ga0070676_10031130 3300005328 Bacteria 3046
40 Ga0070683_100002997 3300005329 Bacteria 13548
41 Ga0070683_100067661 3300005329 Bacteria 3327
42 Ga0070690_100002546 3300005330 Bacteria 9809
43 Ga0070690_100003545 3300005330 Bacteria 8557
44 Ga0070690_100022196 3300005330 Bacteria 3881
45 Ga0070690_100194638 3300005330 Bacteria 1407
46 Ga0070690_100218798 3300005330 Bacteria 1333
47 Ga0070690_100313120 3300005330 Bacteria 1129
48 Ga0070690_100551954 3300005330 Unclassified 869
49 Ga0070670_100001544 3300005331 Bacteria 18563
50 Ga0070670_100005236 3300005331 Bacteria 10920
51 Ga0070670_100154002 3300005331 Bacteria 1990
52 Ga0070670_100812982 3300005331 Bacteria 844
53 Ga0070677_10000038 3300005333 Bacteria 40055
54 Ga0070677_10016774 3300005333 Bacteria 2612
55 Ga0070677_10029474 3300005333 Bacteria 2081
56 Ga0070677_10104839 3300005333 Bacteria 1253
57 Ga0068869_100000054 3300005334 Bacteria 49952
58 Ga0068869_100169330 3300005334 Bacteria 1706
59 Ga0068869_100450057 3300005334 Bacteria 1067
60 Ga0068869_100650715 3300005334 Bacteria 895
61 Ga0070666_10046576 3300005335 Bacteria 2909
62 Ga0070666_10127785 3300005335 Bacteria 1765
63 Ga0070666_10139406 3300005335 Bacteria 1689
64 Ga0070680_100004742 3300005336 Bacteria 10235
65 Ga0070680_100191245 3300005336 Bacteria 1724
66 Ga0070682_100000181 3300005337 Bacteria 47168
67 Ga0070682_100083595 3300005337 Bacteria 2072
68 Ga0070682_100091649 3300005337 Bacteria 1990
69 Ga0070682_100123788 3300005337 Bacteria 1740
70 Ga0068868_100002127 3300005338 Bacteria 13663
71 Ga0068868_100003086 3300005338 Bacteria 11592
72 Ga0068868_100087352 3300005338 Bacteria 2507
73 Ga0068868_100171033 3300005338 Bacteria 1799
74 Ga0068868_100181563 3300005338 Bacteria 1746
75 Ga0070660_100000660 3300005339 Bacteria 22766
76 Ga0070660_100062555 3300005339 Bacteria 2892
77 Ga0070660_100064473 3300005339 Bacteria 2850
78 Ga0070660_100278485 3300005339 Bacteria 1368
79 Ga0070660_100452990 3300005339 Bacteria 1065
80 Ga0070689_100003434 3300005340 Bacteria 10545
81 Ga0070689_100003508 3300005340 Bacteria 10425
82 Ga0070689_100004183 3300005340 Bacteria 9729
83 Ga0070689_100025050 3300005340 Bacteria 4480
84 Ga0070689_100029697 3300005340 Bacteria 4141
85 Ga0070689_100182206 3300005340 Bacteria 1706
86 Ga0070691_10000491 3300005341 Bacteria 14859
87 Ga0070691_10109721 3300005341 Bacteria 1379
88 Ga0070687_100000358 3300005343 Bacteria 15563
89 Ga0070687_100011228 3300005343 Bacteria 3911
90 Ga0070687_100011387 3300005343 Bacteria 3889
91 Ga0070687_100034735 3300005343 Bacteria 2498
92 Ga0070687_100064142 3300005343 Bacteria 1951
93 Ga0070687_100118747 3300005343 Bacteria 1509
94 Ga0070687_100148142 3300005343 Bacteria 1375
95 Ga0070687_100595184 3300005343 Bacteria 759
96 Ga0070661_100000797 3300005344 Bacteria 22658
97 Ga0070661_100047671 3300005344 Bacteria 3136
98 Ga0070661_100091588 3300005344 Bacteria 2252
99 Ga0070661_100321610 3300005344 Bacteria 1208
100 Ga0070661_100488577 3300005344 Bacteria 984
101 Ga0070692_10000320 3300005345 Bacteria 13809
102 Ga0070692_10008804 3300005345 Bacteria 4517
103 Ga0070692_10038825 3300005345 Bacteria 2429
104 Ga0070668_100004777 3300005347 Bacteria 10049
105 Ga0070668_100044390 3300005347 Bacteria 3410
106 Ga0070668_100123028 3300005347 Bacteria 2076
107 Ga0070669_100001643 3300005353 Bacteria 16208
108 Ga0070669_100027609 3300005353 Bacteria 4086
109 Ga0070669_100353257 3300005353 Bacteria 1194
110 Ga0070675_100005771 3300005354 Bacteria 9470
111 Ga0070675_100111785 3300005354 Bacteria 2312
112 Ga0070671_100003232 3300005355 Bacteria 12704
113 Ga0070671_100031220 3300005355 Bacteria 4399
114 Ga0070671_100041035 3300005355 Bacteria 3845
115 Ga0070671_100089793 3300005355 Bacteria 2572
116 Ga0070671_100555295 3300005355 Bacteria 990
117 Ga0070671_100632121 3300005355 Unclassified 926
118 Ga0070674_100000140 3300005356 Bacteria 33405
119 Ga0070674_100226858 3300005356 Bacteria 1456
120 Ga0070673_100007770 3300005364 Bacteria 7094
121 Ga0070673_100029834 3300005364 Bacteria 4072
122 Ga0070673_100067400 3300005364 Bacteria 2862
123 Ga0070673_100503104 3300005364 Bacteria 1096
124 Ga0070673_100525476 3300005364 Bacteria 1073
125 Ga0070688_100002076 3300005365 Bacteria 10116
126 Ga0070688_100005196 3300005365 Bacteria 6837
127 Ga0070688_100026043 3300005365 Bacteria 3470
128 Ga0070659_100004532 3300005366 Bacteria 9922
129 Ga0070659_100032102 3300005366 Bacteria 4070
130 Ga0070659_100038432 3300005366 Bacteria 3733
131 Ga0070659_100042897 3300005366 Bacteria 3537
132 Ga0070667_100001305 3300005367 Bacteria 22468
133 Ga0070667_100165388 3300005367 Bacteria 1951
134 Ga0070667_100355091 3300005367 Bacteria 1328
135 Ga0070667_100556513 3300005367 Bacteria 1054
136 Ga0070703_10001982 3300005406 Bacteria 6000
137 Ga0070703_10005800 3300005406 Bacteria 3459
138 Ga0070703_10029695 3300005406 Bacteria 1643
139 Ga0070709_10004597 3300005434 Bacteria 7455
140 Ga0070709_10007654 3300005434 Bacteria 5928
141 Ga0070714_100054238 3300005435 Bacteria 3424
142 Ga0070714_100058840 3300005435 Bacteria 3294
143 Ga0070714_100293538 3300005435 Bacteria 1514
144 Ga0070713_100010421 3300005436 Bacteria 6712
145 Ga0070713_100021777 3300005436 Bacteria 4940
146 Ga0070713_100024821 3300005436 Bacteria 4677
147 Ga0070713_100326724 3300005436 Bacteria 1418
148 Ga0070710_10004200 3300005437 Bacteria 6828
149 Ga0070710_10014806 3300005437 Bacteria 3931
150 Ga0070710_10062090 3300005437 Bacteria 2130
151 Ga0070701_10000297 3300005438 Bacteria 16259
152 Ga0070701_10001300 3300005438 Bacteria 9184
153 Ga0070701_10020956 3300005438 Bacteria 3112
154 Ga0070711_100076631 3300005439 Bacteria 2371
155 Ga0070711_100128769 3300005439 Bacteria 1882
156 Ga0070711_100304595 3300005439 Bacteria 1268
157 Ga0070705_100000989 3300005440 Bacteria 15855
158 Ga0070705_100070844 3300005440 Bacteria 2106
159 Ga0070700_100002276 3300005441 Bacteria 9754
160 Ga0070700_100011750 3300005441 Bacteria 4860
161 Ga0070700_100070030 3300005441 Bacteria 2235
162 Ga0070694_100000444 3300005444 Bacteria 22578
163 Ga0070694_100003236 3300005444 Bacteria 9721
164 Ga0070694_100268192 3300005444 Bacteria 1297
165 Ga0070694_100407529 3300005444 Bacteria 1066
166 Ga0070708_100031469 3300005445 Bacteria 4592
167 Ga0070663_100000436 3300005455 Bacteria 22024
168 Ga0070663_100028875 3300005455 Bacteria 3782
169 Ga0070663_100067556 3300005455 Bacteria 2593
170 Ga0070663_100215216 3300005455 Bacteria 1506
171 Ga0070678_100000382 3300005456 Bacteria 20769
172 Ga0070678_100003875 3300005456 Bacteria 8404
173 Ga0070678_100050943 3300005456 Bacteria 2998
174 Ga0070662_100003913 3300005457 Bacteria 9340
175 Ga0070662_100005358 3300005457 Bacteria 8191
176 Ga0070662_100006339 3300005457 Bacteria 7621
177 Ga0070662_100222459 3300005457 Bacteria 1507
178 Ga0070662_100286958 3300005457 Bacteria 1333
179 Ga0070681_10005795 3300005458 Bacteria 11955
180 Ga0070681_10044092 3300005458 Bacteria 4464
181 Ga0070681_10104858 3300005458 Bacteria 2769
182 Ga0070681_10118502 3300005458 Bacteria 2584
183 Ga0070681_10320906 3300005458 Bacteria 1458
184 Ga0070681_10349941 3300005458 Bacteria 1388
185 Ga0070681_11014279 3300005458 Bacteria 750
186 Ga0068867_100004037 3300005459 Bacteria 10325
187 Ga0068867_100031738 3300005459 Bacteria 3816
188 Ga0068867_100049962 3300005459 Bacteria 3080
189 Ga0068867_100115286 3300005459 Bacteria 2069
190 Ga0070685_10011992 3300005466 Bacteria 4544
191 Ga0070685_10019254 3300005466 Bacteria 3680
192 Ga0070685_10053921 3300005466 Bacteria 2331
193 Ga0070685_10090723 3300005466 Bacteria 1849
194 Ga0070685_10099640 3300005466 Bacteria 1772
195 Ga0070706_100142059 3300005467 Bacteria 2241
196 Ga0070698_100206822 3300005471 Bacteria 1898
197 Ga0070699_100234039 3300005518 Bacteria 1638
198 Ga0070679_100001204 3300005530 Bacteria 22768
199 Ga0070679_100096291 3300005530 Bacteria 2947
200 Ga0070684_100004481 3300005535 Bacteria 10635
201 Ga0070684_100031381 3300005535 Bacteria 4523
202 Ga0070684_100063427 3300005535 Bacteria 3239
203 Ga0070697_100291756 3300005536 Bacteria 1401
204 Ga0068853_100001615 3300005539 Bacteria 16456
205 Ga0068853_100004372 3300005539 Bacteria 10934
206 Ga0070672_100003461 3300005543 Bacteria 10231
207 Ga0070672_100083198 3300005543 Bacteria 2568
208 Ga0070672_100337527 3300005543 Bacteria 1283
209 Ga0070686_100002518 3300005544 Bacteria 10097
210 Ga0070686_100009403 3300005544 Bacteria 5495
211 Ga0070686_100293445 3300005544 Bacteria 1203
212 Ga0070695_100002937 3300005545 Bacteria 9928
213 Ga0070695_100004993 3300005545 Bacteria 7823
214 Ga0070695_100417542 3300005545 Bacteria 1021
215 Ga0070696_100009850 3300005546 Bacteria 6392
216 Ga0070696_100309863 3300005546 Bacteria 1212
217 Ga0070696_100328530 3300005546 Bacteria 1179
218 Ga0070693_100000628 3300005547 Bacteria 15686
219 Ga0070665_100112704 3300005548 Bacteria 2722
220 Ga0070665_100153502 3300005548 Bacteria 2305
221 Ga0070665_100207924 3300005548 Bacteria 1958
222 Ga0070665_100298035 3300005548 Bacteria 1615
223 Ga0070665_100580933 3300005548 Bacteria 1133
224 Ga0070704_100055623 3300005549 Bacteria 2806
225 Ga0070704_100058274 3300005549 Bacteria 2750
226 Ga0070704_100223496 3300005549 Bacteria 1532
227 Ga0070704_100256179 3300005549 Bacteria 1439
228 Ga0070704_100347552 3300005549 Bacteria 1251
229 Ga0070704_100831568 3300005549 Bacteria 827
230 Ga0068855_100023116 3300005563 Bacteria 7449
231 Ga0068855_100095264 3300005563 Bacteria 3431
232 Ga0068855_100380532 3300005563 Bacteria 1550
233 Ga0070664_100004566 3300005564 Bacteria 11109
234 Ga0070664_100063082 3300005564 Bacteria 3159
235 Ga0070664_100085062 3300005564 Bacteria 2731
236 Ga0070664_100382548 3300005564 Unclassified 1285
237 Ga0070664_100598894 3300005564 Bacteria 1022
238 Ga0070664_100676981 3300005564 Bacteria 960
239 Ga0068857_100006169 3300005577 Bacteria 10247
240 Ga0068857_100016920 3300005577 Bacteria 6388
241 Ga0068857_100043816 3300005577 Bacteria 3969
242 Ga0068857_100210605 3300005577 Bacteria 1774
243 Ga0068854_100003262 3300005578 Bacteria 10104
244 Ga0068854_100015505 3300005578 Bacteria 5051
245 Ga0068854_100041635 3300005578 Bacteria 3247
246 Ga0068854_100064618 3300005578 Bacteria 2659
247 Ga0068854_100705520 3300005578 Bacteria 871
248 Ga0068856_100004644 3300005614 Bacteria 13644
249 Ga0068856_100155865 3300005614 Bacteria 2294
250 Ga0068856_100177921 3300005614 Bacteria 2140
251 Ga0068856_100331265 3300005614 Bacteria 1540
252 Ga0068856_100409452 3300005614 Bacteria 1376
253 Ga0070702_100000041 3300005615 Bacteria 34639
254 Ga0070702_100002073 3300005615 Bacteria 8492
255 Ga0070702_100064308 3300005615 Bacteria 2146
256 Ga0070702_100080293 3300005615 Bacteria 1951
257 Ga0070702_100096687 3300005615 Bacteria 1803
258 Ga0070702_100427359 3300005615 Bacteria 955
259 Ga0070702_100594342 3300005615 Unclassified 828
260 Ga0068852_100038957 3300005616 Bacteria 3998
261 Ga0068852_100109132 3300005616 Bacteria 2512
262 Ga0068852_100214847 3300005616 Bacteria 1826
263 Ga0068852_100384529 3300005616 Bacteria 1377
264 Ga0068859_100014564 3300005617 Bacteria 7899
265 Ga0068859_100046546 3300005617 Bacteria 4356
266 Ga0068859_100058549 3300005617 Bacteria 3881
267 Ga0068859_100063160 3300005617 Bacteria 3734
268 Ga0068859_100538324 3300005617 Bacteria 1262
269 Ga0068859_100635760 3300005617 Bacteria 1159
270 Ga0068859_100825974 3300005617 Bacteria 1013
271 Ga0068864_100000172 3300005618 Bacteria 59525
272 Ga0068864_100005707 3300005618 Bacteria 10206
273 Ga0068864_100038825 3300005618 Bacteria 4067
274 Ga0068864_100146517 3300005618 Bacteria 2135
275 Ga0068864_100596999 3300005618 Unclassified 1071
276 Ga0068866_10000209 3300005718 Bacteria 27638
277 Ga0068866_10044664 3300005718 Bacteria 2217
278 Ga0068861_100001340 3300005719 Bacteria 15459
279 Ga0068851_10193464 3300005834 Bacteria 1132
280 Ga0068870_10000652 3300005840 Bacteria 13237
281 Ga0068870_10002924 3300005840 Bacteria 7197
282 Ga0068870_10503266 3300005840 Bacteria 808
283 Ga0068863_100001541 3300005841 Bacteria 22740
284 Ga0068863_100030974 3300005841 Bacteria 5108
285 Ga0068863_100077872 3300005841 Bacteria 3138
286 Ga0068858_100014295 3300005842 Bacteria 7485
287 Ga0068858_100120659 3300005842 Bacteria 2451
288 Ga0068858_100309409 3300005842 Bacteria 1508
289 Ga0068858_100348362 3300005842 Bacteria 1419
290 Ga0068860_100007995 3300005843 Bacteria 10543
291 Ga0068860_100059288 3300005843 Bacteria 3639
292 Ga0068860_100577100 3300005843 Bacteria 1128
293 Ga0068860_100666320 3300005843 Bacteria 1049
294 Ga0068862_100003247 3300005844 Bacteria 14065
295 Ga0068862_100005613 3300005844 Bacteria 10485
296 Ga0068862_100010836 3300005844 Bacteria 7527
297 Ga0068862_100214860 3300005844 Bacteria 1739
298 Ga0081455_10000002 3300005937 Bacteria 460472
299 Ga0081455_10011036 3300005937 Bacteria 9099
300 Ga0081455_10011972 3300005937 Bacteria 8683
301 Ga0081455_10096499 3300005937 Bacteria 2383
302 Ga0081538_10002134 3300005981 Bacteria 19697
303 Ga0081540_1011265 3300005983 Bacteria 5989
304 Ga0081539_10001661 3300005985 Bacteria 36064
305 Ga0070717_10004108 3300006028 Bacteria 10499
306 Ga0070717_10009760 3300006028 Bacteria 7228
307 Ga0070717_10276089 3300006028 Bacteria 1489
308 Ga0070717_10414929 3300006028 Bacteria 1211
309 Ga0075365_10135490 3300006038 Bacteria 1706
310 Ga0075365_10292781 3300006038 Bacteria 1145
311 Ga0075368_10009240 3300006042 Bacteria 3542
312 Ga0075363_100013123 3300006048 Bacteria 4007
313 Ga0075363_100158075 3300006048 Bacteria 1282
314 Ga0075363_100304050 3300006048 Bacteria 926
315 Ga0075364_10408328 3300006051 Bacteria 927
316 Ga0075432_10049484 3300006058 Bacteria 1481
317 Ga0070715_10000720 3300006163 Bacteria 8912
318 Ga0070715_10117210 3300006163 Bacteria 1264
319 Ga0070716_100010508 3300006173 Bacteria 4642
320 Ga0070716_100328235 3300006173 Bacteria 1075
321 Ga0070712_100000460 3300006175 Bacteria 23354
322 Ga0070712_100070971 3300006175 Bacteria 2490
323 Ga0070712_100158873 3300006175 Bacteria 1744
324 Ga0070712_100177873 3300006175 Bacteria 1656
325 Ga0070712_100211580 3300006175 Bacteria 1529
326 Ga0075362_10021323 3300006177 Bacteria 2717
327 Ga0075367_10019074 3300006178 Bacteria 3797
328 Ga0075367_10267614 3300006178 Bacteria 1073
329 Ga0075369_10011405 3300006186 Bacteria 3496
330 Ga0075366_10010047 3300006195 Bacteria 5305
331 Ga0075366_10012444 3300006195 Bacteria 4826
332 Ga0097621_100000565 3300006237 Bacteria 25981
333 Ga0097621_100385545 3300006237 Bacteria 1252
334 Ga0075370_10077261 3300006353 Bacteria 1910
335 Ga0075370_10409502 3300006353 Unclassified 814
336 Ga0068871_100000303 3300006358 Bacteria 34296
337 Ga0068871_100005491 3300006358 Bacteria 8893
338 Ga0068871_100074783 3300006358 Bacteria 2795
339 Ga0075428_100030184 3300006844 Bacteria 5997
340 Ga0075428_100325676 3300006844 Bacteria 1651
341 Ga0075428_100396918 3300006844 Bacteria 1478
342 Ga0075428_100592657 3300006844 Bacteria 1184
343 Ga0075430_100000492 3300006846 Bacteria 29679
344 Ga0075430_100013197 3300006846 Bacteria 7039
345 Ga0075430_100156711 3300006846 Bacteria 1896
346 Ga0075430_100204326 3300006846 Bacteria 1640
347 Ga0075431_100040575 3300006847 Bacteria 4798
348 Ga0075431_100116984 3300006847 Bacteria 2751
349 Ga0075431_100220767 3300006847 Bacteria 1933
350 Ga0075433_10053274 3300006852 Bacteria 3527
351 Ga0075433_10554797 3300006852 Unclassified 1010
352 Ga0075434_100000412 3300006871 Bacteria 31664
353 Ga0075434_100032747 3300006871 Bacteria 5126
354 Ga0075434_100033742 3300006871 Bacteria 5052
355 Ga0075434_100050156 3300006871 Bacteria 4146
356 Ga0075434_100098202 3300006871 Bacteria 2934
357 Ga0075434_100103939 3300006871 Bacteria 2849
358 Ga0075434_100156042 3300006871 Bacteria 2302
359 Ga0075434_100240904 3300006871 Bacteria 1829
360 Ga0075434_100253868 3300006871 Bacteria 1777
361 Ga0075434_100267351 3300006871 Bacteria 1729
362 Ga0075434_100716376 3300006871 Bacteria 1018
363 Ga0075429_100099929 3300006880 Bacteria 2532
364 Ga0068865_100000682 3300006881 Bacteria 19141
365 Ga0068865_100069839 3300006881 Bacteria 2487
366 Ga0068865_100182153 3300006881 Bacteria 1618
367 Ga0075436_100070943 3300006914 Bacteria 2408
368 Ga0097620_100014563 3300006931 Bacteria 7899
369 Ga0097620_100046544 3300006931 Bacteria 4356
370 Ga0097620_100058549 3300006931 Bacteria 3881
371 Ga0097620_100063160 3300006931 Bacteria 3734
372 Ga0097620_100538302 3300006931 Bacteria 1262
373 Ga0097620_100635779 3300006931 Bacteria 1159
374 Ga0097620_100825969 3300006931 Bacteria 1013
375 Ga0075435_100040717 3300007076 Bacteria 3711
376 Ga0075435_100102310 3300007076 Bacteria 2374
377 Ga0075435_100280083 3300007076 Bacteria 1423
378 Ga0075435_100736870 3300007076 Bacteria 857
379 Ga0099794_10038823 3300007265 Bacteria 2257
380 Ga0105251_10137861 3300009011 Bacteria 1104
381 Ga0105240_10056226 3300009093 Bacteria 4924
382 Ga0105240_10069601 3300009093 Bacteria 4355
383 Ga0105240_10239587 3300009093 Bacteria 2104
384 Ga0105240_10249173 3300009093 Bacteria 2055
385 Ga0105240_10798219 3300009093 Bacteria 1023
386 Ga0111539_10002657 3300009094 Bacteria 23686
387 Ga0111539_10002897 3300009094 Bacteria 22777
388 Ga0111539_10108622 3300009094 Bacteria 3256
389 Ga0111539_10132079 3300009094 Bacteria 2923
390 Ga0111539_10183045 3300009094 Bacteria 2447
391 Ga0111539_10201052 3300009094 Bacteria 2324
392 Ga0111539_10507741 3300009094 Bacteria 1404
393 Ga0111539_10683689 3300009094 Bacteria 1195
394 Ga0105245_10000882 3300009098 Bacteria 27254
395 Ga0105245_10037434 3300009098 Bacteria 4313
396 Ga0105245_10106664 3300009098 Bacteria 2600
397 Ga0105245_10271015 3300009098 Bacteria 1656
398 Ga0105247_10001969 3300009101 Bacteria 14264
399 Ga0105247_10004828 3300009101 Bacteria 8579
400 Ga0105247_10289542 3300009101 Bacteria 1132
401 Ga0114129_10008610 3300009147 Bacteria 14548
402 Ga0114129_10021090 3300009147 Bacteria 9252
403 Ga0114129_10061242 3300009147 Bacteria 5259
404 Ga0114129_10095382 3300009147 Bacteria 4120
405 Ga0114129_10104552 3300009147 Bacteria 3913
406 Ga0114129_10157533 3300009147 Bacteria 3104
407 Ga0114129_10586182 3300009147 Bacteria 1446
408 Ga0114129_10605105 3300009147 Bacteria 1419
409 Ga0114129_11902180 3300009147 Unclassified 721
410 Ga0105243_10001029 3300009148 Bacteria 25692
411 Ga0105243_10009289 3300009148 Bacteria 7502
412 Ga0105243_10023731 3300009148 Bacteria 4675
413 Ga0105243_10230935 3300009148 Bacteria 1641
414 Ga0105243_10262535 3300009148 Bacteria 1547
415 Ga0105243_10428274 3300009148 Bacteria 1236
416 Ga0105241_10006660 3300009174 Bacteria 8501
417 Ga0105241_10181648 3300009174 Bacteria 1746
418 Ga0105241_10350024 3300009174 Bacteria 1282
419 Ga0105241_10427289 3300009174 Bacteria 1167
420 Ga0105241_10725696 3300009174 Bacteria 909
421 Ga0105242_10002177 3300009176 Bacteria 15458
422 Ga0105242_10027348 3300009176 Bacteria 4527
423 Ga0105242_10294895 3300009176 Bacteria 1478
424 Ga0105248_10002945 3300009177 Bacteria 18879
425 Ga0105248_10012305 3300009177 Bacteria 9437
426 Ga0105248_10014996 3300009177 Bacteria 8532
427 Ga0105248_10074990 3300009177 Bacteria 3802
428 Ga0105248_10074998 3300009177 Bacteria 3801
429 Ga0105248_10097925 3300009177 Bacteria 3305
430 Ga0105237_10003304 3300009545 Bacteria 19235
431 Ga0105237_10063614 3300009545 Bacteria 3687
432 Ga0105237_10112977 3300009545 Bacteria 2708
433 Ga0105237_10208332 3300009545 Bacteria 1955
434 Ga0105237_10341732 3300009545 Bacteria 1501
435 Ga0105238_10066156 3300009551 Bacteria 3616
436 Ga0105238_10171734 3300009551 Bacteria 2144
437 Ga0105238_10282647 3300009551 Bacteria 1641
438 Ga0105238_10644735 3300009551 Unclassified 1069
439 Ga0105249_10006632 3300009553 Bacteria 10072
440 Ga0105249_10028570 3300009553 Bacteria 5034
441 Ga0105249_10032153 3300009553 Bacteria 4745
442 Ga0105249_10175965 3300009553 Bacteria 2078
443 Ga0099796_10005397 3300010159 Bacteria 3188
444 Ga0105239_10021993 3300010375 Bacteria 7030
445 Ga0105239_10032680 3300010375 Bacteria 5717
446 Ga0105239_10094993 3300010375 Bacteria 3293
447 Ga0105239_10132130 3300010375 Bacteria 2777
448 Ga0105239_10207875 3300010375 Bacteria 2193
449 Ga0105239_10329989 3300010375 Bacteria 1721
450 Ga0105246_10000463 3300011119 Bacteria 21809
451 Ga0105246_10033093 3300011119 Bacteria 3433
452 Ga0105246_10048040 3300011119 Bacteria 2917
453 Ga0105246_10399843 3300011119 Bacteria 1140
454 Ga0105246_10541243 3300011119 Bacteria 996
455 Ga0157313_1000926 3300012503 Bacteria 1471
456 Ga0157373_10015583 3300013100 Bacteria 5555
457 Ga0157371_10115937 3300013102 Bacteria 1903
458 Ga0157370_10173108 3300013104 Bacteria 2006
459 Ga0157370_10256887 3300013104 Bacteria 1615
460 Ga0157369_10427420 3300013105 Bacteria 1373
461 Ga0157374_10000614 3300013296 Bacteria 31520
462 Ga0157374_10065462 3300013296 Bacteria 3413
463 Ga0157374_10495888 3300013296 Bacteria 1225
464 Ga0157374_11165826 3300013296 Bacteria 791
465 Ga0157378_10000701 3300013297 Bacteria 31354
466 Ga0157378_10027642 3300013297 Bacteria 5003
467 Ga0157378_10154419 3300013297 Bacteria 2141
468 Ga0157378_10415059 3300013297 Bacteria 1329
469 Ga0157378_10472828 3300013297 Bacteria 1247
470 Ga0163162_10008098 3300013306 Bacteria 10258
471 Ga0163162_10108282 3300013306 Bacteria 2875
472 Ga0163162_10186391 3300013306 Bacteria 2202
473 Ga0163162_10458816 3300013306 Bacteria 1406
474 Ga0163162_10722294 3300013306 Bacteria 1117
475 Ga0157372_10016291 3300013307 Bacteria 7979
476 Ga0157372_10098111 3300013307 Bacteria 3342
477 Ga0157372_10140711 3300013307 Bacteria 2779
478 Ga0157372_10594965 3300013307 Bacteria 1289
479 Ga0157375_10005857 3300013308 Bacteria 10698
480 Ga0157375_10022311 3300013308 Bacteria 5825
481 Ga0163163_10004757 3300014325 Bacteria 11644
482 Ga0163163_10017614 3300014325 Bacteria 6668
483 Ga0163163_10053547 3300014325 Bacteria 3984
484 Ga0163163_10063537 3300014325 Bacteria 3661
485 Ga0163163_10135712 3300014325 Bacteria 2502
486 Ga0163163_10183790 3300014325 Bacteria 2138
487 Ga0163163_11085892 3300014325 Unclassified 863
488 Ga0157380_10001646 3300014326 Bacteria 14707
489 Ga0157380_10069598 3300014326 Bacteria 2840
490 Ga0157380_10165606 3300014326 Bacteria 1926
491 Ga0182008_10166078 3300014497 Bacteria 1113
492 Ga0157377_10000514 3300014745 Bacteria 16439
493 Ga0157379_10000792 3300014968 Bacteria 25616
494 Ga0157379_10010974 3300014968 Bacteria 7901
495 Ga0157379_10057501 3300014968 Bacteria 3475
496 Ga0157379_10072154 3300014968 Bacteria 3089
497 Ga0157379_10096732 3300014968 Bacteria 2650
498 Ga0157379_10293592 3300014968 Bacteria 1481
499 Ga0157379_10983242 3300014968 Bacteria 804
500 Ga0157376_10000352 3300014969 Bacteria 30620
501 Ga0157376_10063069 3300014969 Bacteria 3121
502 Ga0157376_10211676 3300014969 Bacteria 1790
503 Ga0157376_10511043 3300014969 Bacteria 1182
504 Ga0157376_10827550 3300014969 Bacteria 940
505 Ga0182005_1087240 3300015265 Bacteria 865
506 Ga0163161_10000956 3300017792 Bacteria 22176
507 Ga0163161_10079514 3300017792 Bacteria 2411
508 Ga0163161_10089657 3300017792 Bacteria 2274
509 Ga0163161_10143176 3300017792 Bacteria 1811
510 Ga0206353_10376412 3300020082 Bacteria 3399
511 Ga0207666_1000043 3300025271 Bacteria 24939
512 Ga0207673_1000044 3300025290 Bacteria 9940
513 Ga0209758_1000182 3300025297 Bacteria 140630
514 Ga0209758_1000293 3300025297 Bacteria 98643
515 Ga0209758_1019701 3300025297 Bacteria 3237
516 Ga0209758_1056344 3300025297 Bacteria 1328
517 Ga0207426_1007081 3300025302 Bacteria 4746
518 Ga0207426_1031401 3300025302 Bacteria 1733
519 Ga0209257_1000390 3300025304 Bacteria 87532
520 Ga0207697_10001136 3300025315 Bacteria 14657
521 Ga0207697_10012548 3300025315 Bacteria 3551
522 Ga0207656_10038144 3300025321 Bacteria 2025
523 Ga0207656_10077332 3300025321 Bacteria 1490
524 Ga0207655_1061275 3300025728 Unclassified 1453
525 Ga0207682_10000021 3300025893 Bacteria 63904
526 Ga0207682_10000660 3300025893 Bacteria 16114
527 Ga0207682_10203212 3300025893 Bacteria 912
528 Ga0207692_10002654 3300025898 Bacteria 6883
529 Ga0207692_10008133 3300025898 Bacteria 4330
530 Ga0207642_10000623 3300025899 Bacteria 10867
531 Ga0207642_10046441 3300025899 Bacteria 1935
532 Ga0207642_10100529 3300025899 Bacteria 1451
533 Ga0207642_10141871 3300025899 Bacteria 1268
534 Ga0207710_10001214 3300025900 Bacteria 13078
535 Ga0207710_10020661 3300025900 Bacteria 2817
536 Ga0207710_10025361 3300025900 Bacteria 2558
537 Ga0207688_10000949 3300025901 Bacteria 14704
538 Ga0207688_10002814 3300025901 Bacteria 9448
539 Ga0207688_10071997 3300025901 Bacteria 1963
540 Ga0207688_10131402 3300025901 Bacteria 1468
541 Ga0207688_10179547 3300025901 Bacteria 1262
542 Ga0207680_10003232 3300025903 Bacteria 7665
543 Ga0207680_10077406 3300025903 Bacteria 2080
544 Ga0207680_10110291 3300025903 Bacteria 1783
545 Ga0207680_10111466 3300025903 Bacteria 1775
546 Ga0207680_10131464 3300025903 Bacteria 1650
547 Ga0207647_10007234 3300025904 Bacteria 8037
548 Ga0207647_10011184 3300025904 Bacteria 6305
549 Ga0207647_10046289 3300025904 Bacteria 2711
550 Ga0207647_10122033 3300025904 Bacteria 1536
551 Ga0207685_10011541 3300025905 Bacteria 2660
552 Ga0207685_10045199 3300025905 Bacteria 1669
553 Ga0207685_10055572 3300025905 Bacteria 1546
554 Ga0207699_10020713 3300025906 Bacteria 3530
555 Ga0207699_10045331 3300025906 Bacteria 2566
556 Ga0207699_10152742 3300025906 Bacteria 1529
557 Ga0207645_10002488 3300025907 Bacteria 14456
558 Ga0207645_10002945 3300025907 Bacteria 13153
559 Ga0207645_10023617 3300025907 Bacteria 3992
560 Ga0207645_10045340 3300025907 Bacteria 2810
561 Ga0207645_10063944 3300025907 Bacteria 2351
562 Ga0207643_10000108 3300025908 Bacteria 56497
563 Ga0207643_10002845 3300025908 Bacteria 9348
564 Ga0207643_10014351 3300025908 Bacteria 4301
565 Ga0207684_10002963 3300025910 Bacteria 16822
566 Ga0207654_10002719 3300025911 Bacteria 8977
567 Ga0207654_10011794 3300025911 Bacteria 4463
568 Ga0207654_10235793 3300025911 Bacteria 1220
569 Ga0207707_10000691 3300025912 Bacteria 33408
570 Ga0207707_10040215 3300025912 Bacteria 4083
571 Ga0207707_10128051 3300025912 Bacteria 2220
572 Ga0207695_10039943 3300025913 Bacteria 5038
573 Ga0207671_10003167 3300025914 Bacteria 16626
574 Ga0207671_10086869 3300025914 Bacteria 2351
575 Ga0207671_10100478 3300025914 Bacteria 2190
576 Ga0207671_10295710 3300025914 Bacteria 1279
577 Ga0207693_10000825 3300025915 Bacteria 27536
578 Ga0207693_10007085 3300025915 Bacteria 9254
579 Ga0207693_10009090 3300025915 Bacteria 8110
580 Ga0207693_10021699 3300025915 Bacteria 5104
581 Ga0207693_10115971 3300025915 Bacteria 2103
582 Ga0207693_10147296 3300025915 Bacteria 1851
583 Ga0207693_10203547 3300025915 Bacteria 1556
584 Ga0207663_10022199 3300025916 Bacteria 3625
585 Ga0207660_10000014 3300025917 Bacteria 79328
586 Ga0207660_10293877 3300025917 Bacteria 1292
587 Ga0207662_10006062 3300025918 Bacteria 6501
588 Ga0207662_10008927 3300025918 Bacteria 5499
589 Ga0207662_10019625 3300025918 Bacteria 3850
590 Ga0207662_10096544 3300025918 Bacteria 1826
591 Ga0207662_10202160 3300025918 Bacteria 1286
592 Ga0207662_10231465 3300025918 Bacteria 1207
593 Ga0207657_10037081 3300025919 Bacteria 4359
594 Ga0207657_10046349 3300025919 Bacteria 3808
595 Ga0207657_10046352 3300025919 Bacteria 3808
596 Ga0207657_10077327 3300025919 Bacteria 2805
597 Ga0207657_10228097 3300025919 Bacteria 1490
598 Ga0207649_10000086 3300025920 Bacteria 79546
599 Ga0207649_10043035 3300025920 Bacteria 2758
600 Ga0207649_10076337 3300025920 Bacteria 2156
601 Ga0207649_10086928 3300025920 Bacteria 2038
602 Ga0207652_10000255 3300025921 Bacteria 55415
603 Ga0207652_10044044 3300025921 Bacteria 3801
604 Ga0207652_10161000 3300025921 Bacteria 2012
605 Ga0207652_10398264 3300025921 Bacteria 1242
606 Ga0207681_10000024 3300025923 Bacteria 206607
607 Ga0207694_10361708 3300025924 Bacteria 1203
608 Ga0207650_10002572 3300025925 Bacteria 12563
609 Ga0207650_10012030 3300025925 Bacteria 5965
610 Ga0207650_10119105 3300025925 Bacteria 2053
611 Ga0207650_10140734 3300025925 Bacteria 1897
612 Ga0207650_10174839 3300025925 Bacteria 1708
613 Ga0207650_10414781 3300025925 Bacteria 1116
614 Ga0207659_10000034 3300025926 Bacteria 108227
615 Ga0207659_10018147 3300025926 Bacteria 4608
616 Ga0207659_10047389 3300025926 Bacteria 3040
617 Ga0207687_10000110 3300025927 Bacteria 58672
618 Ga0207687_10008628 3300025927 Bacteria 6663
619 Ga0207687_10119758 3300025927 Bacteria 1967
620 Ga0207700_10035453 3300025928 Bacteria 3594
621 Ga0207700_10068719 3300025928 Bacteria 2716
622 Ga0207700_10090236 3300025928 Bacteria 2418
623 Ga0207700_10133338 3300025928 Bacteria 2031
624 Ga0207700_10151584 3300025928 Bacteria 1916
625 Ga0207700_10303672 3300025928 Bacteria 1379
626 Ga0207700_10324076 3300025928 Bacteria 1336
627 Ga0207664_10007232 3300025929 Bacteria 7689
628 Ga0207664_10023737 3300025929 Bacteria 4599
629 Ga0207664_10027533 3300025929 Bacteria 4310
630 Ga0207644_10000642 3300025931 Bacteria 22154
631 Ga0207644_10003006 3300025931 Bacteria 10851
632 Ga0207644_10047247 3300025931 Bacteria 3070
633 Ga0207644_10112084 3300025931 Bacteria 2064
634 Ga0207690_10000270 3300025932 Bacteria 36976
635 Ga0207690_10022682 3300025932 Bacteria 3907
636 Ga0207690_10051466 3300025932 Bacteria 2754
637 Ga0207690_10168676 3300025932 Bacteria 1638
638 Ga0207690_10189827 3300025932 Bacteria 1553
639 Ga0207706_10001336 3300025933 Bacteria 24661
640 Ga0207706_10005854 3300025933 Bacteria 11434
641 Ga0207706_10007295 3300025933 Bacteria 10222
642 Ga0207706_10007337 3300025933 Bacteria 10195
643 Ga0207706_10108352 3300025933 Bacteria 2445
644 Ga0207706_10109295 3300025933 Bacteria 2433
645 Ga0207706_10341353 3300025933 Bacteria 1303
646 Ga0207706_10403529 3300025933 Bacteria 1185
647 Ga0207706_10479894 3300025933 Bacteria 1074
648 Ga0207686_10000214 3300025934 Bacteria 44245
649 Ga0207686_10044726 3300025934 Bacteria 2721
650 Ga0207686_10275477 3300025934 Bacteria 1240
651 Ga0207709_10000344 3300025935 Bacteria 48058
652 Ga0207709_10003540 3300025935 Bacteria 9237
653 Ga0207709_10165987 3300025935 Bacteria 1545
654 Ga0207670_10000461 3300025936 Bacteria 22671
655 Ga0207670_10002631 3300025936 Bacteria 9445
656 Ga0207670_10111337 3300025936 Bacteria 1973
657 Ga0207670_10151846 3300025936 Bacteria 1720
658 Ga0207670_10243822 3300025936 Unclassified 1386
659 Ga0207669_10000295 3300025937 Bacteria 22936
660 Ga0207669_10001111 3300025937 Bacteria 11514
661 Ga0207669_10029074 3300025937 Bacteria 3051
662 Ga0207704_10000343 3300025938 Bacteria 21644
663 Ga0207704_10052137 3300025938 Bacteria 2478
664 Ga0207704_10060299 3300025938 Bacteria 2347
665 Ga0207665_10001068 3300025939 Bacteria 18420
666 Ga0207665_10003817 3300025939 Bacteria 10071
667 Ga0207665_10109985 3300025939 Bacteria 1935
668 Ga0207665_10129375 3300025939 Bacteria 1790
669 Ga0207691_10000635 3300025940 Bacteria 34764
670 Ga0207691_10003768 3300025940 Bacteria 14723
671 Ga0207691_10012880 3300025940 Bacteria 8006
672 Ga0207711_10007313 3300025941 Bacteria 9244
673 Ga0207711_10093487 3300025941 Bacteria 2649
674 Ga0207711_10186767 3300025941 Bacteria 1887
675 Ga0207711_10223596 3300025941 Bacteria 1723
676 Ga0207689_10002655 3300025942 Bacteria 16537
677 Ga0207689_10003641 3300025942 Bacteria 14070
678 Ga0207689_10024648 3300025942 Bacteria 5045
679 Ga0207689_10043531 3300025942 Bacteria 3711
680 Ga0207689_10213810 3300025942 Bacteria 1593
681 Ga0207661_10000036 3300025944 Bacteria 149720
682 Ga0207661_10135662 3300025944 Bacteria 2113
683 Ga0207661_10672300 3300025944 Bacteria 952
684 Ga0207679_10000025 3300025945 Bacteria 203699
685 Ga0207679_10014282 3300025945 Bacteria 5216
686 Ga0207679_10082518 3300025945 Bacteria 2461
687 Ga0207679_10374527 3300025945 Bacteria 1247
688 Ga0207679_10556082 3300025945 Bacteria 1030
689 Ga0207679_10823092 3300025945 Bacteria 847
690 Ga0207667_10007960 3300025949 Bacteria 12642
691 Ga0207667_10463367 3300025949 Bacteria 1287
692 Ga0207651_10000028 3300025960 Bacteria 68962
693 Ga0207651_10013440 3300025960 Bacteria 4686
694 Ga0207651_10053292 3300025960 Bacteria 2764
695 Ga0207651_10153312 3300025960 Bacteria 1797
696 Ga0207651_10224029 3300025960 Bacteria 1522
697 Ga0207651_10441443 3300025960 Bacteria 1115
698 Ga0207712_10000558 3300025961 Bacteria 30161
699 Ga0207712_10002399 3300025961 Bacteria 12137
700 Ga0207712_10089239 3300025961 Bacteria 2266
701 Ga0207712_10372855 3300025961 Bacteria 1192
702 Ga0207668_10000538 3300025972 Bacteria 23787
703 Ga0207668_10013637 3300025972 Bacteria 5013
704 Ga0207668_10031104 3300025972 Bacteria 3512
705 Ga0207640_10006541 3300025981 Bacteria 6398
706 Ga0207640_10041977 3300025981 Bacteria 2913
707 Ga0207640_10043342 3300025981 Bacteria 2875
708 Ga0207640_10170042 3300025981 Bacteria 1623
709 Ga0207640_10691598 3300025981 Bacteria 873
710 Ga0207640_10804095 3300025981 Bacteria 815
711 Ga0207658_10000795 3300025986 Bacteria 26521
712 Ga0207658_10046077 3300025986 Bacteria 3182
713 Ga0207658_10197400 3300025986 Bacteria 1677
714 Ga0207658_10370139 3300025986 Bacteria 1252
715 Ga0207677_10001822 3300026023 Bacteria 11259
716 Ga0207677_10015703 3300026023 Bacteria 4463
717 Ga0207677_10043555 3300026023 Bacteria 2985
718 Ga0207677_10099423 3300026023 Bacteria 2136
719 Ga0207703_10008768 3300026035 Bacteria 7975
720 Ga0207703_10012768 3300026035 Bacteria 6549
721 Ga0207703_10041098 3300026035 Bacteria 3703
722 Ga0207703_10401509 3300026035 Bacteria 1272
723 Ga0207703_10556570 3300026035 Bacteria 1082
724 Ga0207703_11072959 3300026035 Bacteria 773
725 Ga0207639_10000925 3300026041 Bacteria 19873
726 Ga0207639_10018222 3300026041 Bacteria 4986
727 Ga0207639_10045906 3300026041 Bacteria 3293
728 Ga0207639_10238405 3300026041 Bacteria 1580
729 Ga0207639_10276924 3300026041 Bacteria 1474
730 Ga0207639_10316368 3300026041 Bacteria 1385
731 Ga0207678_10003256 3300026067 Bacteria 14657
732 Ga0207678_10004902 3300026067 Bacteria 12024
733 Ga0207678_10006940 3300026067 Bacteria 10052
734 Ga0207678_10010341 3300026067 Bacteria 8190
735 Ga0207678_10016580 3300026067 Bacteria 6470
736 Ga0207678_10248247 3300026067 Bacteria 1524
737 Ga0207708_10004521 3300026075 Bacteria 10234
738 Ga0207708_10019050 3300026075 Bacteria 5168
739 Ga0207708_10037218 3300026075 Bacteria 3707
740 Ga0207702_10004638 3300026078 Bacteria 12166
741 Ga0207702_10065787 3300026078 Bacteria 3105
742 Ga0207702_10069314 3300026078 Bacteria 3032
743 Ga0207702_10073820 3300026078 Bacteria 2942
744 Ga0207641_10001294 3300026088 Bacteria 24893
745 Ga0207648_10003105 3300026089 Bacteria 17542
746 Ga0207648_10004307 3300026089 Bacteria 14659
747 Ga0207648_10011750 3300026089 Bacteria 8232
748 Ga0207648_10076986 3300026089 Bacteria 2908
749 Ga0207648_10553353 3300026089 Bacteria 1057
750 Ga0207676_10000640 3300026095 Bacteria 28116
751 Ga0207676_10024382 3300026095 Bacteria 4475
752 Ga0207676_10042058 3300026095 Bacteria 3513
753 Ga0207676_10313281 3300026095 Bacteria 1437
754 Ga0207674_10005795 3300026116 Bacteria 14657
755 Ga0207674_10074975 3300026116 Bacteria 3394
756 Ga0207674_10104935 3300026116 Bacteria 2804
757 Ga0207674_10253632 3300026116 Bacteria 1706
758 Ga0207674_10489740 3300026116 Bacteria 1188
759 Ga0207675_100003849 3300026118 Bacteria 14589
760 Ga0207675_100004255 3300026118 Bacteria 13848
761 Ga0207683_10000001 3300026121 Bacteria 352047
762 Ga0207683_10004806 3300026121 Bacteria 11633
763 Ga0207683_10007077 3300026121 Bacteria 9617
764 Ga0207683_10023723 3300026121 Bacteria 5278
765 Ga0207683_10044817 3300026121 Bacteria 3867
766 Ga0207698_10014590 3300026142 Bacteria 5230
767 Ga0207698_10026697 3300026142 Bacteria 4088
768 Ga0207698_10127971 3300026142 Bacteria 2164
769 Ga0207698_10291971 3300026142 Bacteria 1513
770 Ga0207698_10458495 3300026142 Bacteria 1232
771 Ga0207698_10996118 3300026142 Bacteria 848
772 Ga0209995_1017210 3300027471 Bacteria 1189
773 Ga0209179_1029153 3300027512 Bacteria 1122
774 Ga0209968_1030175 3300027526 Bacteria 905
775 Ga0209982_1002600 3300027552 Bacteria 2541
776 Ga0209970_1012282 3300027614 Bacteria 1415
777 Ga0210002_1001810 3300027617 Bacteria 3044
778 Ga0209983_1035560 3300027665 Bacteria 1069
779 Ga0209971_1037950 3300027682 Bacteria 1160
780 Ga0209966_1001479 3300027695 Bacteria 4079
781 Ga0209966_1001617 3300027695 Bacteria 3849
782 Ga0209998_10001115 3300027717 Bacteria 6677
783 Ga0209998_10001190 3300027717 Bacteria 6421
784 Ga0209813_10001830 3300027866 Bacteria 4791
785 Ga0209974_10000991 3300027876 Bacteria 9982
786 Ga0209974_10123482 3300027876 Bacteria 919
787 Ga0207428_10000823 3300027907 Bacteria 34987
788 Ga0207428_10001512 3300027907 Bacteria 24323
789 Ga0207428_10105356 3300027907 Bacteria 2175
790 Ga0265357_1001253 3300028023 Bacteria 1813
791 Ga0268266_10026518 3300028379 Bacteria 4930
792 Ga0268266_10135900 3300028379 Bacteria 2202
793 Ga0268266_10153292 3300028379 Bacteria 2079
794 Ga0268266_10167713 3300028379 Bacteria 1991
795 Ga0268266_10311633 3300028379 Bacteria 1471
796 Ga0268265_10001288 3300028380 Bacteria 21569
797 Ga0268265_10086490 3300028380 Bacteria 2491
798 Ga0268265_10555025 3300028380 Bacteria 1091
799 Ga0268264_10000456 3300028381 Bacteria 55761
800 Ga0268264_10005325 3300028381 Bacteria 10898
801 Ga0268264_10074026 3300028381 Bacteria 2892
802 Ga0268264_10128105 3300028381 Bacteria 2246
803 Ga0268264_10354635 3300028381 Bacteria 1397
804 Ga0268264_10559966 3300028381 Bacteria 1122
805 Ga0265318_10004032 3300028577 Bacteria 7212
806 Ga0265330_10007771 3300031235 Bacteria 5206
807 Ga0265330_10053496 3300031235 Bacteria 1767
808 Ga0265332_10012389 3300031238 Bacteria 3785
809 Ga0265320_10018493 3300031240 Bacteria 3834
810 Ga0265325_10004992 3300031241 Bacteria 8267
811 Ga0265329_10012587 3300031242 Bacteria 3036
812 Ga0265340_10004865 3300031247 Bacteria 7472
813 Ga0265340_10020868 3300031247 Bacteria 3362
814 Ga0265339_10004645 3300031249 Bacteria 9336
815 Ga0265339_10013807 3300031249 Bacteria 4887
816 Ga0265331_10012924 3300031250 Bacteria 4501
817 Ga0265331_10051231 3300031250 Bacteria 1976
818 Ga0265316_10025046 3300031344 Bacteria 4984
819 Ga0265316_10070106 3300031344 Bacteria 2704
820 Ga0265316_10129850 3300031344 Bacteria 1898
821 Ga0307513_10115927 3300031456 Bacteria 2660
822 Ga0265313_10022841 3300031595 Bacteria 3383
823 Ga0265314_10008306 3300031711 Bacteria 8906
824 Ga0265342_10000092 3300031712 Bacteria 99040
825 Ga0265342_10014308 3300031712 Bacteria 5271
826 Ga0307410_10730951 3300031852 Bacteria 837
827 Ga0316583_10000594 3300032133 Bacteria 10995
828 Ga0307510_10192420 3300033180 Bacteria 1586
829 Ga0373930_0000196 3300034816 Bacteria 7356
830 Ga0373948_0000861 3300034817 Bacteria 4040
831 Ga0373948_0001041 3300034817 Bacteria 3733
832 Ga0373948_0001761 3300034817 Bacteria 3079
833 Ga0373950_0000297 3300034818 Bacteria 6238
834 Ga0373950_0005679 3300034818 Bacteria 1872
835 Ga0373958_0002061 3300034819 Bacteria 2777
836 Ga0373958_0006709 3300034819 Bacteria 1806
837 Ga0373958_0008200 3300034819 Bacteria 1686
838 Ga0373959_0001177 3300034820 Bacteria 4225
839 Ga0373959_0002292 3300034820 Bacteria 3042
840 Ga0373938_0000046 3300034957 Bacteria 16304
841 Ga0373938_0002402 3300034957 Bacteria 3017
842 Ga0373938_0020342 3300034957 Bacteria 1336
843 Ga0373926_0021975 3300035083 Bacteria 2212
844 Ga0373926_0046822 3300035083 Bacteria 1552
845 Ga0373928_0001726 3300035084 Bacteria 4244
846 Ga0373928_0046076 3300035084 Unclassified 1016
847 Ga0373929_0000284 3300035085 Bacteria 9427
848 Ga0373929_0002711 3300035085 Bacteria 3232
849 Ga0373934_0022290 3300035086 Bacteria 2443
850 Ga0373934_0076615 3300035086 Bacteria 1341
851 Ga0373940_0001045 3300035088 Bacteria 4772
852 Ga0373940_0001289 3300035088 Bacteria 4460
853 Ga0373944_0003559 3300035089 Bacteria 4028
854 Ga0373944_0005088 3300035089 Bacteria 3453
855 Ga0373944_0040433 3300035089 Bacteria 1439
856 Ga0373949_0000546 3300035090 Bacteria 12423
857 Ga0373949_0001599 3300035090 Bacteria 6378
858 Ga0373949_0024744 3300035090 Bacteria 1397
859 Ga0373951_0000608 3300035091 Bacteria 9852
860 Ga0373951_0001694 3300035091 Bacteria 5757
861 Ga0373951_0020605 3300035091 Bacteria 1510
862 Ga0373952_0000574 3300035092 Bacteria 6477
863 Ga0373952_0004003 3300035092 Bacteria 2662
864 Ga0373923_0016264 3300035111 Bacteria 2823
865 Ga0373923_0066038 3300035111 Bacteria 1545
866 Ga0373923_0094372 3300035111 Bacteria 1312
867 Ga0373932_0000577 3300035112 Bacteria 11181
868 Ga0373932_0001670 3300035112 Bacteria 6058
869 Ga0373932_0011388 3300035112 Bacteria 2172
870 Ga0373936_0005473 3300035113 Bacteria 4790
871 Ga0373936_0122148 3300035113 Bacteria 1113
872 Ga0373939_0000691 3300035114 Bacteria 8369
873 Ga0373939_0001452 3300035114 Bacteria 5734
874 Ga0373939_0002354 3300035114 Bacteria 4469
875 Ga0373941_0003673 3300035115 Bacteria 3493
876 Ga0373941_0007450 3300035115 Bacteria 2677
877 Ga0373945_0021266 3300035116 Bacteria 2228
878 Ga0373945_0021839 3300035116 Bacteria 2202
879 Ga0373945_0036414 3300035116 Bacteria 1763
880 Ga0373945_0095753 3300035116 Bacteria 1155
881 Ga0373945_0134297 3300035116 Bacteria 994
882 Ga0373953_0007986 3300035117 Bacteria 3573
883 Ga0373953_0014564 3300035117 Bacteria 2832
884 Ga0373953_0105645 3300035117 Bacteria 1188
885 Ga0373954_0004076 3300035118 Bacteria 6261
886 Ga0373954_0128019 3300035118 Bacteria 1235
887 Ga0373956_0001739 3300035119 Bacteria 8964
888 Ga0373956_0001917 3300035119 Bacteria 8598
889 Ga0373956_0024511 3300035119 Bacteria 2600
890 Ga0373957_0006573 3300035120 Bacteria 3671
891 Ga0373957_0006843 3300035120 Bacteria 3614
892 Ga0373960_0000587 3300035121 Bacteria 7449
893 Ga0373960_0011868 3300035121 Bacteria 2155
894 Ga0373960_0058946 3300035121 Unclassified 1159
895 Ga0373943_0002330 3300035170 Bacteria 8635
896 Ga0373943_0011524 3300035170 Bacteria 3979
897 Ga0373943_0084121 3300035170 Bacteria 1636
898 Ga0373946_0008539 3300035171 Bacteria 3759
899 Ga0373946_0011321 3300035171 Bacteria 3325
900 Ga0373946_0036676 3300035171 Bacteria 1989
901 Ga0373955_0001883 3300035172 Bacteria 9050
902 Ga0373955_0021582 3300035172 Bacteria 3253
903 Ga0373955_0150546 3300035172 Bacteria 1369
904 Ga0373955_0416613 3300035172 Bacteria 817
905 Ga0373955_0440854 3300035172 Bacteria 793
906 Ga0373942_0001465 3300035207 Bacteria 6062
907 Ga0373942_0004097 3300035207 Bacteria 3396
908 Ga0373942_0010473 3300035207 Bacteria 2182
909 Ga0373961_0000385 3300035241 Bacteria 18617
910 Ga0373961_0000869 3300035241 Bacteria 10181
911 Ga0373961_0051776 3300035241 Bacteria 1220
912 Ga0373961_0054494 3300035241 Bacteria 1196
913 Ga0373962_0003613 3300035242 Bacteria 3718
914 Ga0373962_0006217 3300035242 Bacteria 2888
915 Ga0373962_0062480 3300035242 Bacteria 1096
916 Ga0373962_0073279 3300035242 Bacteria 1027
917 Ga0373924_0223256 3300035410 Bacteria 832
918 Ga0373931_0001882 3300035691 Bacteria 9166
919 Ga0373931_0003354 3300035691 Bacteria 7175
920 Ga0373931_0012617 3300035691 Bacteria 4097
921 Ga0373935_0002676 3300035692 Bacteria 10246
922 Ga0373935_0257719 3300035692 Bacteria 1222
923 Ga0373927_0010750 3300035695 Bacteria 6096
924 Ga0373927_0122790 3300035695 Bacteria 1695
925 Ga0373927_0179285 3300035695 Bacteria 1389
926 Ga0373933_0000125 3300035724 Bacteria 49268
927 Ga0373933_0002112 3300035724 Bacteria 11410
928 Ga0373933_0010711 3300035724 Bacteria 5029
929 Ga0373933_0017319 3300035724 Bacteria 4041
930 Ga0373947_0001553 3300035725 Bacteria 14063
931 Ga0373947_0080026 3300035725 Bacteria 2020
932 Ga0373947_0170067 3300035725 Bacteria 1414
933 Ga0373947_0436927 3300035725 Bacteria 885
934 Ga0373937_0002048 3300036401 Bacteria 16856
935 Ga0373937_0188820 3300036401 Bacteria 1936
936 Ga0373937_0223998 3300036401 Bacteria 1770
937 Ga0373937_0511460 3300036401 Bacteria 1141
938 Ga0373925_0008896 3300037068 Bacteria 7316
939 Ga0373925_0033160 3300037068 Bacteria 3806
940 Ga0373925_0125619 3300037068 Bacteria 1995
941 Ga0373925_0256122 3300037068 Bacteria 1405
942 Ga0373925_0640801 3300037068 Bacteria 875
943 Ga0395899_0097748 3300037312 Bacteria 2122
944 Ga0395900_0003627 3300037418 Bacteria 16600
945 Ga0395898_0174352 3300037466 Bacteria 2055
946 Ga0395898_0931075 3300037466 Bacteria 806
947 Ga0395905_0014986 3300037471 Bacteria 7393
948 Ga0436364_0794080 3300037853 Bacteria 1792
949 Ga0395901_0040521 3300038443 Bacteria 4825
950 Ga0395901_0048746 3300038443 Bacteria 4399
951 Ga0395901_0152787 3300038443 Bacteria 2425
952 Ga0242420_015440 3300038996 Unclassified 1320
953 Ga0436365_0657686 3300039437 Bacteria 27042
954 Ga0436365_1898637 3300039437 Bacteria 5776
955 Ga0436361_0256491 3300039447 Bacteria 1036
956 Ga0436361_0950726 3300039447 Bacteria 11725
957 Ga0436362_0287115 3300039453 Bacteria 1021
958 Ga0436362_1090515 3300039453 Bacteria 1191
959 Ga0439453_0001852 3300041408 Bacteria 2812
960 Ga0439435_0015895 3300042436 Bacteria 1879
961 Ga0439464_0021214 3300042439 Bacteria 1783
962 Ga0451577_0297987 3300042876 Bacteria 1461
963 Ga0466972_0052403 3300044658 Bacteria 1967
964 Ga0466965_0052201 3300044683 Bacteria 2030
965 Ga0466965_0148285 3300044683 Bacteria 1225
966 Ga0466965_0205969 3300044683 Bacteria 1045
967 Ga0466963_0009295 3300044694 Bacteria 5920
968 Ga0466968_0059735 3300044735 Bacteria 1642
969 Ga0466968_0078596 3300044735 Bacteria 1446
970 Ga0466960_0126038 3300044901 Bacteria 1346
971 Ga0466959_0433853 3300045049 Bacteria 891
972 Ga0451576_0021183 3300045051 Bacteria 7067
973 Ga0466967_0076147 3300045976 Bacteria 3017
974 Ga0495617_076952 3300046452 Bacteria 1094
975 Ga0495592_0004699 3300046454 Bacteria 10018
976 Ga0495592_0014796 3300046454 Bacteria 5923
977 Ga0495592_0041714 3300046454 Bacteria 3439
978 Ga0495592_0156492 3300046454 Bacteria 1571
979 Ga0495592_0192099 3300046454 Bacteria 1383
980 Ga0495603_0025855 3300046455 Bacteria 3548
981 Ga0495603_0082710 3300046455 Bacteria 1880
982 Ga0495629_0003044 3300046459 Bacteria 12743
983 Ga0495629_0014934 3300046459 Bacteria 5580
984 Ga0495629_0142612 3300046459 Bacteria 1666
985 Ga0495629_0157088 3300046459 Bacteria 1580
986 Ga0495629_0188613 3300046459 Bacteria 1427
987 Ga0495638_0046393 3300046460 Bacteria 2729
988 Ga0495641_0016811 3300046461 Bacteria 3839
989 Ga0495641_0036035 3300046461 Bacteria 2327
990 Ga0495641_0084391 3300046461 Bacteria 1422
991 Ga0495651_0002035 3300046462 Bacteria 15618
992 Ga0495651_0010719 3300046462 Bacteria 7049
993 Ga0495651_0036349 3300046462 Bacteria 3835
994 Ga0495651_0098800 3300046462 Bacteria 2177
995 Ga0495651_0164118 3300046462 Bacteria 1588
996 Ga0495653_0035187 3300046463 Bacteria 3954
997 Ga0495653_0065475 3300046463 Bacteria 2735
998 Ga0495653_0089810 3300046463 Bacteria 2250
999 Ga0495653_0223012 3300046463 Bacteria 1266
1000 Ga0495653_0359077 3300046463 Bacteria 935
1001 Ga0495580_0152763 3300046472 Bacteria 1599
1002 Ga0495580_0199102 3300046472 Bacteria 1380
1003 Ga0495582_0003239 3300046473 Bacteria 9143
1004 Ga0495582_0028856 3300046473 Bacteria 3046
1005 Ga0495582_0084807 3300046473 Bacteria 1761
1006 Ga0495582_0104126 3300046473 Bacteria 1590
1007 Ga0495605_0035609 3300046474 Bacteria 2515
1008 Ga0495639_0121074 3300046475 Bacteria 1248
1009 Ga0495662_0048090 3300046476 Bacteria 2059
1010 Ga0495662_0107218 3300046476 Bacteria 1368
1011 Ga0495664_0016212 3300046477 Bacteria 4244
1012 Ga0495664_0030072 3300046477 Bacteria 3180
1013 Ga0495664_0101108 3300046477 Bacteria 1737
1014 Ga0495664_0110833 3300046477 Bacteria 1656
1015 Ga0495584_0007023 3300046491 Bacteria 5881
1016 Ga0495584_0018261 3300046491 Bacteria 3566
1017 Ga0495584_0111683 3300046491 Bacteria 1383
1018 Ga0495584_0177029 3300046491 Bacteria 1084
1019 Ga0495585_0000856 3300046492 Bacteria 26041
1020 Ga0495585_0007417 3300046492 Bacteria 6716
1021 Ga0495585_0028456 3300046492 Bacteria 3188
1022 Ga0495585_0111422 3300046492 Bacteria 1455
1023 Ga0495594_0008038 3300046499 Bacteria 5424
1024 Ga0495594_0011796 3300046499 Bacteria 4544
1025 Ga0495594_0096793 3300046499 Bacteria 1658
1026 Ga0495594_0110433 3300046499 Bacteria 1550
1027 Ga0495607_0027202 3300046501 Bacteria 3540
1028 Ga0495607_0195196 3300046501 Bacteria 1006
1029 Ga0495606_0009508 3300046507 Bacteria 8211
1030 Ga0495606_0134135 3300046507 Bacteria 1468
1031 Ga0495608_0000915 3300046511 Bacteria 20676
1032 Ga0495608_0050572 3300046511 Bacteria 2757
1033 Ga0495608_0058533 3300046511 Bacteria 2540
1034 Ga0495608_0066508 3300046511 Bacteria 2359
1035 Ga0495608_0076902 3300046511 Bacteria 2173
1036 Ga0495610_0053992 3300046512 Bacteria 1943
1037 Ga0495618_0052960 3300046514 Bacteria 2566
1038 Ga0495628_0008958 3300046516 Bacteria 8558
1039 Ga0495628_0032827 3300046516 Bacteria 4187
1040 Ga0495628_0082672 3300046516 Bacteria 2494
1041 Ga0495628_0112489 3300046516 Bacteria 2093
1042 Ga0495628_0184642 3300046516 Bacteria 1576
1043 Ga0495630_0126393 3300046517 Bacteria 1940
1044 Ga0495630_0130219 3300046517 Bacteria 1911
1045 Ga0495630_0238275 3300046517 Bacteria 1390
1046 Ga0495630_0541043 3300046517 Bacteria 893
1047 Ga0495630_0659536 3300046517 Bacteria 801
1048 Ga0495630_1022742 3300046517 Bacteria 628
1049 Ga0495631_0094340 3300046518 Bacteria 1288
1050 Ga0495637_0044734 3300046520 Bacteria 1883
1051 Ga0495637_0113199 3300046520 Bacteria 1050
1052 Ga0495644_0011268 3300046523 Bacteria 3444
1053 Ga0495644_0033593 3300046523 Bacteria 1937
1054 Ga0495648_0002380 3300046524 Bacteria 17465
1055 Ga0495663_0021146 3300046525 Bacteria 1873
1056 Ga0495666_0014396 3300046526 Bacteria 3938
1057 Ga0495666_0018752 3300046526 Bacteria 3437
1058 Ga0495666_0136415 3300046526 Bacteria 1145
1059 Ga0495642_0167641 3300046528 Bacteria 954
1060 Ga0495652_0005789 3300046529 Bacteria 11570
1061 Ga0495652_0020937 3300046529 Bacteria 5812
1062 Ga0495652_0063623 3300046529 Bacteria 3105
1063 Ga0495652_0076458 3300046529 Bacteria 2777
1064 Ga0495652_0261233 3300046529 Bacteria 1278
1065 Ga0495652_0352001 3300046529 Bacteria 1055
1066 Ga0495665_0061258 3300046531 Bacteria 1987
1067 Ga0495665_0082559 3300046531 Bacteria 1690
1068 Ga0495665_0097718 3300046531 Bacteria 1541
1069 Ga0495640_0071044 3300046533 Bacteria 2336
1070 Ga0495640_0101573 3300046533 Bacteria 1887
1071 Ga0495640_0209888 3300046533 Bacteria 1231
1072 Ga0495640_0348910 3300046533 Bacteria 914
1073 Ga0495640_0486745 3300046533 Bacteria 751
1074 Ga0495586_0075875 3300046535 Bacteria 1841
1075 Ga0495587_0001734 3300046536 Bacteria 14559
1076 Ga0495587_0018262 3300046536 Bacteria 4351
1077 Ga0495587_0076892 3300046536 Bacteria 1938
1078 Ga0495587_0116350 3300046536 Bacteria 1533
1079 Ga0495598_0000233 3300046537 Bacteria 9950
1080 Ga0495598_0020531 3300046537 Bacteria 1745
1081 Ga0495609_0039144 3300046538 Bacteria 2135
1082 Ga0495621_0008367 3300046539 Bacteria 3100
1083 Ga0495621_0050241 3300046539 Bacteria 1490
1084 Ga0495621_0091691 3300046539 Bacteria 1146
1085 Ga0495645_0011672 3300046543 Bacteria 6184
1086 Ga0495645_0086453 3300046543 Bacteria 2244
1087 Ga0495622_0024440 3300046557 Bacteria 2821
1088 Ga0495622_0141676 3300046557 Bacteria 1091
1089 Ga0495633_0017034 3300046558 Bacteria 3727
1090 Ga0495667_0000259 3300046559 Bacteria 34280
1091 Ga0495667_0018366 3300046559 Bacteria 4723
1092 Ga0495667_0070601 3300046559 Bacteria 2278
1093 Ga0495656_0000215 3300046615 Bacteria 20636
1094 Ga0495668_0039909 3300046616 Bacteria 2620
1095 Ga0495668_0046683 3300046616 Bacteria 2406
1096 Ga0495634_0008814 3300046642 Bacteria 7480
1097 Ga0495634_0180235 3300046642 Bacteria 1323
1098 Ga0495611_0003842 3300046648 Bacteria 6552
1099 Ga0495611_0078575 3300046648 Bacteria 1515
1100 Ga0495611_0277951 3300046648 Bacteria 774
1101 Ga0495625_0017744 3300046660 Bacteria 5567
1102 Ga0495635_0010301 3300046663 Bacteria 6538
1103 Ga0495635_0015969 3300046663 Bacteria 5243
1104 Ga0495635_0026638 3300046663 Bacteria 4021
1105 Ga0495635_0445479 3300046663 Bacteria 856
1106 Ga0495635_0523152 3300046663 Bacteria 779
1107 Ga0495659_0002574 3300046664 Bacteria 5848
1108 Ga0495659_0054558 3300046664 Bacteria 1462
1109 Ga0495661_0063130 3300046665 Bacteria 2191
1110 Ga0495661_0222522 3300046665 Bacteria 977
1111 Ga0495588_0020179 3300046674 Bacteria 3272
1112 Ga0495588_0131939 3300046674 Bacteria 1318
1113 Ga0495588_0243427 3300046674 Bacteria 948
1114 Ga0495657_0015814 3300046675 Bacteria 5511
1115 Ga0495657_0091756 3300046675 Bacteria 1947
1116 Ga0495599_0002681 3300046678 Bacteria 10394
1117 Ga0495599_0017056 3300046678 Bacteria 4512
1118 Ga0495599_0042653 3300046678 Bacteria 2847
1119 Ga0495599_0115730 3300046678 Bacteria 1668
1120 Ga0495623_0020755 3300046679 Bacteria 4245
1121 Ga0495623_0064743 3300046679 Bacteria 2287
1122 Ga0495623_0132012 3300046679 Bacteria 1494
1123 Ga0495646_0010194 3300046680 Bacteria 5975
1124 Ga0495646_0026632 3300046680 Bacteria 3629
1125 Ga0495646_0059772 3300046680 Bacteria 2275
1126 Ga0495647_0020437 3300046681 Bacteria 2376
1127 Ga0495658_0000360 3300046683 Bacteria 25675
1128 Ga0495658_0005781 3300046683 Bacteria 6071
1129 Ga0495658_0094433 3300046683 Bacteria 1776
1130 Ga0495613_0006693 3300046689 Bacteria 8606
1131 Ga0495613_0027827 3300046689 Bacteria 4207
1132 Ga0495613_0033307 3300046689 Bacteria 3829
1133 Ga0495613_0065362 3300046689 Bacteria 2658
1134 Ga0495613_0207131 3300046689 Bacteria 1380
1135 Ga0495624_0155778 3300046690 Bacteria 1396
1136 Ga0495624_0227022 3300046690 Bacteria 1131
1137 Ga0495624_0240543 3300046690 Bacteria 1095
1138 Ga0495624_0256231 3300046690 Bacteria 1058
1139 Ga0495624_0260707 3300046690 Bacteria 1047
1140 Ga0495670_0000213 3300046691 Bacteria 26531
1141 Ga0495670_0033566 3300046691 Bacteria 2553
1142 Ga0495670_0144478 3300046691 Bacteria 1246
1143 Ga0495671_0062082 3300046692 Bacteria 1842
1144 Ga0495671_0301809 3300046692 Bacteria 770
1145 Ga0495649_0040385 3300046694 Bacteria 2555
1146 Ga0495649_0368703 3300046694 Bacteria 724
1147 Ga0495600_0006046 3300046809 Bacteria 7331
1148 Ga0495600_0025897 3300046809 Bacteria 3782
1149 Ga0495600_0052146 3300046809 Bacteria 2671
1150 Ga0495600_0280197 3300046809 Bacteria 1055
1151 Ga0495581_0049437 3300047315 Bacteria 2428
1152 Ga0495581_0057033 3300047315 Bacteria 2254
1153 Ga0495581_0059837 3300047315 Bacteria 2201
1154 Ga0495581_0064661 3300047315 Bacteria 2114
1155 Ga0495604_0002294 3300047317 Bacteria 15322
1156 Ga0495604_0006070 3300047317 Bacteria 9587
1157 Ga0495604_0009049 3300047317 Bacteria 7879
1158 Ga0495604_0057607 3300047317 Bacteria 2987
1159 Ga0495604_0215008 3300047317 Bacteria 1326
1160 Ga0495636_0138265 3300047318 Bacteria 1087
1161 Ga0495674_0116513 3300047319 Bacteria 2260
1162 Ga0495674_0138581 3300047319 Bacteria 2046
1163 Ga0495674_0252836 3300047319 Bacteria 1450
1164 Ga0495674_0338640 3300047319 Bacteria 1223
1165 Ga0495674_0371609 3300047319 Bacteria 1158
1166 Ga0495674_0627891 3300047319 Bacteria 849
1167 Ga0495676_0103110 3300047321 Bacteria 2107
1168 Ga0495676_0142975 3300047321 Bacteria 1712
1169 Ga0495680_0002446 3300047322 Bacteria 19009
1170 Ga0495680_0004222 3300047322 Bacteria 13790
1171 Ga0495680_0006606 3300047322 Bacteria 10758
1172 Ga0495680_0012206 3300047322 Bacteria 7577
1173 Ga0495680_0018853 3300047322 Bacteria 5846
1174 Ga0495683_0102690 3300047323 Bacteria 1373
1175 Ga0495683_0107894 3300047323 Bacteria 1332
1176 Ga0495675_0000147 3300047444 Bacteria 49274
1177 Ga0495675_0001653 3300047444 Bacteria 13342
1178 Ga0495675_0156734 3300047444 Bacteria 1404
1179 Ga0495675_0226208 3300047444 Bacteria 1130
1180 Ga0495673_0089310 3300047469 Bacteria 1262
1181 Ga0495684_0028528 3300047471 Bacteria 4284
1182 Ga0495684_0047645 3300047471 Bacteria 3278
1183 Ga0495684_0133969 3300047471 Bacteria 1859
1184 Ga0495686_0108062 3300047472 Bacteria 1671
1185 Ga0495593_0014970 3300047673 Bacteria 4403
1186 Ga0495593_0039262 3300047673 Bacteria 2553
1187 Ga0495593_0050848 3300047673 Bacteria 2194
1188 Ga0495593_0059876 3300047673 Bacteria 1994
1189 Ga0495593_0090251 3300047673 Bacteria 1578
1190 Ga0495593_0091642 3300047673 Bacteria 1565
1191 Ga0495602_0017376 3300048088 Bacteria 7212
1192 Ga0495602_0017828 3300048088 Bacteria 7109
1193 Ga0495602_0021291 3300048088 Bacteria 6387
1194 Ga0495602_0032133 3300048088 Bacteria 4947
1195 Ga0495602_0371326 3300048088 Bacteria 1027
1196 Ga0495614_0016270 3300048089 Bacteria 3239
1197 Ga0495614_0103831 3300048089 Bacteria 1244
1198 Ga0495614_0162082 3300048089 Bacteria 1001
1199 Ga0495615_0052303 3300048090 Bacteria 1055
1200 Ga0495626_0096330 3300048091 Bacteria 1295
1201 Ga0495626_0155680 3300048091 Bacteria 961
1202 Ga0495626_0185251 3300048091 Bacteria 861
1203 Ga0496100_0006594 3300048903 Bacteria 6342
1204 Ga0496100_0013961 3300048903 Bacteria 4650
1205 Ga0496100_0017287 3300048903 Bacteria 4254
1206 Ga0496100_0019150 3300048903 Bacteria 4077
1207 Ga0496100_0027597 3300048903 Bacteria 3493
1208 Ga0496100_0055392 3300048903 Bacteria 2590
1209 Ga0496100_0155297 3300048903 Bacteria 1636
1210 Ga0496100_0654765 3300048903 Bacteria 818
1211 Ga0496101_0000079 3300048904 Bacteria 107673
1212 Ga0496101_0008107 3300048904 Bacteria 6853
1213 Ga0496101_0040176 3300048904 Bacteria 3331
1214 Ga0496101_0042859 3300048904 Bacteria 3231
1215 Ga0496101_0207438 3300048904 Unclassified 1517
1216 Ga0496101_0494469 3300048904 Bacteria 966
1217 Ga0496102_0000942 3300048905 Bacteria 27472
1218 Ga0496102_0008860 3300048905 Bacteria 8634
1219 Ga0496102_0032833 3300048905 Bacteria 4664
1220 Ga0496102_0045286 3300048905 Bacteria 3994
1221 Ga0496102_0058807 3300048905 Bacteria 3513
1222 Ga0496102_0062689 3300048905 Bacteria 3404
1223 Ga0496102_0065998 3300048905 Bacteria 3317
1224 Ga0496102_0240279 3300048905 Bacteria 1708
1225 Ga0496102_0484428 3300048905 Bacteria 1158
1226 Ga0496102_0570034 3300048905 Bacteria 1055
1227 Ga0496102_0634479 3300048905 Bacteria 991
1228 Ga0496103_0002375 3300048906 Bacteria 11868
1229 Ga0496103_0003062 3300048906 Bacteria 10279
1230 Ga0496103_0003997 3300048906 Bacteria 8957
1231 Ga0496103_0019249 3300048906 Bacteria 4099
1232 Ga0496103_0127351 3300048906 Bacteria 1624
1233 Ga0496103_0181710 3300048906 Bacteria 1352
1234 Ga0496104_0000431 3300048907 Bacteria 36365
1235 Ga0496104_0001836 3300048907 Bacteria 18358
1236 Ga0496104_0004143 3300048907 Bacteria 12587
1237 Ga0496104_0004191 3300048907 Bacteria 12522
1238 Ga0496104_0004953 3300048907 Bacteria 11622
1239 Ga0496104_0048661 3300048907 Bacteria 3996
1240 Ga0496104_0057612 3300048907 Bacteria 3676
1241 Ga0496104_0119489 3300048907 Bacteria 2530
1242 Ga0496104_0121646 3300048907 Bacteria 2506
1243 Ga0496105_0003143 3300048908 Bacteria 12154
1244 Ga0496105_0010944 3300048908 Bacteria 7147
1245 Ga0496105_0023618 3300048908 Bacteria 4989
1246 Ga0496105_0030941 3300048908 Bacteria 4387
1247 Ga0496105_0106414 3300048908 Bacteria 2315
1248 Ga0496105_0198022 3300048908 Bacteria 1640
1249 Ga0496105_0269708 3300048908 Bacteria 1375
1250 Ga0496105_0482244 3300048908 Bacteria 975
1251 Ga0496106_0001143 3300048909 Bacteria 19671
1252 Ga0496106_0003554 3300048909 Bacteria 11610
1253 Ga0496106_0005844 3300048909 Bacteria 9101
1254 Ga0496106_0006633 3300048909 Bacteria 8570
1255 Ga0496106_0020095 3300048909 Bacteria 4953
1256 Ga0496106_0025502 3300048909 Bacteria 4400
1257 Ga0496106_0045494 3300048909 Bacteria 3296
1258 Ga0496106_0161002 3300048909 Bacteria 1775
1259 Ga0496106_0210718 3300048909 Bacteria 1548
1260 Ga0496106_0243728 3300048909 Bacteria 1436
1261 Ga0496106_0263203 3300048909 Bacteria 1380
1262 Ga0496107_0000359 3300048910 Bacteria 24907
1263 Ga0496107_0000436 3300048910 Bacteria 22636
1264 Ga0496107_0001363 3300048910 Bacteria 15012
1265 Ga0496107_0015236 3300048910 Bacteria 5387
1266 Ga0496107_0031502 3300048910 Bacteria 3784
1267 Ga0496107_0070373 3300048910 Bacteria 2540
1268 Ga0496107_0426888 3300048910 Bacteria 985
1269 Ga0496107_0641522 3300048910 Bacteria 783
1270 Ga0496108_0002867 3300048911 Bacteria 13838
1271 Ga0496108_0004006 3300048911 Bacteria 11815
1272 Ga0496108_0005147 3300048911 Bacteria 10572
1273 Ga0496108_0009582 3300048911 Bacteria 7848
1274 Ga0496108_0014038 3300048911 Bacteria 6535
1275 Ga0496108_0026663 3300048911 Bacteria 4768
1276 Ga0496108_0049594 3300048911 Bacteria 3511
1277 Ga0496108_0070596 3300048911 Bacteria 2948
1278 Ga0496108_0539247 3300048911 Bacteria 1018
1279 Ga0496109_0000223 3300048912 Bacteria 56008
1280 Ga0496109_0000404 3300048912 Bacteria 38842
1281 Ga0496109_0003116 3300048912 Bacteria 13828
1282 Ga0496109_0003557 3300048912 Bacteria 13009
1283 Ga0496109_0011617 3300048912 Bacteria 7572
1284 Ga0496109_0018871 3300048912 Bacteria 6069
1285 Ga0496109_0032437 3300048912 Bacteria 4695
1286 Ga0496109_0043419 3300048912 Bacteria 4074
1287 Ga0496109_0062763 3300048912 Bacteria 3398
1288 Ga0496109_0129345 3300048912 Bacteria 2356
1289 Ga0496109_0160862 3300048912 Bacteria 2104
1290 Ga0496109_0353838 3300048912 Bacteria 1387
1291 Ga0496109_0433724 3300048912 Bacteria 1241
1292 Ga0496110_0001910 3300048913 Bacteria 15419
1293 Ga0496110_0002394 3300048913 Bacteria 14052
1294 Ga0496110_0003653 3300048913 Bacteria 11834
1295 Ga0496110_0016589 3300048913 Bacteria 6151
1296 Ga0496110_0018162 3300048913 Bacteria 5892
1297 Ga0496110_0021793 3300048913 Bacteria 5431
1298 Ga0496110_0156603 3300048913 Bacteria 2064
1299 Ga0496110_0216741 3300048913 Bacteria 1741
1300 Ga0496110_0224907 3300048913 Bacteria 1707
1301 Ga0496110_0352580 3300048913 Bacteria 1340
1302 Ga0496110_0382159 3300048913 Bacteria 1283
1303 Ga0496110_0393332 3300048913 Unclassified 1263
1304 Ga0496111_0001774 3300048914 Bacteria 12653
1305 Ga0496111_0002312 3300048914 Bacteria 11466
1306 Ga0496111_0010932 3300048914 Bacteria 6105
1307 Ga0496111_0019333 3300048914 Bacteria 4729
1308 Ga0496111_0031701 3300048914 Bacteria 3765
1309 Ga0496111_0042841 3300048914 Bacteria 3251
1310 Ga0496111_0052032 3300048914 Bacteria 2957
1311 Ga0496111_0224552 3300048914 Bacteria 1395
1312 Ga0496112_0002963 3300048915 Bacteria 13850
1313 Ga0496112_0003601 3300048915 Bacteria 12888
1314 Ga0496112_0011928 3300048915 Bacteria 7962
1315 Ga0496112_0013071 3300048915 Bacteria 7658
1316 Ga0496112_0016019 3300048915 Bacteria 7009
1317 Ga0496112_0033447 3300048915 Bacteria 4998
1318 Ga0496112_0041430 3300048915 Bacteria 4506
1319 Ga0496112_0067614 3300048915 Bacteria 3527
1320 Ga0496112_0153304 3300048915 Bacteria 2271
1321 Ga0496112_0421394 3300048915 Bacteria 1274
1322 Ga0496112_0961166 3300048915 Bacteria 775
1323 Ga0496112_0991408 3300048915 Bacteria 760
1324 Ga0496113_0000624 3300048916 Bacteria 17779
1325 Ga0496113_0001396 3300048916 Bacteria 13436
1326 Ga0496113_0001735 3300048916 Bacteria 12339
1327 Ga0496113_0019330 3300048916 Bacteria 4763
1328 Ga0496113_0024186 3300048916 Bacteria 4314
1329 Ga0496113_0055173 3300048916 Bacteria 2977
1330 Ga0496113_0084102 3300048916 Bacteria 2443
1331 Ga0496113_0179025 3300048916 Bacteria 1680
1332 Ga0496113_0183840 3300048916 Bacteria 1657
1333 Ga0496113_0194380 3300048916 Bacteria 1611
1334 Ga0496113_0466813 3300048916 Bacteria 1014
1335 Ga0496113_0553775 3300048916 Bacteria 922
1336 Ga0496114_0003222 3300048917 Bacteria 12516
1337 Ga0496114_0003326 3300048917 Bacteria 12354
1338 Ga0496114_0026647 3300048917 Bacteria 4734
1339 Ga0496114_0030663 3300048917 Bacteria 4425
1340 Ga0496114_0104819 3300048917 Bacteria 2418
1341 Ga0496115_0000547 3300048918 Bacteria 29281
1342 Ga0496115_0008495 3300048918 Bacteria 7594
1343 Ga0496115_0011806 3300048918 Bacteria 6561
1344 Ga0496115_0269700 3300048918 Bacteria 1398
1345 Ga0496115_0616009 3300048918 Unclassified 861
1346 Ga0496116_0244215 3300048919 Bacteria 899
1347 Ga0496118_0158767 3300048921 Bacteria 1402
1348 Ga0496119_0004123 3300048922 Bacteria 14637
1349 Ga0496119_0044953 3300048922 Bacteria 2774
1350 Ga0496120_0006519 3300048923 Bacteria 8945
1351 Ga0496120_0051081 3300048923 Bacteria 2364
1352 Ga0496121_0041733 3300048924 Bacteria 4005
1353 Ga0496122_0081141 3300048925 Bacteria 2259
1354 Ga0496125_0033107 3300048928 Bacteria 4580
1355 Ga0496126_0040330 3300048929 Bacteria 4328
1356 Ga0501033_0076983 3300049570 Bacteria 2448
1357 Ga0501034_0112807 3300049571 Bacteria 2708
1358 Ga0501034_0418822 3300049571 Bacteria 1261
1359 Ga0501034_0485901 3300049571 Bacteria 1150
1360 Ga0501036_0027820 3300049572 Bacteria 4779
1361 Ga0501036_0364034 3300049572 Bacteria 1207
1362 Ga0501038_0196245 3300049574 Bacteria 1622
1363 Ga0501038_0285339 3300049574 Bacteria 1298
1364 Ga0501039_0092711 3300049575 Bacteria 2354
1365 Ga0501039_0435483 3300049575 Bacteria 1030
1366 Ga0501039_0517843 3300049575 Bacteria 936
1367 Ga0501040_0100563 3300049576 Bacteria 2016
1368 Ga0501042_0248800 3300049578 Bacteria 1283
1369 Ga0501043_0017209 3300049579 Bacteria 5670
1370 Ga0501047_0038971 3300049581 Bacteria 4596
1371 Ga0501047_0252772 3300049581 Bacteria 1611
1372 Ga0501047_0534621 3300049581 Bacteria 997
1373 Ga0501048_0165489 3300049582 Bacteria 1566
1374 Ga0501068_0015903 3300049584 Bacteria 4333
1375 Ga0501068_0297176 3300049584 Bacteria 1033
1376 Ga0501070_0019024 3300049586 Bacteria 5760
1377 Ga0501070_0084044 3300049586 Bacteria 2635
1378 Ga0501071_0049958 3300049587 Bacteria 3012
1379 Ga0501071_0285310 3300049587 Bacteria 1250
1380 Ga0501072_0002712 3300049588 Bacteria 13291
1381 Ga0501072_0004481 3300049588 Bacteria 10608
1382 Ga0501072_0334990 3300049588 Bacteria 1202
1383 Ga0501073_0033637 3300049589 Bacteria 3649
1384 Ga0501073_0135204 3300049589 Bacteria 1709
1385 Ga0501075_0083915 3300049591 Bacteria 2413
1386 Ga0501076_0062530 3300049592 Bacteria 2965
1387 Ga0501077_0018282 3300049593 Bacteria 4436
1388 Ga0501077_0342582 3300049593 Bacteria 953
1389 Ga0501079_0087588 3300049741 Bacteria 2410
1390 Ga0501079_0152376 3300049741 Bacteria 1802
1391 Ga0501079_0195043 3300049741 Bacteria 1581
1392 Ga0501079_0232621 3300049741 Bacteria 1440
1393 Ga0501079_0872822 3300049741 Bacteria 708
1394 Ga0501080_0235329 3300049742 Bacteria 1673
1395 Ga0501080_0239470 3300049742 Bacteria 1656
1396 Ga0501080_0266948 3300049742 Bacteria 1558
1397 Ga0501081_0050631 3300049743 Bacteria 2861
1398 Ga0501081_0245361 3300049743 Unclassified 1306
1399 Ga0501083_0185812 3300049744 Bacteria 1357
1400 Ga0501083_0290466 3300049744 Bacteria 1063
1401 Ga0501035_0001940 3300049822 Bacteria 20709
1402 Ga0501035_0061568 3300049822 Bacteria 3340
1403 Ga0501044_0063861 3300049823 Bacteria 3759
1404 Ga0501044_0065573 3300049823 Bacteria 3703
1405 Ga0501044_0145089 3300049823 Bacteria 2360
1406 Ga0501044_0387481 3300049823 Bacteria 1312
1407 Ga0501045_0212135 3300049824 Bacteria 1442
1408 Ga0501045_0341272 3300049824 Unclassified 1115
1409 nmdc:mga03683_14084_c2 3300050489 Bacteria 1938
1410 nmdc:mga03683_29136_c1 3300050489 Bacteria 2199
1411 nmdc:mga03n38_20855_c1 3300050490 Bacteria 2628
1412 nmdc:mga03n38_29865_c1 3300050490 Bacteria 2286
1413 nmdc:mga00v17_135626_c1 3300050491 Bacteria 1575
1414 nmdc:mga00v17_23425_c1 3300050491 Bacteria 3571
1415 nmdc:mga00v17_52949_c1 3300050491 Bacteria 2472
1416 nmdc:mga0yw44_1437_c1 3300050492 Bacteria 9099
1417 nmdc:mga0yw44_480014_c1 3300050492 Bacteria 843
1418 nmdc:mga0yw44_9426_c1 3300050492 Bacteria 4936
1419 nmdc:mga0k408_2858_c1 3300050493 Bacteria 9168
1420 nmdc:mga0k408_8431_c1 3300050493 Bacteria 5532
1421 nmdc:mga06z11_23264_c1 3300050494 Bacteria 2908
1422 nmdc:mga06z11_25302_c1 3300050494 Bacteria 2811
1423 nmdc:mga04h51_8211_c1 3300050495 Bacteria 2787
1424 nmdc:mga07m45_23396_c1 3300050496 Bacteria 3377
1425 nmdc:mga07m45_5426_c1 3300050496 Bacteria 6346
1426 nmdc:mga05p37_14557_c1 3300050507 Bacteria 9445
1427 nmdc:mga05p37_210565_c1 3300050507 Bacteria 2350
1428 nmdc:mga05p37_31120_c1 3300050507 Bacteria 6517
1429 nmdc:mga05p37_36596_c1 3300050507 Bacteria 6020
1430 nmdc:mga05p37_775316_c1 3300050507 Bacteria 1053
1431 nmdc:mga05p37_884548_c1 3300050507 Bacteria 965
1432 nmdc:mga09592_84725_c1 3300050508 Bacteria 2703
1433 nmdc:mga0qj67_150426_c1 3300050509 Bacteria 1888
1434 nmdc:mga0qj67_18_c1 3300050509 Bacteria 120268
1435 nmdc:mga0qj67_563395_c1 3300050509 Bacteria 913
1436 nmdc:mga06r32_100936_c1 3300050510 Bacteria 2831
1437 nmdc:mga06r32_40585_c1 3300050510 Bacteria 4419
1438 nmdc:mga06r32_64510_c1 3300050510 Bacteria 3532
1439 nmdc:mga08y16_110772_c1 3300050511 Bacteria 2859
1440 nmdc:mga08y16_133176_c1 3300050511 Bacteria 2584
1441 nmdc:mga08y16_226164_c1 3300050511 Bacteria 1936
1442 nmdc:mga08y16_319526_c1 3300050511 Unclassified 1599
1443 nmdc:mga08y16_468887_c1 3300050511 Bacteria 1282
1444 nmdc:mga08y16_939725_c1 3300050511 Bacteria 848
1445 nmdc:mga0n895_1039522_c1 3300050512 Unclassified 799
1446 nmdc:mga0n895_225470_c1 3300050512 Bacteria 1902
1447 nmdc:mga0n895_280338_c1 3300050512 Bacteria 1690
1448 nmdc:mga0n895_330737_c1 3300050512 Bacteria 1544
1449 nmdc:mga0n895_35380_c1 3300050512 Bacteria 4815
1450 nmdc:mga0n895_52081_c1 3300050512 Bacteria 4017
1451 nmdc:mga0n895_622_c1 3300050512 Bacteria 24660
1452 nmdc:mga0n895_64950_c2 3300050512 Bacteria 1635
1453 nmdc:mga0n895_94521_c1 3300050512 Bacteria 2993
1454 nmdc:mga0n895_946020_c1 3300050512 Bacteria 845
1455 nmdc:mga0rr50_221431_c1 3300050513 Bacteria 1563
1456 nmdc:mga0rr50_259688_c1 3300050513 Bacteria 1445
1457 nmdc:mga0rr50_50061_c1 3300050513 Bacteria 3094
1458 nmdc:mga0rr50_68530_c1 3300050513 Bacteria 2698
1459 nmdc:mga0rr50_711847_c1 3300050513 Bacteria 857
1460 nmdc:mga0rr50_79217_c1 3300050513 Bacteria 2530
1461 nmdc:mga08x19_38629_c1 3300050514 Bacteria 3032
1462 nmdc:mga0a205_27052_c1 3300050515 Bacteria 5476
1463 nmdc:mga0a205_368579_c1 3300050515 Bacteria 1302
1464 nmdc:mga0a205_7768_c1 3300050515 Bacteria 9737
1465 nmdc:mga0sz30_12769_c1 3300050516 Bacteria 3273
1466 nmdc:mga0sz30_96175_c1 3300050516 Bacteria 1291
1467 Ga0495601_0001750 3300053077 Bacteria 12016
1468 Ga0495601_0002382 3300053077 Bacteria 10661
1469 Ga0495601_0017376 3300053077 Bacteria 4365
1470 Ga0495601_0025698 3300053077 Bacteria 3632
1471 Ga0495601_0063960 3300053077 Bacteria 2338
1472 Ga0495601_0120741 3300053077 Bacteria 1702
1473 Ga0495601_0153457 3300053077 Bacteria 1504
1474 Ga0495612_0008869 3300053078 Bacteria 4073
1475 Ga0495612_0010274 3300053078 Bacteria 3787
1476 Ga0495612_0043535 3300053078 Bacteria 1835
1477 Ga0495612_0064139 3300053078 Bacteria 1524
1478 Ga0495655_0003016 3300053083 Bacteria 2733
1479 Ga0495655_0008381 3300053083 Bacteria 1961
1480 Ga0495655_0019962 3300053083 Bacteria 1497
1481 Ga0495595_0000576 3300053084 Bacteria 14034
1482 Ga0495595_0004751 3300053084 Bacteria 5466
1483 Ga0495595_0032435 3300053084 Bacteria 2353
1484 Ga0495595_0037073 3300053084 Bacteria 2215
1485 Ga0495595_0090029 3300053084 Bacteria 1471
1486 Ga0495619_0000132 3300053085 Bacteria 55452
1487 Ga0495619_0000178 3300053085 Bacteria 46773
1488 Ga0495619_0011281 3300053085 Bacteria 5621
1489 Ga0495619_0031232 3300053085 Bacteria 3450
1490 Ga0495619_0037425 3300053085 Bacteria 3161
1491 Ga0495619_0037480 3300053085 Bacteria 3159
1492 Ga0495619_0055466 3300053085 Bacteria 2624
1493 Ga0495619_0249010 3300053085 Bacteria 1231
1494 Ga0500646_0039137 3300053090 Bacteria 1329
1495 Ga0500647_0077257 3300053091 Bacteria 1597
1496 Ga0500641_0024406 3300053096 Bacteria 2331
1497 Ga0500654_074863 3300053099 Bacteria 1623
1498 Ga0500557_000012 3300053105 Bacteria 115728
1499 Ga0500595_014887 3300053119 Bacteria 2938
1500 Ga0500614_064498 3300053123 Bacteria 992
1501 Ga0500642_0000232 3300053130 Bacteria 21724
1502 Ga0500568_0098276 3300053139 Bacteria 1100
1503 Ga0500590_182758 3300053148 Bacteria 908
1504 Ga0500604_0232428 3300053151 Unclassified 637
1505 Ga0500625_028959 3300053729 Bacteria 2628
1506 Ga0501084_0170578 3300054114 Bacteria 1836
1507 Ga0501084_0336545 3300054114 Bacteria 1275
1508 Ga0500661_004079 3300055283 Bacteria 2730
1509 Ga0501082_0000145 3300060353 Bacteria 58967
1510 Ga0501082_0077631 3300060353 Bacteria 2864
1511 Ga0501082_0155815 3300060353 Bacteria 1985
1512 Ga0501082_0156230 3300060353 Bacteria 1982
1513 Ga0501082_0259839 3300060353 Bacteria 1510
1514 Ga0530510_0340487 3300061734 Bacteria 1126
1515 2507505059 2507262055 Bacteria 8048963
1516 2508538995 2508501009 Bacteria 7784016
1517 2508695310 2508501042 Bacteria 8719808
1518 2513639744 2513237094 Bacteria 8789602
1519 2513647769 2513237095 Bacteria 8976980
1520 2513873717 2513237139 Bacteria 8737671
1521 2514015235 2513237161 Bacteria 8871253
1522 2515625673 2515154112 Bacteria 8294334
1523 2517102161 2517093001 Bacteria 9002274
1524 2793064970 2791355196 Bacteria 7323613
1525 2805915800 2802429603 Bacteria 8777136
1526 2818237476 2816332527 Bacteria 8933356
1527 2824608313 2824600985 Bacteria 8488197
1528 2824617217 2824609381 Bacteria 8672835
1529 2824660117 2824653114 Bacteria 8493680
1530 2824677769 2824671348 Bacteria 8369588
1531 2824692046 2824687955 Bacteria 8360029
1532 2824700583 2824696289 Bacteria 8335049
1533 2824772602 2824763712 Bacteria 9792355
1534 2838124323 2838122688 Bacteria 8803140
1535 2841948865 2841941048 Bacteria 8688029
1536 2841951801 2841949485 Bacteria 8680857
1537 2841973822 2841966195 Bacteria 8673214
1538 2841980148 2841974524 Bacteria 8931498
1539 2841985331 2841983080 Bacteria 8395090
1540 2842043684 2842038055 Bacteria 8002051
1541 2842052326 2842045827 Bacteria 8006841
1542 2847941954 2847939898 Bacteria 8606328
1543 2849082864 2849076700 Bacteria 7039503
1544 2874597058 2874590934 Bacteria 8299676
1545 2874624606 2874620515 Bacteria 8290088
1546 2874648094 2874645413 Bacteria 8214782
1547 2876777522 2876771140 Bacteria 8287509
1548 2876825604 2876818435 Bacteria 8274608
1549 2879077782 2879074833 Bacteria 8279565
1550 2879127856 2879127579 Bacteria 8294491
1551 2879148877 2879142872 Bacteria 8267021
1552 2881365853 2881364244 Bacteria 7710352
1553 2885371215 2885366525 Bacteria 8326213
1554 2888420491 2888419890 Bacteria 7857137
1555 2904672055 2904666416 Bacteria 8226587
1556 2904715762 2904711408 Bacteria 9771557
1557 2932794500 2932794094 Bacteria 7915132
1558 2932806781 2932801729 Bacteria 7987968
1559 2935615366 2935608549 Bacteria 8203142
1560 2935654813 2935648319 Bacteria 8801166
1561 2935663754 2935656913 Bacteria 8965014
1562 2935773427 2935769743 Bacteria 7878163
1563 2935782301 2935777560 Bacteria 8077691
1564 2935789253 2935785616 Bacteria 7962367
1565 2935797190 2935793552 Bacteria 8012592
1566 2935825256 2935819856 Bacteria 8261050
1567 2935853090 2935847175 Bacteria 8228321
1568 2935888552 2935883170 Bacteria 7964738
1569 2935910162 2935908558 Bacteria 8568796
1570 2935918541 2935916978 Bacteria 9113783
1571 2935927927 2935926038 Bacteria 8601059
1572 2935936201 2935934488 Bacteria 8602579
1573 2935944246 2935942939 Bacteria 8599779
1574 2935952683 2935951376 Bacteria 8602333
1575 2935969523 2935967501 Bacteria 8603075
1576 2935977715 2935975950 Bacteria 8347125
1577 2935984968 2935984226 Bacteria 8302647
1578 2936017849 2936011229 Bacteria 8801034
1579 2936026352 2936019824 Bacteria 8804134
1580 2936031600 2936028420 Bacteria 8965941
1581 2936053386 2936046547 Bacteria 8903709
1582 2936056137 2936055302 Bacteria 8785755
1583 2941532513 2941531003 Bacteria 7653939
1584 3005710820 3005710791 Bacteria 7622528
1585 8016525954 8016522445 Bacteria 8156687
1586 8016557871 8016557553 Bacteria 8154380
1587 8016569251 8016566248 Bacteria 8158151
1588 8016581886 8016575299 Bacteria 8154085
1589 8016595890 8016595262 Bacteria 8149947
1590 8016618659 8016613128 Bacteria 8794220
1591 8016623402 8016622563 Bacteria 7999408
1592 8016635860 8016630954 Bacteria 9217207
1593 8019530838 8019530166 Bacteria 8155624
1594 8019540744 8019538911 Bacteria 7872763
1595 8019622772 8019619141 Bacteria 9218857
1596 8019630334 8019629233 Bacteria 8687553
1597 8019640278 8019638758 Bacteria 9062356
1598 8019652671 8019648815 Bacteria 10014479
1599 8019667163 8019659431 Bacteria 8577854
1600 8019676948 8019668869 Bacteria 8791617
1601 8019679040 8019678201 Bacteria 8863603
1602 8019696486 8019687851 Bacteria 8712826
1603 8056971101 8056967851 Bacteria 9038162
1604 Ga0207695_10000107
1605 2214756331
1606 ARcpr5yngRDRAFT_c000052
1607 ARSoilOldRDRAFT_c000001
1608 ARCol0oldRDRAFT_c00112
1609 ARCol0yngRDRAFT_1000001
1610 JGI24741J21665_1007670
1611 JGI24752J21851_1001356
1612 JGI24746J21847_1000477
1613 JGI24739J22299_10000177
1614 JGI24737J22298_10000967
1615 JGI24737J22298_10006515
1616 JGI24743J22301_10001361
1617 JGI24750J21931_1000547
1618 JGI24750J21931_1003185
1619 JGI24745J21846_1001306
1620 JGI24748J21848_1000209
1621 JGI24738J21930_10000256
1622 JGI24738J21930_10000437
1623 JGI24749J21850_1000857
1624 JGI24744J21845_10000555
1625 JGI24744J21845_10001216
1626 JGI24035J26624_1000009
1627 JGI24034J26672_10000760
1628 JGI24742J22300_10001007
1629 JGI25153J46596_10007997
1630 Ga0055531_10004894
1631 JGI25405J52794_10028701
1632 Ga0055543_1022841
1633 Ga0065165_1006357
1634 Ga0065165_1020376
1635 Ga0065704_10160483
1636 Ga0065712_10082879
1637 Ga0065715_10001850
1638 Ga0065715_10100237
1639 Ga0070676_10000076
1640 Ga0070676_10022801
1641 Ga0070676_10024250
1642 Ga0070676_10031130
1643 Ga0070683_100002997
1644 Ga0070683_100067661
1645 Ga0070690_100002546
1646 Ga0070690_100003545
1647 Ga0070690_100022196
1648 Ga0070690_100194638
1649 Ga0070690_100218798
1650 Ga0070690_100313120
1651 Ga0070690_100551954
1652 Ga0070670_100001544
1653 Ga0070670_100005236
1654 Ga0070670_100154002
1655 Ga0070670_100812982
1656 Ga0070677_10000038
1657 Ga0070677_10016774
1658 Ga0070677_10029474
1659 Ga0070677_10104839
1660 Ga0068869_100000054
1661 Ga0068869_100169330
1662 Ga0068869_100450057
1663 Ga0068869_100650715
1664 Ga0070666_10046576
1665 Ga0070666_10127785
1666 Ga0070666_10139406
1667 Ga0070680_100004742
1668 Ga0070680_100191245
1669 Ga0070682_100000181
1670 Ga0070682_100083595
1671 Ga0070682_100091649
1672 Ga0070682_100123788
1673 Ga0068868_100002127
1674 Ga0068868_100003086
1675 Ga0068868_100087352
1676 Ga0068868_100171033
1677 Ga0068868_100181563
1678 Ga0070660_100000660
1679 Ga0070660_100062555
1680 Ga0070660_100064473
1681 Ga0070660_100278485
1682 Ga0070660_100452990
1683 Ga0070689_100003434
1684 Ga0070689_100003508
1685 Ga0070689_100004183
1686 Ga0070689_100025050
1687 Ga0070689_100029697
1688 Ga0070689_100182206
1689 Ga0070691_10000491
1690 Ga0070691_10109721
1691 Ga0070687_100000358
1692 Ga0070687_100011228
1693 Ga0070687_100011387
1694 Ga0070687_100034735
1695 Ga0070687_100064142
1696 Ga0070687_100118747
1697 Ga0070687_100148142
1698 Ga0070687_100595184
1699 Ga0070661_100000797
1700 Ga0070661_100047671
1701 Ga0070661_100091588
1702 Ga0070661_100321610
1703 Ga0070661_100488577
1704 Ga0070692_10000320
1705 Ga0070692_10008804
1706 Ga0070692_10038825
1707 Ga0070668_100004777
1708 Ga0070668_100044390
1709 Ga0070668_100123028
1710 Ga0070669_100001643
1711 Ga0070669_100027609
1712 Ga0070669_100353257
1713 Ga0070675_100005771
1714 Ga0070675_100111785
1715 Ga0070671_100003232
1716 Ga0070671_100031220
1717 Ga0070671_100041035
1718 Ga0070671_100089793
1719 Ga0070671_100555295
1720 Ga0070671_100632121
1721 Ga0070674_100000140
1722 Ga0070674_100226858
1723 Ga0070673_100007770
1724 Ga0070673_100029834
1725 Ga0070673_100067400
1726 Ga0070673_100503104
1727 Ga0070673_100525476
1728 Ga0070688_100002076
1729 Ga0070688_100005196
1730 Ga0070688_100026043
1731 Ga0070659_100004532
1732 Ga0070659_100032102
1733 Ga0070659_100038432
1734 Ga0070659_100042897
1735 Ga0070667_100001305
1736 Ga0070667_100165388
1737 Ga0070667_100355091
1738 Ga0070667_100556513
1739 Ga0070703_10001982
1740 Ga0070703_10005800
1741 Ga0070703_10029695
1742 Ga0070709_10004597
1743 Ga0070709_10007654
1744 Ga0070714_100054238
1745 Ga0070714_100058840
1746 Ga0070714_100293538
1747 Ga0070713_100010421
1748 Ga0070713_100021777
1749 Ga0070713_100024821
1750 Ga0070713_100326724
1751 Ga0070710_10004200
1752 Ga0070710_10014806
1753 Ga0070710_10062090
1754 Ga0070701_10000297
1755 Ga0070701_10001300
1756 Ga0070701_10020956
1757 Ga0070711_100076631
1758 Ga0070711_100128769
1759 Ga0070711_100304595
1760 Ga0070705_100000989
1761 Ga0070705_100070844
1762 Ga0070700_100002276
1763 Ga0070700_100011750
1764 Ga0070700_100070030
1765 Ga0070694_100000444
1766 Ga0070694_100003236
1767 Ga0070694_100268192
1768 Ga0070694_100407529
1769 Ga0070708_100031469
1770 Ga0070663_100000436
1771 Ga0070663_100028875
1772 Ga0070663_100067556
1773 Ga0070663_100215216
1774 Ga0070678_100000382
1775 Ga0070678_100003875
1776 Ga0070678_100050943
1777 Ga0070662_100003913
1778 Ga0070662_100005358
1779 Ga0070662_100006339
1780 Ga0070662_100222459
1781 Ga0070662_100286958
1782 Ga0070681_10005795
1783 Ga0070681_10044092
1784 Ga0070681_10104858
1785 Ga0070681_10118502
1786 Ga0070681_10320906
1787 Ga0070681_10349941
1788 Ga0070681_11014279
1789 Ga0068867_100004037
1790 Ga0068867_100031738
1791 Ga0068867_100049962
1792 Ga0068867_100115286
1793 Ga0070685_10011992
1794 Ga0070685_10019254
1795 Ga0070685_10053921
1796 Ga0070685_10090723
1797 Ga0070685_10099640
1798 Ga0070706_100142059
1799 Ga0070698_100206822
1800 Ga0070699_100234039
1801 Ga0070679_100001204
1802 Ga0070679_100096291
1803 Ga0070684_100004481
1804 Ga0070684_100031381
1805 Ga0070684_100063427
1806 Ga0070697_100291756
1807 Ga0068853_100001615
1808 Ga0068853_100004372
1809 Ga0070672_100003461
1810 Ga0070672_100083198
1811 Ga0070672_100337527
1812 Ga0070686_100002518
1813 Ga0070686_100009403
1814 Ga0070686_100293445
1815 Ga0070695_100002937
1816 Ga0070695_100004993
1817 Ga0070695_100417542
1818 Ga0070696_100009850
1819 Ga0070696_100309863
1820 Ga0070696_100328530
1821 Ga0070693_100000628
1822 Ga0070665_100112704
1823 Ga0070665_100153502
1824 Ga0070665_100207924
1825 Ga0070665_100298035
1826 Ga0070665_100580933
1827 Ga0070704_100055623
1828 Ga0070704_100058274
1829 Ga0070704_100223496
1830 Ga0070704_100256179
1831 Ga0070704_100347552
1832 Ga0070704_100831568
1833 Ga0068855_100023116
1834 Ga0068855_100095264
1835 Ga0068855_100380532
1836 Ga0070664_100004566
1837 Ga0070664_100063082
1838 Ga0070664_100085062
1839 Ga0070664_100382548
1840 Ga0070664_100598894
1841 Ga0070664_100676981
1842 Ga0068857_100006169
1843 Ga0068857_100016920
1844 Ga0068857_100043816
1845 Ga0068857_100210605
1846 Ga0068854_100003262
1847 Ga0068854_100015505
1848 Ga0068854_100041635
1849 Ga0068854_100064618
1850 Ga0068854_100705520
1851 Ga0068856_100004644
1852 Ga0068856_100155865
1853 Ga0068856_100177921
1854 Ga0068856_100331265
1855 Ga0068856_100409452
1856 Ga0070702_100000041
1857 Ga0070702_100002073
1858 Ga0070702_100064308
1859 Ga0070702_100080293
1860 Ga0070702_100096687
1861 Ga0070702_100427359
1862 Ga0070702_100594342
1863 Ga0068852_100038957
1864 Ga0068852_100109132
1865 Ga0068852_100214847
1866 Ga0068852_100384529
1867 Ga0068859_100014564
1868 Ga0068859_100046546
1869 Ga0068859_100058549
1870 Ga0068859_100063160
1871 Ga0068859_100538324
1872 Ga0068859_100635760
1873 Ga0068859_100825974
1874 Ga0068864_100000172
1875 Ga0068864_100005707
1876 Ga0068864_100038825
1877 Ga0068864_100146517
1878 Ga0068864_100596999
1879 Ga0068866_10000209
1880 Ga0068866_10044664
1881 Ga0068861_100001340
1882 Ga0068851_10193464
1883 Ga0068870_10000652
1884 Ga0068870_10002924
1885 Ga0068870_10503266
1886 Ga0068863_100001541
1887 Ga0068863_100030974
1888 Ga0068863_100077872
1889 Ga0068858_100014295
1890 Ga0068858_100120659
1891 Ga0068858_100309409
1892 Ga0068858_100348362
1893 Ga0068860_100007995
1894 Ga0068860_100059288
1895 Ga0068860_100577100
1896 Ga0068860_100666320
1897 Ga0068862_100003247
1898 Ga0068862_100005613
1899 Ga0068862_100010836
1900 Ga0068862_100214860
1901 Ga0081455_10000002
1902 Ga0081455_10011036
1903 Ga0081455_10011972
1904 Ga0081455_10096499
1905 Ga0081538_10002134
1906 Ga0081540_1011265
1907 Ga0081539_10001661
1908 Ga0070717_10004108
1909 Ga0070717_10009760
1910 Ga0070717_10276089
1911 Ga0070717_10414929
1912 Ga0075365_10135490
1913 Ga0075365_10292781
1914 Ga0075368_10009240
1915 Ga0075363_100013123
1916 Ga0075363_100158075
1917 Ga0075363_100304050
1918 Ga0075364_10408328
1919 Ga0075432_10049484
1920 Ga0070715_10000720
1921 Ga0070715_10117210
1922 Ga0070716_100010508
1923 Ga0070716_100328235
1924 Ga0070712_100000460
1925 Ga0070712_100070971
1926 Ga0070712_100158873
1927 Ga0070712_100177873
1928 Ga0070712_100211580
1929 Ga0075362_10021323
1930 Ga0075367_10019074
1931 Ga0075367_10267614
1932 Ga0075369_10011405
1933 Ga0075366_10010047
1934 Ga0075366_10012444
1935 Ga0097621_100000565
1936 Ga0097621_100385545
1937 Ga0075370_10077261
1938 Ga0075370_10409502
1939 Ga0068871_100000303
1940 Ga0068871_100005491
1941 Ga0068871_100074783
1942 Ga0075428_100030184
1943 Ga0075428_100325676
1944 Ga0075428_100396918
1945 Ga0075428_100592657
1946 Ga0075430_100000492
1947 Ga0075430_100013197
1948 Ga0075430_100156711
1949 Ga0075430_100204326
1950 Ga0075431_100040575
1951 Ga0075431_100116984
1952 Ga0075431_100220767
1953 Ga0075433_10053274
1954 Ga0075433_10554797
1955 Ga0075434_100000412
1956 Ga0075434_100032747
1957 Ga0075434_100033742
1958 Ga0075434_100050156
1959 Ga0075434_100098202
1960 Ga0075434_100103939
1961 Ga0075434_100156042
1962 Ga0075434_100240904
1963 Ga0075434_100253868
1964 Ga0075434_100267351
1965 Ga0075434_100716376
1966 Ga0075429_100099929
1967 Ga0068865_100000682
1968 Ga0068865_100069839
1969 Ga0068865_100182153
1970 Ga0075436_100070943
1971 Ga0097620_100014563
1972 Ga0097620_100046544
1973 Ga0097620_100058549
1974 Ga0097620_100063160
1975 Ga0097620_100538302
1976 Ga0097620_100635779
1977 Ga0097620_100825969
1978 Ga0075435_100040717
1979 Ga0075435_100102310
1980 Ga0075435_100280083
1981 Ga0075435_100736870
1982 Ga0099794_10038823
1983 Ga0105251_10137861
1984 Ga0105240_10056226
1985 Ga0105240_10069601
1986 Ga0105240_10239587
1987 Ga0105240_10249173
1988 Ga0105240_10798219
1989 Ga0111539_10002657
1990 Ga0111539_10002897
1991 Ga0111539_10108622
1992 Ga0111539_10132079
1993 Ga0111539_10183045
1994 Ga0111539_10201052
1995 Ga0111539_10507741
1996 Ga0111539_10683689
1997 Ga0105245_10000882
1998 Ga0105245_10037434
1999 Ga0105245_10106664
2000 Ga0105245_10271015
2001 Ga0105247_10001969
2002 Ga0105247_10004828
2003 Ga0105247_10289542
2004 Ga0114129_10008610
2005 Ga0114129_10021090
2006 Ga0114129_10061242
2007 Ga0114129_10095382
2008 Ga0114129_10104552
2009 Ga0114129_10157533
2010 Ga0114129_10586182
2011 Ga0114129_10605105
2012 Ga0114129_11902180
2013 Ga0105243_10001029
2014 Ga0105243_10009289
2015 Ga0105243_10023731
2016 Ga0105243_10230935
2017 Ga0105243_10262535
2018 Ga0105243_10428274
2019 Ga0105241_10006660
2020 Ga0105241_10181648
2021 Ga0105241_10350024
2022 Ga0105241_10427289
2023 Ga0105241_10725696
2024 Ga0105242_10002177
2025 Ga0105242_10027348
2026 Ga0105242_10294895
2027 Ga0105248_10002945
2028 Ga0105248_10012305
2029 Ga0105248_10014996
2030 Ga0105248_10074990
2031 Ga0105248_10074998
2032 Ga0105248_10097925
2033 Ga0105237_10003304
2034 Ga0105237_10063614
2035 Ga0105237_10112977
2036 Ga0105237_10208332
2037 Ga0105237_10341732
2038 Ga0105238_10066156
2039 Ga0105238_10171734
2040 Ga0105238_10282647
2041 Ga0105238_10644735
2042 Ga0105249_10006632
2043 Ga0105249_10028570
2044 Ga0105249_10032153
2045 Ga0105249_10175965
2046 Ga0099796_10005397
2047 Ga0105239_10021993
2048 Ga0105239_10032680
2049 Ga0105239_10094993
2050 Ga0105239_10132130
2051 Ga0105239_10207875
2052 Ga0105239_10329989
2053 Ga0105246_10000463
2054 Ga0105246_10033093
2055 Ga0105246_10048040
2056 Ga0105246_10399843
2057 Ga0105246_10541243
2058 Ga0157313_1000926
2059 Ga0157373_10015583
2060 Ga0157371_10115937
2061 Ga0157370_10173108
2062 Ga0157370_10256887
2063 Ga0157369_10427420
2064 Ga0157374_10000614
2065 Ga0157374_10065462
2066 Ga0157374_10495888
2067 Ga0157374_11165826
2068 Ga0157378_10000701
2069 Ga0157378_10027642
2070 Ga0157378_10154419
2071 Ga0157378_10415059
2072 Ga0157378_10472828
2073 Ga0163162_10008098
2074 Ga0163162_10108282
2075 Ga0163162_10186391
2076 Ga0163162_10458816
2077 Ga0163162_10722294
2078 Ga0157372_10016291
2079 Ga0157372_10098111
2080 Ga0157372_10140711
2081 Ga0157372_10594965
2082 Ga0157375_10005857
2083 Ga0157375_10022311
2084 Ga0163163_10004757
2085 Ga0163163_10017614
2086 Ga0163163_10053547
2087 Ga0163163_10063537
2088 Ga0163163_10135712
2089 Ga0163163_10183790
2090 Ga0163163_11085892
2091 Ga0157380_10001646
2092 Ga0157380_10069598
2093 Ga0157380_10165606
2094 Ga0182008_10166078
2095 Ga0157377_10000514
2096 Ga0157379_10000792
2097 Ga0157379_10010974
2098 Ga0157379_10057501
2099 Ga0157379_10072154
2100 Ga0157379_10096732
2101 Ga0157379_10293592
2102 Ga0157379_10983242
2103 Ga0157376_10000352
2104 Ga0157376_10063069
2105 Ga0157376_10211676
2106 Ga0157376_10511043
2107 Ga0157376_10827550
2108 Ga0182005_1087240
2109 Ga0163161_10000956
2110 Ga0163161_10079514
2111 Ga0163161_10089657
2112 Ga0163161_10143176
2113 Ga0206353_10376412
2114 Ga0207666_1000043
2115 Ga0207673_1000044
2116 Ga0209758_1000182
2117 Ga0209758_1000293
2118 Ga0209758_1019701
2119 Ga0209758_1056344
2120 Ga0207426_1007081
2121 Ga0207426_1031401
2122 Ga0209257_1000390
2123 Ga0207697_10001136
2124 Ga0207697_10012548
2125 Ga0207656_10038144
2126 Ga0207656_10077332
2127 Ga0207655_1061275
2128 Ga0207682_10000021
2129 Ga0207682_10000660
2130 Ga0207682_10203212
2131 Ga0207692_10002654
2132 Ga0207692_10008133
2133 Ga0207642_10000623
2134 Ga0207642_10046441
2135 Ga0207642_10100529
2136 Ga0207642_10141871
2137 Ga0207710_10001214
2138 Ga0207710_10020661
2139 Ga0207710_10025361
2140 Ga0207688_10000949
2141 Ga0207688_10002814
2142 Ga0207688_10071997
2143 Ga0207688_10131402
2144 Ga0207688_10179547
2145 Ga0207680_10003232
2146 Ga0207680_10077406
2147 Ga0207680_10110291
2148 Ga0207680_10111466
2149 Ga0207680_10131464
2150 Ga0207647_10007234
2151 Ga0207647_10011184
2152 Ga0207647_10046289
2153 Ga0207647_10122033
2154 Ga0207685_10011541
2155 Ga0207685_10045199
2156 Ga0207685_10055572
2157 Ga0207699_10020713
2158 Ga0207699_10045331
2159 Ga0207699_10152742
2160 Ga0207645_10002488
2161 Ga0207645_10002945
2162 Ga0207645_10023617
2163 Ga0207645_10045340
2164 Ga0207645_10063944
2165 Ga0207643_10000108
2166 Ga0207643_10002845
2167 Ga0207643_10014351
2168 Ga0207684_10002963
2169 Ga0207654_10002719
2170 Ga0207654_10011794
2171 Ga0207654_10235793
2172 Ga0207707_10000691
2173 Ga0207707_10040215
2174 Ga0207707_10128051
2175 Ga0207695_10039943
2176 Ga0207671_10003167
2177 Ga0207671_10086869
2178 Ga0207671_10100478
2179 Ga0207671_10295710
2180 Ga0207693_10000825
2181 Ga0207693_10007085
2182 Ga0207693_10009090
2183 Ga0207693_10021699
2184 Ga0207693_10115971
2185 Ga0207693_10147296
2186 Ga0207693_10203547
2187 Ga0207663_10022199
2188 Ga0207660_10000014
2189 Ga0207660_10293877
2190 Ga0207662_10006062
2191 Ga0207662_10008927
2192 Ga0207662_10019625
2193 Ga0207662_10096544
2194 Ga0207662_10202160
2195 Ga0207662_10231465
2196 Ga0207657_10037081
2197 Ga0207657_10046349
2198 Ga0207657_10046352
2199 Ga0207657_10077327
2200 Ga0207657_10228097
2201 Ga0207649_10000086
2202 Ga0207649_10043035
2203 Ga0207649_10076337
2204 Ga0207649_10086928
2205 Ga0207652_10000255
2206 Ga0207652_10044044
2207 Ga0207652_10161000
2208 Ga0207652_10398264
2209 Ga0207681_10000024
2210 Ga0207694_10361708
2211 Ga0207650_10002572
2212 Ga0207650_10012030
2213 Ga0207650_10119105
2214 Ga0207650_10140734
2215 Ga0207650_10174839
2216 Ga0207650_10414781
2217 Ga0207659_10000034
2218 Ga0207659_10018147
2219 Ga0207659_10047389
2220 Ga0207687_10000110
2221 Ga0207687_10008628
2222 Ga0207687_10119758
2223 Ga0207700_10035453
2224 Ga0207700_10068719
2225 Ga0207700_10090236
2226 Ga0207700_10133338
2227 Ga0207700_10151584
2228 Ga0207700_10303672
2229 Ga0207700_10324076
2230 Ga0207664_10007232
2231 Ga0207664_10023737
2232 Ga0207664_10027533
2233 Ga0207644_10000642
2234 Ga0207644_10003006
2235 Ga0207644_10047247
2236 Ga0207644_10112084
2237 Ga0207690_10000270
2238 Ga0207690_10022682
2239 Ga0207690_10051466
2240 Ga0207690_10168676
2241 Ga0207690_10189827
2242 Ga0207706_10001336
2243 Ga0207706_10005854
2244 Ga0207706_10007295
2245 Ga0207706_10007337
2246 Ga0207706_10108352
2247 Ga0207706_10109295
2248 Ga0207706_10341353
2249 Ga0207706_10403529
2250 Ga0207706_10479894
2251 Ga0207686_10000214
2252 Ga0207686_10044726
2253 Ga0207686_10275477
2254 Ga0207709_10000344
2255 Ga0207709_10003540
2256 Ga0207709_10165987
2257 Ga0207670_10000461
2258 Ga0207670_10002631
2259 Ga0207670_10111337
2260 Ga0207670_10151846
2261 Ga0207670_10243822
2262 Ga0207669_10000295
2263 Ga0207669_10001111
2264 Ga0207669_10029074
2265 Ga0207704_10000343
2266 Ga0207704_10052137
2267 Ga0207704_10060299
2268 Ga0207665_10001068
2269 Ga0207665_10003817
2270 Ga0207665_10109985
2271 Ga0207665_10129375
2272 Ga0207691_10000635
2273 Ga0207691_10003768
2274 Ga0207691_10012880
2275 Ga0207711_10007313
2276 Ga0207711_10093487
2277 Ga0207711_10186767
2278 Ga0207711_10223596
2279 Ga0207689_10002655
2280 Ga0207689_10003641
2281 Ga0207689_10024648
2282 Ga0207689_10043531
2283 Ga0207689_10213810
2284 Ga0207661_10000036
2285 Ga0207661_10135662
2286 Ga0207661_10672300
2287 Ga0207679_10000025
2288 Ga0207679_10014282
2289 Ga0207679_10082518
2290 Ga0207679_10374527
2291 Ga0207679_10556082
2292 Ga0207679_10823092
2293 Ga0207667_10007960
2294 Ga0207667_10463367
2295 Ga0207651_10000028
2296 Ga0207651_10013440
2297 Ga0207651_10053292
2298 Ga0207651_10153312
2299 Ga0207651_10224029
2300 Ga0207651_10441443
2301 Ga0207712_10000558
2302 Ga0207712_10002399
2303 Ga0207712_10089239
2304 Ga0207712_10372855
2305 Ga0207668_10000538
2306 Ga0207668_10013637
2307 Ga0207668_10031104
2308 Ga0207640_10006541
2309 Ga0207640_10041977
2310 Ga0207640_10043342
2311 Ga0207640_10170042
2312 Ga0207640_10691598
2313 Ga0207640_10804095
2314 Ga0207658_10000795
2315 Ga0207658_10046077
2316 Ga0207658_10197400
2317 Ga0207658_10370139
2318 Ga0207677_10001822
2319 Ga0207677_10015703
2320 Ga0207677_10043555
2321 Ga0207677_10099423
2322 Ga0207703_10008768
2323 Ga0207703_10012768
2324 Ga0207703_10041098
2325 Ga0207703_10401509
2326 Ga0207703_10556570
2327 Ga0207703_11072959
2328 Ga0207639_10000925
2329 Ga0207639_10018222
2330 Ga0207639_10045906
2331 Ga0207639_10238405
2332 Ga0207639_10276924
2333 Ga0207639_10316368
2334 Ga0207678_10003256
2335 Ga0207678_10004902
2336 Ga0207678_10006940
2337 Ga0207678_10010341
2338 Ga0207678_10016580
2339 Ga0207678_10248247
2340 Ga0207708_10004521
2341 Ga0207708_10019050
2342 Ga0207708_10037218
2343 Ga0207702_10004638
2344 Ga0207702_10065787
2345 Ga0207702_10069314
2346 Ga0207702_10073820
2347 Ga0207641_10001294
2348 Ga0207648_10003105
2349 Ga0207648_10004307
2350 Ga0207648_10011750
2351 Ga0207648_10076986
2352 Ga0207648_10553353
2353 Ga0207676_10000640
2354 Ga0207676_10024382
2355 Ga0207676_10042058
2356 Ga0207676_10313281
2357 Ga0207674_10005795
2358 Ga0207674_10074975
2359 Ga0207674_10104935
2360 Ga0207674_10253632
2361 Ga0207674_10489740
2362 Ga0207675_100003849
2363 Ga0207675_100004255
2364 Ga0207683_10000001
2365 Ga0207683_10004806
2366 Ga0207683_10007077
2367 Ga0207683_10023723
2368 Ga0207683_10044817
2369 Ga0207698_10014590
2370 Ga0207698_10026697
2371 Ga0207698_10127971
2372 Ga0207698_10291971
2373 Ga0207698_10458495
2374 Ga0207698_10996118
2375 Ga0209995_1017210
2376 Ga0209179_1029153
2377 Ga0209968_1030175
2378 Ga0209982_1002600
2379 Ga0209970_1012282
2380 Ga0210002_1001810
2381 Ga0209983_1035560
2382 Ga0209971_1037950
2383 Ga0209966_1001479
2384 Ga0209966_1001617
2385 Ga0209998_10001115
2386 Ga0209998_10001190
2387 Ga0209813_10001830
2388 Ga0209974_10000991
2389 Ga0209974_10123482
2390 Ga0207428_10000823
2391 Ga0207428_10001512
2392 Ga0207428_10105356
2393 Ga0265357_1001253
2394 Ga0268266_10026518
2395 Ga0268266_10135900
2396 Ga0268266_10153292
2397 Ga0268266_10167713
2398 Ga0268266_10311633
2399 Ga0268265_10001288
2400 Ga0268265_10086490
2401 Ga0268265_10555025
2402 Ga0268264_10000456
2403 Ga0268264_10005325
2404 Ga0268264_10074026
2405 Ga0268264_10128105
2406 Ga0268264_10354635
2407 Ga0268264_10559966
2408 Ga0265318_10004032
2409 Ga0265330_10007771
2410 Ga0265330_10053496
2411 Ga0265332_10012389
2412 Ga0265320_10018493
2413 Ga0265325_10004992
2414 Ga0265329_10012587
2415 Ga0265340_10004865
2416 Ga0265340_10020868
2417 Ga0265339_10004645
2418 Ga0265339_10013807
2419 Ga0265331_10012924
2420 Ga0265331_10051231
2421 Ga0265316_10025046
2422 Ga0265316_10070106
2423 Ga0265316_10129850
2424 Ga0307513_10115927
2425 Ga0265313_10022841
2426 Ga0265314_10008306
2427 Ga0265342_10000092
2428 Ga0265342_10014308
2429 Ga0307410_10730951
2430 Ga0316583_10000594
2431 Ga0307510_10192420
2432 Ga0373930_0000196
2433 Ga0373948_0000861
2434 Ga0373948_0001041
2435 Ga0373948_0001761
2436 Ga0373950_0000297
2437 Ga0373950_0005679
2438 Ga0373958_0002061
2439 Ga0373958_0006709
2440 Ga0373958_0008200
2441 Ga0373959_0001177
2442 Ga0373959_0002292
2443 Ga0373938_0000046
2444 Ga0373938_0002402
2445 Ga0373938_0020342
2446 Ga0373926_0021975
2447 Ga0373926_0046822
2448 Ga0373928_0001726
2449 Ga0373928_0046076
2450 Ga0373929_0000284
2451 Ga0373929_0002711
2452 Ga0373934_0022290
2453 Ga0373934_0076615
2454 Ga0373940_0001045
2455 Ga0373940_0001289
2456 Ga0373944_0003559
2457 Ga0373944_0005088
2458 Ga0373944_0040433
2459 Ga0373949_0000546
2460 Ga0373949_0001599
2461 Ga0373949_0024744
2462 Ga0373951_0000608
2463 Ga0373951_0001694
2464 Ga0373951_0020605
2465 Ga0373952_0000574
2466 Ga0373952_0004003
2467 Ga0373923_0016264
2468 Ga0373923_0066038
2469 Ga0373923_0094372
2470 Ga0373932_0000577
2471 Ga0373932_0001670
2472 Ga0373932_0011388
2473 Ga0373936_0005473
2474 Ga0373936_0122148
2475 Ga0373939_0000691
2476 Ga0373939_0001452
2477 Ga0373939_0002354
2478 Ga0373941_0003673
2479 Ga0373941_0007450
2480 Ga0373945_0021266
2481 Ga0373945_0021839
2482 Ga0373945_0036414
2483 Ga0373945_0095753
2484 Ga0373945_0134297
2485 Ga0373953_0007986
2486 Ga0373953_0014564
2487 Ga0373953_0105645
2488 Ga0373954_0004076
2489 Ga0373954_0128019
2490 Ga0373956_0001739
2491 Ga0373956_0001917
2492 Ga0373956_0024511
2493 Ga0373957_0006573
2494 Ga0373957_0006843
2495 Ga0373960_0000587
2496 Ga0373960_0011868
2497 Ga0373960_0058946
2498 Ga0373943_0002330
2499 Ga0373943_0011524
2500 Ga0373943_0084121
2501 Ga0373946_0008539
2502 Ga0373946_0011321
2503 Ga0373946_0036676
2504 Ga0373955_0001883
2505 Ga0373955_0021582
2506 Ga0373955_0150546
2507 Ga0373955_0416613
2508 Ga0373955_0440854
2509 Ga0373942_0001465
2510 Ga0373942_0004097
2511 Ga0373942_0010473
2512 Ga0373961_0000385
2513 Ga0373961_0000869
2514 Ga0373961_0051776
2515 Ga0373961_0054494
2516 Ga0373962_0003613
2517 Ga0373962_0006217
2518 Ga0373962_0062480
2519 Ga0373962_0073279
2520 Ga0373924_0223256
2521 Ga0373931_0001882
2522 Ga0373931_0003354
2523 Ga0373931_0012617
2524 Ga0373935_0002676
2525 Ga0373935_0257719
2526 Ga0373927_0010750
2527 Ga0373927_0122790
2528 Ga0373927_0179285
2529 Ga0373933_0000125
2530 Ga0373933_0002112
2531 Ga0373933_0010711
2532 Ga0373933_0017319
2533 Ga0373947_0001553
2534 Ga0373947_0080026
2535 Ga0373947_0170067
2536 Ga0373947_0436927
2537 Ga0373937_0002048
2538 Ga0373937_0188820
2539 Ga0373937_0223998
2540 Ga0373937_0511460
2541 Ga0373925_0008896
2542 Ga0373925_0033160
2543 Ga0373925_0125619
2544 Ga0373925_0256122
2545 Ga0373925_0640801
2546 Ga0395899_0097748
2547 Ga0395900_0003627
2548 Ga0395898_0174352
2549 Ga0395898_0931075
2550 Ga0395905_0014986
2551 Ga0436364_0794080
2552 Ga0395901_0040521
2553 Ga0395901_0048746
2554 Ga0395901_0152787
2555 Ga0242420_015440
2556 Ga0436365_0657686
2557 Ga0436365_1898637
2558 Ga0436361_0256491
2559 Ga0436361_0950726
2560 Ga0436362_0287115
2561 Ga0436362_1090515
2562 Ga0439453_0001852
2563 Ga0439435_0015895
2564 Ga0439464_0021214
2565 Ga0451577_0297987
2566 Ga0466972_0052403
2567 Ga0466965_0052201
2568 Ga0466965_0148285
2569 Ga0466965_0205969
2570 Ga0466963_0009295
2571 Ga0466968_0059735
2572 Ga0466968_0078596
2573 Ga0466960_0126038
2574 Ga0466959_0433853
2575 Ga0451576_0021183
2576 Ga0466967_0076147
2577 Ga0495617_076952
2578 Ga0495592_0004699
2579 Ga0495592_0014796
2580 Ga0495592_0041714
2581 Ga0495592_0156492
2582 Ga0495592_0192099
2583 Ga0495603_0025855
2584 Ga0495603_0082710
2585 Ga0495629_0003044
2586 Ga0495629_0014934
2587 Ga0495629_0142612
2588 Ga0495629_0157088
2589 Ga0495629_0188613
2590 Ga0495638_0046393
2591 Ga0495641_0016811
2592 Ga0495641_0036035
2593 Ga0495641_0084391
2594 Ga0495651_0002035
2595 Ga0495651_0010719
2596 Ga0495651_0036349
2597 Ga0495651_0098800
2598 Ga0495651_0164118
2599 Ga0495653_0035187
2600 Ga0495653_0065475
2601 Ga0495653_0089810
2602 Ga0495653_0223012
2603 Ga0495653_0359077
2604 Ga0495580_0152763
2605 Ga0495580_0199102
2606 Ga0495582_0003239
2607 Ga0495582_0028856
2608 Ga0495582_0084807
2609 Ga0495582_0104126
2610 Ga0495605_0035609
2611 Ga0495639_0121074
2612 Ga0495662_0048090
2613 Ga0495662_0107218
2614 Ga0495664_0016212
2615 Ga0495664_0030072
2616 Ga0495664_0101108
2617 Ga0495664_0110833
2618 Ga0495584_0007023
2619 Ga0495584_0018261
2620 Ga0495584_0111683
2621 Ga0495584_0177029
2622 Ga0495585_0000856
2623 Ga0495585_0007417
2624 Ga0495585_0028456
2625 Ga0495585_0111422
2626 Ga0495594_0008038
2627 Ga0495594_0011796
2628 Ga0495594_0096793
2629 Ga0495594_0110433
2630 Ga0495607_0027202
2631 Ga0495607_0195196
2632 Ga0495606_0009508
2633 Ga0495606_0134135
2634 Ga0495608_0000915
2635 Ga0495608_0050572
2636 Ga0495608_0058533
2637 Ga0495608_0066508
2638 Ga0495608_0076902
2639 Ga0495610_0053992
2640 Ga0495618_0052960
2641 Ga0495628_0008958
2642 Ga0495628_0032827
2643 Ga0495628_0082672
2644 Ga0495628_0112489
2645 Ga0495628_0184642
2646 Ga0495630_0126393
2647 Ga0495630_0130219
2648 Ga0495630_0238275
2649 Ga0495630_0541043
2650 Ga0495630_0659536
2651 Ga0495630_1022742
2652 Ga0495631_0094340
2653 Ga0495637_0044734
2654 Ga0495637_0113199
2655 Ga0495644_0011268
2656 Ga0495644_0033593
2657 Ga0495648_0002380
2658 Ga0495663_0021146
2659 Ga0495666_0014396
2660 Ga0495666_0018752
2661 Ga0495666_0136415
2662 Ga0495642_0167641
2663 Ga0495652_0005789
2664 Ga0495652_0020937
2665 Ga0495652_0063623
2666 Ga0495652_0076458
2667 Ga0495652_0261233
2668 Ga0495652_0352001
2669 Ga0495665_0061258
2670 Ga0495665_0082559
2671 Ga0495665_0097718
2672 Ga0495640_0071044
2673 Ga0495640_0101573
2674 Ga0495640_0209888
2675 Ga0495640_0348910
2676 Ga0495640_0486745
2677 Ga0495586_0075875
2678 Ga0495587_0001734
2679 Ga0495587_0018262
2680 Ga0495587_0076892
2681 Ga0495587_0116350
2682 Ga0495598_0000233
2683 Ga0495598_0020531
2684 Ga0495609_0039144
2685 Ga0495621_0008367
2686 Ga0495621_0050241
2687 Ga0495621_0091691
2688 Ga0495645_0011672
2689 Ga0495645_0086453
2690 Ga0495622_0024440
2691 Ga0495622_0141676
2692 Ga0495633_0017034
2693 Ga0495667_0000259
2694 Ga0495667_0018366
2695 Ga0495667_0070601
2696 Ga0495656_0000215
2697 Ga0495668_0039909
2698 Ga0495668_0046683
2699 Ga0495634_0008814
2700 Ga0495634_0180235
2701 Ga0495611_0003842
2702 Ga0495611_0078575
2703 Ga0495611_0277951
2704 Ga0495625_0017744
2705 Ga0495635_0010301
2706 Ga0495635_0015969
2707 Ga0495635_0026638
2708 Ga0495635_0445479
2709 Ga0495635_0523152
2710 Ga0495659_0002574
2711 Ga0495659_0054558
2712 Ga0495661_0063130
2713 Ga0495661_0222522
2714 Ga0495588_0020179
2715 Ga0495588_0131939
2716 Ga0495588_0243427
2717 Ga0495657_0015814
2718 Ga0495657_0091756
2719 Ga0495599_0002681
2720 Ga0495599_0017056
2721 Ga0495599_0042653
2722 Ga0495599_0115730
2723 Ga0495623_0020755
2724 Ga0495623_0064743
2725 Ga0495623_0132012
2726 Ga0495646_0010194
2727 Ga0495646_0026632
2728 Ga0495646_0059772
2729 Ga0495647_0020437
2730 Ga0495658_0000360
2731 Ga0495658_0005781
2732 Ga0495658_0094433
2733 Ga0495613_0006693
2734 Ga0495613_0027827
2735 Ga0495613_0033307
2736 Ga0495613_0065362
2737 Ga0495613_0207131
2738 Ga0495624_0155778
2739 Ga0495624_0227022
2740 Ga0495624_0240543
2741 Ga0495624_0256231
2742 Ga0495624_0260707
2743 Ga0495670_0000213
2744 Ga0495670_0033566
2745 Ga0495670_0144478
2746 Ga0495671_0062082
2747 Ga0495671_0301809
2748 Ga0495649_0040385
2749 Ga0495649_0368703
2750 Ga0495600_0006046
2751 Ga0495600_0025897
2752 Ga0495600_0052146
2753 Ga0495600_0280197
2754 Ga0495581_0049437
2755 Ga0495581_0057033
2756 Ga0495581_0059837
2757 Ga0495581_0064661
2758 Ga0495604_0002294
2759 Ga0495604_0006070
2760 Ga0495604_0009049
2761 Ga0495604_0057607
2762 Ga0495604_0215008
2763 Ga0495636_0138265
2764 Ga0495674_0116513
2765 Ga0495674_0138581
2766 Ga0495674_0252836
2767 Ga0495674_0338640
2768 Ga0495674_0371609
2769 Ga0495674_0627891
2770 Ga0495676_0103110
2771 Ga0495676_0142975
2772 Ga0495680_0002446
2773 Ga0495680_0004222
2774 Ga0495680_0006606
2775 Ga0495680_0012206
2776 Ga0495680_0018853
2777 Ga0495683_0102690
2778 Ga0495683_0107894
2779 Ga0495675_0000147
2780 Ga0495675_0001653
2781 Ga0495675_0156734
2782 Ga0495675_0226208
2783 Ga0495673_0089310
2784 Ga0495684_0028528
2785 Ga0495684_0047645
2786 Ga0495684_0133969
2787 Ga0495686_0108062
2788 Ga0495593_0014970
2789 Ga0495593_0039262
2790 Ga0495593_0050848
2791 Ga0495593_0059876
2792 Ga0495593_0090251
2793 Ga0495593_0091642
2794 Ga0495602_0017376
2795 Ga0495602_0017828
2796 Ga0495602_0021291
2797 Ga0495602_0032133
2798 Ga0495602_0371326
2799 Ga0495614_0016270
2800 Ga0495614_0103831
2801 Ga0495614_0162082
2802 Ga0495615_0052303
2803 Ga0495626_0096330
2804 Ga0495626_0155680
2805 Ga0495626_0185251
2806 Ga0496100_0006594
2807 Ga0496100_0013961
2808 Ga0496100_0017287
2809 Ga0496100_0019150
2810 Ga0496100_0027597
2811 Ga0496100_0055392
2812 Ga0496100_0155297
2813 Ga0496100_0654765
2814 Ga0496101_0000079
2815 Ga0496101_0008107
2816 Ga0496101_0040176
2817 Ga0496101_0042859
2818 Ga0496101_0207438
2819 Ga0496101_0494469
2820 Ga0496102_0000942
2821 Ga0496102_0008860
2822 Ga0496102_0032833
2823 Ga0496102_0045286
2824 Ga0496102_0058807
2825 Ga0496102_0062689
2826 Ga0496102_0065998
2827 Ga0496102_0240279
2828 Ga0496102_0484428
2829 Ga0496102_0570034
2830 Ga0496102_0634479
2831 Ga0496103_0002375
2832 Ga0496103_0003062
2833 Ga0496103_0003997
2834 Ga0496103_0019249
2835 Ga0496103_0127351
2836 Ga0496103_0181710
2837 Ga0496104_0000431
2838 Ga0496104_0001836
2839 Ga0496104_0004143
2840 Ga0496104_0004191
2841 Ga0496104_0004953
2842 Ga0496104_0048661
2843 Ga0496104_0057612
2844 Ga0496104_0119489
2845 Ga0496104_0121646
2846 Ga0496105_0003143
2847 Ga0496105_0010944
2848 Ga0496105_0023618
2849 Ga0496105_0030941
2850 Ga0496105_0106414
2851 Ga0496105_0198022
2852 Ga0496105_0269708
2853 Ga0496105_0482244
2854 Ga0496106_0001143
2855 Ga0496106_0003554
2856 Ga0496106_0005844
2857 Ga0496106_0006633
2858 Ga0496106_0020095
2859 Ga0496106_0025502
2860 Ga0496106_0045494
2861 Ga0496106_0161002
2862 Ga0496106_0210718
2863 Ga0496106_0243728
2864 Ga0496106_0263203
2865 Ga0496107_0000359
2866 Ga0496107_0000436
2867 Ga0496107_0001363
2868 Ga0496107_0015236
2869 Ga0496107_0031502
2870 Ga0496107_0070373
2871 Ga0496107_0426888
2872 Ga0496107_0641522
2873 Ga0496108_0002867
2874 Ga0496108_0004006
2875 Ga0496108_0005147
2876 Ga0496108_0009582
2877 Ga0496108_0014038
2878 Ga0496108_0026663
2879 Ga0496108_0049594
2880 Ga0496108_0070596
2881 Ga0496108_0539247
2882 Ga0496109_0000223
2883 Ga0496109_0000404
2884 Ga0496109_0003116
2885 Ga0496109_0003557
2886 Ga0496109_0011617
2887 Ga0496109_0018871
2888 Ga0496109_0032437
2889 Ga0496109_0043419
2890 Ga0496109_0062763
2891 Ga0496109_0129345
2892 Ga0496109_0160862
2893 Ga0496109_0353838
2894 Ga0496109_0433724
2895 Ga0496110_0001910
2896 Ga0496110_0002394
2897 Ga0496110_0003653
2898 Ga0496110_0016589
2899 Ga0496110_0018162
2900 Ga0496110_0021793
2901 Ga0496110_0156603
2902 Ga0496110_0216741
2903 Ga0496110_0224907
2904 Ga0496110_0352580
2905 Ga0496110_0382159
2906 Ga0496110_0393332
2907 Ga0496111_0001774
2908 Ga0496111_0002312
2909 Ga0496111_0010932
2910 Ga0496111_0019333
2911 Ga0496111_0031701
2912 Ga0496111_0042841
2913 Ga0496111_0052032
2914 Ga0496111_0224552
2915 Ga0496112_0002963
2916 Ga0496112_0003601
2917 Ga0496112_0011928
2918 Ga0496112_0013071
2919 Ga0496112_0016019
2920 Ga0496112_0033447
2921 Ga0496112_0041430
2922 Ga0496112_0067614
2923 Ga0496112_0153304
2924 Ga0496112_0421394
2925 Ga0496112_0961166
2926 Ga0496112_0991408
2927 Ga0496113_0000624
2928 Ga0496113_0001396
2929 Ga0496113_0001735
2930 Ga0496113_0019330
2931 Ga0496113_0024186
2932 Ga0496113_0055173
2933 Ga0496113_0084102
2934 Ga0496113_0179025
2935 Ga0496113_0183840
2936 Ga0496113_0194380
2937 Ga0496113_0466813
2938 Ga0496113_0553775
2939 Ga0496114_0003222
2940 Ga0496114_0003326
2941 Ga0496114_0026647
2942 Ga0496114_0030663
2943 Ga0496114_0104819
2944 Ga0496115_0000547
2945 Ga0496115_0008495
2946 Ga0496115_0011806
2947 Ga0496115_0269700
2948 Ga0496115_0616009
2949 Ga0496116_0244215
2950 Ga0496118_0158767
2951 Ga0496119_0004123
2952 Ga0496119_0044953
2953 Ga0496120_0006519
2954 Ga0496120_0051081
2955 Ga0496121_0041733
2956 Ga0496122_0081141
2957 Ga0496125_0033107
2958 Ga0496126_0040330
2959 Ga0501033_0076983
2960 Ga0501034_0112807
2961 Ga0501034_0418822
2962 Ga0501034_0485901
2963 Ga0501036_0027820
2964 Ga0501036_0364034
2965 Ga0501038_0196245
2966 Ga0501038_0285339
2967 Ga0501039_0092711
2968 Ga0501039_0435483
2969 Ga0501039_0517843
2970 Ga0501040_0100563
2971 Ga0501042_0248800
2972 Ga0501043_0017209
2973 Ga0501047_0038971
2974 Ga0501047_0252772
2975 Ga0501047_0534621
2976 Ga0501048_0165489
2977 Ga0501068_0015903
2978 Ga0501068_0297176
2979 Ga0501070_0019024
2980 Ga0501070_0084044
2981 Ga0501071_0049958
2982 Ga0501071_0285310
2983 Ga0501072_0002712
2984 Ga0501072_0004481
2985 Ga0501072_0334990
2986 Ga0501073_0033637
2987 Ga0501073_0135204
2988 Ga0501075_0083915
2989 Ga0501076_0062530
2990 Ga0501077_0018282
2991 Ga0501077_0342582
2992 Ga0501079_0087588
2993 Ga0501079_0152376
2994 Ga0501079_0195043
2995 Ga0501079_0232621
2996 Ga0501079_0872822
2997 Ga0501080_0235329
2998 Ga0501080_0239470
2999 Ga0501080_0266948
3000 Ga0501081_0050631
3001 Ga0501081_0245361
3002 Ga0501083_0185812
3003 Ga0501083_0290466
3004 Ga0501035_0001940
3005 Ga0501035_0061568
3006 Ga0501044_0063861
3007 Ga0501044_0065573
3008 Ga0501044_0145089
3009 Ga0501044_0387481
3010 Ga0501045_0212135
3011 Ga0501045_0341272
3012 nmdc:mga03683_14084_c2
3013 nmdc:mga03683_29136_c1
3014 nmdc:mga03n38_20855_c1
3015 nmdc:mga03n38_29865_c1
3016 nmdc:mga00v17_135626_c1
3017 nmdc:mga00v17_23425_c1
3018 nmdc:mga00v17_52949_c1
3019 nmdc:mga0yw44_1437_c1
3020 nmdc:mga0yw44_480014_c1
3021 nmdc:mga0yw44_9426_c1
3022 nmdc:mga0k408_2858_c1
3023 nmdc:mga0k408_8431_c1
3024 nmdc:mga06z11_23264_c1
3025 nmdc:mga06z11_25302_c1
3026 nmdc:mga04h51_8211_c1
3027 nmdc:mga07m45_23396_c1
3028 nmdc:mga07m45_5426_c1
3029 nmdc:mga05p37_14557_c1
3030 nmdc:mga05p37_210565_c1
3031 nmdc:mga05p37_31120_c1
3032 nmdc:mga05p37_36596_c1
3033 nmdc:mga05p37_775316_c1
3034 nmdc:mga05p37_884548_c1
3035 nmdc:mga09592_84725_c1
3036 nmdc:mga0qj67_150426_c1
3037 nmdc:mga0qj67_18_c1
3038 nmdc:mga0qj67_563395_c1
3039 nmdc:mga06r32_100936_c1
3040 nmdc:mga06r32_40585_c1
3041 nmdc:mga06r32_64510_c1
3042 nmdc:mga08y16_110772_c1
3043 nmdc:mga08y16_133176_c1
3044 nmdc:mga08y16_226164_c1
3045 nmdc:mga08y16_319526_c1
3046 nmdc:mga08y16_468887_c1
3047 nmdc:mga08y16_939725_c1
3048 nmdc:mga0n895_1039522_c1
3049 nmdc:mga0n895_225470_c1
3050 nmdc:mga0n895_280338_c1
3051 nmdc:mga0n895_330737_c1
3052 nmdc:mga0n895_35380_c1
3053 nmdc:mga0n895_52081_c1
3054 nmdc:mga0n895_622_c1
3055 nmdc:mga0n895_64950_c2
3056 nmdc:mga0n895_94521_c1
3057 nmdc:mga0n895_946020_c1
3058 nmdc:mga0rr50_221431_c1
3059 nmdc:mga0rr50_259688_c1
3060 nmdc:mga0rr50_50061_c1
3061 nmdc:mga0rr50_68530_c1
3062 nmdc:mga0rr50_711847_c1
3063 nmdc:mga0rr50_79217_c1
3064 nmdc:mga08x19_38629_c1
3065 nmdc:mga0a205_27052_c1
3066 nmdc:mga0a205_368579_c1
3067 nmdc:mga0a205_7768_c1
3068 nmdc:mga0sz30_12769_c1
3069 nmdc:mga0sz30_96175_c1
3070 Ga0495601_0001750
3071 Ga0495601_0002382
3072 Ga0495601_0017376
3073 Ga0495601_0025698
3074 Ga0495601_0063960
3075 Ga0495601_0120741
3076 Ga0495601_0153457
3077 Ga0495612_0008869
3078 Ga0495612_0010274
3079 Ga0495612_0043535
3080 Ga0495612_0064139
3081 Ga0495655_0003016
3082 Ga0495655_0008381
3083 Ga0495655_0019962
3084 Ga0495595_0000576
3085 Ga0495595_0004751
3086 Ga0495595_0032435
3087 Ga0495595_0037073
3088 Ga0495595_0090029
3089 Ga0495619_0000132
3090 Ga0495619_0000178
3091 Ga0495619_0011281
3092 Ga0495619_0031232
3093 Ga0495619_0037425
3094 Ga0495619_0037480
3095 Ga0495619_0055466
3096 Ga0495619_0249010
3097 Ga0500646_0039137
3098 Ga0500647_0077257
3099 Ga0500641_0024406
3100 Ga0500654_074863
3101 Ga0500557_000012
3102 Ga0500595_014887
3103 Ga0500614_064498
3104 Ga0500642_0000232
3105 Ga0500568_0098276
3106 Ga0500590_182758
3107 Ga0500604_0232428
3108 Ga0500625_028959
3109 Ga0501084_0170578
3110 Ga0501084_0336545
3111 Ga0500661_004079
3112 Ga0501082_0000145
3113 Ga0501082_0077631
3114 Ga0501082_0155815
3115 Ga0501082_0156230
3116 Ga0501082_0259839
3117 Ga0530510_0340487
3118 2507505059
3119 2508538995
3120 2508695310
3121 2513639744
3122 2513647769
3123 2513873717
3124 2514015235
3125 2515625673
3126 2517102161
3127 2793064970
3128 2805915800
3129 2818237476
3130 2824608313
3131 2824617217
3132 2824660117
3133 2824677769
3134 2824692046
3135 2824700583
3136 2824772602
3137 2838124323
3138 2841948865
3139 2841951801
3140 2841973822
3141 2841980148
3142 2841985331
3143 2842043684
3144 2842052326
3145 2847941954
3146 2849082864
3147 2874597058
3148 2874624606
3149 2874648094
3150 2876777522
3151 2876825604
3152 2879077782
3153 2879127856
3154 2879148877
3155 2881365853
3156 2885371215
3157 2888420491
3158 2904672055
3159 2904715762
3160 2932794500
3161 2932806781
3162 2935615366
3163 2935654813
3164 2935663754
3165 2935773427
3166 2935782301
3167 2935789253
3168 2935797190
3169 2935825256
3170 2935853090
3171 2935888552
3172 2935910162
3173 2935918541
3174 2935927927
3175 2935936201
3176 2935944246
3177 2935952683
3178 2935969523
3179 2935977715
3180 2935984968
3181 2936017849
3182 2936026352
3183 2936031600
3184 2936053386
3185 2936056137
3186 2941532513
3187 3005710820
3188 8016525954
3189 8016557871
3190 8016569251
3191 8016581886
3192 8016595890
3193 8016618659
3194 8016623402
3195 8016635860
3196 8019530838
3197 8019540744
3198 8019622772
3199 8019630334
3200 8019640278
3201 8019652671
3202 8019667163
3203 8019676948
3204 8019679040
3205 8019696486
3206 8056971101

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00814

TsaD

tRNA N6-adenosine threonylcarbamoyltransferase

52

203

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nak-assembly1.cif.gz_C bacterial protein complex tm bde complex 0.8642 1 198
2a6a-assembly1.cif.gz_A crystal structure of glycoprotein endopeptidase (tm0874) from thermotoga maritima at 2.50 a resolution 0.858 1 198
3r6m-assembly2.cif.gz_C crystal structure of vibrio parahaemolyticus yeaz 0.8432 1 198
4y0w-assembly1.cif.gz_D-2 yeaz from pseudomonas aeruginosa 0.8207 1 198
4y0w-assembly1.cif.gz_E-2 yeaz from pseudomonas aeruginosa 0.8176 1 210
ID Description Score Start End Superfamily
af_P76256_2_102_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9396 2 97 3.30.420.40
5br9C01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9391 2 96 3.30.420.40
af_Q2FWL0_1_92_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9254 1 94 3.30.420.40
af_Q2FWL0_1_92_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9159 1 94 3.30.420.40
3zeuB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9139 1 100 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A382ESK2-F1-model_v4 Gcp-like domain-containing protein 0.9452 1 97 GO:0002949
GO:0005829
AF-A0A7Y3ELP6-F1-model_v4 tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB 0.9389 1 100 GO:0002949
GO:0005829
GO:0016740
AF-A0A5E6NHC8-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaB (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaB) 0.9369 1 96 GO:0002949
AF-A0A1Q6UYR5-F1-model_v4 tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB 0.9347 1 98 GO:0002949
GO:0005829
GO:0016740
AF-A0A4V5SEI4-F1-model_v4 deleted 0.9341 1 96

Map