F495006

General Info

Members Datasets Scaffolds Average Seq Length
1603 330 1603 166

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_1623280|Ga0451576_1623280_151_648
Length 165
Sequence VADQYSFDVVSQVDMQEVKNAVDQTMKEVRQRFDFKGSKTDLTLMEKERTLIVLSDDEFKLKAVLEILKGKFVKRGVSVKALTFGQVEQALGGTVRQAIAIQSGIPGEKAKEIAKEIRDGKFKVQTQIQGEQLRVQSKSRDELQAVIAFLKQKDFEIDLQYINYR

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
103 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
104 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
137 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
204 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
205 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
206 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
207 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
208 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
209 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
210 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
211 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
212 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
213 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
214 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
215 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
216 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
217 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
218 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
219 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
220 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
221 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
222 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
223 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
224 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
226 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
227 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
228 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
231 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
232 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
233 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
234 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
235 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
236 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
237 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
238 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
239 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
240 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
241 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
242 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
243 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
244 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
245 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
246 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
247 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
248 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
251 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
254 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
255 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
256 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
257 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
258 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
259 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
260 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
261 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
275 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
276 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
277 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
278 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
279 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
280 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
281 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
282 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
283 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
284 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
285 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
286 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
287 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
288 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
289 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
290 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
291 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
292 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
293 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
294 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
295 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
296 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
297 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
298 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
299 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
300 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
301 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
302 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
303 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
304 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
305 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
306 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
307 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
308 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
309 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
310 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
311 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
312 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
313 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
314 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
315 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049849 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought Metagenome Rhizosphere
317 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
318 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
319 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
320 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
321 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
322 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
323 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
324 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
325 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
326 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
327 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
328 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
329 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
330 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.06
Nodule 0
Rhizoplane 1.43
Rhizosphere 98
Stem 0
Stem Tuber 0
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_25904 2124908027 Bacteria 910
2 SwRhRL2b_contig_1494996 2162886007 Bacteria 2385
3 JGI24737J22298_10163824 3300001990 Bacteria 656
4 JGI24748J21848_1000003 3300002074 Bacteria 323921
5 JGI24749J21850_1060465 3300002076 Unclassified 575
6 JGI24034J26672_10000005 3300002239 Bacteria 404185
7 JGI24751J29686_10000085 3300002459 Bacteria 52356
8 JGI25406J46586_10005741 3300003203 Bacteria 5736
9 JGI25406J46586_10011023 3300003203 Bacteria 3976
10 JGI25406J46586_10011063 3300003203 Unclassified 3966
11 Ga0065714_10064444 3300005288 Bacteria 94227
12 Ga0065704_10039429 3300005289 Unclassified 837
13 Ga0065704_10117053 3300005289 Bacteria 1842
14 Ga0065704_10132432 3300005289 Bacteria 1612
15 Ga0065704_10143041 3300005289 Bacteria 1499
16 Ga0065704_10244530 3300005289 Bacteria 1003
17 Ga0065704_10450959 3300005289 Unclassified 693
18 Ga0065704_10475927 3300005289 Unclassified 685
19 Ga0065712_10010420 3300005290 Unclassified 3108
20 Ga0065712_10025721 3300005290 Bacteria 1780
21 Ga0065712_10030034 3300005290 Unclassified 876
22 Ga0065712_10067736 3300005290 Bacteria 94196
23 Ga0065712_10072133 3300005290 Unclassified 4883
24 Ga0065712_10079828 3300005290 Bacteria 3175
25 Ga0065712_10355129 3300005290 Unclassified 782
26 Ga0065715_10003956 3300005293 Bacteria 3758
27 Ga0065715_10014485 3300005293 Bacteria 2224
28 Ga0065715_10018531 3300005293 Bacteria 2202
29 Ga0065715_10090715 3300005293 Bacteria 6575
30 Ga0065715_10100860 3300005293 Bacteria 3260
31 Ga0065715_10122203 3300005293 Unclassified 2188
32 Ga0065715_10123337 3300005293 Unclassified 2168
33 Ga0065715_10274289 3300005293 Bacteria 1103
34 Ga0065715_10327167 3300005293 Bacteria 991
35 Ga0065715_10368634 3300005293 Bacteria 924
36 Ga0065715_10379622 3300005293 Unclassified 909
37 Ga0065715_10411178 3300005293 Bacteria 869
38 Ga0065715_10524944 3300005293 Unclassified 753
39 Ga0065715_10621480 3300005293 Unclassified 695
40 Ga0065715_10819193 3300005293 Unclassified 603
41 Ga0065707_10001462 3300005295 Bacteria 11811
42 Ga0065707_10020998 3300005295 Bacteria 1471
43 Ga0065707_10026934 3300005295 Bacteria 1489
44 Ga0065707_10089972 3300005295 Unclassified 4237
45 Ga0065707_10113776 3300005295 Bacteria 2316
46 Ga0065707_10170993 3300005295 Bacteria 1485
47 Ga0065707_10348724 3300005295 Bacteria 922
48 Ga0070658_10008799 3300005327 Bacteria 8113
49 Ga0070658_10146778 3300005327 Bacteria 1973
50 Ga0070676_10061106 3300005328 Bacteria 2239
51 Ga0070676_10131569 3300005328 Bacteria 1583
52 Ga0070676_10202062 3300005328 Bacteria 1303
53 Ga0070683_101136427 3300005329 Unclassified 750
54 Ga0070690_100002320 3300005330 Bacteria 10217
55 Ga0070690_100106789 3300005330 Bacteria 1863
56 Ga0070690_100115287 3300005330 Bacteria 1797
57 Ga0070690_100527616 3300005330 Bacteria 887
58 Ga0070690_100812537 3300005330 Bacteria 726
59 Ga0070670_100000057 3300005331 Bacteria 118540
60 Ga0070670_100088040 3300005331 Bacteria 2669
61 Ga0070670_100128392 3300005331 Bacteria 2188
62 Ga0070670_100202334 3300005331 Bacteria 1726
63 Ga0070670_100272632 3300005331 Bacteria 1477
64 Ga0070670_100622243 3300005331 Unclassified 967
65 Ga0070670_100875061 3300005331 Unclassified 814
66 Ga0070670_101776661 3300005331 Unclassified 568
67 Ga0070677_10310605 3300005333 Bacteria 804
68 Ga0068869_100019360 3300005334 Unclassified 4649
69 Ga0068869_100029072 3300005334 Bacteria 3869
70 Ga0068869_100187201 3300005334 Bacteria 1626
71 Ga0068869_100214733 3300005334 Bacteria 1522
72 Ga0068869_100323833 3300005334 Bacteria 1251
73 Ga0068869_100984298 3300005334 Unclassified 734
74 Ga0068869_101084475 3300005334 Unclassified 700
75 Ga0068869_101149542 3300005334 Bacteria 681
76 Ga0068869_101609049 3300005334 Unclassified 579
77 Ga0070666_10128161 3300005335 Bacteria 1762
78 Ga0070666_10131359 3300005335 Bacteria 1740
79 Ga0070666_11043000 3300005335 Bacteria 607
80 Ga0070680_100004835 3300005336 Bacteria 10143
81 Ga0070680_100141451 3300005336 Bacteria 2018
82 Ga0070680_100310139 3300005336 Bacteria 1339
83 Ga0070680_100364168 3300005336 Bacteria 1230
84 Ga0070680_100379591 3300005336 Bacteria 1203
85 Ga0070680_100900142 3300005336 Bacteria 763
86 Ga0070682_100000068 3300005337 Bacteria 96186
87 Ga0070682_100001206 3300005337 Bacteria 14741
88 Ga0070682_100051449 3300005337 Bacteria 2575
89 Ga0070682_100323292 3300005337 Bacteria 1140
90 Ga0070682_101327154 3300005337 Bacteria 612
91 Ga0068868_100052164 3300005338 Bacteria 3220
92 Ga0068868_100106440 3300005338 Bacteria 2275
93 Ga0068868_100546663 3300005338 Bacteria 1020
94 Ga0068868_100574778 3300005338 Bacteria 996
95 Ga0068868_100659147 3300005338 Unclassified 933
96 Ga0068868_101146754 3300005338 Bacteria 717
97 Ga0068868_101149644 3300005338 Unclassified 716
98 Ga0070660_100197598 3300005339 Bacteria 1631
99 Ga0070660_101466709 3300005339 Unclassified 580
100 Ga0070689_100095221 3300005340 Bacteria 2352
101 Ga0070689_100101389 3300005340 Bacteria 2278
102 Ga0070689_100373944 3300005340 Bacteria 1200
103 Ga0070689_100519150 3300005340 Bacteria 1023
104 Ga0070689_100567312 3300005340 Unclassified 980
105 Ga0070689_100577548 3300005340 Bacteria 971
106 Ga0070689_101166374 3300005340 Bacteria 690
107 Ga0070689_101269317 3300005340 Bacteria 663
108 Ga0070687_100037644 3300005343 Bacteria 2420
109 Ga0070687_100075607 3300005343 Bacteria 1822
110 Ga0070687_100082579 3300005343 Bacteria 1757
111 Ga0070687_100206822 3300005343 Bacteria 1193
112 Ga0070687_100406104 3300005343 Bacteria 894
113 Ga0070687_100817661 3300005343 Unclassified 662
114 Ga0070692_10002955 3300005345 Bacteria 6761
115 Ga0070692_10045813 3300005345 Bacteria 2257
116 Ga0070692_10102275 3300005345 Bacteria 1573
117 Ga0070692_10141226 3300005345 Bacteria 1363
118 Ga0070692_10637789 3300005345 Unclassified 709
119 Ga0070692_10693038 3300005345 Unclassified 685
120 Ga0070668_100159518 3300005347 Bacteria 1829
121 Ga0070668_100205070 3300005347 Bacteria 1620
122 Ga0070668_100294945 3300005347 Bacteria 1358
123 Ga0070668_100307036 3300005347 Bacteria 1332
124 Ga0070669_100028643 3300005353 Bacteria 4011
125 Ga0070669_100047062 3300005353 Unclassified 3146
126 Ga0070669_100118096 3300005353 Bacteria 2020
127 Ga0070669_100159622 3300005353 Bacteria 1751
128 Ga0070669_100472247 3300005353 Bacteria 1037
129 Ga0070669_101223556 3300005353 Unclassified 649
130 Ga0070675_100037011 3300005354 Bacteria 3973
131 Ga0070675_100096163 3300005354 Bacteria 2488
132 Ga0070675_100112115 3300005354 Unclassified 2309
133 Ga0070675_100330106 3300005354 Bacteria 1349
134 Ga0070675_100495441 3300005354 Bacteria 1100
135 Ga0070675_100601110 3300005354 Bacteria 997
136 Ga0070675_100658421 3300005354 Bacteria 952
137 Ga0070675_101137737 3300005354 Unclassified 718
138 Ga0070671_100005420 3300005355 Bacteria 10177
139 Ga0070671_100017392 3300005355 Bacteria 5823
140 Ga0070671_100030391 3300005355 Bacteria 4457
141 Ga0070671_100044534 3300005355 Bacteria 3688
142 Ga0070671_100200392 3300005355 Unclassified 1692
143 Ga0070671_100230820 3300005355 Unclassified 1570
144 Ga0070671_100459813 3300005355 Bacteria 1092
145 Ga0070671_100800923 3300005355 Unclassified 820
146 Ga0070674_100014407 3300005356 Bacteria 4916
147 Ga0070674_100458649 3300005356 Bacteria 1053
148 Ga0070673_100009655 3300005364 Bacteria 6490
149 Ga0070673_100192708 3300005364 Bacteria 1751
150 Ga0070673_100246460 3300005364 Bacteria 1555
151 Ga0070673_100456562 3300005364 Bacteria 1150
152 Ga0070673_100466044 3300005364 Bacteria 1138
153 Ga0070673_100469070 3300005364 Bacteria 1135
154 Ga0070673_100689232 3300005364 Bacteria 937
155 Ga0070673_100834134 3300005364 Bacteria 852
156 Ga0070673_101030064 3300005364 Bacteria 767
157 Ga0070673_101203432 3300005364 Bacteria 710
158 Ga0070688_100039510 3300005365 Bacteria 2887
159 Ga0070688_100064136 3300005365 Bacteria 2330
160 Ga0070688_100326691 3300005365 Bacteria 1116
161 Ga0070659_100002999 3300005366 Bacteria 12012
162 Ga0070659_100919953 3300005366 Bacteria 765
163 Ga0070667_100727791 3300005367 Unclassified 919
164 Ga0070703_10000036 3300005406 Bacteria 65827
165 Ga0070703_10006367 3300005406 Bacteria 3309
166 Ga0070703_10212852 3300005406 Bacteria 765
167 Ga0070703_10220340 3300005406 Bacteria 755
168 Ga0070713_100832593 3300005436 Bacteria 885
169 Ga0070713_101699829 3300005436 Bacteria 613
170 Ga0070701_10002888 3300005438 Bacteria 6697
171 Ga0070701_10037404 3300005438 Bacteria 2450
172 Ga0070701_10199108 3300005438 Bacteria 1183
173 Ga0070701_10202403 3300005438 Bacteria 1174
174 Ga0070701_10256663 3300005438 Bacteria 1058
175 Ga0070701_10273833 3300005438 Bacteria 1028
176 Ga0070711_100147103 3300005439 Bacteria 1773
177 Ga0070711_100193174 3300005439 Unclassified 1566
178 Ga0070705_100008077 3300005440 Bacteria 5203
179 Ga0070705_100066331 3300005440 Bacteria 2164
180 Ga0070705_100094488 3300005440 Unclassified 1872
181 Ga0070705_100144075 3300005440 Bacteria 1572
182 Ga0070705_100222023 3300005440 Bacteria 1309
183 Ga0070705_100249141 3300005440 Unclassified 1246
184 Ga0070705_100251569 3300005440 Bacteria 1241
185 Ga0070705_100320993 3300005440 Bacteria 1118
186 Ga0070705_100466667 3300005440 Bacteria 951
187 Ga0070705_100499475 3300005440 Unclassified 923
188 Ga0070700_100000305 3300005441 Bacteria 25711
189 Ga0070700_100013026 3300005441 Bacteria 4663
190 Ga0070700_100013485 3300005441 Bacteria 4591
191 Ga0070700_100038424 3300005441 Bacteria 2917
192 Ga0070700_100266391 3300005441 Unclassified 1236
193 Ga0070700_100534927 3300005441 Bacteria 908
194 Ga0070700_100743993 3300005441 Bacteria 784
195 Ga0070700_100845270 3300005441 Bacteria 741
196 Ga0070700_100899361 3300005441 Bacteria 721
197 Ga0070700_101026009 3300005441 Unclassified 680
198 Ga0070694_100003401 3300005444 Bacteria 9536
199 Ga0070694_100012648 3300005444 Bacteria 5254
200 Ga0070694_100034624 3300005444 Unclassified 3332
201 Ga0070694_100053308 3300005444 Bacteria 2737
202 Ga0070694_100064168 3300005444 Bacteria 2514
203 Ga0070694_100069501 3300005444 Bacteria 2423
204 Ga0070694_100084711 3300005444 Unclassified 2212
205 Ga0070694_100147884 3300005444 Bacteria 1713
206 Ga0070694_100157885 3300005444 Bacteria 1662
207 Ga0070694_100158270 3300005444 Bacteria 1660
208 Ga0070694_100196629 3300005444 Unclassified 1501
209 Ga0070694_100212075 3300005444 Bacteria 1449
210 Ga0070694_100243252 3300005444 Bacteria 1358
211 Ga0070694_100276299 3300005444 Bacteria 1279
212 Ga0070694_100452719 3300005444 Bacteria 1014
213 Ga0070694_100527923 3300005444 Bacteria 942
214 Ga0070708_100000002 3300005445 Bacteria 195857
215 Ga0070708_100091118 3300005445 Bacteria 2776
216 Ga0070708_100238319 3300005445 Bacteria 1708
217 Ga0070708_100383701 3300005445 Unclassified 1325
218 Ga0070708_100394875 3300005445 Bacteria 1304
219 Ga0070708_100514121 3300005445 Bacteria 1129
220 Ga0070708_100564709 3300005445 Unclassified 1073
221 Ga0070663_100010827 3300005455 Bacteria 5698
222 Ga0070663_100195521 3300005455 Bacteria 1576
223 Ga0070678_100039701 3300005456 Bacteria 3324
224 Ga0070678_100099281 3300005456 Unclassified 2252
225 Ga0070678_101184905 3300005456 Bacteria 708
226 Ga0070662_100054047 3300005457 Bacteria 2910
227 Ga0070662_100079638 3300005457 Bacteria 2437
228 Ga0070662_100135095 3300005457 Bacteria 1906
229 Ga0070662_100286111 3300005457 Bacteria 1335
230 Ga0070662_100441170 3300005457 Bacteria 1079
231 Ga0070681_10000041 3300005458 Bacteria 89178
232 Ga0070681_10022424 3300005458 Bacteria 6340
233 Ga0070681_10032714 3300005458 Bacteria 5221
234 Ga0070681_10056272 3300005458 Bacteria 3915
235 Ga0070681_10292888 3300005458 Bacteria 1538
236 Ga0070681_10357899 3300005458 Bacteria 1370
237 Ga0068867_100020647 3300005459 Unclassified 4693
238 Ga0068867_100080756 3300005459 Bacteria 2450
239 Ga0068867_100129016 3300005459 Bacteria 1963
240 Ga0068867_100132774 3300005459 Bacteria 1937
241 Ga0068867_100272279 3300005459 Bacteria 1385
242 Ga0068867_100310513 3300005459 Bacteria 1303
243 Ga0068867_100398992 3300005459 Bacteria 1159
244 Ga0070685_10018014 3300005466 Bacteria 3793
245 Ga0070685_10043836 3300005466 Bacteria 2559
246 Ga0070685_10085226 3300005466 Bacteria 1902
247 Ga0070685_10240527 3300005466 Bacteria 1195
248 Ga0070685_10401007 3300005466 Unclassified 950
249 Ga0070706_100000002 3300005467 Bacteria 326510
250 Ga0070706_100005846 3300005467 Bacteria 11671
251 Ga0070706_100018943 3300005467 Bacteria 6349
252 Ga0070706_100024882 3300005467 Bacteria 5511
253 Ga0070706_100065565 3300005467 Bacteria 3359
254 Ga0070706_100261277 3300005467 Bacteria 1616
255 Ga0070706_100331812 3300005467 Unclassified 1418
256 Ga0070707_100000167 3300005468 Bacteria 63391
257 Ga0070707_100007291 3300005468 Bacteria 10269
258 Ga0070707_100021845 3300005468 Bacteria 6050
259 Ga0070707_100241610 3300005468 Bacteria 1757
260 Ga0070707_100490479 3300005468 Bacteria 1190
261 Ga0070707_100761443 3300005468 Unclassified 932
262 Ga0070698_100000164 3300005471 Bacteria 61194
263 Ga0070698_100000916 3300005471 Bacteria 32268
264 Ga0070698_100002314 3300005471 Bacteria 21075
265 Ga0070698_100004907 3300005471 Bacteria 14674
266 Ga0070698_100010410 3300005471 Bacteria 9933
267 Ga0070698_100023683 3300005471 Bacteria 6414
268 Ga0070698_100104782 3300005471 Unclassified 2798
269 Ga0070698_100177667 3300005471 Bacteria 2068
270 Ga0070698_100180746 3300005471 Bacteria 2048
271 Ga0070698_100506855 3300005471 Unclassified 1145
272 Ga0070698_100566987 3300005471 Bacteria 1075
273 Ga0070698_100610972 3300005471 Bacteria 1031
274 Ga0070699_100000169 3300005518 Bacteria 63052
275 Ga0070699_100000483 3300005518 Bacteria 37967
276 Ga0070699_100005961 3300005518 Bacteria 10640
277 Ga0070699_100061167 3300005518 Bacteria 3264
278 Ga0070699_100118703 3300005518 Unclassified 2325
279 Ga0070699_100150672 3300005518 Bacteria 2057
280 Ga0070699_100198725 3300005518 Bacteria 1782
281 Ga0070699_100319184 3300005518 Bacteria 1396
282 Ga0070699_100390119 3300005518 Unclassified 1258
283 Ga0070699_100466560 3300005518 Bacteria 1145
284 Ga0070699_100772870 3300005518 Bacteria 879
285 Ga0070699_101406187 3300005518 Unclassified 640
286 Ga0070679_100000074 3300005530 Bacteria 74890
287 Ga0070679_100014621 3300005530 Bacteria 7543
288 Ga0070679_100240510 3300005530 Bacteria 1768
289 Ga0070679_100302165 3300005530 Bacteria 1551
290 Ga0070679_101155965 3300005530 Bacteria 719
291 Ga0070684_100178389 3300005535 Bacteria 1931
292 Ga0070697_100000071 3300005536 Bacteria 80945
293 Ga0070697_100008492 3300005536 Bacteria 8015
294 Ga0070697_100048221 3300005536 Bacteria 3453
295 Ga0070697_100058589 3300005536 Bacteria 3135
296 Ga0070697_100092041 3300005536 Unclassified 2508
297 Ga0070697_100103671 3300005536 Bacteria 2365
298 Ga0070697_100374776 3300005536 Unclassified 1232
299 Ga0070697_100438917 3300005536 Bacteria 1136
300 Ga0070697_100869725 3300005536 Unclassified 799
301 Ga0068853_100009637 3300005539 Bacteria 7784
302 Ga0068853_100009751 3300005539 Bacteria 7746
303 Ga0068853_100033867 3300005539 Bacteria 4334
304 Ga0068853_100110758 3300005539 Bacteria 2438
305 Ga0068853_100178384 3300005539 Bacteria 1925
306 Ga0068853_100268402 3300005539 Bacteria 1571
307 Ga0068853_100284003 3300005539 Bacteria 1526
308 Ga0068853_101044896 3300005539 Bacteria 787
309 Ga0070672_100045970 3300005543 Bacteria 3380
310 Ga0070672_100068119 3300005543 Unclassified 2822
311 Ga0070672_100076799 3300005543 Bacteria 2669
312 Ga0070672_100275768 3300005543 Bacteria 1421
313 Ga0070672_100322416 3300005543 Bacteria 1313
314 Ga0070672_100335823 3300005543 Unclassified 1286
315 Ga0070686_100006607 3300005544 Bacteria 6455
316 Ga0070686_100076214 3300005544 Bacteria 2208
317 Ga0070686_100125234 3300005544 Unclassified 1769
318 Ga0070686_100189055 3300005544 Bacteria 1469
319 Ga0070686_100268304 3300005544 Bacteria 1254
320 Ga0070686_100334624 3300005544 Bacteria 1133
321 Ga0070695_100013907 3300005545 Bacteria 4844
322 Ga0070695_100043568 3300005545 Unclassified 2854
323 Ga0070695_100046755 3300005545 Unclassified 2762
324 Ga0070695_100052246 3300005545 Bacteria 2626
325 Ga0070695_100083505 3300005545 Unclassified 2116
326 Ga0070695_100098659 3300005545 Bacteria 1963
327 Ga0070695_100099604 3300005545 Bacteria 1955
328 Ga0070695_100134074 3300005545 Unclassified 1710
329 Ga0070695_100185181 3300005545 Bacteria 1478
330 Ga0070695_100359744 3300005545 Bacteria 1093
331 Ga0070695_100491129 3300005545 Unclassified 948
332 Ga0070695_100556683 3300005545 Bacteria 895
333 Ga0070695_100560860 3300005545 Unclassified 891
334 Ga0070695_100573912 3300005545 Bacteria 882
335 Ga0070695_100608255 3300005545 Bacteria 859
336 Ga0070695_100641045 3300005545 Unclassified 838
337 Ga0070695_100643741 3300005545 Unclassified 836
338 Ga0070695_100976003 3300005545 Unclassified 688
339 Ga0070695_101595204 3300005545 Unclassified 545
340 Ga0070696_100002034 3300005546 Bacteria 13267
341 Ga0070696_100009479 3300005546 Bacteria 6522
342 Ga0070696_100014172 3300005546 Bacteria 5349
343 Ga0070696_100017420 3300005546 Bacteria 4848
344 Ga0070696_100070384 3300005546 Bacteria 2460
345 Ga0070696_100078966 3300005546 Bacteria 2328
346 Ga0070696_100090720 3300005546 Bacteria 2175
347 Ga0070696_100133490 3300005546 Bacteria 1809
348 Ga0070696_100167936 3300005546 Bacteria 1620
349 Ga0070696_100200995 3300005546 Unclassified 1488
350 Ga0070696_100203086 3300005546 Unclassified 1480
351 Ga0070696_100330944 3300005546 Bacteria 1175
352 Ga0070696_100398135 3300005546 Bacteria 1077
353 Ga0070696_100622857 3300005546 Unclassified 872
354 Ga0070696_100851393 3300005546 Unclassified 753
355 Ga0070696_100926285 3300005546 Unclassified 724
356 Ga0070696_100944469 3300005546 Unclassified 717
357 Ga0070696_101014112 3300005546 Bacteria 694
358 Ga0070696_101124304 3300005546 Bacteria 661
359 Ga0070693_100015794 3300005547 Bacteria 3895
360 Ga0070693_100078583 3300005547 Unclassified 1961
361 Ga0070693_100122299 3300005547 Bacteria 1616
362 Ga0070693_100131812 3300005547 Bacteria 1563
363 Ga0070693_100181403 3300005547 Bacteria 1355
364 Ga0070693_100415541 3300005547 Unclassified 936
365 Ga0070693_100471279 3300005547 Bacteria 885
366 Ga0070693_101157551 3300005547 Bacteria 592
367 Ga0070665_100281443 3300005548 Bacteria 1665
368 Ga0070665_100656070 3300005548 Bacteria 1062
369 Ga0070665_101826675 3300005548 Unclassified 614
370 Ga0070704_100003508 3300005549 Bacteria 9009
371 Ga0070704_100008606 3300005549 Bacteria 6128
372 Ga0070704_100016529 3300005549 Bacteria 4665
373 Ga0070704_100035319 3300005549 Unclassified 3397
374 Ga0070704_100035616 3300005549 Unclassified 3384
375 Ga0070704_100102818 3300005549 Unclassified 2157
376 Ga0070704_100158907 3300005549 Bacteria 1785
377 Ga0070704_100168771 3300005549 Bacteria 1738
378 Ga0070704_100225066 3300005549 Bacteria 1527
379 Ga0070704_100533903 3300005549 Unclassified 1023
380 Ga0070704_100727898 3300005549 Bacteria 882
381 Ga0070704_101290727 3300005549 Unclassified 668
382 Ga0068855_100013973 3300005563 Bacteria 9682
383 Ga0068855_100234851 3300005563 Bacteria 2051
384 Ga0068855_100288276 3300005563 Bacteria 1821
385 Ga0070664_100000280 3300005564 Bacteria 36774
386 Ga0070664_100040842 3300005564 Bacteria 3913
387 Ga0070664_100290888 3300005564 Bacteria 1475
388 Ga0070664_100690477 3300005564 Bacteria 950
389 Ga0070664_100720943 3300005564 Bacteria 930
390 Ga0070664_100797876 3300005564 Bacteria 883
391 Ga0070664_100879306 3300005564 Bacteria 840
392 Ga0070664_101032813 3300005564 Unclassified 773
393 Ga0070664_101072887 3300005564 Unclassified 758
394 Ga0068857_100013657 3300005577 Bacteria 7076
395 Ga0068857_100110846 3300005577 Bacteria 2466
396 Ga0068857_100249325 3300005577 Bacteria 1627
397 Ga0068857_100269116 3300005577 Bacteria 1566
398 Ga0068857_100582080 3300005577 Bacteria 1057
399 Ga0068857_100688551 3300005577 Unclassified 971
400 Ga0068857_100764796 3300005577 Unclassified 921
401 Ga0068857_100828937 3300005577 Unclassified 884
402 Ga0068854_100091683 3300005578 Unclassified 2262
403 Ga0068854_100107311 3300005578 Bacteria 2102
404 Ga0068854_100141018 3300005578 Bacteria 1850
405 Ga0068854_100759070 3300005578 Bacteria 842
406 Ga0068854_100799925 3300005578 Bacteria 822
407 Ga0068856_100439763 3300005614 Unclassified 1324
408 Ga0070702_100002032 3300005615 Bacteria 8549
409 Ga0070702_100122934 3300005615 Unclassified 1627
410 Ga0070702_100183184 3300005615 Bacteria 1372
411 Ga0070702_100257398 3300005615 Bacteria 1186
412 Ga0070702_100444178 3300005615 Bacteria 939
413 Ga0068852_100140694 3300005616 Bacteria 2233
414 Ga0068852_100198078 3300005616 Unclassified 1899
415 Ga0068852_100584829 3300005616 Bacteria 1120
416 Ga0068852_100869241 3300005616 Unclassified 918
417 Ga0068852_100901245 3300005616 Unclassified 901
418 Ga0068859_100003166 3300005617 Bacteria 16737
419 Ga0068859_100018658 3300005617 Bacteria 6973
420 Ga0068859_100029652 3300005617 Bacteria 5490
421 Ga0068859_100033363 3300005617 Bacteria 5169
422 Ga0068859_100035651 3300005617 Bacteria 4992
423 Ga0068859_100037551 3300005617 Bacteria 4861
424 Ga0068859_100045900 3300005617 Bacteria 4388
425 Ga0068859_100082061 3300005617 Bacteria 3267
426 Ga0068859_100109989 3300005617 Bacteria 2817
427 Ga0068859_100137767 3300005617 Unclassified 2514
428 Ga0068859_100175866 3300005617 Bacteria 2222
429 Ga0068859_100179404 3300005617 Bacteria 2200
430 Ga0068859_100206524 3300005617 Unclassified 2049
431 Ga0068859_100261688 3300005617 Bacteria 1821
432 Ga0068859_100304161 3300005617 Bacteria 1688
433 Ga0068859_100359694 3300005617 Bacteria 1550
434 Ga0068859_100437430 3300005617 Bacteria 1404
435 Ga0068859_100559506 3300005617 Bacteria 1238
436 Ga0068859_100591257 3300005617 Bacteria 1203
437 Ga0068859_100701302 3300005617 Bacteria 1103
438 Ga0068859_100887319 3300005617 Unclassified 977
439 Ga0068859_100892036 3300005617 Unclassified 974
440 Ga0068859_101107025 3300005617 Unclassified 871
441 Ga0068859_101154711 3300005617 Bacteria 852
442 Ga0068864_100022935 3300005618 Bacteria 5237
443 Ga0068864_100029542 3300005618 Bacteria 4644
444 Ga0068864_100033299 3300005618 Bacteria 4381
445 Ga0068864_100045602 3300005618 Unclassified 3760
446 Ga0068864_100048124 3300005618 Bacteria 3664
447 Ga0068864_100098665 3300005618 Bacteria 2587
448 Ga0068864_100104528 3300005618 Bacteria 2516
449 Ga0068864_100175739 3300005618 Unclassified 1955
450 Ga0068864_100193270 3300005618 Bacteria 1866
451 Ga0068864_100200053 3300005618 Bacteria 1835
452 Ga0068864_100212165 3300005618 Unclassified 1783
453 Ga0068864_100311442 3300005618 Bacteria 1476
454 Ga0068864_100386459 3300005618 Bacteria 1327
455 Ga0068864_100480745 3300005618 Bacteria 1192
456 Ga0068864_100511827 3300005618 Bacteria 1156
457 Ga0068864_100767656 3300005618 Bacteria 946
458 Ga0068866_10130065 3300005718 Bacteria 1430
459 Ga0068861_100029995 3300005719 Bacteria 3983
460 Ga0068861_100069640 3300005719 Bacteria 2722
461 Ga0068861_100121439 3300005719 Bacteria 2108
462 Ga0068861_100127522 3300005719 Bacteria 2061
463 Ga0068861_100180707 3300005719 Archaea 1756
464 Ga0068861_100181743 3300005719 Bacteria 1751
465 Ga0068861_100324554 3300005719 Unclassified 1342
466 Ga0068861_100453785 3300005719 Bacteria 1149
467 Ga0068861_100530703 3300005719 Bacteria 1069
468 Ga0068861_100559091 3300005719 Bacteria 1044
469 Ga0068861_100586522 3300005719 Bacteria 1021
470 Ga0068861_100768171 3300005719 Bacteria 902
471 Ga0068861_100930486 3300005719 Unclassified 825
472 Ga0068861_101195026 3300005719 Unclassified 735
473 Ga0068861_101283543 3300005719 Bacteria 711
474 Ga0068851_10000508 3300005834 Bacteria 17031
475 Ga0068870_10030369 3300005840 Bacteria 2730
476 Ga0068870_10030552 3300005840 Bacteria 2723
477 Ga0068870_10157726 3300005840 Bacteria 1343
478 Ga0068870_10174763 3300005840 Bacteria 1284
479 Ga0068870_10286738 3300005840 Bacteria 1034
480 Ga0068863_100044808 3300005841 Unclassified 4198
481 Ga0068863_100046793 3300005841 Bacteria 4106
482 Ga0068863_100061232 3300005841 Unclassified 3558
483 Ga0068863_100061594 3300005841 Bacteria 3548
484 Ga0068863_100231880 3300005841 Unclassified 1781
485 Ga0068863_100243725 3300005841 Bacteria 1735
486 Ga0068863_100414690 3300005841 Bacteria 1318
487 Ga0068863_100526774 3300005841 Bacteria 1165
488 Ga0068863_100535454 3300005841 Bacteria 1155
489 Ga0068863_100637136 3300005841 Bacteria 1056
490 Ga0068863_100693541 3300005841 Bacteria 1012
491 Ga0068863_101190820 3300005841 Bacteria 768
492 Ga0068863_101674663 3300005841 Unclassified 645
493 Ga0068858_100000134 3300005842 Bacteria 77566
494 Ga0068858_100001473 3300005842 Bacteria 24229
495 Ga0068858_100027082 3300005842 Bacteria 5325
496 Ga0068858_100056480 3300005842 Unclassified 3628
497 Ga0068858_100109873 3300005842 Bacteria 2574
498 Ga0068858_100129545 3300005842 Unclassified 2365
499 Ga0068858_100148296 3300005842 Bacteria 2204
500 Ga0068858_100166619 3300005842 Bacteria 2076
501 Ga0068858_100229286 3300005842 Bacteria 1760
502 Ga0068858_100391323 3300005842 Bacteria 1335
503 Ga0068858_100460957 3300005842 Bacteria 1226
504 Ga0068858_100562341 3300005842 Bacteria 1104
505 Ga0068858_100621764 3300005842 Unclassified 1049
506 Ga0068858_100689075 3300005842 Bacteria 994
507 Ga0068858_100989838 3300005842 Unclassified 824
508 Ga0068858_102064237 3300005842 Unclassified 564
509 Ga0068860_100006276 3300005843 Bacteria 11937
510 Ga0068860_100043714 3300005843 Bacteria 4272
511 Ga0068860_100090392 3300005843 Unclassified 2916
512 Ga0068860_100107672 3300005843 Bacteria 2664
513 Ga0068860_100199901 3300005843 Unclassified 1936
514 Ga0068860_100281717 3300005843 Bacteria 1625
515 Ga0068860_100305925 3300005843 Unclassified 1558
516 Ga0068860_100367089 3300005843 Bacteria 1419
517 Ga0068860_100401518 3300005843 Bacteria 1356
518 Ga0068860_100689958 3300005843 Bacteria 1030
519 Ga0068860_100781487 3300005843 Bacteria 968
520 Ga0068860_100795742 3300005843 Bacteria 959
521 Ga0068860_100882903 3300005843 Bacteria 910
522 Ga0068860_101417483 3300005843 Unclassified 716
523 Ga0068860_102035480 3300005843 Unclassified 596
524 Ga0068860_102063324 3300005843 Bacteria 591
525 Ga0068862_100010366 3300005844 Bacteria 7692
526 Ga0068862_100028615 3300005844 Bacteria 4693
527 Ga0068862_100101196 3300005844 Unclassified 2521
528 Ga0068862_100115289 3300005844 Unclassified 2363
529 Ga0068862_100118142 3300005844 Bacteria 2334
530 Ga0068862_100221102 3300005844 Bacteria 1714
531 Ga0068862_100575301 3300005844 Bacteria 1078
532 Ga0068862_100645869 3300005844 Bacteria 1020
533 Ga0068862_100794876 3300005844 Bacteria 923
534 Ga0068862_100925932 3300005844 Bacteria 858
535 Ga0068862_101048035 3300005844 Bacteria 808
536 Ga0068862_101211638 3300005844 Unclassified 754
537 Ga0081455_10352887 3300005937 Bacteria 1037
538 Ga0081540_1075760 3300005983 Bacteria 1536
539 Ga0081539_10000931 3300005985 Bacteria 54965
540 Ga0081539_10001415 3300005985 Bacteria 41285
541 Ga0081539_10002562 3300005985 Bacteria 25196
542 Ga0081539_10061872 3300005985 Unclassified 2048
543 Ga0081539_10101600 3300005985 Unclassified 1464
544 Ga0081539_10214432 3300005985 Bacteria 880
545 Ga0070717_10083849 3300006028 Bacteria 2681
546 Ga0070715_10000018 3300006163 Bacteria 124487
547 Ga0070716_100000017 3300006173 Bacteria 88957
548 Ga0070716_100033150 3300006173 Bacteria 2823
549 Ga0070716_100275941 3300006173 Bacteria 1158
550 Ga0097621_100001570 3300006237 Bacteria 15609
551 Ga0097621_100003941 3300006237 Bacteria 10284
552 Ga0097621_100025494 3300006237 Bacteria 4627
553 Ga0097621_100074871 3300006237 Bacteria 2805
554 Ga0097621_100204279 3300006237 Bacteria 1716
555 Ga0097621_100276727 3300006237 Bacteria 1476
556 Ga0097621_100602006 3300006237 Bacteria 1005
557 Ga0068871_100001715 3300006358 Bacteria 14742
558 Ga0068871_100003493 3300006358 Bacteria 10806
559 Ga0068871_100004902 3300006358 Bacteria 9349
560 Ga0068871_100085299 3300006358 Bacteria 2622
561 Ga0068871_100171852 3300006358 Bacteria 1858
562 Ga0068871_100361035 3300006358 Unclassified 1286
563 Ga0068871_100973980 3300006358 Unclassified 789
564 Ga0075428_100229157 3300006844 Bacteria 2005
565 Ga0075428_100250559 3300006844 Unclassified 1909
566 Ga0075428_100312427 3300006844 Bacteria 1689
567 Ga0075428_100576645 3300006844 Unclassified 1202
568 Ga0075428_100657885 3300006844 Unclassified 1117
569 Ga0075428_100749390 3300006844 Bacteria 1039
570 Ga0075428_101126062 3300006844 Bacteria 829
571 Ga0075430_100051442 3300006846 Bacteria 3471
572 Ga0075431_100586214 3300006847 Unclassified 1100
573 Ga0075433_10000049 3300006852 Bacteria 50192
574 Ga0075433_10004819 3300006852 Bacteria 10539
575 Ga0075433_10023132 3300006852 Bacteria 5227
576 Ga0075433_10044860 3300006852 Bacteria 3842
577 Ga0075433_10078290 3300006852 Unclassified 2913
578 Ga0075433_10103461 3300006852 Bacteria 2522
579 Ga0075433_10243037 3300006852 Bacteria 1598
580 Ga0075433_10256560 3300006852 Bacteria 1551
581 Ga0075433_10278910 3300006852 Unclassified 1481
582 Ga0075433_10610078 3300006852 Bacteria 958
583 Ga0075434_100001792 3300006871 Bacteria 18554
584 Ga0075434_100011248 3300006871 Bacteria 8429
585 Ga0075434_100250146 3300006871 Bacteria 1792
586 Ga0075434_100252270 3300006871 Bacteria 1784
587 Ga0075434_100256420 3300006871 Bacteria 1768
588 Ga0075434_100407424 3300006871 Bacteria 1381
589 Ga0075434_100663622 3300006871 Bacteria 1061
590 Ga0075434_101065883 3300006871 Unclassified 822
591 Ga0075434_101255615 3300006871 Bacteria 752
592 Ga0075434_101462818 3300006871 Bacteria 693
593 Ga0075429_100096943 3300006880 Bacteria 2573
594 Ga0075429_100271292 3300006880 Unclassified 1486
595 Ga0075429_100318626 3300006880 Bacteria 1361
596 Ga0075429_100657655 3300006880 Bacteria 918
597 Ga0068865_100030118 3300006881 Bacteria 3607
598 Ga0068865_100031323 3300006881 Bacteria 3545
599 Ga0068865_100080047 3300006881 Bacteria 2342
600 Ga0068865_100285391 3300006881 Bacteria 1316
601 Ga0068865_100353733 3300006881 Bacteria 1191
602 Ga0068865_100700696 3300006881 Bacteria 865
603 Ga0068865_101309375 3300006881 Unclassified 644
604 Ga0075436_100000011 3300006914 Bacteria 208094
605 Ga0075436_100012513 3300006914 Bacteria 5815
606 Ga0075436_100053501 3300006914 Bacteria 2787
607 Ga0075436_100065993 3300006914 Unclassified 2501
608 Ga0097620_100003166 3300006931 Bacteria 16737
609 Ga0097620_100018658 3300006931 Bacteria 6973
610 Ga0097620_100029653 3300006931 Bacteria 5490
611 Ga0097620_100033364 3300006931 Bacteria 5169
612 Ga0097620_100035652 3300006931 Bacteria 4992
613 Ga0097620_100037550 3300006931 Bacteria 4861
614 Ga0097620_100045900 3300006931 Bacteria 4388
615 Ga0097620_100082063 3300006931 Bacteria 3267
616 Ga0097620_100109983 3300006931 Bacteria 2817
617 Ga0097620_100137768 3300006931 Unclassified 2514
618 Ga0097620_100175870 3300006931 Bacteria 2222
619 Ga0097620_100179393 3300006931 Bacteria 2200
620 Ga0097620_100206534 3300006931 Unclassified 2049
621 Ga0097620_100261674 3300006931 Bacteria 1821
622 Ga0097620_100304123 3300006931 Bacteria 1688
623 Ga0097620_100359693 3300006931 Bacteria 1550
624 Ga0097620_100437454 3300006931 Bacteria 1404
625 Ga0097620_100559519 3300006931 Bacteria 1238
626 Ga0097620_100591256 3300006931 Bacteria 1203
627 Ga0097620_100701264 3300006931 Bacteria 1103
628 Ga0097620_100887376 3300006931 Unclassified 977
629 Ga0097620_100892010 3300006931 Unclassified 974
630 Ga0097620_101107117 3300006931 Unclassified 871
631 Ga0097620_101154785 3300006931 Bacteria 852
632 Ga0075435_100000134 3300007076 Bacteria 41749
633 Ga0075435_100009513 3300007076 Bacteria 7043
634 Ga0075435_100031672 3300007076 Bacteria 4168
635 Ga0075435_100141595 3300007076 Bacteria 2018
636 Ga0075435_100565932 3300007076 Unclassified 985
637 Ga0099795_10414936 3300007788 Unclassified 614
638 Ga0105251_10336356 3300009011 Unclassified 688
639 Ga0105251_10408049 3300009011 Unclassified 625
640 Ga0105251_10437982 3300009011 Bacteria 604
641 Ga0105250_10054230 3300009092 Bacteria 1608
642 Ga0105240_10041387 3300009093 Bacteria 5881
643 Ga0105240_11654454 3300009093 Bacteria 669
644 Ga0111539_10001784 3300009094 Bacteria 28601
645 Ga0111539_10131725 3300009094 Bacteria 2928
646 Ga0111539_10164064 3300009094 Bacteria 2598
647 Ga0111539_10179811 3300009094 Bacteria 2471
648 Ga0111539_10291147 3300009094 Bacteria 1900
649 Ga0111539_10353141 3300009094 Bacteria 1711
650 Ga0111539_10400211 3300009094 Bacteria 1599
651 Ga0105245_10017618 3300009098 Bacteria 6235
652 Ga0105245_10094357 3300009098 Bacteria 2758
653 Ga0105245_10197513 3300009098 Bacteria 1930
654 Ga0105245_10470416 3300009098 Bacteria 1269
655 Ga0105245_11289753 3300009098 Bacteria 779
656 Ga0105247_10000022 3300009101 Bacteria 219796
657 Ga0105247_10003696 3300009101 Bacteria 9931
658 Ga0105247_10041404 3300009101 Unclassified 2819
659 Ga0105247_10042199 3300009101 Bacteria 2793
660 Ga0105247_10190329 3300009101 Bacteria 1373
661 Ga0105247_10191408 3300009101 Unclassified 1370
662 Ga0105247_10609018 3300009101 Bacteria 811
663 Ga0105247_10775277 3300009101 Bacteria 729
664 Ga0105247_10787768 3300009101 Bacteria 724
665 Ga0114129_10021892 3300009147 Bacteria 9073
666 Ga0114129_10077095 3300009147 Bacteria 4638
667 Ga0114129_10128631 3300009147 Bacteria 3481
668 Ga0114129_10164311 3300009147 Bacteria 3030
669 Ga0114129_10169017 3300009147 Bacteria 2982
670 Ga0114129_10169409 3300009147 Bacteria 2978
671 Ga0114129_10196551 3300009147 Bacteria 2734
672 Ga0114129_10198008 3300009147 Unclassified 2723
673 Ga0114129_10218100 3300009147 Bacteria 2575
674 Ga0114129_10255360 3300009147 Bacteria 2352
675 Ga0114129_10273284 3300009147 Bacteria 2260
676 Ga0114129_10676587 3300009147 Bacteria 1329
677 Ga0114129_10870023 3300009147 Unclassified 1144
678 Ga0114129_11028433 3300009147 Bacteria 1036
679 Ga0114129_11120791 3300009147 Bacteria 984
680 Ga0114129_11486651 3300009147 Unclassified 833
681 Ga0114129_11713294 3300009147 Unclassified 767
682 Ga0105243_10000102 3300009148 Bacteria 97833
683 Ga0105243_10000207 3300009148 Bacteria 68914
684 Ga0105243_10040911 3300009148 Unclassified 3623
685 Ga0105243_10052352 3300009148 Unclassified 3233
686 Ga0105243_10175848 3300009148 Bacteria 1858
687 Ga0105243_10305091 3300009148 Bacteria 1444
688 Ga0105243_10528866 3300009148 Bacteria 1123
689 Ga0105243_11125427 3300009148 Unclassified 795
690 Ga0105243_11195655 3300009148 Bacteria 773
691 Ga0105243_11329035 3300009148 Bacteria 737
692 Ga0105243_11706643 3300009148 Unclassified 659
693 Ga0105243_11740910 3300009148 Unclassified 653
694 Ga0105243_11750210 3300009148 Unclassified 651
695 Ga0105243_12200417 3300009148 Unclassified 588
696 Ga0105241_10009361 3300009174 Bacteria 7200
697 Ga0105241_10019871 3300009174 Unclassified 4957
698 Ga0105241_10131740 3300009174 Bacteria 2025
699 Ga0105241_10146718 3300009174 Bacteria 1926
700 Ga0105241_10234027 3300009174 Bacteria 1550
701 Ga0105241_10582414 3300009174 Bacteria 1009
702 Ga0105241_10596025 3300009174 Unclassified 998
703 Ga0105241_11395707 3300009174 Unclassified 670
704 Ga0105241_11494972 3300009174 Unclassified 650
705 Ga0105242_10000279 3300009176 Bacteria 40655
706 Ga0105242_10000807 3300009176 Bacteria 24281
707 Ga0105242_10005822 3300009176 Bacteria 9493
708 Ga0105242_10155864 3300009176 Bacteria 1995
709 Ga0105242_10197673 3300009176 Bacteria 1784
710 Ga0105242_10510406 3300009176 Unclassified 1145
711 Ga0105242_10998784 3300009176 Bacteria 844
712 Ga0105242_11979462 3300009176 Unclassified 625
713 Ga0105248_10004786 3300009177 Bacteria 14983
714 Ga0105248_10005461 3300009177 Bacteria 13971
715 Ga0105248_10010608 3300009177 Bacteria 10156
716 Ga0105248_10013500 3300009177 Bacteria 8993
717 Ga0105248_10116314 3300009177 Unclassified 3016
718 Ga0105248_10134111 3300009177 Bacteria 2794
719 Ga0105248_10178524 3300009177 Bacteria 2393
720 Ga0105248_10190150 3300009177 Bacteria 2313
721 Ga0105248_10239205 3300009177 Unclassified 2044
722 Ga0105248_10250727 3300009177 Bacteria 1993
723 Ga0105248_10284646 3300009177 Bacteria 1861
724 Ga0105248_10421823 3300009177 Bacteria 1503
725 Ga0105248_10444584 3300009177 Bacteria 1461
726 Ga0105248_10957608 3300009177 Unclassified 967
727 Ga0105248_11436390 3300009177 Bacteria 781
728 Ga0105248_12531589 3300009177 Unclassified 585
729 Ga0105237_10034027 3300009545 Bacteria 5161
730 Ga0105237_10073202 3300009545 Bacteria 3419
731 Ga0105237_10125573 3300009545 Bacteria 2560
732 Ga0105237_10905880 3300009545 Unclassified 889
733 Ga0105237_10930761 3300009545 Bacteria 876
734 Ga0105237_12000879 3300009545 Unclassified 588
735 Ga0105238_10009968 3300009551 Bacteria 9527
736 Ga0105238_10013272 3300009551 Bacteria 8313
737 Ga0105238_10816606 3300009551 Unclassified 948
738 Ga0105238_10954870 3300009551 Bacteria 877
739 Ga0105249_10000142 3300009553 Bacteria 92745
740 Ga0105249_10013404 3300009553 Bacteria 7239
741 Ga0105249_10074481 3300009553 Bacteria 3142
742 Ga0105249_10089500 3300009553 Bacteria 2877
743 Ga0105249_10126962 3300009553 Bacteria 2430
744 Ga0105249_10192297 3300009553 Bacteria 1992
745 Ga0105249_10246378 3300009553 Bacteria 1769
746 Ga0105249_10342315 3300009553 Unclassified 1512
747 Ga0105249_11161965 3300009553 Bacteria 843
748 Ga0105249_11193837 3300009553 Unclassified 832
749 Ga0099796_10213468 3300010159 Unclassified 788
750 Ga0105239_10237248 3300010375 Bacteria 2047
751 Ga0105239_10352157 3300010375 Unclassified 1662
752 Ga0105239_10568703 3300010375 Bacteria 1292
753 Ga0105239_10845756 3300010375 Bacteria 1049
754 Ga0105246_10012997 3300011119 Bacteria 5210
755 Ga0105246_10161630 3300011119 Bacteria 1706
756 Ga0105246_10186646 3300011119 Viruses 1601
757 Ga0105246_10320135 3300011119 Bacteria 1260
758 Ga0105246_10337967 3300011119 Bacteria 1230
759 Ga0105246_10496115 3300011119 Bacteria 1036
760 Ga0105246_11231553 3300011119 Unclassified 690
761 Ga0105246_11317786 3300011119 Unclassified 670
762 Ga0157373_10004608 3300013100 Bacteria 10368
763 Ga0157373_10065205 3300013100 Bacteria 2577
764 Ga0157373_10090756 3300013100 Bacteria 2152
765 Ga0157373_10093302 3300013100 Bacteria 2120
766 Ga0157373_10341783 3300013100 Archaea 1067
767 Ga0157373_10385977 3300013100 Unclassified 1002
768 Ga0157371_10407945 3300013102 Bacteria 995
769 Ga0157371_10682729 3300013102 Unclassified 768
770 Ga0157369_10370798 3300013105 Bacteria 1486
771 Ga0157369_10395466 3300013105 Unclassified 1434
772 Ga0157374_10042590 3300013296 Bacteria 4188
773 Ga0157374_10047953 3300013296 Unclassified 3962
774 Ga0157374_10284951 3300013296 Bacteria 1631
775 Ga0157374_10577877 3300013296 Unclassified 1133
776 Ga0157374_10604775 3300013296 Bacteria 1106
777 Ga0157374_10686851 3300013296 Bacteria 1036
778 Ga0157374_11784481 3300013296 Bacteria 640
779 Ga0157378_10000191 3300013297 Bacteria 59071
780 Ga0157378_10009723 3300013297 Bacteria 8377
781 Ga0157378_10014643 3300013297 Bacteria 6867
782 Ga0157378_10024594 3300013297 Bacteria 5302
783 Ga0157378_10032949 3300013297 Bacteria 4580
784 Ga0157378_10033984 3300013297 Bacteria 4510
785 Ga0157378_10078315 3300013297 Unclassified 2981
786 Ga0157378_10092551 3300013297 Unclassified 2751
787 Ga0157378_10111174 3300013297 Bacteria 2512
788 Ga0157378_10113449 3300013297 Bacteria 2488
789 Ga0157378_10147662 3300013297 Bacteria 2188
790 Ga0157378_10173588 3300013297 Unclassified 2023
791 Ga0157378_10202612 3300013297 Bacteria 1877
792 Ga0157378_10237192 3300013297 Bacteria 1741
793 Ga0157378_10418289 3300013297 Bacteria 1324
794 Ga0157378_11014230 3300013297 Bacteria 865
795 Ga0157378_11172571 3300013297 Unclassified 807
796 Ga0157378_11340378 3300013297 Bacteria 757
797 Ga0157378_11772621 3300013297 Bacteria 665
798 Ga0157378_12841709 3300013297 Unclassified 537
799 Ga0163162_10000553 3300013306 Bacteria 34596
800 Ga0163162_10012064 3300013306 Bacteria 8429
801 Ga0163162_10015538 3300013306 Bacteria 7438
802 Ga0163162_10015662 3300013306 Bacteria 7410
803 Ga0163162_10038965 3300013306 Unclassified 4745
804 Ga0163162_10041905 3300013306 Bacteria 4581
805 Ga0163162_10042270 3300013306 Unclassified 4561
806 Ga0163162_10075719 3300013306 Bacteria 3426
807 Ga0163162_10117338 3300013306 Bacteria 2763
808 Ga0163162_10124137 3300013306 Unclassified 2687
809 Ga0163162_10143656 3300013306 Bacteria 2501
810 Ga0163162_10187017 3300013306 Unclassified 2198
811 Ga0163162_10238326 3300013306 Bacteria 1950
812 Ga0163162_10320613 3300013306 Bacteria 1682
813 Ga0163162_10368523 3300013306 Bacteria 1569
814 Ga0163162_10462806 3300013306 Bacteria 1400
815 Ga0163162_10544599 3300013306 Unclassified 1289
816 Ga0163162_11248568 3300013306 Unclassified 844
817 Ga0163162_12222620 3300013306 Unclassified 630
818 Ga0157372_10043475 3300013307 Unclassified 4974
819 Ga0157372_10108256 3300013307 Bacteria 3180
820 Ga0157372_10181443 3300013307 Bacteria 2437
821 Ga0157372_10303178 3300013307 Bacteria 1858
822 Ga0157372_10338720 3300013307 Bacteria 1752
823 Ga0157372_10341605 3300013307 Unclassified 1744
824 Ga0157372_10628643 3300013307 Bacteria 1251
825 Ga0157372_10877857 3300013307 Bacteria 1041
826 Ga0157372_11740328 3300013307 Bacteria 717
827 Ga0157375_10004435 3300013308 Bacteria 12188
828 Ga0157375_10021549 3300013308 Bacteria 5912
829 Ga0157375_10023277 3300013308 Bacteria 5713
830 Ga0157375_10066328 3300013308 Bacteria 3603
831 Ga0157375_10074008 3300013308 Unclassified 3427
832 Ga0157375_10093322 3300013308 Unclassified 3076
833 Ga0157375_10174899 3300013308 Bacteria 2296
834 Ga0157375_10184113 3300013308 Bacteria 2241
835 Ga0157375_10250780 3300013308 Bacteria 1931
836 Ga0157375_10307349 3300013308 Bacteria 1750
837 Ga0157375_10593833 3300013308 Bacteria 1267
838 Ga0157375_10646005 3300013308 Bacteria 1214
839 Ga0157375_10841498 3300013308 Bacteria 1064
840 Ga0157375_10902456 3300013308 Unclassified 1028
841 Ga0157375_11064328 3300013308 Bacteria 946
842 Ga0157375_11540389 3300013308 Unclassified 785
843 Ga0163163_10000184 3300014325 Bacteria 64203
844 Ga0163163_10004533 3300014325 Bacteria 11860
845 Ga0163163_10005720 3300014325 Bacteria 10783
846 Ga0163163_10012406 3300014325 Bacteria 7762
847 Ga0163163_10012999 3300014325 Bacteria 7603
848 Ga0163163_10024208 3300014325 Bacteria 5776
849 Ga0163163_10039476 3300014325 Bacteria 4606
850 Ga0163163_10044389 3300014325 Bacteria 4360
851 Ga0163163_10143718 3300014325 Bacteria 2429
852 Ga0163163_10182671 3300014325 Bacteria 2145
853 Ga0163163_10406126 3300014325 Bacteria 1420
854 Ga0163163_10766614 3300014325 Bacteria 1028
855 Ga0163163_10772792 3300014325 Bacteria 1024
856 Ga0163163_11762723 3300014325 Unclassified 680
857 Ga0157380_10000627 3300014326 Bacteria 21695
858 Ga0157380_10003949 3300014326 Bacteria 10238
859 Ga0157380_10006388 3300014326 Bacteria 8297
860 Ga0157380_10010260 3300014326 Bacteria 6732
861 Ga0157380_10014623 3300014326 Bacteria 5746
862 Ga0157380_10080406 3300014326 Bacteria 2664
863 Ga0157380_10121859 3300014326 Bacteria 2210
864 Ga0157380_10122958 3300014326 Unclassified 2201
865 Ga0157380_10290836 3300014326 Bacteria 1500
866 Ga0157380_10307344 3300014326 Bacteria 1464
867 Ga0157380_10513550 3300014326 Unclassified 1167
868 Ga0157380_10596189 3300014326 Bacteria 1092
869 Ga0157380_10736495 3300014326 Bacteria 995
870 Ga0157380_11120406 3300014326 Unclassified 827
871 Ga0182008_10219978 3300014497 Unclassified 971
872 Ga0157377_10041834 3300014745 Bacteria 2543
873 Ga0157377_10088814 3300014745 Bacteria 1821
874 Ga0157377_10789803 3300014745 Unclassified 699
875 Ga0157379_10006241 3300014968 Bacteria 10266
876 Ga0157379_10036431 3300014968 Unclassified 4387
877 Ga0157379_10049363 3300014968 Bacteria 3758
878 Ga0157379_10206098 3300014968 Bacteria 1779
879 Ga0157379_10514610 3300014968 Bacteria 1110
880 Ga0157379_10639137 3300014968 Unclassified 996
881 Ga0157379_11439681 3300014968 Bacteria 669
882 Ga0157376_10015880 3300014969 Bacteria 5701
883 Ga0157376_10038847 3300014969 Unclassified 3876
884 Ga0157376_10108630 3300014969 Bacteria 2437
885 Ga0157376_10220571 3300014969 Bacteria 1756
886 Ga0157376_10330532 3300014969 Unclassified 1452
887 Ga0157376_11055134 3300014969 Unclassified 837
888 Ga0182007_10137389 3300015262 Bacteria 825
889 Ga0163161_10022258 3300017792 Bacteria 4461
890 Ga0163161_10047433 3300017792 Unclassified 3102
891 Ga0163161_10062447 3300017792 Unclassified 2714
892 Ga0163161_10120731 3300017792 Bacteria 1969
893 Ga0163161_10161047 3300017792 Bacteria 1711
894 Ga0163161_10193349 3300017792 Unclassified 1565
895 Ga0163161_10808576 3300017792 Unclassified 788
896 Ga0213876_10017616 3300021384 Bacteria 3770
897 Ga0207672_1000046 3300025223 Bacteria 16046
898 Ga0207697_10100541 3300025315 Bacteria 1232
899 Ga0207697_10122557 3300025315 Bacteria 1120
900 Ga0207697_10189147 3300025315 Bacteria 904
901 Ga0207656_10099910 3300025321 Bacteria 1329
902 Ga0207656_10160505 3300025321 Bacteria 1069
903 Ga0207696_1058383 3300025711 Bacteria 1089
904 Ga0207653_10000008 3300025885 Bacteria 197323
905 Ga0207653_10008577 3300025885 Bacteria 3184
906 Ga0207653_10014875 3300025885 Bacteria 2442
907 Ga0207682_10057659 3300025893 Bacteria 1620
908 Ga0207682_10103753 3300025893 Bacteria 1245
909 Ga0207682_10403275 3300025893 Bacteria 646
910 Ga0207642_10040653 3300025899 Bacteria 2030
911 Ga0207710_10000001 3300025900 Bacteria 1797433
912 Ga0207710_10018112 3300025900 Bacteria 2994
913 Ga0207710_10018149 3300025900 Unclassified 2990
914 Ga0207710_10181423 3300025900 Unclassified 1033
915 Ga0207710_10329160 3300025900 Bacteria 776
916 Ga0207710_10563304 3300025900 Bacteria 594
917 Ga0207680_10301777 3300025903 Bacteria 1116
918 Ga0207647_10006088 3300025904 Bacteria 8792
919 Ga0207647_10148823 3300025904 Unclassified 1369
920 Ga0207647_10151084 3300025904 Bacteria 1357
921 Ga0207647_10214351 3300025904 Bacteria 1111
922 Ga0207647_10350260 3300025904 Unclassified 836
923 Ga0207647_10382403 3300025904 Unclassified 795
924 Ga0207685_10000022 3300025905 Bacteria 125184
925 Ga0207645_10090447 3300025907 Bacteria 1968
926 Ga0207645_10335245 3300025907 Unclassified 1010
927 Ga0207645_10882671 3300025907 Bacteria 608
928 Ga0207643_10009459 3300025908 Bacteria 5235
929 Ga0207643_10020496 3300025908 Bacteria 3629
930 Ga0207643_10035314 3300025908 Bacteria 2803
931 Ga0207643_10128602 3300025908 Bacteria 1505
932 Ga0207705_10026077 3300025909 Bacteria 4171
933 Ga0207705_10914779 3300025909 Bacteria 679
934 Ga0207684_10000076 3300025910 Bacteria 183107
935 Ga0207684_10014326 3300025910 Bacteria 6839
936 Ga0207684_10015928 3300025910 Bacteria 6460
937 Ga0207684_10041713 3300025910 Unclassified 3890
938 Ga0207684_10051531 3300025910 Bacteria 3492
939 Ga0207684_10226622 3300025910 Bacteria 1613
940 Ga0207684_10772316 3300025910 Unclassified 813
941 Ga0207654_10026859 3300025911 Bacteria 3123
942 Ga0207654_10189076 3300025911 Unclassified 1348
943 Ga0207654_10241094 3300025911 Unclassified 1208
944 Ga0207654_10292771 3300025911 Bacteria 1105
945 Ga0207654_10713569 3300025911 Unclassified 721
946 Ga0207707_10000077 3300025912 Bacteria 100255
947 Ga0207707_10017193 3300025912 Bacteria 6303
948 Ga0207707_10021381 3300025912 Bacteria 5656
949 Ga0207707_10191833 3300025912 Bacteria 1782
950 Ga0207707_10304439 3300025912 Unclassified 1378
951 Ga0207707_10540910 3300025912 Unclassified 990
952 Ga0207695_10097543 3300025913 Unclassified 2940
953 Ga0207671_10002740 3300025914 Bacteria 18427
954 Ga0207660_10039895 3300025917 Unclassified 3284
955 Ga0207660_10138515 3300025917 Bacteria 1859
956 Ga0207660_10359200 3300025917 Bacteria 1168
957 Ga0207660_10453091 3300025917 Bacteria 1038
958 Ga0207660_10581917 3300025917 Bacteria 911
959 Ga0207662_10018917 3300025918 Bacteria 3913
960 Ga0207662_10025954 3300025918 Bacteria 3377
961 Ga0207662_10071936 3300025918 Bacteria 2095
962 Ga0207662_10083504 3300025918 Unclassified 1953
963 Ga0207662_10279502 3300025918 Bacteria 1104
964 Ga0207662_10907846 3300025918 Unclassified 624
965 Ga0207657_10184645 3300025919 Bacteria 1684
966 Ga0207657_10399642 3300025919 Bacteria 1081
967 Ga0207649_10565206 3300025920 Bacteria 872
968 Ga0207652_10000096 3300025921 Bacteria 96047
969 Ga0207652_10081877 3300025921 Bacteria 2824
970 Ga0207652_10214648 3300025921 Bacteria 1733
971 Ga0207652_10792036 3300025921 Bacteria 842
972 Ga0207646_10001426 3300025922 Bacteria 29683
973 Ga0207646_10022181 3300025922 Bacteria 5854
974 Ga0207646_10044788 3300025922 Unclassified 3971
975 Ga0207646_10150147 3300025922 Unclassified 2101
976 Ga0207646_10178705 3300025922 Bacteria 1917
977 Ga0207646_10415365 3300025922 Bacteria 1215
978 Ga0207646_10458205 3300025922 Bacteria 1150
979 Ga0207646_10687722 3300025922 Unclassified 915
980 Ga0207646_11447444 3300025922 Unclassified 596
981 Ga0207681_10078357 3300025923 Bacteria 2325
982 Ga0207681_10166856 3300025923 Bacteria 1665
983 Ga0207681_11057481 3300025923 Bacteria 681
984 Ga0207650_10000027 3300025925 Bacteria 257466
985 Ga0207650_10026744 3300025925 Unclassified 4120
986 Ga0207650_10027728 3300025925 Unclassified 4056
987 Ga0207650_10266980 3300025925 Unclassified 1390
988 Ga0207650_10280903 3300025925 Bacteria 1356
989 Ga0207650_10294183 3300025925 Bacteria 1325
990 Ga0207650_10461351 3300025925 Bacteria 1058
991 Ga0207650_10718078 3300025925 Unclassified 845
992 Ga0207650_11411615 3300025925 Unclassified 592
993 Ga0207659_10064987 3300025926 Unclassified 2643
994 Ga0207659_10373373 3300025926 Bacteria 1188
995 Ga0207659_10951335 3300025926 Bacteria 739
996 Ga0207687_10026530 3300025927 Unclassified 3880
997 Ga0207687_10153793 3300025927 Unclassified 1758
998 Ga0207687_10269538 3300025927 Bacteria 1360
999 Ga0207687_11339148 3300025927 Unclassified 615
1000 Ga0207644_10002044 3300025931 Bacteria 13063
1001 Ga0207644_10025578 3300025931 Bacteria 4059
1002 Ga0207644_10029736 3300025931 Unclassified 3793
1003 Ga0207644_10092991 3300025931 Unclassified 2251
1004 Ga0207644_10099520 3300025931 Bacteria 2182
1005 Ga0207644_10455869 3300025931 Unclassified 1051
1006 Ga0207644_10563619 3300025931 Unclassified 944
1007 Ga0207690_10031903 3300025932 Bacteria 3376
1008 Ga0207690_10422471 3300025932 Bacteria 1067
1009 Ga0207706_10159184 3300025933 Bacteria 1985
1010 Ga0207706_10185035 3300025933 Bacteria 1829
1011 Ga0207706_10362866 3300025933 Bacteria 1258
1012 Ga0207706_10464105 3300025933 Bacteria 1095
1013 Ga0207706_10680553 3300025933 Bacteria 880
1014 Ga0207706_10901665 3300025933 Bacteria 747
1015 Ga0207686_10000062 3300025934 Bacteria 97842
1016 Ga0207686_10001492 3300025934 Bacteria 13197
1017 Ga0207686_10007557 3300025934 Bacteria 5853
1018 Ga0207686_10009952 3300025934 Bacteria 5169
1019 Ga0207686_10060120 3300025934 Unclassified 2404
1020 Ga0207686_10178943 3300025934 Bacteria 1502
1021 Ga0207686_10209298 3300025934 Unclassified 1401
1022 Ga0207686_10682734 3300025934 Unclassified 815
1023 Ga0207709_10000091 3300025935 Bacteria 144622
1024 Ga0207709_10012008 3300025935 Bacteria 4776
1025 Ga0207709_10022753 3300025935 Unclassified 3558
1026 Ga0207709_10120115 3300025935 Bacteria 1773
1027 Ga0207709_10147103 3300025935 Bacteria 1627
1028 Ga0207709_10233125 3300025935 Bacteria 1334
1029 Ga0207709_10235778 3300025935 Bacteria 1328
1030 Ga0207709_10311042 3300025935 Bacteria 1175
1031 Ga0207709_10435835 3300025935 Unclassified 1010
1032 Ga0207709_10532688 3300025935 Bacteria 921
1033 Ga0207709_10815121 3300025935 Unclassified 754
1034 Ga0207709_10952091 3300025935 Unclassified 700
1035 Ga0207709_10987294 3300025935 Unclassified 688
1036 Ga0207709_11151547 3300025935 Unclassified 638
1037 Ga0207709_11314698 3300025935 Unclassified 598
1038 Ga0207670_10029974 3300025936 Bacteria 3472
1039 Ga0207670_10059131 3300025936 Bacteria 2606
1040 Ga0207670_10105804 3300025936 Bacteria 2017
1041 Ga0207670_10239735 3300025936 Bacteria 1396
1042 Ga0207670_10345995 3300025936 Bacteria 1176
1043 Ga0207670_10733505 3300025936 Unclassified 820
1044 Ga0207670_10765003 3300025936 Unclassified 803
1045 Ga0207669_10023693 3300025937 Bacteria 3284
1046 Ga0207669_10288294 3300025937 Bacteria 1242
1047 Ga0207704_10031813 3300025938 Bacteria 2978
1048 Ga0207704_10587464 3300025938 Unclassified 910
1049 Ga0207665_10000033 3300025939 Bacteria 89014
1050 Ga0207665_10036012 3300025939 Bacteria 3288
1051 Ga0207665_10045529 3300025939 Bacteria 2938
1052 Ga0207665_10048985 3300025939 Bacteria 2838
1053 Ga0207691_10023812 3300025940 Bacteria 5763
1054 Ga0207691_10044279 3300025940 Bacteria 4097
1055 Ga0207691_10054893 3300025940 Bacteria 3633
1056 Ga0207691_10296339 3300025940 Bacteria 1390
1057 Ga0207691_10425659 3300025940 Bacteria 1131
1058 Ga0207691_10607085 3300025940 Unclassified 926
1059 Ga0207691_10813163 3300025940 Unclassified 785
1060 Ga0207711_10004896 3300025941 Bacteria 11367
1061 Ga0207711_10008701 3300025941 Bacteria 8489
1062 Ga0207711_10009657 3300025941 Bacteria 8039
1063 Ga0207711_10017604 3300025941 Bacteria 5935
1064 Ga0207711_10054024 3300025941 Unclassified 3445
1065 Ga0207711_10209715 3300025941 Unclassified 1779
1066 Ga0207711_10393877 3300025941 Bacteria 1286
1067 Ga0207711_10437869 3300025941 Bacteria 1216
1068 Ga0207711_10494138 3300025941 Unclassified 1140
1069 Ga0207711_10621300 3300025941 Unclassified 1008
1070 Ga0207711_10709661 3300025941 Unclassified 938
1071 Ga0207711_10943851 3300025941 Bacteria 801
1072 Ga0207711_11161970 3300025941 Unclassified 713
1073 Ga0207711_11182556 3300025941 Bacteria 706
1074 Ga0207711_11293233 3300025941 Bacteria 671
1075 Ga0207689_10006262 3300025942 Bacteria 10547
1076 Ga0207689_10011390 3300025942 Bacteria 7621
1077 Ga0207689_10026921 3300025942 Unclassified 4814
1078 Ga0207689_10045330 3300025942 Bacteria 3636
1079 Ga0207689_10048822 3300025942 Bacteria 3492
1080 Ga0207689_10051986 3300025942 Unclassified 3377
1081 Ga0207689_10078161 3300025942 Bacteria 2719
1082 Ga0207689_10154880 3300025942 Bacteria 1889
1083 Ga0207689_10260014 3300025942 Bacteria 1436
1084 Ga0207689_10289744 3300025942 Bacteria 1356
1085 Ga0207689_10604542 3300025942 Unclassified 922
1086 Ga0207689_10886627 3300025942 Unclassified 753
1087 Ga0207661_11320862 3300025944 Bacteria 662
1088 Ga0207679_10055065 3300025945 Bacteria 2931
1089 Ga0207679_10615183 3300025945 Unclassified 980
1090 Ga0207679_10661220 3300025945 Bacteria 946
1091 Ga0207679_10737439 3300025945 Unclassified 895
1092 Ga0207679_10933495 3300025945 Unclassified 794
1093 Ga0207679_11054799 3300025945 Unclassified 745
1094 Ga0207651_10070141 3300025960 Bacteria 2478
1095 Ga0207651_10141031 3300025960 Archaea 1862
1096 Ga0207651_10173082 3300025960 Unclassified 1705
1097 Ga0207651_10848155 3300025960 Bacteria 812
1098 Ga0207651_11215310 3300025960 Unclassified 677
1099 Ga0207712_10000106 3300025961 Bacteria 94950
1100 Ga0207712_10016341 3300025961 Bacteria 4803
1101 Ga0207712_10107539 3300025961 Bacteria 2086
1102 Ga0207712_10168780 3300025961 Bacteria 1708
1103 Ga0207712_10170114 3300025961 Bacteria 1702
1104 Ga0207712_10635895 3300025961 Bacteria 926
1105 Ga0207712_11162212 3300025961 Unclassified 688
1106 Ga0207668_10292150 3300025972 Bacteria 1341
1107 Ga0207668_10469889 3300025972 Bacteria 1077
1108 Ga0207668_11309495 3300025972 Bacteria 652
1109 Ga0207640_10067608 3300025981 Unclassified 2392
1110 Ga0207640_10109309 3300025981 Bacteria 1956
1111 Ga0207640_10139684 3300025981 Bacteria 1764
1112 Ga0207640_10296197 3300025981 Bacteria 1278
1113 Ga0207640_10399145 3300025981 Bacteria 1119
1114 Ga0207640_10512281 3300025981 Bacteria 1001
1115 Ga0207640_10608564 3300025981 Bacteria 926
1116 Ga0207640_10689280 3300025981 Bacteria 875
1117 Ga0207640_10705007 3300025981 Bacteria 866
1118 Ga0207640_10858050 3300025981 Bacteria 790
1119 Ga0207658_10023337 3300025986 Bacteria 4318
1120 Ga0207658_10055961 3300025986 Unclassified 2925
1121 Ga0207658_10125671 3300025986 Unclassified 2052
1122 Ga0207658_10335051 3300025986 Unclassified 1314
1123 Ga0207658_10702717 3300025986 Bacteria 914
1124 Ga0207677_10060089 3300026023 Unclassified 2625
1125 Ga0207677_10132373 3300026023 Bacteria 1896
1126 Ga0207677_10192370 3300026023 Bacteria 1615
1127 Ga0207677_10524888 3300026023 Bacteria 1028
1128 Ga0207677_10651972 3300026023 Unclassified 929
1129 Ga0207703_10000481 3300026035 Bacteria 41719
1130 Ga0207703_10001157 3300026035 Bacteria 24897
1131 Ga0207703_10006636 3300026035 Bacteria 9232
1132 Ga0207703_10015662 3300026035 Bacteria 5913
1133 Ga0207703_10032728 3300026035 Bacteria 4116
1134 Ga0207703_10055950 3300026035 Bacteria 3211
1135 Ga0207703_10057836 3300026035 Unclassified 3163
1136 Ga0207703_10076190 3300026035 Bacteria 2782
1137 Ga0207703_10132078 3300026035 Bacteria 2157
1138 Ga0207703_10249011 3300026035 Bacteria 1600
1139 Ga0207703_10288808 3300026035 Bacteria 1492
1140 Ga0207703_10375885 3300026035 Bacteria 1313
1141 Ga0207703_10549745 3300026035 Bacteria 1088
1142 Ga0207703_10661919 3300026035 Bacteria 991
1143 Ga0207703_11232558 3300026035 Unclassified 719
1144 Ga0207639_10025126 3300026041 Bacteria 4319
1145 Ga0207639_10038113 3300026041 Unclassified 3574
1146 Ga0207639_10161728 3300026041 Bacteria 1887
1147 Ga0207639_10339196 3300026041 Bacteria 1339
1148 Ga0207639_10700358 3300026041 Bacteria 940
1149 Ga0207639_11401088 3300026041 Unclassified 656
1150 Ga0207678_10140884 3300026067 Bacteria 2058
1151 Ga0207678_10248399 3300026067 Unclassified 1524
1152 Ga0207708_10000235 3300026075 Bacteria 43719
1153 Ga0207708_10015082 3300026075 Bacteria 5792
1154 Ga0207708_10022826 3300026075 Bacteria 4726
1155 Ga0207708_10039853 3300026075 Bacteria 3580
1156 Ga0207708_10072579 3300026075 Bacteria 2637
1157 Ga0207708_10280024 3300026075 Bacteria 1351
1158 Ga0207708_10322343 3300026075 Bacteria 1261
1159 Ga0207708_10360863 3300026075 Bacteria 1194
1160 Ga0207708_10467116 3300026075 Unclassified 1053
1161 Ga0207708_10572014 3300026075 Bacteria 955
1162 Ga0207708_10715436 3300026075 Bacteria 857
1163 Ga0207708_11039590 3300026075 Unclassified 713
1164 Ga0207702_10481024 3300026078 Bacteria 1208
1165 Ga0207641_10005244 3300026088 Bacteria 11081
1166 Ga0207641_10062794 3300026088 Unclassified 3171
1167 Ga0207641_10121460 3300026088 Bacteria 2332
1168 Ga0207641_10212017 3300026088 Unclassified 1792
1169 Ga0207641_10256272 3300026088 Unclassified 1636
1170 Ga0207641_10317875 3300026088 Bacteria 1475
1171 Ga0207641_10343384 3300026088 Bacteria 1421
1172 Ga0207641_10741442 3300026088 Bacteria 969
1173 Ga0207641_10792101 3300026088 Bacteria 937
1174 Ga0207641_11002821 3300026088 Unclassified 832
1175 Ga0207641_11086873 3300026088 Unclassified 798
1176 Ga0207641_11254059 3300026088 Unclassified 741
1177 Ga0207648_10009383 3300026089 Bacteria 9372
1178 Ga0207648_10088757 3300026089 Bacteria 2700
1179 Ga0207648_10099908 3300026089 Bacteria 2541
1180 Ga0207648_10102424 3300026089 Bacteria 2509
1181 Ga0207648_10135270 3300026089 Bacteria 2171
1182 Ga0207648_10145571 3300026089 Unclassified 2090
1183 Ga0207648_10166950 3300026089 Unclassified 1945
1184 Ga0207648_10219529 3300026089 Bacteria 1689
1185 Ga0207648_10249232 3300026089 Bacteria 1583
1186 Ga0207648_10287008 3300026089 Unclassified 1473
1187 Ga0207648_10381820 3300026089 Bacteria 1274
1188 Ga0207648_10511208 3300026089 Bacteria 1100
1189 Ga0207648_10550167 3300026089 Bacteria 1060
1190 Ga0207648_10655096 3300026089 Bacteria 971
1191 Ga0207676_10001919 3300026095 Bacteria 15191
1192 Ga0207676_10006195 3300026095 Bacteria 8447
1193 Ga0207676_10014373 3300026095 Bacteria 5694
1194 Ga0207676_10117303 3300026095 Bacteria 2238
1195 Ga0207676_10130724 3300026095 Bacteria 2134
1196 Ga0207676_10260881 3300026095 Bacteria 1565
1197 Ga0207676_10261118 3300026095 Bacteria 1564
1198 Ga0207676_10286582 3300026095 Bacteria 1497
1199 Ga0207676_10297318 3300026095 Bacteria 1473
1200 Ga0207676_10342444 3300026095 Bacteria 1380
1201 Ga0207676_10367362 3300026095 Bacteria 1335
1202 Ga0207676_10466801 3300026095 Bacteria 1193
1203 Ga0207676_10474838 3300026095 Bacteria 1183
1204 Ga0207676_10525374 3300026095 Bacteria 1127
1205 Ga0207676_10543387 3300026095 Bacteria 1109
1206 Ga0207676_10912800 3300026095 Bacteria 862
1207 Ga0207676_11188917 3300026095 Unclassified 755
1208 Ga0207676_11200358 3300026095 Bacteria 752
1209 Ga0207676_11402639 3300026095 Bacteria 695
1210 Ga0207674_10000525 3300026116 Bacteria 50323
1211 Ga0207674_10017630 3300026116 Bacteria 7787
1212 Ga0207674_10138878 3300026116 Bacteria 2391
1213 Ga0207674_10183087 3300026116 Bacteria 2046
1214 Ga0207674_10348877 3300026116 Bacteria 1431
1215 Ga0207674_10423353 3300026116 Unclassified 1287
1216 Ga0207674_10468568 3300026116 Unclassified 1217
1217 Ga0207674_10506129 3300026116 Bacteria 1167
1218 Ga0207675_100001552 3300026118 Bacteria 22994
1219 Ga0207675_100005444 3300026118 Bacteria 12201
1220 Ga0207675_100015389 3300026118 Bacteria 7135
1221 Ga0207675_100017262 3300026118 Bacteria 6739
1222 Ga0207675_100031385 3300026118 Bacteria 4950
1223 Ga0207675_100075254 3300026118 Bacteria 3160
1224 Ga0207675_100127665 3300026118 Unclassified 2410
1225 Ga0207675_100130632 3300026118 Bacteria 2382
1226 Ga0207675_100158073 3300026118 Bacteria 2161
1227 Ga0207675_100160160 3300026118 Bacteria 2146
1228 Ga0207675_100184754 3300026118 Archaea 1998
1229 Ga0207675_100246555 3300026118 Bacteria 1728
1230 Ga0207675_100267385 3300026118 Unclassified 1658
1231 Ga0207675_100410432 3300026118 Bacteria 1336
1232 Ga0207675_100664013 3300026118 Bacteria 1049
1233 Ga0207675_100726433 3300026118 Unclassified 1003
1234 Ga0207675_100775893 3300026118 Bacteria 971
1235 Ga0207675_101275706 3300026118 Bacteria 755
1236 Ga0207683_10071994 3300026121 Bacteria 3057
1237 Ga0207683_10236271 3300026121 Bacteria 1667
1238 Ga0207683_10273340 3300026121 Unclassified 1544
1239 Ga0207683_11101527 3300026121 Unclassified 737
1240 Ga0207683_11284713 3300026121 Unclassified 678
1241 Ga0207698_10337223 3300026142 Bacteria 1419
1242 Ga0207698_10623860 3300026142 Bacteria 1065
1243 Ga0207698_10701619 3300026142 Bacteria 1007
1244 Ga0207698_10888012 3300026142 Bacteria 898
1245 Ga0207698_11021874 3300026142 Bacteria 838
1246 Ga0209179_1114183 3300027512 Unclassified 603
1247 Ga0207428_10004899 3300027907 Bacteria 12612
1248 Ga0207428_10099483 3300027907 Bacteria 2249
1249 Ga0207428_10300280 3300027907 Bacteria 1188
1250 Ga0207428_10325557 3300027907 Bacteria 1134
1251 Ga0207428_10634319 3300027907 Unclassified 768
1252 Ga0268266_10614751 3300028379 Bacteria 1044
1253 Ga0268265_10003630 3300028380 Bacteria 11011
1254 Ga0268265_10155414 3300028380 Bacteria 1935
1255 Ga0268265_10193550 3300028380 Bacteria 1758
1256 Ga0268265_10506809 3300028380 Bacteria 1138
1257 Ga0268265_10590493 3300028380 Unclassified 1060
1258 Ga0268265_10823430 3300028380 Bacteria 906
1259 Ga0268265_10891119 3300028380 Bacteria 873
1260 Ga0268265_10936295 3300028380 Unclassified 853
1261 Ga0268264_10005319 3300028381 Bacteria 10904
1262 Ga0268264_10006931 3300028381 Bacteria 9507
1263 Ga0268264_10019417 3300028381 Bacteria 5555
1264 Ga0268264_10050094 3300028381 Bacteria 3476
1265 Ga0268264_10148899 3300028381 Unclassified 2096
1266 Ga0268264_10150148 3300028381 Unclassified 2088
1267 Ga0268264_10171445 3300028381 Bacteria 1963
1268 Ga0268264_10286096 3300028381 Bacteria 1546
1269 Ga0268264_10315683 3300028381 Unclassified 1476
1270 Ga0268264_10339746 3300028381 Unclassified 1426
1271 Ga0268264_10367378 3300028381 Bacteria 1374
1272 Ga0268264_10396794 3300028381 Bacteria 1325
1273 Ga0268264_10407270 3300028381 Bacteria 1308
1274 Ga0268264_10609949 3300028381 Bacteria 1076
1275 Ga0268264_11193195 3300028381 Bacteria 770
1276 Ga0268264_11326198 3300028381 Unclassified 730
1277 Ga0268264_12035747 3300028381 Bacteria 583
1278 Ga0268264_12075760 3300028381 Unclassified 577
1279 Ga0316182_1250615 3300030745 Bacteria 734
1280 Ga0307513_10001810 3300031456 Bacteria 30363
1281 Ga0307513_10569372 3300031456 Bacteria 844
1282 Ga0307408_100008854 3300031548 Bacteria 6647
1283 Ga0307408_100242787 3300031548 Bacteria 1481
1284 Ga0307408_100368437 3300031548 Archaea 1224
1285 Ga0307408_100619453 3300031548 Bacteria 964
1286 Ga0307408_100735940 3300031548 Unclassified 889
1287 Ga0307408_101120057 3300031548 Bacteria 731
1288 Ga0307405_10004255 3300031731 Bacteria 6736
1289 Ga0307405_10020335 3300031731 Bacteria 3707
1290 Ga0307405_10021988 3300031731 Unclassified 3597
1291 Ga0307405_10073078 3300031731 Bacteria 2213
1292 Ga0307405_10084677 3300031731 Unclassified 2082
1293 Ga0307405_10112780 3300031731 Bacteria 1845
1294 Ga0307405_10393475 3300031731 Unclassified 1083
1295 Ga0307413_10018801 3300031824 Bacteria 3634
1296 Ga0307413_10024394 3300031824 Bacteria 3297
1297 Ga0307413_10044642 3300031824 Bacteria 2621
1298 Ga0307413_10068179 3300031824 Bacteria 2227
1299 Ga0307413_10219597 3300031824 Bacteria 1387
1300 Ga0307413_10274131 3300031824 Bacteria 1265
1301 Ga0307413_10458987 3300031824 Bacteria 1013
1302 Ga0307410_10013140 3300031852 Bacteria 4818
1303 Ga0307410_10013817 3300031852 Bacteria 4726
1304 Ga0307410_10245959 3300031852 Unclassified 1388
1305 Ga0307410_10248131 3300031852 Bacteria 1383
1306 Ga0307410_10308132 3300031852 Bacteria 1252
1307 Ga0307410_10421086 3300031852 Bacteria 1083
1308 Ga0307410_10450125 3300031852 Bacteria 1050
1309 Ga0307410_10551024 3300031852 Bacteria 956
1310 Ga0307406_10007171 3300031901 Bacteria 6174
1311 Ga0307406_10011489 3300031901 Bacteria 5029
1312 Ga0307406_10249572 3300031901 Bacteria 1336
1313 Ga0307406_10872405 3300031901 Unclassified 764
1314 Ga0307406_11143854 3300031901 Bacteria 674
1315 Ga0307407_10007946 3300031903 Bacteria 4835
1316 Ga0307407_10159326 3300031903 Bacteria 1475
1317 Ga0307407_10162969 3300031903 Bacteria 1461
1318 Ga0307412_10052512 3300031911 Bacteria 2699
1319 Ga0307412_10055898 3300031911 Bacteria 2628
1320 Ga0307412_10056920 3300031911 Unclassified 2608
1321 Ga0307412_10085572 3300031911 Bacteria 2191
1322 Ga0307409_100006264 3300031995 Bacteria 6969
1323 Ga0307409_100350432 3300031995 Bacteria 1393
1324 Ga0307409_100852615 3300031995 Bacteria 922
1325 Ga0307409_100887452 3300031995 Bacteria 904
1326 Ga0307409_101590788 3300031995 Unclassified 682
1327 Ga0307416_100004832 3300032002 Bacteria 8196
1328 Ga0307416_100015918 3300032002 Bacteria 5210
1329 Ga0307416_100380298 3300032002 Bacteria 1442
1330 Ga0307416_101227180 3300032002 Unclassified 855
1331 Ga0307416_101564214 3300032002 Bacteria 765
1332 Ga0307416_101832342 3300032002 Unclassified 710
1333 Ga0307416_101899074 3300032002 Unclassified 699
1334 Ga0307416_102454084 3300032002 Bacteria 620
1335 Ga0307414_10011752 3300032004 Bacteria 5150
1336 Ga0307414_10049325 3300032004 Bacteria 2910
1337 Ga0307414_10210989 3300032004 Bacteria 1587
1338 Ga0307414_10212594 3300032004 Bacteria 1582
1339 Ga0307414_10281889 3300032004 Bacteria 1397
1340 Ga0307414_10539486 3300032004 Unclassified 1038
1341 Ga0307414_10846089 3300032004 Unclassified 836
1342 Ga0307414_11110754 3300032004 Bacteria 730
1343 Ga0307411_10006971 3300032005 Bacteria 5707
1344 Ga0307411_10021834 3300032005 Bacteria 3756
1345 Ga0307411_10120851 3300032005 Bacteria 1895
1346 Ga0307411_10285346 3300032005 Bacteria 1316
1347 Ga0307411_10300064 3300032005 Bacteria 1288
1348 Ga0307411_10526431 3300032005 Unclassified 1004
1349 Ga0307411_11142272 3300032005 Unclassified 704
1350 Ga0307415_100016598 3300032126 Bacteria 4393
1351 Ga0307415_100063138 3300032126 Bacteria 2572
1352 Ga0307415_100091086 3300032126 Bacteria 2208
1353 Ga0307415_100106168 3300032126 Bacteria 2073
1354 Ga0307415_100823177 3300032126 Bacteria 849
1355 Ga0373959_0043410 3300034820 Unclassified 951
1356 Ga0373940_0053696 3300035088 Bacteria 1138
1357 Ga0373951_0003754 3300035091 Bacteria 3662
1358 Ga0373951_0089749 3300035091 Unclassified 805
1359 Ga0373932_0122195 3300035112 Bacteria 869
1360 Ga0373932_0193024 3300035112 Unclassified 720
1361 Ga0373932_0349676 3300035112 Bacteria 562
1362 Ga0373941_0166982 3300035115 Bacteria 818
1363 Ga0373961_0092351 3300035241 Bacteria 969
1364 Ga0373962_0215178 3300035242 Unclassified 655
1365 Ga0373937_0089715 3300036401 Unclassified 2847
1366 Ga0395900_0095536 3300037418 Bacteria 3054
1367 Ga0395900_0215130 3300037418 Bacteria 1940
1368 Ga0395900_0651565 3300037418 Bacteria 990
1369 Ga0395900_1006133 3300037418 Unclassified 753
1370 Ga0395898_0607733 3300037466 Bacteria 1036
1371 Ga0395905_0006243 3300037471 Bacteria 12033
1372 Ga0395905_0029319 3300037471 Bacteria 5185
1373 Ga0436364_1375113 3300037853 Unclassified 1618
1374 Ga0395901_0166097 3300038443 Bacteria 2318
1375 Ga0395901_0218696 3300038443 Bacteria 1992
1376 Ga0395901_0275573 3300038443 Bacteria 1749
1377 Ga0242422_00915 3300038699 Unclassified 2003
1378 Ga0242422_04863 3300038699 Unclassified 830
1379 Ga0242420_004415 3300038996 Unclassified 2126
1380 Ga0242420_004617 3300038996 Bacteria 2091
1381 Ga0242420_012275 3300038996 Bacteria 1448
1382 Ga0436365_0671904 3300039437 Bacteria 4445
1383 Ga0436365_0740320 3300039437 Bacteria 1603
1384 Ga0436365_0881711 3300039437 Bacteria 771
1385 Ga0436365_1860421 3300039437 Bacteria 1540
1386 Ga0439453_0026611 3300041408 Unclassified 1073
1387 Ga0439448_0110086 3300042005 Unclassified 940
1388 Ga0439449_0277139 3300042007 Bacteria 632
1389 Ga0439455_0006129 3300042012 Bacteria 2480
1390 Ga0439462_0129370 3300042015 Bacteria 704
1391 Ga0439446_0011230 3300042156 Bacteria 2429
1392 Ga0439458_0005147 3300042157 Bacteria 2949
1393 Ga0439434_0022033 3300042435 Bacteria 1915
1394 Ga0450916_014560 3300042530 Bacteria 1026
1395 Ga0451577_0010762 3300042876 Bacteria 8704
1396 Ga0451577_0528078 3300042876 Bacteria 1072
1397 Ga0453683_0026879 3300044673 Unclassified 3653
1398 Ga0453683_0112947 3300044673 Bacteria 1709
1399 Ga0453683_0207094 3300044673 Bacteria 1245
1400 Ga0453683_0462078 3300044673 Bacteria 822
1401 Ga0453684_0521793 3300044712 Bacteria 1312
1402 Ga0451576_0027944 3300045051 Bacteria 6050
1403 Ga0451576_0042739 3300045051 Unclassified 4784
1404 Ga0451576_0223808 3300045051 Unclassified 1965
1405 Ga0451576_0432056 3300045051 Unclassified 1382
1406 Ga0451576_1061299 3300045051 Unclassified 848
1407 Ga0451576_1623280 3300045051 Bacteria 670
1408 Ga0451576_1629439 3300045051 Unclassified 669
1409 Ga0451576_1897661 3300045051 Bacteria 615
1410 Ga0495580_0200551 3300046472 Bacteria 1375
1411 Ga0495662_0225749 3300046476 Bacteria 923
1412 Ga0495584_0257170 3300046491 Bacteria 888
1413 Ga0495630_0248877 3300046517 Bacteria 1358
1414 Ga0495643_0179669 3300046522 Bacteria 1029
1415 Ga0495663_0000433 3300046525 Bacteria 15293
1416 Ga0495587_0195396 3300046536 Unclassified 1145
1417 Ga0495598_0002150 3300046537 Bacteria 4026
1418 Ga0495598_0004506 3300046537 Unclassified 3022
1419 Ga0495621_0002053 3300046539 Bacteria 5328
1420 Ga0495634_0341040 3300046642 Bacteria 899
1421 Ga0495635_0552333 3300046663 Unclassified 755
1422 Ga0495659_0073632 3300046664 Bacteria 1284
1423 Ga0495658_0000468 3300046683 Bacteria 22335
1424 Ga0495658_0297351 3300046683 Unclassified 1021
1425 Ga0495670_0096461 3300046691 Bacteria 1518
1426 Ga0495672_0084998 3300047320 Bacteria 1754
1427 Ga0495672_0358902 3300047320 Unclassified 675
1428 Ga0495680_0296987 3300047322 Unclassified 1135
1429 Ga0496101_0969763 3300048904 Unclassified 669
1430 Ga0496102_0639548 3300048905 Bacteria 987
1431 Ga0496102_1415872 3300048905 Unclassified 614
1432 Ga0496104_0128948 3300048907 Bacteria 2429
1433 Ga0496104_0841074 3300048907 Unclassified 823
1434 Ga0496104_1100051 3300048907 Bacteria 698
1435 Ga0496105_0346690 3300048908 Bacteria 1187
1436 Ga0496106_0037768 3300048909 Bacteria 3613
1437 Ga0496106_0967249 3300048909 Bacteria 670
1438 Ga0496108_0087202 3300048911 Unclassified 2651
1439 Ga0496108_0259001 3300048911 Unclassified 1514
1440 Ga0496109_0333755 3300048912 Bacteria 1431
1441 Ga0496109_1065211 3300048912 Unclassified 746
1442 Ga0496110_0172091 3300048913 Bacteria 1965
1443 Ga0496110_0408029 3300048913 Bacteria 1239
1444 Ga0496110_0763773 3300048913 Bacteria 870
1445 Ga0496111_0504625 3300048914 Bacteria 890
1446 Ga0496112_0506507 3300048915 Bacteria 1142
1447 Ga0496112_0658939 3300048915 Unclassified 976
1448 Ga0496112_0889326 3300048915 Unclassified 813
1449 Ga0496112_1066533 3300048915 Bacteria 727
1450 Ga0496114_0505393 3300048917 Unclassified 1069
1451 Ga0496115_0197257 3300048918 Bacteria 1663
1452 Ga0501290_029014 3300049513 Bacteria 786
1453 Ga0501291_010360 3300049514 Bacteria 1325
1454 Ga0501291_023001 3300049514 Bacteria 1005
1455 Ga0501292_009194 3300049515 Bacteria 1463
1456 Ga0501293_015490 3300049516 Bacteria 702
1457 Ga0501296_002072 3300049519 Bacteria 2061
1458 Ga0501296_003660 3300049519 Bacteria 1647
1459 Ga0501296_016193 3300049519 Unclassified 925
1460 Ga0501298_076426 3300049521 Unclassified 730
1461 Ga0501299_019458 3300049522 Bacteria 1228
1462 Ga0501299_034099 3300049522 Unclassified 995
1463 Ga0501303_021393 3300049526 Unclassified 692
1464 Ga0501071_0580785 3300049587 Bacteria 861
1465 Ga0501198_005552 3300049649 Bacteria 1778
1466 Ga0501198_032576 3300049649 Bacteria 876
1467 Ga0501202_009854 3300049652 Bacteria 1764
1468 Ga0501202_012666 3300049652 Bacteria 1595
1469 Ga0501202_028508 3300049652 Bacteria 1153
1470 Ga0501207_011564 3300049654 Bacteria 1316
1471 Ga0501207_030313 3300049654 Bacteria 906
1472 Ga0501208_019907 3300049655 Bacteria 1086
1473 Ga0501216_006795 3300049660 Unclassified 1764
1474 Ga0501216_007853 3300049660 Bacteria 1667
1475 Ga0501217_005217 3300049661 Bacteria 2708
1476 Ga0501217_025120 3300049661 Bacteria 1431
1477 Ga0501217_029945 3300049661 Bacteria 1334
1478 Ga0501223_005137 3300049663 Bacteria 2764
1479 Ga0501223_010856 3300049663 Bacteria 1829
1480 Ga0501223_028003 3300049663 Bacteria 1097
1481 Ga0501223_042103 3300049663 Bacteria 886
1482 Ga0501227_000507 3300049665 Bacteria 8353
1483 Ga0501227_008655 3300049665 Bacteria 2183
1484 Ga0501227_124903 3300049665 Bacteria 697
1485 Ga0501233_007017 3300049668 Unclassified 2135
1486 Ga0501235_002582 3300049669 Bacteria 3897
1487 Ga0501235_043789 3300049669 Bacteria 1027
1488 Ga0501235_064580 3300049669 Unclassified 860
1489 Ga0501236_032306 3300049670 Unclassified 833
1490 Ga0501240_009003 3300049673 Bacteria 1294
1491 Ga0501240_013696 3300049673 Bacteria 1129
1492 Ga0501243_008153 3300049675 Bacteria 1611
1493 Ga0501246_013156 3300049676 Bacteria 784
1494 Ga0501246_041747 3300049676 Bacteria 550
1495 Ga0501249_011380 3300049679 Bacteria 1867
1496 Ga0501250_009161 3300049680 Bacteria 1108
1497 Ga0501251_003811 3300049681 Bacteria 1527
1498 Ga0501255_013484 3300049684 Bacteria 972
1499 Ga0501256_011166 3300049685 Bacteria 865
1500 Ga0501256_017115 3300049685 Bacteria 737
1501 Ga0501257_012993 3300049686 Bacteria 1908
1502 Ga0501257_013305 3300049686 Unclassified 1887
1503 Ga0501257_045799 3300049686 Bacteria 1082
1504 Ga0501260_002995 3300049689 Bacteria 1495
1505 Ga0501260_012712 3300049689 Bacteria 863
1506 Ga0501260_013557 3300049689 Bacteria 841
1507 Ga0501221_010336 3300049704 Bacteria 1656
1508 Ga0501221_058055 3300049704 Bacteria 888
1509 Ga0501221_179211 3300049704 Unclassified 578
1510 Ga0501225_0000353 3300049705 Bacteria 14561
1511 Ga0501225_0002065 3300049705 Bacteria 6245
1512 Ga0501225_0023783 3300049705 Bacteria 1688
1513 Ga0501225_0032378 3300049705 Bacteria 1438
1514 Ga0501225_0033552 3300049705 Bacteria 1412
1515 Ga0501225_0034674 3300049705 Bacteria 1389
1516 Ga0501234_002584 3300049707 Bacteria 2853
1517 Ga0501234_005142 3300049707 Bacteria 2046
1518 Ga0501245_025422 3300049708 Unclassified 951
1519 Ga0501079_0253081 3300049741 Bacteria 1377
1520 Ga0501232_018729 3300049757 Bacteria 873
1521 Ga0501265_030866 3300049762 Bacteria 770
1522 Ga0501268_025709 3300049765 Bacteria 1036
1523 Ga0501268_030360 3300049765 Unclassified 975
1524 Ga0501268_073992 3300049765 Bacteria 693
1525 Ga0501273_001548 3300049770 Bacteria 2214
1526 Ga0501278_015916 3300049774 Bacteria 651
1527 Ga0501283_001444 3300049779 Bacteria 3084
1528 Ga0501283_041360 3300049779 Unclassified 798
1529 Ga0501283_077483 3300049779 Bacteria 621
1530 Ga0501045_0351569 3300049824 Unclassified 1097
1531 Ga0501200_02225 3300049849 Bacteria 786
1532 Ga0501212_006264 3300049851 Bacteria 1600
1533 Ga0501212_061217 3300049851 Bacteria 652
1534 Ga0501226_006784 3300049853 Bacteria 1291
1535 nmdc:mga05p37_1012610_c1 3300050507 Bacteria 881
1536 nmdc:mga05p37_13138_c2 3300050507 Bacteria 4705
1537 nmdc:mga05p37_1558846_c1 3300050507 Bacteria 654
1538 nmdc:mga05p37_157730_c2 3300050507 Bacteria 2350
1539 nmdc:mga05p37_166487_c1 3300050507 Bacteria 2690
1540 nmdc:mga05p37_263938_c1 3300050507 Bacteria 2059
1541 nmdc:mga05p37_279144_c1 3300050507 Bacteria 1993
1542 nmdc:mga05p37_318323_c1 3300050507 Bacteria 1842
1543 nmdc:mga05p37_327283_c1 3300050507 Unclassified 1811
1544 nmdc:mga05p37_449186_c1 3300050507 Bacteria 1493
1545 nmdc:mga05p37_472071_c1 3300050507 Bacteria 1447
1546 nmdc:mga05p37_589915_c1 3300050507 Bacteria 1256
1547 nmdc:mga05p37_603664_c1 3300050507 Bacteria 1238
1548 nmdc:mga05p37_65876_c2 3300050507 Bacteria 3919
1549 nmdc:mga05p37_830784_c1 3300050507 Bacteria 1006
1550 nmdc:mga09592_122616_c1 3300050508 Bacteria 2233
1551 nmdc:mga09592_223094_c1 3300050508 Bacteria 1633
1552 nmdc:mga09592_556518_c1 3300050508 Bacteria 985
1553 nmdc:mga09592_98377_c1 3300050508 Bacteria 2504
1554 nmdc:mga0qj67_184498_c1 3300050509 Bacteria 1695
1555 nmdc:mga0qj67_316065_c1 3300050509 Bacteria 1264
1556 nmdc:mga0qj67_54043_c1 3300050509 Bacteria 3180
1557 nmdc:mga06r32_1277379_c1 3300050510 Unclassified 678
1558 nmdc:mga06r32_1539053_c1 3300050510 Unclassified 605
1559 nmdc:mga06r32_442342_c1 3300050510 Bacteria 1280
1560 nmdc:mga06r32_580501_c1 3300050510 Unclassified 1093
1561 nmdc:mga08y16_161298_c1 3300050511 Bacteria 2330
1562 nmdc:mga08y16_181698_c1 3300050511 Bacteria 2184
1563 nmdc:mga08y16_181767_c1 3300050511 Unclassified 2183
1564 nmdc:mga08y16_215192_c1 3300050511 Bacteria 1990
1565 nmdc:mga08y16_3544_c1 3300050511 Bacteria 16207
1566 nmdc:mga08y16_456406_c1 3300050511 Bacteria 1303
1567 nmdc:mga08y16_734125_c1 3300050511 Unclassified 985
1568 nmdc:mga08y16_933117_c1 3300050511 Bacteria 852
1569 nmdc:mga0n895_111904_c1 3300050512 Bacteria 2747
1570 nmdc:mga0n895_145294_c1 3300050512 Bacteria 2401
1571 nmdc:mga0n895_246981_c1 3300050512 Bacteria 1811
1572 nmdc:mga0n895_258647_c1 3300050512 Bacteria 1767
1573 nmdc:mga0n895_316832_c1 3300050512 Bacteria 1581
1574 nmdc:mga0n895_388090_c1 3300050512 Bacteria 1412
1575 nmdc:mga0n895_409532_c1 3300050512 Bacteria 1371
1576 nmdc:mga0n895_4359_c1 3300050512 Bacteria 11604
1577 nmdc:mga0n895_734098_c1 3300050512 Bacteria 982
1578 nmdc:mga0n895_939_c1 3300050512 Bacteria 21048
1579 nmdc:mga0rr50_711_c1 3300050513 Bacteria 17893
1580 nmdc:mga0rr50_8332_c1 3300050513 Bacteria 6449
1581 nmdc:mga0rr50_9855_c1 3300050513 Bacteria 6036
1582 nmdc:mga08x19_10917_c1 3300050514 Bacteria 5463
1583 nmdc:mga08x19_115629_c1 3300050514 Bacteria 1793
1584 nmdc:mga08x19_13_c1 3300050514 Bacteria 366166
1585 nmdc:mga08x19_5561_c2 3300050514 Bacteria 5783
1586 nmdc:mga08x19_87894_c1 3300050514 Unclassified 2048
1587 nmdc:mga0a205_175950_c1 3300050515 Bacteria 2035
1588 nmdc:mga0a205_178748_c1 3300050515 Bacteria 2016
1589 nmdc:mga0a205_18_c2 3300050515 Bacteria 96859
1590 nmdc:mga0a205_20337_c1 3300050515 Bacteria 6261
1591 nmdc:mga0a205_214547_c1 3300050515 Bacteria 1812
1592 nmdc:mga0a205_22311_c1 3300050515 Bacteria 5994
1593 nmdc:mga0a205_23433_c1 3300050515 Bacteria 5856
1594 nmdc:mga0a205_326721_c1 3300050515 Bacteria 1404
1595 nmdc:mga0a205_432479_c1 3300050515 Bacteria 1177
1596 nmdc:mga0a205_49266_c1 3300050515 Unclassified 4066
1597 nmdc:mga0a205_615442_c1 3300050515 Bacteria 939
1598 nmdc:mga0a205_641215_c1 3300050515 Unclassified 914
1599 nmdc:mga0a205_649040_c1 3300050515 Bacteria 907
1600 nmdc:mga0a205_991398_c1 3300050515 Bacteria 687
1601 Ga0500616_0003139 3300053153 Bacteria 12913
1602 Ga0501084_0872196 3300054114 Unclassified 757
1603 Ga0530510_0032439 3300061734 Bacteria 3758

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025933 Ga0207706_10901665 Ga0207706_109016652 155
2 3300026095 Ga0207676_11200358 Ga0207676_112003581 159
3 3300005440 Ga0070705_100094488 Ga0070705_1000944882 162
4 3300005444 Ga0070694_100196629 Ga0070694_1001966291 162
5 3300005445 Ga0070708_100383701 Ga0070708_1003837012 162
6 3300005546 Ga0070696_100009479 Ga0070696_1000094794 162
7 3300005546 Ga0070696_100622857 Ga0070696_1006228572 162
8 3300005549 Ga0070704_100008606 Ga0070704_1000086063 162
9 3300015262 Ga0182007_10137389 Ga0182007_101373891 163
10 3300045051 Ga0451576_1623280 Ga0451576_1623280_151_648 163
11 3300005436 Ga0070713_100832593 Ga0070713_1008325931 164
12 3300005436 Ga0070713_101699829 Ga0070713_1016998291 164
13 3300006028 Ga0070717_10083849 Ga0070717_100838493 164
14 3300006881 Ga0068865_100030118 Ga0068865_1000301184 164
15 3300009093 Ga0105240_11654454 Ga0105240_116544541 164
16 3300009148 Ga0105243_11329035 Ga0105243_113290351 164
17 3300013297 Ga0157378_10032949 Ga0157378_100329492 164
18 3300025920 Ga0207649_10565206 Ga0207649_105652062 164
19 3300025927 Ga0207687_11339148 Ga0207687_113391481 164
20 3300025935 Ga0207709_11314698 Ga0207709_113146981 164
21 3300026075 Ga0207708_10572014 Ga0207708_105720142 164
22 3300045051 Ga0451576_0432056 Ga0451576_0432056_803_1297 164
23 3300046536 Ga0495587_0195396 Ga0495587_0195396_485_982 164
24 3300048918 Ga0496115_0197257 Ga0496115_0197257_1112_1609 164
25 2124908027 MRS2a_Contig_25904 MRS2a_00747600 165
26 2162886007 SwRhRL2b_contig_1494996 SwRhRL2b_0980.00006380 165
27 3300001990 JGI24737J22298_10163824 JGI24737J22298_101638241 165
28 3300002074 JGI24748J21848_1000003 JGI24748J21848_1000003157 165
29 3300002076 JGI24749J21850_1060465 JGI24749J21850_10604651 165
30 3300002239 JGI24034J26672_10000005 JGI24034J26672_10000005244 165
31 3300002459 JGI24751J29686_10000085 JGI24751J29686_1000008549 165
32 3300003203 JGI25406J46586_10005741 JGI25406J46586_100057416 165
33 3300003203 JGI25406J46586_10011023 JGI25406J46586_100110233 165
34 3300003203 JGI25406J46586_10011063 JGI25406J46586_100110633 165
35 3300005288 Ga0065714_10064444 Ga0065714_1006444476 165
36 3300005289 Ga0065704_10039429 Ga0065704_100394291 165
37 3300005289 Ga0065704_10117053 Ga0065704_101170531 165
38 3300005289 Ga0065704_10132432 Ga0065704_101324322 165
39 3300005289 Ga0065704_10143041 Ga0065704_101430412 165
40 3300005289 Ga0065704_10244530 Ga0065704_102445302 165
41 3300005289 Ga0065704_10450959 Ga0065704_104509591 165
42 3300005289 Ga0065704_10475927 Ga0065704_104759271 165
43 3300005290 Ga0065712_10010420 Ga0065712_100104203 165
44 3300005290 Ga0065712_10025721 Ga0065712_100257212 165
45 3300005290 Ga0065712_10030034 Ga0065712_100300341 165
46 3300005290 Ga0065712_10067736 Ga0065712_1006773624 165
47 3300005290 Ga0065712_10072133 Ga0065712_100721332 165
48 3300005290 Ga0065712_10079828 Ga0065712_100798282 165
49 3300005290 Ga0065712_10355129 Ga0065712_103551291 165
50 3300005293 Ga0065715_10003956 Ga0065715_100039562 165
51 3300005293 Ga0065715_10014485 Ga0065715_100144852 165
52 3300005293 Ga0065715_10018531 Ga0065715_100185312 165
53 3300005293 Ga0065715_10090715 Ga0065715_100907155 165
54 3300005293 Ga0065715_10100860 Ga0065715_101008603 165
55 3300005293 Ga0065715_10122203 Ga0065715_101222032 165
56 3300005293 Ga0065715_10123337 Ga0065715_101233372 165
57 3300005293 Ga0065715_10274289 Ga0065715_102742892 165
58 3300005293 Ga0065715_10327167 Ga0065715_103271671 165
59 3300005293 Ga0065715_10368634 Ga0065715_103686342 165
60 3300005293 Ga0065715_10379622 Ga0065715_103796222 165
61 3300005293 Ga0065715_10411178 Ga0065715_104111781 165
62 3300005293 Ga0065715_10524944 Ga0065715_105249441 165
63 3300005293 Ga0065715_10621480 Ga0065715_106214801 165
64 3300005293 Ga0065715_10819193 Ga0065715_108191931 165
65 3300005295 Ga0065707_10001462 Ga0065707_100014626 165
66 3300005295 Ga0065707_10020998 Ga0065707_100209982 165
67 3300005295 Ga0065707_10026934 Ga0065707_100269341 165
68 3300005295 Ga0065707_10089972 Ga0065707_100899724 165
69 3300005295 Ga0065707_10113776 Ga0065707_101137762 165
70 3300005295 Ga0065707_10170993 Ga0065707_101709932 165
71 3300005295 Ga0065707_10348724 Ga0065707_103487241 165
72 3300005327 Ga0070658_10008799 Ga0070658_100087994 165
73 3300005327 Ga0070658_10146778 Ga0070658_101467782 165
74 3300005328 Ga0070676_10061106 Ga0070676_100611062 165
75 3300005328 Ga0070676_10131569 Ga0070676_101315692 165
76 3300005328 Ga0070676_10202062 Ga0070676_102020621 165
77 3300005329 Ga0070683_101136427 Ga0070683_1011364272 165
78 3300005330 Ga0070690_100002320 Ga0070690_1000023207 165
79 3300005330 Ga0070690_100106789 Ga0070690_1001067893 165
80 3300005330 Ga0070690_100115287 Ga0070690_1001152872 165
81 3300005330 Ga0070690_100527616 Ga0070690_1005276162 165
82 3300005330 Ga0070690_100812537 Ga0070690_1008125372 165
83 3300005331 Ga0070670_100000057 Ga0070670_100000057107 165
84 3300005331 Ga0070670_100088040 Ga0070670_1000880404 165
85 3300005331 Ga0070670_100128392 Ga0070670_1001283923 165
86 3300005331 Ga0070670_100202334 Ga0070670_1002023342 165
87 3300005331 Ga0070670_100272632 Ga0070670_1002726322 165
88 3300005331 Ga0070670_100622243 Ga0070670_1006222431 165
89 3300005331 Ga0070670_100875061 Ga0070670_1008750612 165
90 3300005331 Ga0070670_101776661 Ga0070670_1017766611 165
91 3300005333 Ga0070677_10310605 Ga0070677_103106052 165
92 3300005334 Ga0068869_100019360 Ga0068869_1000193602 165
93 3300005334 Ga0068869_100029072 Ga0068869_1000290724 165
94 3300005334 Ga0068869_100187201 Ga0068869_1001872012 165
95 3300005334 Ga0068869_100214733 Ga0068869_1002147332 165
96 3300005334 Ga0068869_100323833 Ga0068869_1003238332 165
97 3300005334 Ga0068869_100984298 Ga0068869_1009842982 165
98 3300005334 Ga0068869_101084475 Ga0068869_1010844751 165
99 3300005334 Ga0068869_101149542 Ga0068869_1011495421 165
100 3300005334 Ga0068869_101609049 Ga0068869_1016090491 165
101 3300005335 Ga0070666_10128161 Ga0070666_101281612 165
102 3300005335 Ga0070666_10131359 Ga0070666_101313592 165
103 3300005335 Ga0070666_11043000 Ga0070666_110430001 165
104 3300005336 Ga0070680_100004835 Ga0070680_1000048357 165
105 3300005336 Ga0070680_100141451 Ga0070680_1001414512 165
106 3300005336 Ga0070680_100310139 Ga0070680_1003101392 165
107 3300005336 Ga0070680_100364168 Ga0070680_1003641682 165
108 3300005336 Ga0070680_100379591 Ga0070680_1003795911 165
109 3300005336 Ga0070680_100900142 Ga0070680_1009001421 165
110 3300005337 Ga0070682_100000068 Ga0070682_10000006864 165
111 3300005337 Ga0070682_100001206 Ga0070682_1000012069 165
112 3300005337 Ga0070682_100051449 Ga0070682_1000514492 165
113 3300005337 Ga0070682_100323292 Ga0070682_1003232921 165
114 3300005337 Ga0070682_101327154 Ga0070682_1013271541 165
115 3300005338 Ga0068868_100052164 Ga0068868_1000521642 165
116 3300005338 Ga0068868_100106440 Ga0068868_1001064403 165
117 3300005338 Ga0068868_100546663 Ga0068868_1005466632 165
118 3300005338 Ga0068868_100574778 Ga0068868_1005747782 165
119 3300005338 Ga0068868_100659147 Ga0068868_1006591472 165
120 3300005338 Ga0068868_101146754 Ga0068868_1011467541 165
121 3300005338 Ga0068868_101149644 Ga0068868_1011496441 165
122 3300005339 Ga0070660_100197598 Ga0070660_1001975983 165
123 3300005339 Ga0070660_101466709 Ga0070660_1014667091 165
124 3300005340 Ga0070689_100095221 Ga0070689_1000952213 165
125 3300005340 Ga0070689_100101389 Ga0070689_1001013892 165
126 3300005340 Ga0070689_100373944 Ga0070689_1003739442 165
127 3300005340 Ga0070689_100519150 Ga0070689_1005191502 165
128 3300005340 Ga0070689_100567312 Ga0070689_1005673122 165
129 3300005340 Ga0070689_100577548 Ga0070689_1005775481 165
130 3300005340 Ga0070689_101166374 Ga0070689_1011663741 165
131 3300005340 Ga0070689_101269317 Ga0070689_1012693171 165
132 3300005343 Ga0070687_100037644 Ga0070687_1000376442 165
133 3300005343 Ga0070687_100075607 Ga0070687_1000756072 165
134 3300005343 Ga0070687_100082579 Ga0070687_1000825792 165
135 3300005343 Ga0070687_100206822 Ga0070687_1002068222 165
136 3300005343 Ga0070687_100406104 Ga0070687_1004061041 165
137 3300005343 Ga0070687_100817661 Ga0070687_1008176611 165
138 3300005345 Ga0070692_10002955 Ga0070692_100029553 165
139 3300005345 Ga0070692_10045813 Ga0070692_100458133 165
140 3300005345 Ga0070692_10102275 Ga0070692_101022752 165
141 3300005345 Ga0070692_10141226 Ga0070692_101412262 165
142 3300005345 Ga0070692_10637789 Ga0070692_106377891 165
143 3300005345 Ga0070692_10693038 Ga0070692_106930381 165
144 3300005347 Ga0070668_100159518 Ga0070668_1001595182 165
145 3300005347 Ga0070668_100205070 Ga0070668_1002050703 165
146 3300005347 Ga0070668_100294945 Ga0070668_1002949451 165
147 3300005347 Ga0070668_100307036 Ga0070668_1003070362 165
148 3300005353 Ga0070669_100028643 Ga0070669_1000286434 165
149 3300005353 Ga0070669_100047062 Ga0070669_1000470622 165
150 3300005353 Ga0070669_100118096 Ga0070669_1001180962 165
151 3300005353 Ga0070669_100159622 Ga0070669_1001596222 165
152 3300005353 Ga0070669_100472247 Ga0070669_1004722472 165
153 3300005353 Ga0070669_101223556 Ga0070669_1012235561 165
154 3300005354 Ga0070675_100037011 Ga0070675_1000370115 165
155 3300005354 Ga0070675_100096163 Ga0070675_1000961633 165
156 3300005354 Ga0070675_100112115 Ga0070675_1001121152 165
157 3300005354 Ga0070675_100330106 Ga0070675_1003301062 165
158 3300005354 Ga0070675_100495441 Ga0070675_1004954412 165
159 3300005354 Ga0070675_100601110 Ga0070675_1006011102 165
160 3300005354 Ga0070675_100658421 Ga0070675_1006584212 165
161 3300005354 Ga0070675_101137737 Ga0070675_1011377372 165
162 3300005355 Ga0070671_100005420 Ga0070671_1000054208 165
163 3300005355 Ga0070671_100017392 Ga0070671_1000173926 165
164 3300005355 Ga0070671_100030391 Ga0070671_1000303912 165
165 3300005355 Ga0070671_100044534 Ga0070671_1000445344 165
166 3300005355 Ga0070671_100200392 Ga0070671_1002003923 165
167 3300005355 Ga0070671_100230820 Ga0070671_1002308202 165
168 3300005355 Ga0070671_100459813 Ga0070671_1004598132 165
169 3300005355 Ga0070671_100800923 Ga0070671_1008009231 165
170 3300005356 Ga0070674_100014407 Ga0070674_1000144075 165
171 3300005356 Ga0070674_100458649 Ga0070674_1004586492 165
172 3300005364 Ga0070673_100009655 Ga0070673_1000096552 165
173 3300005364 Ga0070673_100192708 Ga0070673_1001927081 165
174 3300005364 Ga0070673_100246460 Ga0070673_1002464601 165
175 3300005364 Ga0070673_100456562 Ga0070673_1004565622 165
176 3300005364 Ga0070673_100466044 Ga0070673_1004660442 165
177 3300005364 Ga0070673_100469070 Ga0070673_1004690702 165
178 3300005364 Ga0070673_100689232 Ga0070673_1006892322 165
179 3300005364 Ga0070673_100834134 Ga0070673_1008341341 165
180 3300005364 Ga0070673_101030064 Ga0070673_1010300641 165
181 3300005364 Ga0070673_101203432 Ga0070673_1012034321 165
182 3300005365 Ga0070688_100039510 Ga0070688_1000395102 165
183 3300005365 Ga0070688_100064136 Ga0070688_1000641362 165
184 3300005365 Ga0070688_100326691 Ga0070688_1003266912 165
185 3300005366 Ga0070659_100002999 Ga0070659_1000029997 165
186 3300005366 Ga0070659_100919953 Ga0070659_1009199531 165
187 3300005367 Ga0070667_100727791 Ga0070667_1007277911 165
188 3300005406 Ga0070703_10000036 Ga0070703_1000003614 165
189 3300005406 Ga0070703_10006367 Ga0070703_100063672 165
190 3300005406 Ga0070703_10212852 Ga0070703_102128522 165
191 3300005406 Ga0070703_10220340 Ga0070703_102203401 165
192 3300005438 Ga0070701_10002888 Ga0070701_100028887 165
193 3300005438 Ga0070701_10037404 Ga0070701_100374043 165
194 3300005438 Ga0070701_10199108 Ga0070701_101991081 165
195 3300005438 Ga0070701_10202403 Ga0070701_102024032 165
196 3300005438 Ga0070701_10256663 Ga0070701_102566632 165
197 3300005438 Ga0070701_10273833 Ga0070701_102738332 165
198 3300005439 Ga0070711_100147103 Ga0070711_1001471032 165
199 3300005439 Ga0070711_100193174 Ga0070711_1001931743 165
200 3300005440 Ga0070705_100008077 Ga0070705_1000080776 165
201 3300005440 Ga0070705_100066331 Ga0070705_1000663313 165
202 3300005440 Ga0070705_100144075 Ga0070705_1001440751 165
203 3300005440 Ga0070705_100222023 Ga0070705_1002220232 165
204 3300005440 Ga0070705_100249141 Ga0070705_1002491412 165
205 3300005440 Ga0070705_100251569 Ga0070705_1002515691 165
206 3300005440 Ga0070705_100320993 Ga0070705_1003209932 165
207 3300005440 Ga0070705_100466667 Ga0070705_1004666671 165
208 3300005440 Ga0070705_100499475 Ga0070705_1004994752 165
209 3300005441 Ga0070700_100000305 Ga0070700_10000030521 165
210 3300005441 Ga0070700_100013026 Ga0070700_1000130264 165
211 3300005441 Ga0070700_100013485 Ga0070700_1000134853 165
212 3300005441 Ga0070700_100038424 Ga0070700_1000384243 165
213 3300005441 Ga0070700_100266391 Ga0070700_1002663912 165
214 3300005441 Ga0070700_100534927 Ga0070700_1005349271 165
215 3300005441 Ga0070700_100743993 Ga0070700_1007439931 165
216 3300005441 Ga0070700_100845270 Ga0070700_1008452702 165
217 3300005441 Ga0070700_100899361 Ga0070700_1008993611 165
218 3300005441 Ga0070700_101026009 Ga0070700_1010260091 165
219 3300005444 Ga0070694_100003401 Ga0070694_1000034018 165
220 3300005444 Ga0070694_100012648 Ga0070694_1000126483 165
221 3300005444 Ga0070694_100034624 Ga0070694_1000346243 165
222 3300005444 Ga0070694_100053308 Ga0070694_1000533083 165
223 3300005444 Ga0070694_100064168 Ga0070694_1000641682 165
224 3300005444 Ga0070694_100069501 Ga0070694_1000695013 165
225 3300005444 Ga0070694_100084711 Ga0070694_1000847112 165
226 3300005444 Ga0070694_100147884 Ga0070694_1001478842 165
227 3300005444 Ga0070694_100157885 Ga0070694_1001578852 165
228 3300005444 Ga0070694_100158270 Ga0070694_1001582702 165
229 3300005444 Ga0070694_100212075 Ga0070694_1002120752 165
230 3300005444 Ga0070694_100243252 Ga0070694_1002432522 165
231 3300005444 Ga0070694_100276299 Ga0070694_1002762991 165
232 3300005444 Ga0070694_100452719 Ga0070694_1004527192 165
233 3300005444 Ga0070694_100527923 Ga0070694_1005279231 165
234 3300005445 Ga0070708_100000002 Ga0070708_100000002123 165
235 3300005445 Ga0070708_100091118 Ga0070708_1000911183 165
236 3300005445 Ga0070708_100238319 Ga0070708_1002383192 165
237 3300005445 Ga0070708_100394875 Ga0070708_1003948752 165
238 3300005445 Ga0070708_100514121 Ga0070708_1005141211 165
239 3300005445 Ga0070708_100564709 Ga0070708_1005647091 165
240 3300005455 Ga0070663_100010827 Ga0070663_1000108275 165
241 3300005455 Ga0070663_100195521 Ga0070663_1001955212 165
242 3300005456 Ga0070678_100039701 Ga0070678_1000397014 165
243 3300005456 Ga0070678_100099281 Ga0070678_1000992812 165
244 3300005456 Ga0070678_101184905 Ga0070678_1011849051 165
245 3300005457 Ga0070662_100054047 Ga0070662_1000540474 165
246 3300005457 Ga0070662_100079638 Ga0070662_1000796383 165
247 3300005457 Ga0070662_100135095 Ga0070662_1001350952 165
248 3300005457 Ga0070662_100286111 Ga0070662_1002861112 165
249 3300005457 Ga0070662_100441170 Ga0070662_1004411702 165
250 3300005458 Ga0070681_10000041 Ga0070681_1000004134 165
251 3300005458 Ga0070681_10022424 Ga0070681_100224241 165
252 3300005458 Ga0070681_10032714 Ga0070681_100327146 165
253 3300005458 Ga0070681_10056272 Ga0070681_100562722 165
254 3300005458 Ga0070681_10292888 Ga0070681_102928882 165
255 3300005458 Ga0070681_10357899 Ga0070681_103578992 165
256 3300005459 Ga0068867_100020647 Ga0068867_1000206475 165
257 3300005459 Ga0068867_100080756 Ga0068867_1000807563 165
258 3300005459 Ga0068867_100129016 Ga0068867_1001290162 165
259 3300005459 Ga0068867_100132774 Ga0068867_1001327742 165
260 3300005459 Ga0068867_100272279 Ga0068867_1002722792 165
261 3300005459 Ga0068867_100310513 Ga0068867_1003105132 165
262 3300005459 Ga0068867_100398992 Ga0068867_1003989921 165
263 3300005466 Ga0070685_10018014 Ga0070685_100180144 165
264 3300005466 Ga0070685_10043836 Ga0070685_100438363 165
265 3300005466 Ga0070685_10085226 Ga0070685_100852262 165
266 3300005466 Ga0070685_10240527 Ga0070685_102405271 165
267 3300005466 Ga0070685_10401007 Ga0070685_104010072 165
268 3300005467 Ga0070706_100000002 Ga0070706_100000002167 165
269 3300005467 Ga0070706_100005846 Ga0070706_1000058464 165
270 3300005467 Ga0070706_100018943 Ga0070706_1000189436 165
271 3300005467 Ga0070706_100024882 Ga0070706_1000248824 165
272 3300005467 Ga0070706_100065565 Ga0070706_1000655652 165
273 3300005467 Ga0070706_100261277 Ga0070706_1002612772 165
274 3300005467 Ga0070706_100331812 Ga0070706_1003318121 165
275 3300005468 Ga0070707_100000167 Ga0070707_10000016723 165
276 3300005468 Ga0070707_100007291 Ga0070707_1000072913 165
277 3300005468 Ga0070707_100021845 Ga0070707_1000218454 165
278 3300005468 Ga0070707_100241610 Ga0070707_1002416102 165
279 3300005468 Ga0070707_100490479 Ga0070707_1004904791 165
280 3300005468 Ga0070707_100761443 Ga0070707_1007614432 165
281 3300005471 Ga0070698_100000164 Ga0070698_10000016413 165
282 3300005471 Ga0070698_100000916 Ga0070698_10000091613 165
283 3300005471 Ga0070698_100002314 Ga0070698_10000231421 165
284 3300005471 Ga0070698_100004907 Ga0070698_10000490715 165
285 3300005471 Ga0070698_100010410 Ga0070698_1000104109 165
286 3300005471 Ga0070698_100023683 Ga0070698_1000236835 165
287 3300005471 Ga0070698_100104782 Ga0070698_1001047823 165
288 3300005471 Ga0070698_100177667 Ga0070698_1001776673 165
289 3300005471 Ga0070698_100180746 Ga0070698_1001807462 165
290 3300005471 Ga0070698_100506855 Ga0070698_1005068551 165
291 3300005471 Ga0070698_100566987 Ga0070698_1005669872 165
292 3300005471 Ga0070698_100610972 Ga0070698_1006109722 165
293 3300005518 Ga0070699_100000169 Ga0070699_10000016941 165
294 3300005518 Ga0070699_100000483 Ga0070699_1000004837 165
295 3300005518 Ga0070699_100005961 Ga0070699_1000059616 165
296 3300005518 Ga0070699_100061167 Ga0070699_1000611673 165
297 3300005518 Ga0070699_100118703 Ga0070699_1001187032 165
298 3300005518 Ga0070699_100150672 Ga0070699_1001506723 165
299 3300005518 Ga0070699_100198725 Ga0070699_1001987252 165
300 3300005518 Ga0070699_100319184 Ga0070699_1003191842 165
301 3300005518 Ga0070699_100390119 Ga0070699_1003901192 165
302 3300005518 Ga0070699_100466560 Ga0070699_1004665602 165
303 3300005518 Ga0070699_100772870 Ga0070699_1007728701 165
304 3300005518 Ga0070699_101406187 Ga0070699_1014061871 165
305 3300005530 Ga0070679_100000074 Ga0070679_10000007463 165
306 3300005530 Ga0070679_100014621 Ga0070679_1000146214 165
307 3300005530 Ga0070679_100240510 Ga0070679_1002405102 165
308 3300005530 Ga0070679_100302165 Ga0070679_1003021651 165
309 3300005530 Ga0070679_101155965 Ga0070679_1011559651 165
310 3300005535 Ga0070684_100178389 Ga0070684_1001783892 165
311 3300005536 Ga0070697_100000071 Ga0070697_10000007110 165
312 3300005536 Ga0070697_100008492 Ga0070697_1000084923 165
313 3300005536 Ga0070697_100048221 Ga0070697_1000482214 165
314 3300005536 Ga0070697_100058589 Ga0070697_1000585892 165
315 3300005536 Ga0070697_100092041 Ga0070697_1000920414 165
316 3300005536 Ga0070697_100103671 Ga0070697_1001036712 165
317 3300005536 Ga0070697_100374776 Ga0070697_1003747762 165
318 3300005536 Ga0070697_100438917 Ga0070697_1004389171 165
319 3300005536 Ga0070697_100869725 Ga0070697_1008697252 165
320 3300005539 Ga0068853_100009637 Ga0068853_1000096373 165
321 3300005539 Ga0068853_100009751 Ga0068853_1000097512 165
322 3300005539 Ga0068853_100033867 Ga0068853_1000338673 165
323 3300005539 Ga0068853_100110758 Ga0068853_1001107583 165
324 3300005539 Ga0068853_100178384 Ga0068853_1001783843 165
325 3300005539 Ga0068853_100268402 Ga0068853_1002684022 165
326 3300005539 Ga0068853_100284003 Ga0068853_1002840032 165
327 3300005539 Ga0068853_101044896 Ga0068853_1010448961 165
328 3300005543 Ga0070672_100045970 Ga0070672_1000459702 165
329 3300005543 Ga0070672_100068119 Ga0070672_1000681194 165
330 3300005543 Ga0070672_100076799 Ga0070672_1000767992 165
331 3300005543 Ga0070672_100275768 Ga0070672_1002757682 165
332 3300005543 Ga0070672_100322416 Ga0070672_1003224162 165
333 3300005543 Ga0070672_100335823 Ga0070672_1003358231 165
334 3300005544 Ga0070686_100006607 Ga0070686_1000066074 165
335 3300005544 Ga0070686_100076214 Ga0070686_1000762141 165
336 3300005544 Ga0070686_100125234 Ga0070686_1001252342 165
337 3300005544 Ga0070686_100189055 Ga0070686_1001890552 165
338 3300005544 Ga0070686_100268304 Ga0070686_1002683042 165
339 3300005544 Ga0070686_100334624 Ga0070686_1003346242 165
340 3300005545 Ga0070695_100013907 Ga0070695_1000139074 165
341 3300005545 Ga0070695_100043568 Ga0070695_1000435682 165
342 3300005545 Ga0070695_100046755 Ga0070695_1000467552 165
343 3300005545 Ga0070695_100052246 Ga0070695_1000522462 165
344 3300005545 Ga0070695_100083505 Ga0070695_1000835053 165
345 3300005545 Ga0070695_100098659 Ga0070695_1000986592 165
346 3300005545 Ga0070695_100099604 Ga0070695_1000996043 165
347 3300005545 Ga0070695_100134074 Ga0070695_1001340742 165
348 3300005545 Ga0070695_100185181 Ga0070695_1001851812 165
349 3300005545 Ga0070695_100359744 Ga0070695_1003597442 165
350 3300005545 Ga0070695_100491129 Ga0070695_1004911291 165
351 3300005545 Ga0070695_100556683 Ga0070695_1005566831 165
352 3300005545 Ga0070695_100560860 Ga0070695_1005608601 165
353 3300005545 Ga0070695_100573912 Ga0070695_1005739122 165
354 3300005545 Ga0070695_100608255 Ga0070695_1006082551 165
355 3300005545 Ga0070695_100641045 Ga0070695_1006410452 165
356 3300005545 Ga0070695_100643741 Ga0070695_1006437412 165
357 3300005545 Ga0070695_100976003 Ga0070695_1009760031 165
358 3300005545 Ga0070695_101595204 Ga0070695_1015952041 165
359 3300005546 Ga0070696_100002034 Ga0070696_10000203414 165
360 3300005546 Ga0070696_100014172 Ga0070696_1000141722 165
361 3300005546 Ga0070696_100017420 Ga0070696_1000174206 165
362 3300005546 Ga0070696_100070384 Ga0070696_1000703842 165
363 3300005546 Ga0070696_100078966 Ga0070696_1000789663 165
364 3300005546 Ga0070696_100090720 Ga0070696_1000907203 165
365 3300005546 Ga0070696_100133490 Ga0070696_1001334902 165
366 3300005546 Ga0070696_100167936 Ga0070696_1001679362 165
367 3300005546 Ga0070696_100200995 Ga0070696_1002009952 165
368 3300005546 Ga0070696_100203086 Ga0070696_1002030862 165
369 3300005546 Ga0070696_100330944 Ga0070696_1003309442 165
370 3300005546 Ga0070696_100398135 Ga0070696_1003981352 165
371 3300005546 Ga0070696_100851393 Ga0070696_1008513931 165
372 3300005546 Ga0070696_100926285 Ga0070696_1009262851 165
373 3300005546 Ga0070696_100944469 Ga0070696_1009444691 165
374 3300005546 Ga0070696_101014112 Ga0070696_1010141121 165
375 3300005546 Ga0070696_101124304 Ga0070696_1011243041 165
376 3300005547 Ga0070693_100015794 Ga0070693_1000157943 165
377 3300005547 Ga0070693_100078583 Ga0070693_1000785832 165
378 3300005547 Ga0070693_100122299 Ga0070693_1001222992 165
379 3300005547 Ga0070693_100131812 Ga0070693_1001318121 165
380 3300005547 Ga0070693_100181403 Ga0070693_1001814032 165
381 3300005547 Ga0070693_100415541 Ga0070693_1004155411 165
382 3300005547 Ga0070693_100471279 Ga0070693_1004712792 165
383 3300005547 Ga0070693_101157551 Ga0070693_1011575511 165
384 3300005548 Ga0070665_100281443 Ga0070665_1002814432 165
385 3300005548 Ga0070665_100656070 Ga0070665_1006560702 165
386 3300005548 Ga0070665_101826675 Ga0070665_1018266751 165
387 3300005549 Ga0070704_100003508 Ga0070704_1000035082 165
388 3300005549 Ga0070704_100016529 Ga0070704_1000165294 165
389 3300005549 Ga0070704_100035319 Ga0070704_1000353191 165
390 3300005549 Ga0070704_100035616 Ga0070704_1000356161 165
391 3300005549 Ga0070704_100102818 Ga0070704_1001028182 165
392 3300005549 Ga0070704_100158907 Ga0070704_1001589072 165
393 3300005549 Ga0070704_100168771 Ga0070704_1001687712 165
394 3300005549 Ga0070704_100225066 Ga0070704_1002250662 165
395 3300005549 Ga0070704_100533903 Ga0070704_1005339031 165
396 3300005549 Ga0070704_100727898 Ga0070704_1007278981 165
397 3300005549 Ga0070704_101290727 Ga0070704_1012907271 165
398 3300005563 Ga0068855_100013973 Ga0068855_1000139733 165
399 3300005563 Ga0068855_100234851 Ga0068855_1002348511 165
400 3300005563 Ga0068855_100288276 Ga0068855_1002882762 165
401 3300005564 Ga0070664_100000280 Ga0070664_10000028035 165
402 3300005564 Ga0070664_100040842 Ga0070664_1000408423 165
403 3300005564 Ga0070664_100290888 Ga0070664_1002908882 165
404 3300005564 Ga0070664_100690477 Ga0070664_1006904772 165
405 3300005564 Ga0070664_100720943 Ga0070664_1007209432 165
406 3300005564 Ga0070664_100797876 Ga0070664_1007978761 165
407 3300005564 Ga0070664_100879306 Ga0070664_1008793062 165
408 3300005564 Ga0070664_101032813 Ga0070664_1010328131 165
409 3300005564 Ga0070664_101072887 Ga0070664_1010728871 165
410 3300005577 Ga0068857_100013657 Ga0068857_1000136572 165
411 3300005577 Ga0068857_100110846 Ga0068857_1001108462 165
412 3300005577 Ga0068857_100249325 Ga0068857_1002493252 165
413 3300005577 Ga0068857_100269116 Ga0068857_1002691163 165
414 3300005577 Ga0068857_100582080 Ga0068857_1005820802 165
415 3300005577 Ga0068857_100688551 Ga0068857_1006885512 165
416 3300005577 Ga0068857_100764796 Ga0068857_1007647961 165
417 3300005577 Ga0068857_100828937 Ga0068857_1008289372 165
418 3300005578 Ga0068854_100091683 Ga0068854_1000916832 165
419 3300005578 Ga0068854_100107311 Ga0068854_1001073112 165
420 3300005578 Ga0068854_100141018 Ga0068854_1001410182 165
421 3300005578 Ga0068854_100759070 Ga0068854_1007590702 165
422 3300005578 Ga0068854_100799925 Ga0068854_1007999252 165
423 3300005614 Ga0068856_100439763 Ga0068856_1004397632 165
424 3300005615 Ga0070702_100002032 Ga0070702_1000020324 165
425 3300005615 Ga0070702_100122934 Ga0070702_1001229342 165
426 3300005615 Ga0070702_100183184 Ga0070702_1001831842 165
427 3300005615 Ga0070702_100257398 Ga0070702_1002573981 165
428 3300005615 Ga0070702_100444178 Ga0070702_1004441781 165
429 3300005616 Ga0068852_100140694 Ga0068852_1001406943 165
430 3300005616 Ga0068852_100198078 Ga0068852_1001980782 165
431 3300005616 Ga0068852_100584829 Ga0068852_1005848291 165
432 3300005616 Ga0068852_100869241 Ga0068852_1008692412 165
433 3300005616 Ga0068852_100901245 Ga0068852_1009012452 165
434 3300005617 Ga0068859_100003166 Ga0068859_10000316613 165
435 3300005617 Ga0068859_100018658 Ga0068859_1000186582 165
436 3300005617 Ga0068859_100029652 Ga0068859_1000296524 165
437 3300005617 Ga0068859_100033363 Ga0068859_1000333633 165
438 3300005617 Ga0068859_100035651 Ga0068859_1000356514 165
439 3300005617 Ga0068859_100037551 Ga0068859_1000375512 165
440 3300005617 Ga0068859_100045900 Ga0068859_1000459004 165
441 3300005617 Ga0068859_100082061 Ga0068859_1000820612 165
442 3300005617 Ga0068859_100109989 Ga0068859_1001099891 165
443 3300005617 Ga0068859_100137767 Ga0068859_1001377672 165
444 3300005617 Ga0068859_100175866 Ga0068859_1001758663 165
445 3300005617 Ga0068859_100179404 Ga0068859_1001794043 165
446 3300005617 Ga0068859_100206524 Ga0068859_1002065243 165
447 3300005617 Ga0068859_100261688 Ga0068859_1002616881 165
448 3300005617 Ga0068859_100304161 Ga0068859_1003041612 165
449 3300005617 Ga0068859_100359694 Ga0068859_1003596942 165
450 3300005617 Ga0068859_100437430 Ga0068859_1004374302 165
451 3300005617 Ga0068859_100559506 Ga0068859_1005595062 165
452 3300005617 Ga0068859_100591257 Ga0068859_1005912571 165
453 3300005617 Ga0068859_100701302 Ga0068859_1007013022 165
454 3300005617 Ga0068859_100887319 Ga0068859_1008873192 165
455 3300005617 Ga0068859_100892036 Ga0068859_1008920361 165
456 3300005617 Ga0068859_101107025 Ga0068859_1011070252 165
457 3300005617 Ga0068859_101154711 Ga0068859_1011547111 165
458 3300005618 Ga0068864_100022935 Ga0068864_1000229354 165
459 3300005618 Ga0068864_100029542 Ga0068864_1000295421 165
460 3300005618 Ga0068864_100033299 Ga0068864_1000332993 165
461 3300005618 Ga0068864_100045602 Ga0068864_1000456023 165
462 3300005618 Ga0068864_100048124 Ga0068864_1000481242 165
463 3300005618 Ga0068864_100098665 Ga0068864_1000986653 165
464 3300005618 Ga0068864_100104528 Ga0068864_1001045283 165
465 3300005618 Ga0068864_100175739 Ga0068864_1001757392 165
466 3300005618 Ga0068864_100193270 Ga0068864_1001932702 165
467 3300005618 Ga0068864_100200053 Ga0068864_1002000532 165
468 3300005618 Ga0068864_100212165 Ga0068864_1002121653 165
469 3300005618 Ga0068864_100311442 Ga0068864_1003114422 165
470 3300005618 Ga0068864_100386459 Ga0068864_1003864592 165
471 3300005618 Ga0068864_100480745 Ga0068864_1004807451 165
472 3300005618 Ga0068864_100511827 Ga0068864_1005118271 165
473 3300005618 Ga0068864_100767656 Ga0068864_1007676561 165
474 3300005718 Ga0068866_10130065 Ga0068866_101300652 165
475 3300005719 Ga0068861_100029995 Ga0068861_1000299954 165
476 3300005719 Ga0068861_100069640 Ga0068861_1000696402 165
477 3300005719 Ga0068861_100121439 Ga0068861_1001214392 165
478 3300005719 Ga0068861_100127522 Ga0068861_1001275223 165
479 3300005719 Ga0068861_100180707 Ga0068861_1001807072 165
480 3300005719 Ga0068861_100181743 Ga0068861_1001817432 165
481 3300005719 Ga0068861_100324554 Ga0068861_1003245543 165
482 3300005719 Ga0068861_100453785 Ga0068861_1004537851 165
483 3300005719 Ga0068861_100530703 Ga0068861_1005307031 165
484 3300005719 Ga0068861_100559091 Ga0068861_1005590912 165
485 3300005719 Ga0068861_100586522 Ga0068861_1005865221 165
486 3300005719 Ga0068861_100768171 Ga0068861_1007681712 165
487 3300005719 Ga0068861_100930486 Ga0068861_1009304862 165
488 3300005719 Ga0068861_101195026 Ga0068861_1011950262 165
489 3300005719 Ga0068861_101283543 Ga0068861_1012835431 165
490 3300005834 Ga0068851_10000508 Ga0068851_100005082 165
491 3300005840 Ga0068870_10030369 Ga0068870_100303693 165
492 3300005840 Ga0068870_10030552 Ga0068870_100305523 165
493 3300005840 Ga0068870_10157726 Ga0068870_101577261 165
494 3300005840 Ga0068870_10174763 Ga0068870_101747632 165
495 3300005840 Ga0068870_10286738 Ga0068870_102867382 165
496 3300005841 Ga0068863_100044808 Ga0068863_1000448084 165
497 3300005841 Ga0068863_100046793 Ga0068863_1000467932 165
498 3300005841 Ga0068863_100061232 Ga0068863_1000612323 165
499 3300005841 Ga0068863_100061594 Ga0068863_1000615943 165
500 3300005841 Ga0068863_100231880 Ga0068863_1002318803 165
501 3300005841 Ga0068863_100243725 Ga0068863_1002437252 165
502 3300005841 Ga0068863_100414690 Ga0068863_1004146902 165
503 3300005841 Ga0068863_100526774 Ga0068863_1005267742 165
504 3300005841 Ga0068863_100535454 Ga0068863_1005354542 165
505 3300005841 Ga0068863_100637136 Ga0068863_1006371362 165
506 3300005841 Ga0068863_100693541 Ga0068863_1006935412 165
507 3300005841 Ga0068863_101190820 Ga0068863_1011908202 165
508 3300005841 Ga0068863_101674663 Ga0068863_1016746632 165
509 3300005842 Ga0068858_100000134 Ga0068858_1000001343 165
510 3300005842 Ga0068858_100001473 Ga0068858_10000147314 165
511 3300005842 Ga0068858_100027082 Ga0068858_1000270825 165
512 3300005842 Ga0068858_100056480 Ga0068858_1000564803 165
513 3300005842 Ga0068858_100109873 Ga0068858_1001098732 165
514 3300005842 Ga0068858_100129545 Ga0068858_1001295453 165
515 3300005842 Ga0068858_100148296 Ga0068858_1001482963 165
516 3300005842 Ga0068858_100166619 Ga0068858_1001666192 165
517 3300005842 Ga0068858_100229286 Ga0068858_1002292862 165
518 3300005842 Ga0068858_100391323 Ga0068858_1003913232 165
519 3300005842 Ga0068858_100460957 Ga0068858_1004609572 165
520 3300005842 Ga0068858_100562341 Ga0068858_1005623412 165
521 3300005842 Ga0068858_100621764 Ga0068858_1006217642 165
522 3300005842 Ga0068858_100689075 Ga0068858_1006890751 165
523 3300005842 Ga0068858_100989838 Ga0068858_1009898381 165
524 3300005842 Ga0068858_102064237 Ga0068858_1020642371 165
525 3300005843 Ga0068860_100006276 Ga0068860_1000062763 165
526 3300005843 Ga0068860_100043714 Ga0068860_1000437143 165
527 3300005843 Ga0068860_100090392 Ga0068860_1000903922 165
528 3300005843 Ga0068860_100107672 Ga0068860_1001076722 165
529 3300005843 Ga0068860_100199901 Ga0068860_1001999013 165
530 3300005843 Ga0068860_100281717 Ga0068860_1002817172 165
531 3300005843 Ga0068860_100305925 Ga0068860_1003059252 165
532 3300005843 Ga0068860_100367089 Ga0068860_1003670892 165
533 3300005843 Ga0068860_100401518 Ga0068860_1004015181 165
534 3300005843 Ga0068860_100689958 Ga0068860_1006899582 165
535 3300005843 Ga0068860_100781487 Ga0068860_1007814871 165
536 3300005843 Ga0068860_100795742 Ga0068860_1007957422 165
537 3300005843 Ga0068860_100882903 Ga0068860_1008829031 165
538 3300005843 Ga0068860_101417483 Ga0068860_1014174831 165
539 3300005843 Ga0068860_102035480 Ga0068860_1020354801 165
540 3300005843 Ga0068860_102063324 Ga0068860_1020633241 165
541 3300005844 Ga0068862_100010366 Ga0068862_1000103662 165
542 3300005844 Ga0068862_100028615 Ga0068862_1000286155 165
543 3300005844 Ga0068862_100101196 Ga0068862_1001011962 165
544 3300005844 Ga0068862_100115289 Ga0068862_1001152893 165
545 3300005844 Ga0068862_100118142 Ga0068862_1001181422 165
546 3300005844 Ga0068862_100221102 Ga0068862_1002211022 165
547 3300005844 Ga0068862_100575301 Ga0068862_1005753012 165
548 3300005844 Ga0068862_100645869 Ga0068862_1006458692 165
549 3300005844 Ga0068862_100794876 Ga0068862_1007948761 165
550 3300005844 Ga0068862_100925932 Ga0068862_1009259322 165
551 3300005844 Ga0068862_101048035 Ga0068862_1010480351 165
552 3300005844 Ga0068862_101211638 Ga0068862_1012116381 165
553 3300005937 Ga0081455_10352887 Ga0081455_103528872 165
554 3300005983 Ga0081540_1075760 Ga0081540_10757602 165
555 3300005985 Ga0081539_10000931 Ga0081539_1000093144 165
556 3300005985 Ga0081539_10001415 Ga0081539_1000141518 165
557 3300005985 Ga0081539_10002562 Ga0081539_1000256222 165
558 3300005985 Ga0081539_10061872 Ga0081539_100618722 165
559 3300005985 Ga0081539_10101600 Ga0081539_101016002 165
560 3300005985 Ga0081539_10214432 Ga0081539_102144322 165
561 3300006163 Ga0070715_10000018 Ga0070715_1000001869 165
562 3300006173 Ga0070716_100000017 Ga0070716_10000001741 165
563 3300006173 Ga0070716_100033150 Ga0070716_1000331502 165
564 3300006173 Ga0070716_100275941 Ga0070716_1002759412 165
565 3300006237 Ga0097621_100001570 Ga0097621_10000157012 165
566 3300006237 Ga0097621_100003941 Ga0097621_1000039417 165
567 3300006237 Ga0097621_100025494 Ga0097621_1000254944 165
568 3300006237 Ga0097621_100074871 Ga0097621_1000748713 165
569 3300006237 Ga0097621_100204279 Ga0097621_1002042792 165
570 3300006237 Ga0097621_100276727 Ga0097621_1002767272 165
571 3300006237 Ga0097621_100602006 Ga0097621_1006020061 165
572 3300006358 Ga0068871_100001715 Ga0068871_1000017156 165
573 3300006358 Ga0068871_100003493 Ga0068871_1000034937 165
574 3300006358 Ga0068871_100004902 Ga0068871_1000049026 165
575 3300006358 Ga0068871_100085299 Ga0068871_1000852993 165
576 3300006358 Ga0068871_100171852 Ga0068871_1001718522 165
577 3300006358 Ga0068871_100361035 Ga0068871_1003610352 165
578 3300006358 Ga0068871_100973980 Ga0068871_1009739801 165
579 3300006844 Ga0075428_100229157 Ga0075428_1002291572 165
580 3300006844 Ga0075428_100250559 Ga0075428_1002505591 165
581 3300006844 Ga0075428_100312427 Ga0075428_1003124273 165
582 3300006844 Ga0075428_100576645 Ga0075428_1005766452 165
583 3300006844 Ga0075428_100657885 Ga0075428_1006578851 165
584 3300006844 Ga0075428_100749390 Ga0075428_1007493902 165
585 3300006844 Ga0075428_101126062 Ga0075428_1011260622 165
586 3300006846 Ga0075430_100051442 Ga0075430_1000514422 165
587 3300006847 Ga0075431_100586214 Ga0075431_1005862142 165
588 3300006852 Ga0075433_10000049 Ga0075433_100000498 165
589 3300006852 Ga0075433_10004819 Ga0075433_100048195 165
590 3300006852 Ga0075433_10023132 Ga0075433_100231322 165
591 3300006852 Ga0075433_10044860 Ga0075433_100448602 165
592 3300006852 Ga0075433_10078290 Ga0075433_100782903 165
593 3300006852 Ga0075433_10103461 Ga0075433_101034613 165
594 3300006852 Ga0075433_10243037 Ga0075433_102430372 165
595 3300006852 Ga0075433_10256560 Ga0075433_102565602 165
596 3300006852 Ga0075433_10278910 Ga0075433_102789102 165
597 3300006852 Ga0075433_10610078 Ga0075433_106100782 165
598 3300006871 Ga0075434_100001792 Ga0075434_1000017926 165
599 3300006871 Ga0075434_100011248 Ga0075434_1000112489 165
600 3300006871 Ga0075434_100250146 Ga0075434_1002501461 165
601 3300006871 Ga0075434_100252270 Ga0075434_1002522702 165
602 3300006871 Ga0075434_100256420 Ga0075434_1002564202 165
603 3300006871 Ga0075434_100407424 Ga0075434_1004074242 165
604 3300006871 Ga0075434_100663622 Ga0075434_1006636222 165
605 3300006871 Ga0075434_101065883 Ga0075434_1010658832 165
606 3300006871 Ga0075434_101255615 Ga0075434_1012556151 165
607 3300006871 Ga0075434_101462818 Ga0075434_1014628181 165
608 3300006880 Ga0075429_100096943 Ga0075429_1000969433 165
609 3300006880 Ga0075429_100271292 Ga0075429_1002712922 165
610 3300006880 Ga0075429_100318626 Ga0075429_1003186262 165
611 3300006880 Ga0075429_100657655 Ga0075429_1006576552 165
612 3300006881 Ga0068865_100031323 Ga0068865_1000313232 165
613 3300006881 Ga0068865_100080047 Ga0068865_1000800472 165
614 3300006881 Ga0068865_100285391 Ga0068865_1002853912 165
615 3300006881 Ga0068865_100353733 Ga0068865_1003537332 165
616 3300006881 Ga0068865_100700696 Ga0068865_1007006961 165
617 3300006881 Ga0068865_101309375 Ga0068865_1013093751 165
618 3300006914 Ga0075436_100000011 Ga0075436_1000000113 165
619 3300006914 Ga0075436_100012513 Ga0075436_1000125137 165
620 3300006914 Ga0075436_100053501 Ga0075436_1000535012 165
621 3300006914 Ga0075436_100065993 Ga0075436_1000659933 165
622 3300006931 Ga0097620_100003166 Ga0097620_10000316613 165
623 3300006931 Ga0097620_100018658 Ga0097620_1000186586 165
624 3300006931 Ga0097620_100029653 Ga0097620_1000296534 165
625 3300006931 Ga0097620_100033364 Ga0097620_1000333643 165
626 3300006931 Ga0097620_100035652 Ga0097620_1000356523 165
627 3300006931 Ga0097620_100037550 Ga0097620_1000375506 165
628 3300006931 Ga0097620_100045900 Ga0097620_1000459004 165
629 3300006931 Ga0097620_100082063 Ga0097620_1000820632 165
630 3300006931 Ga0097620_100109983 Ga0097620_1001099831 165
631 3300006931 Ga0097620_100137768 Ga0097620_1001377682 165
632 3300006931 Ga0097620_100175870 Ga0097620_1001758703 165
633 3300006931 Ga0097620_100179393 Ga0097620_1001793932 165
634 3300006931 Ga0097620_100206534 Ga0097620_1002065342 165
635 3300006931 Ga0097620_100261674 Ga0097620_1002616741 165
636 3300006931 Ga0097620_100304123 Ga0097620_1003041232 165
637 3300006931 Ga0097620_100359693 Ga0097620_1003596932 165
638 3300006931 Ga0097620_100437454 Ga0097620_1004374542 165
639 3300006931 Ga0097620_100559519 Ga0097620_1005595192 165
640 3300006931 Ga0097620_100591256 Ga0097620_1005912561 165
641 3300006931 Ga0097620_100701264 Ga0097620_1007012642 165
642 3300006931 Ga0097620_100887376 Ga0097620_1008873761 165
643 3300006931 Ga0097620_100892010 Ga0097620_1008920101 165
644 3300006931 Ga0097620_101107117 Ga0097620_1011071172 165
645 3300006931 Ga0097620_101154785 Ga0097620_1011547851 165
646 3300007076 Ga0075435_100000134 Ga0075435_10000013431 165
647 3300007076 Ga0075435_100009513 Ga0075435_1000095135 165
648 3300007076 Ga0075435_100031672 Ga0075435_1000316722 165
649 3300007076 Ga0075435_100141595 Ga0075435_1001415952 165
650 3300007076 Ga0075435_100565932 Ga0075435_1005659321 165
651 3300007788 Ga0099795_10414936 Ga0099795_104149361 165
652 3300009011 Ga0105251_10336356 Ga0105251_103363561 165
653 3300009011 Ga0105251_10408049 Ga0105251_104080491 165
654 3300009011 Ga0105251_10437982 Ga0105251_104379821 165
655 3300009092 Ga0105250_10054230 Ga0105250_100542302 165
656 3300009093 Ga0105240_10041387 Ga0105240_100413874 165
657 3300009094 Ga0111539_10001784 Ga0111539_100017847 165
658 3300009094 Ga0111539_10131725 Ga0111539_101317252 165
659 3300009094 Ga0111539_10164064 Ga0111539_101640642 165
660 3300009094 Ga0111539_10179811 Ga0111539_101798112 165
661 3300009094 Ga0111539_10291147 Ga0111539_102911472 165
662 3300009094 Ga0111539_10353141 Ga0111539_103531412 165
663 3300009094 Ga0111539_10400211 Ga0111539_104002112 165
664 3300009098 Ga0105245_10017618 Ga0105245_100176181 165
665 3300009098 Ga0105245_10094357 Ga0105245_100943572 165
666 3300009098 Ga0105245_10197513 Ga0105245_101975132 165
667 3300009098 Ga0105245_10470416 Ga0105245_104704162 165
668 3300009098 Ga0105245_11289753 Ga0105245_112897532 165
669 3300009101 Ga0105247_10000022 Ga0105247_10000022148 165
670 3300009101 Ga0105247_10003696 Ga0105247_100036964 165
671 3300009101 Ga0105247_10041404 Ga0105247_100414042 165
672 3300009101 Ga0105247_10042199 Ga0105247_100421992 165
673 3300009101 Ga0105247_10190329 Ga0105247_101903292 165
674 3300009101 Ga0105247_10191408 Ga0105247_101914082 165
675 3300009101 Ga0105247_10609018 Ga0105247_106090182 165
676 3300009101 Ga0105247_10775277 Ga0105247_107752771 165
677 3300009101 Ga0105247_10787768 Ga0105247_107877681 165
678 3300009147 Ga0114129_10021892 Ga0114129_100218922 165
679 3300009147 Ga0114129_10077095 Ga0114129_100770954 165
680 3300009147 Ga0114129_10128631 Ga0114129_101286312 165
681 3300009147 Ga0114129_10164311 Ga0114129_101643112 165
682 3300009147 Ga0114129_10169017 Ga0114129_101690173 165
683 3300009147 Ga0114129_10169409 Ga0114129_101694094 165
684 3300009147 Ga0114129_10196551 Ga0114129_101965513 165
685 3300009147 Ga0114129_10198008 Ga0114129_101980083 165
686 3300009147 Ga0114129_10218100 Ga0114129_102181003 165
687 3300009147 Ga0114129_10255360 Ga0114129_102553603 165
688 3300009147 Ga0114129_10273284 Ga0114129_102732842 165
689 3300009147 Ga0114129_10676587 Ga0114129_106765872 165
690 3300009147 Ga0114129_10870023 Ga0114129_108700232 165
691 3300009147 Ga0114129_11028433 Ga0114129_110284332 165
692 3300009147 Ga0114129_11120791 Ga0114129_111207912 165
693 3300009147 Ga0114129_11486651 Ga0114129_114866511 165
694 3300009147 Ga0114129_11713294 Ga0114129_117132942 165
695 3300009148 Ga0105243_10000102 Ga0105243_100001027 165
696 3300009148 Ga0105243_10000207 Ga0105243_1000020728 165
697 3300009148 Ga0105243_10040911 Ga0105243_100409112 165
698 3300009148 Ga0105243_10052352 Ga0105243_100523524 165
699 3300009148 Ga0105243_10175848 Ga0105243_101758482 165
700 3300009148 Ga0105243_10305091 Ga0105243_103050912 165
701 3300009148 Ga0105243_10528866 Ga0105243_105288662 165
702 3300009148 Ga0105243_11125427 Ga0105243_111254271 165
703 3300009148 Ga0105243_11195655 Ga0105243_111956551 165
704 3300009148 Ga0105243_11706643 Ga0105243_117066432 165
705 3300009148 Ga0105243_11740910 Ga0105243_117409101 165
706 3300009148 Ga0105243_11750210 Ga0105243_117502101 165
707 3300009148 Ga0105243_12200417 Ga0105243_122004171 165
708 3300009174 Ga0105241_10009361 Ga0105241_100093616 165
709 3300009174 Ga0105241_10019871 Ga0105241_100198714 165
710 3300009174 Ga0105241_10131740 Ga0105241_101317402 165
711 3300009174 Ga0105241_10146718 Ga0105241_101467182 165
712 3300009174 Ga0105241_10234027 Ga0105241_102340273 165
713 3300009174 Ga0105241_10582414 Ga0105241_105824142 165
714 3300009174 Ga0105241_10596025 Ga0105241_105960252 165
715 3300009174 Ga0105241_11395707 Ga0105241_113957072 165
716 3300009174 Ga0105241_11494972 Ga0105241_114949721 165
717 3300009176 Ga0105242_10000279 Ga0105242_100002796 165
718 3300009176 Ga0105242_10000807 Ga0105242_1000080713 165
719 3300009176 Ga0105242_10005822 Ga0105242_100058222 165
720 3300009176 Ga0105242_10155864 Ga0105242_101558642 165
721 3300009176 Ga0105242_10197673 Ga0105242_101976732 165
722 3300009176 Ga0105242_10510406 Ga0105242_105104062 165
723 3300009176 Ga0105242_10998784 Ga0105242_109987842 165
724 3300009176 Ga0105242_11979462 Ga0105242_119794621 165
725 3300009177 Ga0105248_10004786 Ga0105248_1000478615 165
726 3300009177 Ga0105248_10005461 Ga0105248_1000546113 165
727 3300009177 Ga0105248_10010608 Ga0105248_100106088 165
728 3300009177 Ga0105248_10013500 Ga0105248_100135002 165
729 3300009177 Ga0105248_10116314 Ga0105248_101163142 165
730 3300009177 Ga0105248_10134111 Ga0105248_101341112 165
731 3300009177 Ga0105248_10178524 Ga0105248_101785242 165
732 3300009177 Ga0105248_10190150 Ga0105248_101901503 165
733 3300009177 Ga0105248_10239205 Ga0105248_102392052 165
734 3300009177 Ga0105248_10250727 Ga0105248_102507272 165
735 3300009177 Ga0105248_10284646 Ga0105248_102846462 165
736 3300009177 Ga0105248_10421823 Ga0105248_104218232 165
737 3300009177 Ga0105248_10444584 Ga0105248_104445842 165
738 3300009177 Ga0105248_10957608 Ga0105248_109576082 165
739 3300009177 Ga0105248_11436390 Ga0105248_114363902 165
740 3300009177 Ga0105248_12531589 Ga0105248_125315891 165
741 3300009545 Ga0105237_10034027 Ga0105237_100340273 165
742 3300009545 Ga0105237_10073202 Ga0105237_100732023 165
743 3300009545 Ga0105237_10125573 Ga0105237_101255732 165
744 3300009545 Ga0105237_10905880 Ga0105237_109058801 165
745 3300009545 Ga0105237_10930761 Ga0105237_109307611 165
746 3300009545 Ga0105237_12000879 Ga0105237_120008791 165
747 3300009551 Ga0105238_10009968 Ga0105238_100099687 165
748 3300009551 Ga0105238_10013272 Ga0105238_100132726 165
749 3300009551 Ga0105238_10816606 Ga0105238_108166062 165
750 3300009551 Ga0105238_10954870 Ga0105238_109548701 165
751 3300009553 Ga0105249_10000142 Ga0105249_1000014233 165
752 3300009553 Ga0105249_10013404 Ga0105249_100134044 165
753 3300009553 Ga0105249_10074481 Ga0105249_100744813 165
754 3300009553 Ga0105249_10089500 Ga0105249_100895003 165
755 3300009553 Ga0105249_10126962 Ga0105249_101269622 165
756 3300009553 Ga0105249_10192297 Ga0105249_101922973 165
757 3300009553 Ga0105249_10246378 Ga0105249_102463782 165
758 3300009553 Ga0105249_10342315 Ga0105249_103423152 165
759 3300009553 Ga0105249_11161965 Ga0105249_111619651 165
760 3300009553 Ga0105249_11193837 Ga0105249_111938371 165
761 3300010159 Ga0099796_10213468 Ga0099796_102134682 165
762 3300010375 Ga0105239_10237248 Ga0105239_102372481 165
763 3300010375 Ga0105239_10352157 Ga0105239_103521571 165
764 3300010375 Ga0105239_10568703 Ga0105239_105687032 165
765 3300010375 Ga0105239_10845756 Ga0105239_108457562 165
766 3300011119 Ga0105246_10012997 Ga0105246_100129972 165
767 3300011119 Ga0105246_10161630 Ga0105246_101616301 165
768 3300011119 Ga0105246_10186646 Ga0105246_101866461 165
769 3300011119 Ga0105246_10320135 Ga0105246_103201352 165
770 3300011119 Ga0105246_10337967 Ga0105246_103379672 165
771 3300011119 Ga0105246_10496115 Ga0105246_104961151 165
772 3300011119 Ga0105246_11231553 Ga0105246_112315532 165
773 3300011119 Ga0105246_11317786 Ga0105246_113177861 165
774 3300013100 Ga0157373_10004608 Ga0157373_100046088 165
775 3300013100 Ga0157373_10065205 Ga0157373_100652052 165
776 3300013100 Ga0157373_10090756 Ga0157373_100907563 165
777 3300013100 Ga0157373_10093302 Ga0157373_100933023 165
778 3300013100 Ga0157373_10341783 Ga0157373_103417832 165
779 3300013100 Ga0157373_10385977 Ga0157373_103859772 165
780 3300013102 Ga0157371_10407945 Ga0157371_104079451 165
781 3300013102 Ga0157371_10682729 Ga0157371_106827291 165
782 3300013105 Ga0157369_10370798 Ga0157369_103707982 165
783 3300013105 Ga0157369_10395466 Ga0157369_103954662 165
784 3300013296 Ga0157374_10042590 Ga0157374_100425904 165
785 3300013296 Ga0157374_10047953 Ga0157374_100479535 165
786 3300013296 Ga0157374_10284951 Ga0157374_102849512 165
787 3300013296 Ga0157374_10577877 Ga0157374_105778772 165
788 3300013296 Ga0157374_10604775 Ga0157374_106047751 165
789 3300013296 Ga0157374_10686851 Ga0157374_106868511 165
790 3300013296 Ga0157374_11784481 Ga0157374_117844812 165
791 3300013297 Ga0157378_10000191 Ga0157378_1000019119 165
792 3300013297 Ga0157378_10009723 Ga0157378_100097236 165
793 3300013297 Ga0157378_10014643 Ga0157378_100146433 165
794 3300013297 Ga0157378_10024594 Ga0157378_100245944 165
795 3300013297 Ga0157378_10033984 Ga0157378_100339843 165
796 3300013297 Ga0157378_10078315 Ga0157378_100783152 165
797 3300013297 Ga0157378_10092551 Ga0157378_100925512 165
798 3300013297 Ga0157378_10111174 Ga0157378_101111743 165
799 3300013297 Ga0157378_10113449 Ga0157378_101134493 165
800 3300013297 Ga0157378_10147662 Ga0157378_101476623 165
801 3300013297 Ga0157378_10173588 Ga0157378_101735882 165
802 3300013297 Ga0157378_10202612 Ga0157378_102026122 165
803 3300013297 Ga0157378_10237192 Ga0157378_102371922 165
804 3300013297 Ga0157378_10418289 Ga0157378_104182891 165
805 3300013297 Ga0157378_11014230 Ga0157378_110142301 165
806 3300013297 Ga0157378_11172571 Ga0157378_111725711 165
807 3300013297 Ga0157378_11340378 Ga0157378_113403782 165
808 3300013297 Ga0157378_11772621 Ga0157378_117726211 165
809 3300013297 Ga0157378_12841709 Ga0157378_128417091 165
810 3300013306 Ga0163162_10000553 Ga0163162_100005531 165
811 3300013306 Ga0163162_10012064 Ga0163162_100120644 165
812 3300013306 Ga0163162_10015538 Ga0163162_100155386 165
813 3300013306 Ga0163162_10015662 Ga0163162_100156621 165
814 3300013306 Ga0163162_10038965 Ga0163162_100389654 165
815 3300013306 Ga0163162_10041905 Ga0163162_100419055 165
816 3300013306 Ga0163162_10042270 Ga0163162_100422703 165
817 3300013306 Ga0163162_10075719 Ga0163162_100757193 165
818 3300013306 Ga0163162_10117338 Ga0163162_101173384 165
819 3300013306 Ga0163162_10124137 Ga0163162_101241374 165
820 3300013306 Ga0163162_10143656 Ga0163162_101436563 165
821 3300013306 Ga0163162_10187017 Ga0163162_101870172 165
822 3300013306 Ga0163162_10238326 Ga0163162_102383262 165
823 3300013306 Ga0163162_10320613 Ga0163162_103206131 165
824 3300013306 Ga0163162_10368523 Ga0163162_103685232 165
825 3300013306 Ga0163162_10462806 Ga0163162_104628062 165
826 3300013306 Ga0163162_10544599 Ga0163162_105445992 165
827 3300013306 Ga0163162_11248568 Ga0163162_112485682 165
828 3300013306 Ga0163162_12222620 Ga0163162_122226201 165
829 3300013307 Ga0157372_10043475 Ga0157372_100434754 165
830 3300013307 Ga0157372_10108256 Ga0157372_101082562 165
831 3300013307 Ga0157372_10181443 Ga0157372_101814432 165
832 3300013307 Ga0157372_10303178 Ga0157372_103031782 165
833 3300013307 Ga0157372_10338720 Ga0157372_103387203 165
834 3300013307 Ga0157372_10341605 Ga0157372_103416052 165
835 3300013307 Ga0157372_10628643 Ga0157372_106286433 165
836 3300013307 Ga0157372_10877857 Ga0157372_108778571 165
837 3300013307 Ga0157372_11740328 Ga0157372_117403281 165
838 3300013308 Ga0157375_10004435 Ga0157375_100044359 165
839 3300013308 Ga0157375_10021549 Ga0157375_100215492 165
840 3300013308 Ga0157375_10023277 Ga0157375_100232775 165
841 3300013308 Ga0157375_10066328 Ga0157375_100663283 165
842 3300013308 Ga0157375_10074008 Ga0157375_100740083 165
843 3300013308 Ga0157375_10093322 Ga0157375_100933224 165
844 3300013308 Ga0157375_10174899 Ga0157375_101748992 165
845 3300013308 Ga0157375_10184113 Ga0157375_101841132 165
846 3300013308 Ga0157375_10250780 Ga0157375_102507802 165
847 3300013308 Ga0157375_10307349 Ga0157375_103073492 165
848 3300013308 Ga0157375_10593833 Ga0157375_105938332 165
849 3300013308 Ga0157375_10646005 Ga0157375_106460052 165
850 3300013308 Ga0157375_10841498 Ga0157375_108414981 165
851 3300013308 Ga0157375_10902456 Ga0157375_109024562 165
852 3300013308 Ga0157375_11064328 Ga0157375_110643282 165
853 3300013308 Ga0157375_11540389 Ga0157375_115403891 165
854 3300014325 Ga0163163_10000184 Ga0163163_1000018463 165
855 3300014325 Ga0163163_10004533 Ga0163163_100045334 165
856 3300014325 Ga0163163_10005720 Ga0163163_100057208 165
857 3300014325 Ga0163163_10012406 Ga0163163_100124067 165
858 3300014325 Ga0163163_10012999 Ga0163163_100129997 165
859 3300014325 Ga0163163_10024208 Ga0163163_100242085 165
860 3300014325 Ga0163163_10039476 Ga0163163_100394762 165
861 3300014325 Ga0163163_10044389 Ga0163163_100443895 165
862 3300014325 Ga0163163_10143718 Ga0163163_101437182 165
863 3300014325 Ga0163163_10182671 Ga0163163_101826713 165
864 3300014325 Ga0163163_10406126 Ga0163163_104061262 165
865 3300014325 Ga0163163_10766614 Ga0163163_107666142 165
866 3300014325 Ga0163163_10772792 Ga0163163_107727921 165
867 3300014325 Ga0163163_11762723 Ga0163163_117627231 165
868 3300014326 Ga0157380_10000627 Ga0157380_100006276 165
869 3300014326 Ga0157380_10003949 Ga0157380_100039497 165
870 3300014326 Ga0157380_10006388 Ga0157380_100063886 165
871 3300014326 Ga0157380_10010260 Ga0157380_100102604 165
872 3300014326 Ga0157380_10014623 Ga0157380_100146232 165
873 3300014326 Ga0157380_10080406 Ga0157380_100804063 165
874 3300014326 Ga0157380_10121859 Ga0157380_101218591 165
875 3300014326 Ga0157380_10122958 Ga0157380_101229583 165
876 3300014326 Ga0157380_10290836 Ga0157380_102908362 165
877 3300014326 Ga0157380_10307344 Ga0157380_103073442 165
878 3300014326 Ga0157380_10513550 Ga0157380_105135502 165
879 3300014326 Ga0157380_10596189 Ga0157380_105961892 165
880 3300014326 Ga0157380_10736495 Ga0157380_107364952 165
881 3300014326 Ga0157380_11120406 Ga0157380_111204061 165
882 3300014497 Ga0182008_10219978 Ga0182008_102199782 165
883 3300014745 Ga0157377_10041834 Ga0157377_100418343 165
884 3300014745 Ga0157377_10088814 Ga0157377_100888142 165
885 3300014745 Ga0157377_10789803 Ga0157377_107898031 165
886 3300014968 Ga0157379_10006241 Ga0157379_100062412 165
887 3300014968 Ga0157379_10036431 Ga0157379_100364314 165
888 3300014968 Ga0157379_10049363 Ga0157379_100493633 165
889 3300014968 Ga0157379_10206098 Ga0157379_102060981 165
890 3300014968 Ga0157379_10514610 Ga0157379_105146102 165
891 3300014968 Ga0157379_10639137 Ga0157379_106391372 165
892 3300014968 Ga0157379_11439681 Ga0157379_114396812 165
893 3300014969 Ga0157376_10015880 Ga0157376_100158805 165
894 3300014969 Ga0157376_10038847 Ga0157376_100388472 165
895 3300014969 Ga0157376_10108630 Ga0157376_101086303 165
896 3300014969 Ga0157376_10220571 Ga0157376_102205712 165
897 3300014969 Ga0157376_10330532 Ga0157376_103305322 165
898 3300014969 Ga0157376_11055134 Ga0157376_110551342 165
899 3300017792 Ga0163161_10022258 Ga0163161_100222584 165
900 3300017792 Ga0163161_10047433 Ga0163161_100474332 165
901 3300017792 Ga0163161_10062447 Ga0163161_100624472 165
902 3300017792 Ga0163161_10120731 Ga0163161_101207312 165
903 3300017792 Ga0163161_10161047 Ga0163161_101610472 165
904 3300017792 Ga0163161_10193349 Ga0163161_101933492 165
905 3300017792 Ga0163161_10808576 Ga0163161_108085762 165
906 3300021384 Ga0213876_10017616 Ga0213876_100176164 165
907 3300025223 Ga0207672_1000046 Ga0207672_100004610 165
908 3300025315 Ga0207697_10100541 Ga0207697_101005412 165
909 3300025315 Ga0207697_10122557 Ga0207697_101225571 165
910 3300025315 Ga0207697_10189147 Ga0207697_101891471 165
911 3300025321 Ga0207656_10099910 Ga0207656_100999102 165
912 3300025321 Ga0207656_10160505 Ga0207656_101605052 165
913 3300025711 Ga0207696_1058383 Ga0207696_10583832 165
914 3300025885 Ga0207653_10000008 Ga0207653_10000008153 165
915 3300025885 Ga0207653_10008577 Ga0207653_100085774 165
916 3300025885 Ga0207653_10014875 Ga0207653_100148753 165
917 3300025893 Ga0207682_10057659 Ga0207682_100576592 165
918 3300025893 Ga0207682_10103753 Ga0207682_101037532 165
919 3300025893 Ga0207682_10403275 Ga0207682_104032751 165
920 3300025899 Ga0207642_10040653 Ga0207642_100406532 165
921 3300025900 Ga0207710_10000001 Ga0207710_10000001257 165
922 3300025900 Ga0207710_10018112 Ga0207710_100181122 165
923 3300025900 Ga0207710_10018149 Ga0207710_100181494 165
924 3300025900 Ga0207710_10181423 Ga0207710_101814232 165
925 3300025900 Ga0207710_10329160 Ga0207710_103291601 165
926 3300025900 Ga0207710_10563304 Ga0207710_105633041 165
927 3300025903 Ga0207680_10301777 Ga0207680_103017772 165
928 3300025904 Ga0207647_10006088 Ga0207647_100060886 165
929 3300025904 Ga0207647_10148823 Ga0207647_101488232 165
930 3300025904 Ga0207647_10151084 Ga0207647_101510842 165
931 3300025904 Ga0207647_10214351 Ga0207647_102143512 165
932 3300025904 Ga0207647_10350260 Ga0207647_103502601 165
933 3300025904 Ga0207647_10382403 Ga0207647_103824031 165
934 3300025905 Ga0207685_10000022 Ga0207685_1000002238 165
935 3300025907 Ga0207645_10090447 Ga0207645_100904472 165
936 3300025907 Ga0207645_10335245 Ga0207645_103352452 165
937 3300025907 Ga0207645_10882671 Ga0207645_108826711 165
938 3300025908 Ga0207643_10009459 Ga0207643_100094596 165
939 3300025908 Ga0207643_10020496 Ga0207643_100204962 165
940 3300025908 Ga0207643_10035314 Ga0207643_100353143 165
941 3300025908 Ga0207643_10128602 Ga0207643_101286022 165
942 3300025909 Ga0207705_10026077 Ga0207705_100260773 165
943 3300025909 Ga0207705_10914779 Ga0207705_109147792 165
944 3300025910 Ga0207684_10000076 Ga0207684_1000007650 165
945 3300025910 Ga0207684_10014326 Ga0207684_100143262 165
946 3300025910 Ga0207684_10015928 Ga0207684_100159286 165
947 3300025910 Ga0207684_10041713 Ga0207684_100417134 165
948 3300025910 Ga0207684_10051531 Ga0207684_100515312 165
949 3300025910 Ga0207684_10226622 Ga0207684_102266222 165
950 3300025910 Ga0207684_10772316 Ga0207684_107723162 165
951 3300025911 Ga0207654_10026859 Ga0207654_100268591 165
952 3300025911 Ga0207654_10189076 Ga0207654_101890762 165
953 3300025911 Ga0207654_10241094 Ga0207654_102410942 165
954 3300025911 Ga0207654_10292771 Ga0207654_102927712 165
955 3300025911 Ga0207654_10713569 Ga0207654_107135691 165
956 3300025912 Ga0207707_10000077 Ga0207707_1000007742 165
957 3300025912 Ga0207707_10017193 Ga0207707_100171932 165
958 3300025912 Ga0207707_10021381 Ga0207707_100213816 165
959 3300025912 Ga0207707_10191833 Ga0207707_101918332 165
960 3300025912 Ga0207707_10304439 Ga0207707_103044391 165
961 3300025912 Ga0207707_10540910 Ga0207707_105409102 165
962 3300025913 Ga0207695_10097543 Ga0207695_100975433 165
963 3300025914 Ga0207671_10002740 Ga0207671_100027404 165
964 3300025917 Ga0207660_10039895 Ga0207660_100398954 165
965 3300025917 Ga0207660_10138515 Ga0207660_101385152 165
966 3300025917 Ga0207660_10359200 Ga0207660_103592002 165
967 3300025917 Ga0207660_10453091 Ga0207660_104530912 165
968 3300025917 Ga0207660_10581917 Ga0207660_105819172 165
969 3300025918 Ga0207662_10018917 Ga0207662_100189172 165
970 3300025918 Ga0207662_10025954 Ga0207662_100259544 165
971 3300025918 Ga0207662_10071936 Ga0207662_100719363 165
972 3300025918 Ga0207662_10083504 Ga0207662_100835042 165
973 3300025918 Ga0207662_10279502 Ga0207662_102795022 165
974 3300025918 Ga0207662_10907846 Ga0207662_109078461 165
975 3300025919 Ga0207657_10184645 Ga0207657_101846452 165
976 3300025919 Ga0207657_10399642 Ga0207657_103996422 165
977 3300025921 Ga0207652_10000096 Ga0207652_1000009640 165
978 3300025921 Ga0207652_10081877 Ga0207652_100818772 165
979 3300025921 Ga0207652_10214648 Ga0207652_102146482 165
980 3300025921 Ga0207652_10792036 Ga0207652_107920362 165
981 3300025922 Ga0207646_10001426 Ga0207646_1000142615 165
982 3300025922 Ga0207646_10022181 Ga0207646_100221813 165
983 3300025922 Ga0207646_10044788 Ga0207646_100447882 165
984 3300025922 Ga0207646_10150147 Ga0207646_101501473 165
985 3300025922 Ga0207646_10178705 Ga0207646_101787053 165
986 3300025922 Ga0207646_10415365 Ga0207646_104153652 165
987 3300025922 Ga0207646_10458205 Ga0207646_104582052 165
988 3300025922 Ga0207646_10687722 Ga0207646_106877222 165
989 3300025922 Ga0207646_11447444 Ga0207646_114474441 165
990 3300025923 Ga0207681_10078357 Ga0207681_100783572 165
991 3300025923 Ga0207681_10166856 Ga0207681_101668562 165
992 3300025923 Ga0207681_11057481 Ga0207681_110574811 165
993 3300025925 Ga0207650_10000027 Ga0207650_100000272 165
994 3300025925 Ga0207650_10026744 Ga0207650_100267443 165
995 3300025925 Ga0207650_10027728 Ga0207650_100277282 165
996 3300025925 Ga0207650_10266980 Ga0207650_102669802 165
997 3300025925 Ga0207650_10280903 Ga0207650_102809032 165
998 3300025925 Ga0207650_10294183 Ga0207650_102941832 165
999 3300025925 Ga0207650_10461351 Ga0207650_104613512 165
1000 3300025925 Ga0207650_10718078 Ga0207650_107180781 165
1001 3300025925 Ga0207650_11411615 Ga0207650_114116151 165
1002 3300025926 Ga0207659_10064987 Ga0207659_100649872 165
1003 3300025926 Ga0207659_10373373 Ga0207659_103733732 165
1004 3300025926 Ga0207659_10951335 Ga0207659_109513352 165
1005 3300025927 Ga0207687_10026530 Ga0207687_100265302 165
1006 3300025927 Ga0207687_10153793 Ga0207687_101537932 165
1007 3300025927 Ga0207687_10269538 Ga0207687_102695382 165
1008 3300025931 Ga0207644_10002044 Ga0207644_100020448 165
1009 3300025931 Ga0207644_10025578 Ga0207644_100255784 165
1010 3300025931 Ga0207644_10029736 Ga0207644_100297364 165
1011 3300025931 Ga0207644_10092991 Ga0207644_100929912 165
1012 3300025931 Ga0207644_10099520 Ga0207644_100995202 165
1013 3300025931 Ga0207644_10455869 Ga0207644_104558692 165
1014 3300025931 Ga0207644_10563619 Ga0207644_105636193 165
1015 3300025932 Ga0207690_10031903 Ga0207690_100319031 165
1016 3300025932 Ga0207690_10422471 Ga0207690_104224712 165
1017 3300025933 Ga0207706_10159184 Ga0207706_101591843 165
1018 3300025933 Ga0207706_10185035 Ga0207706_101850352 165
1019 3300025933 Ga0207706_10362866 Ga0207706_103628662 165
1020 3300025933 Ga0207706_10464105 Ga0207706_104641052 165
1021 3300025933 Ga0207706_10680553 Ga0207706_106805531 165
1022 3300025934 Ga0207686_10000062 Ga0207686_100000627 165
1023 3300025934 Ga0207686_10001492 Ga0207686_100014926 165
1024 3300025934 Ga0207686_10007557 Ga0207686_100075575 165
1025 3300025934 Ga0207686_10009952 Ga0207686_100099521 165
1026 3300025934 Ga0207686_10060120 Ga0207686_100601203 165
1027 3300025934 Ga0207686_10178943 Ga0207686_101789432 165
1028 3300025934 Ga0207686_10209298 Ga0207686_102092982 165
1029 3300025934 Ga0207686_10682734 Ga0207686_106827341 165
1030 3300025935 Ga0207709_10000091 Ga0207709_1000009176 165
1031 3300025935 Ga0207709_10012008 Ga0207709_100120084 165
1032 3300025935 Ga0207709_10022753 Ga0207709_100227532 165
1033 3300025935 Ga0207709_10120115 Ga0207709_101201153 165
1034 3300025935 Ga0207709_10147103 Ga0207709_101471032 165
1035 3300025935 Ga0207709_10233125 Ga0207709_102331252 165
1036 3300025935 Ga0207709_10235778 Ga0207709_102357782 165
1037 3300025935 Ga0207709_10311042 Ga0207709_103110422 165
1038 3300025935 Ga0207709_10435835 Ga0207709_104358352 165
1039 3300025935 Ga0207709_10532688 Ga0207709_105326882 165
1040 3300025935 Ga0207709_10815121 Ga0207709_108151212 165
1041 3300025935 Ga0207709_10952091 Ga0207709_109520911 165
1042 3300025935 Ga0207709_10987294 Ga0207709_109872942 165
1043 3300025935 Ga0207709_11151547 Ga0207709_111515471 165
1044 3300025936 Ga0207670_10029974 Ga0207670_100299743 165
1045 3300025936 Ga0207670_10059131 Ga0207670_100591312 165
1046 3300025936 Ga0207670_10105804 Ga0207670_101058043 165
1047 3300025936 Ga0207670_10239735 Ga0207670_102397352 165
1048 3300025936 Ga0207670_10345995 Ga0207670_103459952 165
1049 3300025936 Ga0207670_10733505 Ga0207670_107335052 165
1050 3300025936 Ga0207670_10765003 Ga0207670_107650032 165
1051 3300025937 Ga0207669_10023693 Ga0207669_100236932 165
1052 3300025937 Ga0207669_10288294 Ga0207669_102882942 165
1053 3300025938 Ga0207704_10031813 Ga0207704_100318132 165
1054 3300025938 Ga0207704_10587464 Ga0207704_105874641 165
1055 3300025939 Ga0207665_10000033 Ga0207665_1000003341 165
1056 3300025939 Ga0207665_10036012 Ga0207665_100360123 165
1057 3300025939 Ga0207665_10045529 Ga0207665_100455294 165
1058 3300025939 Ga0207665_10048985 Ga0207665_100489855 165
1059 3300025940 Ga0207691_10023812 Ga0207691_100238124 165
1060 3300025940 Ga0207691_10044279 Ga0207691_100442794 165
1061 3300025940 Ga0207691_10054893 Ga0207691_100548933 165
1062 3300025940 Ga0207691_10296339 Ga0207691_102963391 165
1063 3300025940 Ga0207691_10425659 Ga0207691_104256592 165
1064 3300025940 Ga0207691_10607085 Ga0207691_106070852 165
1065 3300025940 Ga0207691_10813163 Ga0207691_108131631 165
1066 3300025941 Ga0207711_10004896 Ga0207711_100048969 165
1067 3300025941 Ga0207711_10008701 Ga0207711_100087016 165
1068 3300025941 Ga0207711_10009657 Ga0207711_100096577 165
1069 3300025941 Ga0207711_10017604 Ga0207711_100176044 165
1070 3300025941 Ga0207711_10054024 Ga0207711_100540243 165
1071 3300025941 Ga0207711_10209715 Ga0207711_102097152 165
1072 3300025941 Ga0207711_10393877 Ga0207711_103938772 165
1073 3300025941 Ga0207711_10437869 Ga0207711_104378692 165
1074 3300025941 Ga0207711_10494138 Ga0207711_104941381 165
1075 3300025941 Ga0207711_10621300 Ga0207711_106213002 165
1076 3300025941 Ga0207711_10709661 Ga0207711_107096612 165
1077 3300025941 Ga0207711_10943851 Ga0207711_109438511 165
1078 3300025941 Ga0207711_11161970 Ga0207711_111619701 165
1079 3300025941 Ga0207711_11182556 Ga0207711_111825561 165
1080 3300025941 Ga0207711_11293233 Ga0207711_112932331 165
1081 3300025942 Ga0207689_10006262 Ga0207689_100062623 165
1082 3300025942 Ga0207689_10011390 Ga0207689_100113906 165
1083 3300025942 Ga0207689_10026921 Ga0207689_100269212 165
1084 3300025942 Ga0207689_10045330 Ga0207689_100453303 165
1085 3300025942 Ga0207689_10048822 Ga0207689_100488224 165
1086 3300025942 Ga0207689_10051986 Ga0207689_100519863 165
1087 3300025942 Ga0207689_10078161 Ga0207689_100781612 165
1088 3300025942 Ga0207689_10154880 Ga0207689_101548802 165
1089 3300025942 Ga0207689_10260014 Ga0207689_102600142 165
1090 3300025942 Ga0207689_10289744 Ga0207689_102897442 165
1091 3300025942 Ga0207689_10604542 Ga0207689_106045422 165
1092 3300025942 Ga0207689_10886627 Ga0207689_108866271 165
1093 3300025944 Ga0207661_11320862 Ga0207661_113208622 165
1094 3300025945 Ga0207679_10055065 Ga0207679_100550653 165
1095 3300025945 Ga0207679_10615183 Ga0207679_106151832 165
1096 3300025945 Ga0207679_10661220 Ga0207679_106612201 165
1097 3300025945 Ga0207679_10737439 Ga0207679_107374391 165
1098 3300025945 Ga0207679_10933495 Ga0207679_109334952 165
1099 3300025945 Ga0207679_11054799 Ga0207679_110547992 165
1100 3300025960 Ga0207651_10070141 Ga0207651_100701413 165
1101 3300025960 Ga0207651_10141031 Ga0207651_101410312 165
1102 3300025960 Ga0207651_10173082 Ga0207651_101730822 165
1103 3300025960 Ga0207651_10848155 Ga0207651_108481551 165
1104 3300025960 Ga0207651_11215310 Ga0207651_112153101 165
1105 3300025961 Ga0207712_10000106 Ga0207712_100001062 165
1106 3300025961 Ga0207712_10016341 Ga0207712_100163411 165
1107 3300025961 Ga0207712_10107539 Ga0207712_101075391 165
1108 3300025961 Ga0207712_10168780 Ga0207712_101687802 165
1109 3300025961 Ga0207712_10170114 Ga0207712_101701142 165
1110 3300025961 Ga0207712_10635895 Ga0207712_106358952 165
1111 3300025961 Ga0207712_11162212 Ga0207712_111622121 165
1112 3300025972 Ga0207668_10292150 Ga0207668_102921502 165
1113 3300025972 Ga0207668_10469889 Ga0207668_104698891 165
1114 3300025972 Ga0207668_11309495 Ga0207668_113094951 165
1115 3300025981 Ga0207640_10067608 Ga0207640_100676082 165
1116 3300025981 Ga0207640_10109309 Ga0207640_101093092 165
1117 3300025981 Ga0207640_10139684 Ga0207640_101396843 165
1118 3300025981 Ga0207640_10296197 Ga0207640_102961972 165
1119 3300025981 Ga0207640_10399145 Ga0207640_103991452 165
1120 3300025981 Ga0207640_10512281 Ga0207640_105122812 165
1121 3300025981 Ga0207640_10608564 Ga0207640_106085642 165
1122 3300025981 Ga0207640_10689280 Ga0207640_106892802 165
1123 3300025981 Ga0207640_10705007 Ga0207640_107050072 165
1124 3300025981 Ga0207640_10858050 Ga0207640_108580501 165
1125 3300025986 Ga0207658_10023337 Ga0207658_100233374 165
1126 3300025986 Ga0207658_10055961 Ga0207658_100559614 165
1127 3300025986 Ga0207658_10125671 Ga0207658_101256712 165
1128 3300025986 Ga0207658_10335051 Ga0207658_103350512 165
1129 3300025986 Ga0207658_10702717 Ga0207658_107027172 165
1130 3300026023 Ga0207677_10060089 Ga0207677_100600892 165
1131 3300026023 Ga0207677_10132373 Ga0207677_101323732 165
1132 3300026023 Ga0207677_10192370 Ga0207677_101923702 165
1133 3300026023 Ga0207677_10524888 Ga0207677_105248883 165
1134 3300026023 Ga0207677_10651972 Ga0207677_106519721 165
1135 3300026035 Ga0207703_10000481 Ga0207703_1000048140 165
1136 3300026035 Ga0207703_10001157 Ga0207703_1000115711 165
1137 3300026035 Ga0207703_10006636 Ga0207703_100066369 165
1138 3300026035 Ga0207703_10015662 Ga0207703_100156623 165
1139 3300026035 Ga0207703_10032728 Ga0207703_100327282 165
1140 3300026035 Ga0207703_10055950 Ga0207703_100559503 165
1141 3300026035 Ga0207703_10057836 Ga0207703_100578363 165
1142 3300026035 Ga0207703_10076190 Ga0207703_100761903 165
1143 3300026035 Ga0207703_10132078 Ga0207703_101320782 165
1144 3300026035 Ga0207703_10249011 Ga0207703_102490113 165
1145 3300026035 Ga0207703_10288808 Ga0207703_102888082 165
1146 3300026035 Ga0207703_10375885 Ga0207703_103758852 165
1147 3300026035 Ga0207703_10549745 Ga0207703_105497452 165
1148 3300026035 Ga0207703_10661919 Ga0207703_106619192 165
1149 3300026035 Ga0207703_11232558 Ga0207703_112325581 165
1150 3300026041 Ga0207639_10025126 Ga0207639_100251264 165
1151 3300026041 Ga0207639_10038113 Ga0207639_100381133 165
1152 3300026041 Ga0207639_10161728 Ga0207639_101617282 165
1153 3300026041 Ga0207639_10339196 Ga0207639_103391962 165
1154 3300026041 Ga0207639_10700358 Ga0207639_107003581 165
1155 3300026041 Ga0207639_11401088 Ga0207639_114010881 165
1156 3300026067 Ga0207678_10140884 Ga0207678_101408842 165
1157 3300026067 Ga0207678_10248399 Ga0207678_102483992 165
1158 3300026075 Ga0207708_10000235 Ga0207708_1000023528 165
1159 3300026075 Ga0207708_10015082 Ga0207708_100150822 165
1160 3300026075 Ga0207708_10022826 Ga0207708_100228264 165
1161 3300026075 Ga0207708_10039853 Ga0207708_100398533 165
1162 3300026075 Ga0207708_10072579 Ga0207708_100725794 165
1163 3300026075 Ga0207708_10280024 Ga0207708_102800242 165
1164 3300026075 Ga0207708_10322343 Ga0207708_103223431 165
1165 3300026075 Ga0207708_10360863 Ga0207708_103608632 165
1166 3300026075 Ga0207708_10467116 Ga0207708_104671162 165
1167 3300026075 Ga0207708_10715436 Ga0207708_107154361 165
1168 3300026075 Ga0207708_11039590 Ga0207708_110395901 165
1169 3300026078 Ga0207702_10481024 Ga0207702_104810241 165
1170 3300026088 Ga0207641_10005244 Ga0207641_100052445 165
1171 3300026088 Ga0207641_10062794 Ga0207641_100627942 165
1172 3300026088 Ga0207641_10121460 Ga0207641_101214602 165
1173 3300026088 Ga0207641_10212017 Ga0207641_102120172 165
1174 3300026088 Ga0207641_10256272 Ga0207641_102562722 165
1175 3300026088 Ga0207641_10317875 Ga0207641_103178752 165
1176 3300026088 Ga0207641_10343384 Ga0207641_103433842 165
1177 3300026088 Ga0207641_10741442 Ga0207641_107414422 165
1178 3300026088 Ga0207641_10792101 Ga0207641_107921012 165
1179 3300026088 Ga0207641_11002821 Ga0207641_110028212 165
1180 3300026088 Ga0207641_11086873 Ga0207641_110868731 165
1181 3300026088 Ga0207641_11254059 Ga0207641_112540591 165
1182 3300026089 Ga0207648_10009383 Ga0207648_100093836 165
1183 3300026089 Ga0207648_10088757 Ga0207648_100887573 165
1184 3300026089 Ga0207648_10099908 Ga0207648_100999082 165
1185 3300026089 Ga0207648_10102424 Ga0207648_101024242 165
1186 3300026089 Ga0207648_10135270 Ga0207648_101352702 165
1187 3300026089 Ga0207648_10145571 Ga0207648_101455711 165
1188 3300026089 Ga0207648_10166950 Ga0207648_101669502 165
1189 3300026089 Ga0207648_10219529 Ga0207648_102195292 165
1190 3300026089 Ga0207648_10249232 Ga0207648_102492322 165
1191 3300026089 Ga0207648_10287008 Ga0207648_102870082 165
1192 3300026089 Ga0207648_10381820 Ga0207648_103818202 165
1193 3300026089 Ga0207648_10511208 Ga0207648_105112082 165
1194 3300026089 Ga0207648_10550167 Ga0207648_105501672 165
1195 3300026089 Ga0207648_10655096 Ga0207648_106550962 165
1196 3300026095 Ga0207676_10001919 Ga0207676_100019197 165
1197 3300026095 Ga0207676_10006195 Ga0207676_100061956 165
1198 3300026095 Ga0207676_10014373 Ga0207676_100143736 165
1199 3300026095 Ga0207676_10117303 Ga0207676_101173033 165
1200 3300026095 Ga0207676_10130724 Ga0207676_101307242 165
1201 3300026095 Ga0207676_10260881 Ga0207676_102608812 165
1202 3300026095 Ga0207676_10261118 Ga0207676_102611182 165
1203 3300026095 Ga0207676_10286582 Ga0207676_102865822 165
1204 3300026095 Ga0207676_10297318 Ga0207676_102973183 165
1205 3300026095 Ga0207676_10342444 Ga0207676_103424442 165
1206 3300026095 Ga0207676_10367362 Ga0207676_103673621 165
1207 3300026095 Ga0207676_10466801 Ga0207676_104668012 165
1208 3300026095 Ga0207676_10474838 Ga0207676_104748382 165
1209 3300026095 Ga0207676_10525374 Ga0207676_105253742 165
1210 3300026095 Ga0207676_10543387 Ga0207676_105433872 165
1211 3300026095 Ga0207676_10912800 Ga0207676_109128001 165
1212 3300026095 Ga0207676_11188917 Ga0207676_111889171 165
1213 3300026095 Ga0207676_11402639 Ga0207676_114026391 165
1214 3300026116 Ga0207674_10000525 Ga0207674_100005258 165
1215 3300026116 Ga0207674_10017630 Ga0207674_100176302 165
1216 3300026116 Ga0207674_10138878 Ga0207674_101388783 165
1217 3300026116 Ga0207674_10183087 Ga0207674_101830872 165
1218 3300026116 Ga0207674_10348877 Ga0207674_103488771 165
1219 3300026116 Ga0207674_10423353 Ga0207674_104233532 165
1220 3300026116 Ga0207674_10468568 Ga0207674_104685681 165
1221 3300026116 Ga0207674_10506129 Ga0207674_105061292 165
1222 3300026118 Ga0207675_100001552 Ga0207675_10000155215 165
1223 3300026118 Ga0207675_100005444 Ga0207675_1000054442 165
1224 3300026118 Ga0207675_100015389 Ga0207675_1000153894 165
1225 3300026118 Ga0207675_100017262 Ga0207675_1000172622 165
1226 3300026118 Ga0207675_100031385 Ga0207675_1000313852 165
1227 3300026118 Ga0207675_100075254 Ga0207675_1000752542 165
1228 3300026118 Ga0207675_100127665 Ga0207675_1001276652 165
1229 3300026118 Ga0207675_100130632 Ga0207675_1001306323 165
1230 3300026118 Ga0207675_100158073 Ga0207675_1001580732 165
1231 3300026118 Ga0207675_100160160 Ga0207675_1001601602 165
1232 3300026118 Ga0207675_100184754 Ga0207675_1001847543 165
1233 3300026118 Ga0207675_100246555 Ga0207675_1002465551 165
1234 3300026118 Ga0207675_100267385 Ga0207675_1002673852 165
1235 3300026118 Ga0207675_100410432 Ga0207675_1004104322 165
1236 3300026118 Ga0207675_100664013 Ga0207675_1006640132 165
1237 3300026118 Ga0207675_100726433 Ga0207675_1007264331 165
1238 3300026118 Ga0207675_100775893 Ga0207675_1007758931 165
1239 3300026118 Ga0207675_101275706 Ga0207675_1012757062 165
1240 3300026121 Ga0207683_10071994 Ga0207683_100719941 165
1241 3300026121 Ga0207683_10236271 Ga0207683_102362711 165
1242 3300026121 Ga0207683_10273340 Ga0207683_102733401 165
1243 3300026121 Ga0207683_11101527 Ga0207683_111015271 165
1244 3300026121 Ga0207683_11284713 Ga0207683_112847131 165
1245 3300026142 Ga0207698_10337223 Ga0207698_103372232 165
1246 3300026142 Ga0207698_10623860 Ga0207698_106238601 165
1247 3300026142 Ga0207698_10701619 Ga0207698_107016192 165
1248 3300026142 Ga0207698_10888012 Ga0207698_108880122 165
1249 3300026142 Ga0207698_11021874 Ga0207698_110218742 165
1250 3300027512 Ga0209179_1114183 Ga0209179_11141831 165
1251 3300027907 Ga0207428_10004899 Ga0207428_1000489910 165
1252 3300027907 Ga0207428_10099483 Ga0207428_100994832 165
1253 3300027907 Ga0207428_10300280 Ga0207428_103002802 165
1254 3300027907 Ga0207428_10325557 Ga0207428_103255572 165
1255 3300027907 Ga0207428_10634319 Ga0207428_106343192 165
1256 3300028379 Ga0268266_10614751 Ga0268266_106147512 165
1257 3300028380 Ga0268265_10003630 Ga0268265_1000363011 165
1258 3300028380 Ga0268265_10155414 Ga0268265_101554142 165
1259 3300028380 Ga0268265_10193550 Ga0268265_101935502 165
1260 3300028380 Ga0268265_10506809 Ga0268265_105068092 165
1261 3300028380 Ga0268265_10590493 Ga0268265_105904932 165
1262 3300028380 Ga0268265_10823430 Ga0268265_108234301 165
1263 3300028380 Ga0268265_10891119 Ga0268265_108911191 165
1264 3300028380 Ga0268265_10936295 Ga0268265_109362951 165
1265 3300028381 Ga0268264_10005319 Ga0268264_100053193 165
1266 3300028381 Ga0268264_10006931 Ga0268264_100069314 165
1267 3300028381 Ga0268264_10019417 Ga0268264_100194175 165
1268 3300028381 Ga0268264_10050094 Ga0268264_100500944 165
1269 3300028381 Ga0268264_10148899 Ga0268264_101488992 165
1270 3300028381 Ga0268264_10150148 Ga0268264_101501482 165
1271 3300028381 Ga0268264_10171445 Ga0268264_101714453 165
1272 3300028381 Ga0268264_10286096 Ga0268264_102860962 165
1273 3300028381 Ga0268264_10315683 Ga0268264_103156832 165
1274 3300028381 Ga0268264_10339746 Ga0268264_103397462 165
1275 3300028381 Ga0268264_10367378 Ga0268264_103673782 165
1276 3300028381 Ga0268264_10396794 Ga0268264_103967942 165
1277 3300028381 Ga0268264_10407270 Ga0268264_104072701 165
1278 3300028381 Ga0268264_10609949 Ga0268264_106099492 165
1279 3300028381 Ga0268264_11193195 Ga0268264_111931951 165
1280 3300028381 Ga0268264_11326198 Ga0268264_113261981 165
1281 3300028381 Ga0268264_12035747 Ga0268264_120357471 165
1282 3300028381 Ga0268264_12075760 Ga0268264_120757601 165
1283 3300030745 Ga0316182_1250615 Ga0316182_12506152 165
1284 3300031456 Ga0307513_10001810 Ga0307513_100018107 165
1285 3300031456 Ga0307513_10569372 Ga0307513_105693721 165
1286 3300031548 Ga0307408_100008854 Ga0307408_1000088544 165
1287 3300031548 Ga0307408_100242787 Ga0307408_1002427872 165
1288 3300031548 Ga0307408_100368437 Ga0307408_1003684372 165
1289 3300031548 Ga0307408_100619453 Ga0307408_1006194532 165
1290 3300031548 Ga0307408_100735940 Ga0307408_1007359401 165
1291 3300031548 Ga0307408_101120057 Ga0307408_1011200572 165
1292 3300031731 Ga0307405_10004255 Ga0307405_100042554 165
1293 3300031731 Ga0307405_10020335 Ga0307405_100203352 165
1294 3300031731 Ga0307405_10021988 Ga0307405_100219881 165
1295 3300031731 Ga0307405_10073078 Ga0307405_100730782 165
1296 3300031731 Ga0307405_10084677 Ga0307405_100846772 165
1297 3300031731 Ga0307405_10112780 Ga0307405_101127801 165
1298 3300031731 Ga0307405_10393475 Ga0307405_103934751 165
1299 3300031824 Ga0307413_10018801 Ga0307413_100188013 165
1300 3300031824 Ga0307413_10024394 Ga0307413_100243943 165
1301 3300031824 Ga0307413_10044642 Ga0307413_100446423 165
1302 3300031824 Ga0307413_10068179 Ga0307413_100681793 165
1303 3300031824 Ga0307413_10219597 Ga0307413_102195972 165
1304 3300031824 Ga0307413_10274131 Ga0307413_102741311 165
1305 3300031824 Ga0307413_10458987 Ga0307413_104589872 165
1306 3300031852 Ga0307410_10013140 Ga0307410_100131404 165
1307 3300031852 Ga0307410_10013817 Ga0307410_100138174 165
1308 3300031852 Ga0307410_10245959 Ga0307410_102459592 165
1309 3300031852 Ga0307410_10248131 Ga0307410_102481312 165
1310 3300031852 Ga0307410_10308132 Ga0307410_103081322 165
1311 3300031852 Ga0307410_10421086 Ga0307410_104210862 165
1312 3300031852 Ga0307410_10450125 Ga0307410_104501252 165
1313 3300031852 Ga0307410_10551024 Ga0307410_105510242 165
1314 3300031901 Ga0307406_10007171 Ga0307406_100071711 165
1315 3300031901 Ga0307406_10011489 Ga0307406_100114893 165
1316 3300031901 Ga0307406_10249572 Ga0307406_102495722 165
1317 3300031901 Ga0307406_10872405 Ga0307406_108724052 165
1318 3300031901 Ga0307406_11143854 Ga0307406_111438541 165
1319 3300031903 Ga0307407_10007946 Ga0307407_100079463 165
1320 3300031903 Ga0307407_10159326 Ga0307407_101593262 165
1321 3300031903 Ga0307407_10162969 Ga0307407_101629691 165
1322 3300031911 Ga0307412_10052512 Ga0307412_100525123 165
1323 3300031911 Ga0307412_10055898 Ga0307412_100558983 165
1324 3300031911 Ga0307412_10056920 Ga0307412_100569202 165
1325 3300031911 Ga0307412_10085572 Ga0307412_100855723 165
1326 3300031995 Ga0307409_100006264 Ga0307409_1000062645 165
1327 3300031995 Ga0307409_100350432 Ga0307409_1003504321 165
1328 3300031995 Ga0307409_100852615 Ga0307409_1008526152 165
1329 3300031995 Ga0307409_100887452 Ga0307409_1008874522 165
1330 3300031995 Ga0307409_101590788 Ga0307409_1015907882 165
1331 3300032002 Ga0307416_100004832 Ga0307416_1000048323 165
1332 3300032002 Ga0307416_100015918 Ga0307416_1000159183 165
1333 3300032002 Ga0307416_100380298 Ga0307416_1003802982 165
1334 3300032002 Ga0307416_101227180 Ga0307416_1012271801 165
1335 3300032002 Ga0307416_101564214 Ga0307416_1015642141 165
1336 3300032002 Ga0307416_101832342 Ga0307416_1018323421 165
1337 3300032002 Ga0307416_101899074 Ga0307416_1018990741 165
1338 3300032002 Ga0307416_102454084 Ga0307416_1024540841 165
1339 3300032004 Ga0307414_10011752 Ga0307414_100117524 165
1340 3300032004 Ga0307414_10049325 Ga0307414_100493253 165
1341 3300032004 Ga0307414_10210989 Ga0307414_102109892 165
1342 3300032004 Ga0307414_10212594 Ga0307414_102125942 165
1343 3300032004 Ga0307414_10281889 Ga0307414_102818892 165
1344 3300032004 Ga0307414_10539486 Ga0307414_105394861 165
1345 3300032004 Ga0307414_10846089 Ga0307414_108460891 165
1346 3300032004 Ga0307414_11110754 Ga0307414_111107541 165
1347 3300032005 Ga0307411_10006971 Ga0307411_100069713 165
1348 3300032005 Ga0307411_10021834 Ga0307411_100218343 165
1349 3300032005 Ga0307411_10120851 Ga0307411_101208512 165
1350 3300032005 Ga0307411_10285346 Ga0307411_102853462 165
1351 3300032005 Ga0307411_10300064 Ga0307411_103000642 165
1352 3300032005 Ga0307411_10526431 Ga0307411_105264312 165
1353 3300032005 Ga0307411_11142272 Ga0307411_111422721 165
1354 3300032126 Ga0307415_100016598 Ga0307415_1000165983 165
1355 3300032126 Ga0307415_100063138 Ga0307415_1000631384 165
1356 3300032126 Ga0307415_100091086 Ga0307415_1000910862 165
1357 3300032126 Ga0307415_100106168 Ga0307415_1001061683 165
1358 3300032126 Ga0307415_100823177 Ga0307415_1008231771 165
1359 3300034820 Ga0373959_0043410 Ga0373959_0043410_241_738 165
1360 3300035088 Ga0373940_0053696 Ga0373940_0053696_604_1101 165
1361 3300035091 Ga0373951_0003754 Ga0373951_0003754_1332_1829 165
1362 3300035091 Ga0373951_0089749 Ga0373951_0089749_241_738 165
1363 3300035112 Ga0373932_0122195 Ga0373932_0122195_284_781 165
1364 3300035112 Ga0373932_0193024 Ga0373932_0193024_166_663 165
1365 3300035112 Ga0373932_0349676 Ga0373932_0349676_24_521 165
1366 3300035115 Ga0373941_0166982 Ga0373941_0166982_286_783 165
1367 3300035241 Ga0373961_0092351 Ga0373961_0092351_110_607 165
1368 3300035242 Ga0373962_0215178 Ga0373962_0215178_116_613 165
1369 3300036401 Ga0373937_0089715 Ga0373937_0089715_861_1358 165
1370 3300037418 Ga0395900_0095536 Ga0395900_0095536_2184_2681 165
1371 3300037418 Ga0395900_0215130 Ga0395900_0215130_442_939 165
1372 3300037418 Ga0395900_0651565 Ga0395900_0651565_226_723 165
1373 3300037418 Ga0395900_1006133 Ga0395900_1006133_192_689 165
1374 3300037466 Ga0395898_0607733 Ga0395898_0607733_111_608 165
1375 3300037471 Ga0395905_0006243 Ga0395905_0006243_6830_7327 165
1376 3300037471 Ga0395905_0029319 Ga0395905_0029319_2921_3418 165
1377 3300037853 Ga0436364_1375113 Ga0436364_1375113_1021_1518 165
1378 3300038443 Ga0395901_0166097 Ga0395901_0166097_248_745 165
1379 3300038443 Ga0395901_0218696 Ga0395901_0218696_901_1398 165
1380 3300038443 Ga0395901_0275573 Ga0395901_0275573_483_980 165
1381 3300038699 Ga0242422_00915 Ga0242422_00915_1374_1871 165
1382 3300038699 Ga0242422_04863 Ga0242422_04863_85_582 165
1383 3300038996 Ga0242420_004415 Ga0242420_004415_414_911 165
1384 3300038996 Ga0242420_004617 Ga0242420_004617_876_1373 165
1385 3300038996 Ga0242420_012275 Ga0242420_012275_327_824 165
1386 3300039437 Ga0436365_0671904 Ga0436365_0671904_1501_1998 165
1387 3300039437 Ga0436365_0740320 Ga0436365_0740320_679_1176 165
1388 3300039437 Ga0436365_0881711 Ga0436365_0881711_205_702 165
1389 3300039437 Ga0436365_1860421 Ga0436365_1860421_627_1124 165
1390 3300041408 Ga0439453_0026611 Ga0439453_0026611_392_889 165
1391 3300042005 Ga0439448_0110086 Ga0439448_0110086_135_632 165
1392 3300042007 Ga0439449_0277139 Ga0439449_0277139_79_576 165
1393 3300042012 Ga0439455_0006129 Ga0439455_0006129_464_961 165
1394 3300042015 Ga0439462_0129370 Ga0439462_0129370_56_553 165
1395 3300042156 Ga0439446_0011230 Ga0439446_0011230_1789_2286 165
1396 3300042157 Ga0439458_0005147 Ga0439458_0005147_1891_2388 165
1397 3300042435 Ga0439434_0022033 Ga0439434_0022033_356_853 165
1398 3300042530 Ga0450916_014560 Ga0450916_014560_93_590 165
1399 3300042876 Ga0451577_0010762 Ga0451577_0010762_7104_7601 165
1400 3300042876 Ga0451577_0528078 Ga0451577_0528078_274_771 165
1401 3300044673 Ga0453683_0026879 Ga0453683_0026879_1047_1544 165
1402 3300044673 Ga0453683_0112947 Ga0453683_0112947_49_546 165
1403 3300044673 Ga0453683_0207094 Ga0453683_0207094_603_1130 165
1404 3300044673 Ga0453683_0462078 Ga0453683_0462078_284_781 165
1405 3300044712 Ga0453684_0521793 Ga0453684_0521793_98_595 165
1406 3300045051 Ga0451576_0027944 Ga0451576_0027944_3248_3745 165
1407 3300045051 Ga0451576_0042739 Ga0451576_0042739_1265_1792 165
1408 3300045051 Ga0451576_0223808 Ga0451576_0223808_1138_1635 165
1409 3300045051 Ga0451576_1061299 Ga0451576_1061299_281_778 165
1410 3300045051 Ga0451576_1629439 Ga0451576_1629439_86_583 165
1411 3300045051 Ga0451576_1897661 Ga0451576_1897661_15_512 165
1412 3300046472 Ga0495580_0200551 Ga0495580_0200551_166_663 165
1413 3300046476 Ga0495662_0225749 Ga0495662_0225749_232_729 165
1414 3300046491 Ga0495584_0257170 Ga0495584_0257170_315_812 165
1415 3300046517 Ga0495630_0248877 Ga0495630_0248877_718_1215 165
1416 3300046522 Ga0495643_0179669 Ga0495643_0179669_68_583 165
1417 3300046525 Ga0495663_0000433 Ga0495663_0000433_1239_1736 165
1418 3300046537 Ga0495598_0002150 Ga0495598_0002150_1828_2325 165
1419 3300046537 Ga0495598_0004506 Ga0495598_0004506_2324_2821 165
1420 3300046539 Ga0495621_0002053 Ga0495621_0002053_3183_3680 165
1421 3300046642 Ga0495634_0341040 Ga0495634_0341040_121_618 165
1422 3300046663 Ga0495635_0552333 Ga0495635_0552333_53_550 165
1423 3300046664 Ga0495659_0073632 Ga0495659_0073632_768_1265 165
1424 3300046683 Ga0495658_0000468 Ga0495658_0000468_6292_6789 165
1425 3300046683 Ga0495658_0297351 Ga0495658_0297351_314_811 165
1426 3300046691 Ga0495670_0096461 Ga0495670_0096461_169_666 165
1427 3300047320 Ga0495672_0084998 Ga0495672_0084998_160_657 165
1428 3300047320 Ga0495672_0358902 Ga0495672_0358902_164_661 165
1429 3300047322 Ga0495680_0296987 Ga0495680_0296987_162_659 165
1430 3300048904 Ga0496101_0969763 Ga0496101_0969763_58_645 165
1431 3300048905 Ga0496102_0639548 Ga0496102_0639548_52_549 165
1432 3300048905 Ga0496102_1415872 Ga0496102_1415872_90_587 165
1433 3300048907 Ga0496104_0128948 Ga0496104_0128948_1801_2388 165
1434 3300048907 Ga0496104_0841074 Ga0496104_0841074_261_758 165
1435 3300048907 Ga0496104_1100051 Ga0496104_1100051_128_625 165
1436 3300048908 Ga0496105_0346690 Ga0496105_0346690_197_694 165
1437 3300048909 Ga0496106_0037768 Ga0496106_0037768_98_595 165
1438 3300048909 Ga0496106_0967249 Ga0496106_0967249_121_618 165
1439 3300048911 Ga0496108_0087202 Ga0496108_0087202_1336_1833 165
1440 3300048911 Ga0496108_0259001 Ga0496108_0259001_424_921 165
1441 3300048912 Ga0496109_0333755 Ga0496109_0333755_744_1241 165
1442 3300048912 Ga0496109_1065211 Ga0496109_1065211_142_729 165
1443 3300048913 Ga0496110_0172091 Ga0496110_0172091_1131_1646 165
1444 3300048913 Ga0496110_0408029 Ga0496110_0408029_289_786 165
1445 3300048913 Ga0496110_0763773 Ga0496110_0763773_174_671 165
1446 3300048914 Ga0496111_0504625 Ga0496111_0504625_198_713 165
1447 3300048915 Ga0496112_0506507 Ga0496112_0506507_202_699 165
1448 3300048915 Ga0496112_0658939 Ga0496112_0658939_86_583 165
1449 3300048915 Ga0496112_0889326 Ga0496112_0889326_297_794 165
1450 3300048915 Ga0496112_1066533 Ga0496112_1066533_102_599 165
1451 3300048917 Ga0496114_0505393 Ga0496114_0505393_455_952 165
1452 3300049513 Ga0501290_029014 Ga0501290_029014_16_513 165
1453 3300049514 Ga0501291_010360 Ga0501291_010360_673_1170 165
1454 3300049514 Ga0501291_023001 Ga0501291_023001_329_826 165
1455 3300049515 Ga0501292_009194 Ga0501292_009194_831_1328 165
1456 3300049516 Ga0501293_015490 Ga0501293_015490_58_555 165
1457 3300049519 Ga0501296_002072 Ga0501296_002072_502_999 165
1458 3300049519 Ga0501296_003660 Ga0501296_003660_238_735 165
1459 3300049519 Ga0501296_016193 Ga0501296_016193_191_688 165
1460 3300049521 Ga0501298_076426 Ga0501298_076426_37_534 165
1461 3300049522 Ga0501299_019458 Ga0501299_019458_318_815 165
1462 3300049522 Ga0501299_034099 Ga0501299_034099_168_665 165
1463 3300049526 Ga0501303_021393 Ga0501303_021393_97_594 165
1464 3300049587 Ga0501071_0580785 Ga0501071_0580785_339_836 165
1465 3300049649 Ga0501198_005552 Ga0501198_005552_481_978 165
1466 3300049649 Ga0501198_032576 Ga0501198_032576_363_860 165
1467 3300049652 Ga0501202_009854 Ga0501202_009854_296_793 165
1468 3300049652 Ga0501202_012666 Ga0501202_012666_551_1048 165
1469 3300049652 Ga0501202_028508 Ga0501202_028508_522_1019 165
1470 3300049654 Ga0501207_011564 Ga0501207_011564_57_554 165
1471 3300049654 Ga0501207_030313 Ga0501207_030313_52_549 165
1472 3300049655 Ga0501208_019907 Ga0501208_019907_82_579 165
1473 3300049660 Ga0501216_006795 Ga0501216_006795_111_608 165
1474 3300049660 Ga0501216_007853 Ga0501216_007853_857_1354 165
1475 3300049661 Ga0501217_005217 Ga0501217_005217_993_1490 165
1476 3300049661 Ga0501217_025120 Ga0501217_025120_725_1222 165
1477 3300049661 Ga0501217_029945 Ga0501217_029945_153_671 165
1478 3300049663 Ga0501223_005137 Ga0501223_005137_1038_1535 165
1479 3300049663 Ga0501223_010856 Ga0501223_010856_1281_1778 165
1480 3300049663 Ga0501223_028003 Ga0501223_028003_450_947 165
1481 3300049663 Ga0501223_042103 Ga0501223_042103_279_776 165
1482 3300049665 Ga0501227_000507 Ga0501227_000507_6618_7115 165
1483 3300049665 Ga0501227_008655 Ga0501227_008655_719_1216 165
1484 3300049665 Ga0501227_124903 Ga0501227_124903_98_595 165
1485 3300049668 Ga0501233_007017 Ga0501233_007017_1389_1886 165
1486 3300049669 Ga0501235_002582 Ga0501235_002582_1849_2346 165
1487 3300049669 Ga0501235_043789 Ga0501235_043789_261_758 165
1488 3300049669 Ga0501235_064580 Ga0501235_064580_131_628 165
1489 3300049670 Ga0501236_032306 Ga0501236_032306_50_547 165
1490 3300049673 Ga0501240_009003 Ga0501240_009003_672_1169 165
1491 3300049673 Ga0501240_013696 Ga0501240_013696_190_687 165
1492 3300049675 Ga0501243_008153 Ga0501243_008153_158_655 165
1493 3300049676 Ga0501246_013156 Ga0501246_013156_74_571 165
1494 3300049676 Ga0501246_041747 Ga0501246_041747_28_525 165
1495 3300049679 Ga0501249_011380 Ga0501249_011380_131_628 165
1496 3300049680 Ga0501250_009161 Ga0501250_009161_164_661 165
1497 3300049681 Ga0501251_003811 Ga0501251_003811_378_875 165
1498 3300049684 Ga0501255_013484 Ga0501255_013484_425_922 165
1499 3300049685 Ga0501256_011166 Ga0501256_011166_78_575 165
1500 3300049685 Ga0501256_017115 Ga0501256_017115_49_546 165
1501 3300049686 Ga0501257_012993 Ga0501257_012993_566_1063 165
1502 3300049686 Ga0501257_013305 Ga0501257_013305_1212_1709 165
1503 3300049686 Ga0501257_045799 Ga0501257_045799_19_516 165
1504 3300049689 Ga0501260_002995 Ga0501260_002995_237_734 165
1505 3300049689 Ga0501260_012712 Ga0501260_012712_325_822 165
1506 3300049689 Ga0501260_013557 Ga0501260_013557_257_754 165
1507 3300049704 Ga0501221_010336 Ga0501221_010336_1034_1531 165
1508 3300049704 Ga0501221_058055 Ga0501221_058055_37_534 165
1509 3300049704 Ga0501221_179211 Ga0501221_179211_46_543 165
1510 3300049705 Ga0501225_0000353 Ga0501225_0000353_10626_11123 165
1511 3300049705 Ga0501225_0002065 Ga0501225_0002065_1155_1652 165
1512 3300049705 Ga0501225_0023783 Ga0501225_0023783_587_1084 165
1513 3300049705 Ga0501225_0032378 Ga0501225_0032378_762_1259 165
1514 3300049705 Ga0501225_0033552 Ga0501225_0033552_874_1371 165
1515 3300049705 Ga0501225_0034674 Ga0501225_0034674_546_1043 165
1516 3300049707 Ga0501234_002584 Ga0501234_002584_1710_2207 165
1517 3300049707 Ga0501234_005142 Ga0501234_005142_173_670 165
1518 3300049708 Ga0501245_025422 Ga0501245_025422_103_600 165
1519 3300049741 Ga0501079_0253081 Ga0501079_0253081_862_1359 165
1520 3300049757 Ga0501232_018729 Ga0501232_018729_148_645 165
1521 3300049762 Ga0501265_030866 Ga0501265_030866_103_600 165
1522 3300049765 Ga0501268_025709 Ga0501268_025709_94_591 165
1523 3300049765 Ga0501268_030360 Ga0501268_030360_163_660 165
1524 3300049765 Ga0501268_073992 Ga0501268_073992_116_613 165
1525 3300049770 Ga0501273_001548 Ga0501273_001548_985_1482 165
1526 3300049774 Ga0501278_015916 Ga0501278_015916_93_590 165
1527 3300049779 Ga0501283_001444 Ga0501283_001444_1597_2094 165
1528 3300049779 Ga0501283_041360 Ga0501283_041360_46_543 165
1529 3300049779 Ga0501283_077483 Ga0501283_077483_33_530 165
1530 3300049824 Ga0501045_0351569 Ga0501045_0351569_137_682 165
1531 3300049849 Ga0501200_02225 Ga0501200_02225_173_670 165
1532 3300049851 Ga0501212_006264 Ga0501212_006264_901_1398 165
1533 3300049851 Ga0501212_061217 Ga0501212_061217_88_585 165
1534 3300049853 Ga0501226_006784 Ga0501226_006784_658_1155 165
1535 3300050507 nmdc:mga05p37_1012610_c1 nmdc:mga05p37_1012610_c1_105_602 165
1536 3300050507 nmdc:mga05p37_13138_c2 nmdc:mga05p37_13138_c2_2923_3420 165
1537 3300050507 nmdc:mga05p37_1558846_c1 nmdc:mga05p37_1558846_c1_132_629 165
1538 3300050507 nmdc:mga05p37_157730_c2 nmdc:mga05p37_157730_c2_640_1137 165
1539 3300050507 nmdc:mga05p37_166487_c1 nmdc:mga05p37_166487_c1_808_1305 165
1540 3300050507 nmdc:mga05p37_263938_c1 nmdc:mga05p37_263938_c1_325_822 165
1541 3300050507 nmdc:mga05p37_279144_c1 nmdc:mga05p37_279144_c1_1306_1803 165
1542 3300050507 nmdc:mga05p37_318323_c1 nmdc:mga05p37_318323_c1_179_706 165
1543 3300050507 nmdc:mga05p37_327283_c1 nmdc:mga05p37_327283_c1_34_531 165
1544 3300050507 nmdc:mga05p37_449186_c1 nmdc:mga05p37_449186_c1_434_931 165
1545 3300050507 nmdc:mga05p37_472071_c1 nmdc:mga05p37_472071_c1_793_1290 165
1546 3300050507 nmdc:mga05p37_589915_c1 nmdc:mga05p37_589915_c1_576_1073 165
1547 3300050507 nmdc:mga05p37_603664_c1 nmdc:mga05p37_603664_c1_461_958 165
1548 3300050507 nmdc:mga05p37_65876_c2 nmdc:mga05p37_65876_c2_2887_3384 165
1549 3300050507 nmdc:mga05p37_830784_c1 nmdc:mga05p37_830784_c1_272_769 165
1550 3300050508 nmdc:mga09592_122616_c1 nmdc:mga09592_122616_c1_1488_1985 165
1551 3300050508 nmdc:mga09592_223094_c1 nmdc:mga09592_223094_c1_150_647 165
1552 3300050508 nmdc:mga09592_556518_c1 nmdc:mga09592_556518_c1_347_844 165
1553 3300050508 nmdc:mga09592_98377_c1 nmdc:mga09592_98377_c1_384_881 165
1554 3300050509 nmdc:mga0qj67_184498_c1 nmdc:mga0qj67_184498_c1_446_943 165
1555 3300050509 nmdc:mga0qj67_316065_c1 nmdc:mga0qj67_316065_c1_72_569 165
1556 3300050509 nmdc:mga0qj67_54043_c1 nmdc:mga0qj67_54043_c1_322_819 165
1557 3300050510 nmdc:mga06r32_1277379_c1 nmdc:mga06r32_1277379_c1_158_655 165
1558 3300050510 nmdc:mga06r32_1539053_c1 nmdc:mga06r32_1539053_c1_32_529 165
1559 3300050510 nmdc:mga06r32_442342_c1 nmdc:mga06r32_442342_c1_604_1101 165
1560 3300050510 nmdc:mga06r32_580501_c1 nmdc:mga06r32_580501_c1_189_686 165
1561 3300050511 nmdc:mga08y16_161298_c1 nmdc:mga08y16_161298_c1_461_958 165
1562 3300050511 nmdc:mga08y16_181698_c1 nmdc:mga08y16_181698_c1_1384_1881 165
1563 3300050511 nmdc:mga08y16_181767_c1 nmdc:mga08y16_181767_c1_930_1427 165
1564 3300050511 nmdc:mga08y16_215192_c1 nmdc:mga08y16_215192_c1_390_887 165
1565 3300050511 nmdc:mga08y16_3544_c1 nmdc:mga08y16_3544_c1_6352_6849 165
1566 3300050511 nmdc:mga08y16_456406_c1 nmdc:mga08y16_456406_c1_793_1290 165
1567 3300050511 nmdc:mga08y16_734125_c1 nmdc:mga08y16_734125_c1_124_621 165
1568 3300050511 nmdc:mga08y16_933117_c1 nmdc:mga08y16_933117_c1_267_764 165
1569 3300050512 nmdc:mga0n895_111904_c1 nmdc:mga0n895_111904_c1_1812_2309 165
1570 3300050512 nmdc:mga0n895_145294_c1 nmdc:mga0n895_145294_c1_1786_2283 165
1571 3300050512 nmdc:mga0n895_246981_c1 nmdc:mga0n895_246981_c1_113_610 165
1572 3300050512 nmdc:mga0n895_258647_c1 nmdc:mga0n895_258647_c1_444_941 165
1573 3300050512 nmdc:mga0n895_316832_c1 nmdc:mga0n895_316832_c1_263_760 165
1574 3300050512 nmdc:mga0n895_388090_c1 nmdc:mga0n895_388090_c1_254_751 165
1575 3300050512 nmdc:mga0n895_409532_c1 nmdc:mga0n895_409532_c1_210_707 165
1576 3300050512 nmdc:mga0n895_4359_c1 nmdc:mga0n895_4359_c1_7852_8349 165
1577 3300050512 nmdc:mga0n895_734098_c1 nmdc:mga0n895_734098_c1_368_865 165
1578 3300050512 nmdc:mga0n895_939_c1 nmdc:mga0n895_939_c1_14768_15265 165
1579 3300050513 nmdc:mga0rr50_711_c1 nmdc:mga0rr50_711_c1_9111_9608 165
1580 3300050513 nmdc:mga0rr50_8332_c1 nmdc:mga0rr50_8332_c1_506_1003 165
1581 3300050513 nmdc:mga0rr50_9855_c1 nmdc:mga0rr50_9855_c1_3458_3955 165
1582 3300050514 nmdc:mga08x19_10917_c1 nmdc:mga08x19_10917_c1_4033_4530 165
1583 3300050514 nmdc:mga08x19_115629_c1 nmdc:mga08x19_115629_c1_966_1463 165
1584 3300050514 nmdc:mga08x19_13_c1 nmdc:mga08x19_13_c1_2225_2722 165
1585 3300050514 nmdc:mga08x19_5561_c2 nmdc:mga08x19_5561_c2_4083_4580 165
1586 3300050514 nmdc:mga08x19_87894_c1 nmdc:mga08x19_87894_c1_211_708 165
1587 3300050515 nmdc:mga0a205_175950_c1 nmdc:mga0a205_175950_c1_1490_1987 165
1588 3300050515 nmdc:mga0a205_178748_c1 nmdc:mga0a205_178748_c1_360_857 165
1589 3300050515 nmdc:mga0a205_18_c2 nmdc:mga0a205_18_c2_76104_76601 165
1590 3300050515 nmdc:mga0a205_20337_c1 nmdc:mga0a205_20337_c1_5528_6025 165
1591 3300050515 nmdc:mga0a205_214547_c1 nmdc:mga0a205_214547_c1_313_828 165
1592 3300050515 nmdc:mga0a205_22311_c1 nmdc:mga0a205_22311_c1_4650_5147 165
1593 3300050515 nmdc:mga0a205_23433_c1 nmdc:mga0a205_23433_c1_2590_3087 165
1594 3300050515 nmdc:mga0a205_326721_c1 nmdc:mga0a205_326721_c1_320_847 165
1595 3300050515 nmdc:mga0a205_432479_c1 nmdc:mga0a205_432479_c1_112_609 165
1596 3300050515 nmdc:mga0a205_49266_c1 nmdc:mga0a205_49266_c1_1811_2308 165
1597 3300050515 nmdc:mga0a205_615442_c1 nmdc:mga0a205_615442_c1_318_815 165
1598 3300050515 nmdc:mga0a205_641215_c1 nmdc:mga0a205_641215_c1_261_758 165
1599 3300050515 nmdc:mga0a205_649040_c1 nmdc:mga0a205_649040_c1_145_642 165
1600 3300050515 nmdc:mga0a205_991398_c1 nmdc:mga0a205_991398_c1_38_535 165
1601 3300053153 Ga0500616_0003139 Ga0500616_0003139_5223_5720 165
1602 3300054114 Ga0501084_0872196 Ga0501084_0872196_197_742 165
1603 3300061734 Ga0530510_0032439 Ga0530510_0032439_789_1286 165

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04461

DUF520

Protein of unknown function (DUF520)

5

165

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b7w-assembly2.cif.gz_B crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris 0.9062 5 163
5b7w-assembly2.cif.gz_B crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris 0.8904 5 163
1in0-assembly2.cif.gz_B yajq protein (hi1034) 0.8765 6 163
1in0-assembly2.cif.gz_B yajq protein (hi1034) 0.8521 6 163
6q2d-assembly1.cif.gz_F crystal structure of methanobrevibacter smithii dph2 in complex with methanobrevibacter smithii elongation factor 2 0.7318 106 163
ID Description Score Start End Superfamily
1in0B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9872 102 163 3.30.70.860
af_P9WFK9_11_96_3.30.70.990 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9144 12 96 3.30.70.990
5b7wB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9001 12 101 3.30.70.990
af_P9WFK9_11_96_3.30.70.990 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.8944 12 96 3.30.70.990
5b7wB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.8908 12 101 3.30.70.990
ID Description Score Start End GO Terms
AF-A0A537XNU2-F1-model_v4 DUF520 family protein 0.9982 102 163 GO:0000166
GO:0005829
AF-A0A1Z8TXT2-F1-model_v4 Uncharacterized protein 0.987 100 163 GO:0000166
GO:0005829
AF-A0A833PB27-F1-model_v4 Uncharacterized protein 0.983 100 163 GO:0000166
GO:0005829
AF-A0A2D5N4G0-F1-model_v4 deleted 0.9806 99 163
AF-A0A6N6XAK8-F1-model_v4 deleted 0.9788 102 163

Feature Viewer

pLDDT pTM Quality
91.73 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map