F495010

General Info

Members Datasets Scaffolds Average Seq Length
1604 357 1601 277

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10087600|Ga0157379_100876004
Length 324
Sequence MARAGLGRDARVNDVGPGNQHHGALPDKNPSSVTGFQDLGRIYKIFFSWLMMPVQTLAPKIEVRPSAPVETTGKAKVSVQDLNFFYAKVQALHNITIEIPERQVMAFIGPSGCGKSTFLRTLNRMNDVIPATRVEGRVLIDEHDIYEPGTDVVELRRRVGMVFQKSNPFPKSIFDNVAYGLRINKVTKSSSELAERVEQALEDAALWNEVKDRLKTSALSLSGGQQQRLCIARALAIRPEVLLMDEPASALDPIATSKIEELIFDLKERYTIVIVTHNMQQAARVSDKTAFFLLGKLIEVNSTEKMFTAPSEKLTEDYITGRFG

Samples

Sample ID Description Type Environment
1 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
132 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
194 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
200 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
201 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
216 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
217 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
218 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
219 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
220 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
221 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
226 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
230 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
231 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
232 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
233 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
234 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
235 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
236 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
237 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
238 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
239 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
240 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
241 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
242 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
243 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
248 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
249 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
250 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
253 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
254 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
255 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
256 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
257 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
258 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
259 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
260 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
261 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
262 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
263 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
264 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
265 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
280 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
281 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
282 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
283 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
284 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
298 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
299 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
300 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
301 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
305 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
306 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
307 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
308 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
309 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
310 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
311 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
312 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
313 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
314 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
315 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
316 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
317 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
318 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
319 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
320 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
321 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
322 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
323 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
324 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
325 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
326 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
327 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
328 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
329 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
330 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
331 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
332 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
333 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
334 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
335 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
336 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
337 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
338 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
339 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
340 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
341 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
342 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
343 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
344 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
345 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
346 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
347 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
348 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
349 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
350 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
351 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
352 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
353 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
354 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
355 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
356 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
357 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.94
Metatranscriptomes 0
Isolates 0.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2
Nodule 0
Rhizoplane 1.81
Rhizosphere 95.7
Stem 0
Stem Tuber 0
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1000016 3300000532 Bacteria 10639
2 JGI24748J21848_1000001 3300002074 Bacteria 444271
3 JGI24034J26672_10000001 3300002239 Bacteria 1118280
4 JGI24751J29686_10000006 3300002459 Bacteria 134556
5 JGI25406J46586_10001261 3300003203 Bacteria 11880
6 JGI25406J46586_10008161 3300003203 Bacteria 4755
7 JGI25406J46586_10025534 3300003203 Bacteria 2292
8 Ga0055536_1014410 3300003781 Bacteria 2779
9 Ga0065714_10064454 3300005288 Bacteria 72991
10 Ga0065704_10003491 3300005289 Bacteria 5045
11 Ga0065712_10000129 3300005290 Bacteria 72972
12 Ga0065712_10010777 3300005290 Bacteria 2388
13 Ga0065712_10033042 3300005290 Bacteria 1000
14 Ga0065712_10068324 3300005290 Bacteria 11713
15 Ga0065712_10080251 3300005290 Bacteria 3127
16 Ga0065712_10089999 3300005290 Bacteria 2442
17 Ga0065712_10096094 3300005290 Bacteria 2179
18 Ga0065712_10130394 3300005290 Bacteria 1553
19 Ga0065715_10004182 3300005293 Bacteria 6184
20 Ga0065715_10009486 3300005293 Bacteria 3836
21 Ga0065715_10011827 3300005293 Bacteria 3601
22 Ga0065715_10030115 3300005293 Bacteria 1258
23 Ga0065715_10036827 3300005293 Bacteria 1111
24 Ga0065715_10092488 3300005293 Bacteria 5093
25 Ga0065715_10095993 3300005293 Bacteria 3960
26 Ga0065715_10096536 3300005293 Bacteria 3859
27 Ga0065715_10096915 3300005293 Bacteria 3795
28 Ga0065715_10097051 3300005293 Bacteria 3772
29 Ga0065715_10097145 3300005293 Bacteria 3755
30 Ga0065715_10126373 3300005293 Bacteria 2110
31 Ga0065715_10132364 3300005293 Bacteria 1991
32 Ga0065715_10136337 3300005293 Bacteria 1883
33 Ga0065715_10137126 3300005293 Bacteria 1912
34 Ga0065715_10144409 3300005293 Bacteria 1808
35 Ga0065715_10156255 3300005293 Bacteria 1652
36 Ga0065715_10211688 3300005293 Bacteria 1311
37 Ga0065707_10001718 3300005295 Bacteria 6083
38 Ga0065707_10003596 3300005295 Bacteria 4536
39 Ga0065707_10004325 3300005295 Bacteria 3825
40 Ga0065707_10090275 3300005295 Bacteria 4175
41 Ga0065707_10109967 3300005295 Bacteria 2449
42 Ga0065707_10112866 3300005295 Bacteria 2313
43 Ga0065707_10139719 3300005295 Bacteria 1789
44 Ga0065707_10149947 3300005295 Bacteria 1646
45 Ga0065707_10217902 3300005295 Bacteria 1237
46 Ga0065707_10231281 3300005295 Bacteria 1188
47 Ga0065707_10234035 3300005295 Bacteria 1178
48 Ga0070658_10144941 3300005327 Bacteria 1985
49 Ga0070676_10272225 3300005328 Bacteria 1138
50 Ga0070683_100058248 3300005329 Bacteria 3589
51 Ga0070683_100182374 3300005329 Bacteria 1993
52 Ga0070683_100312240 3300005329 Bacteria 1496
53 Ga0070690_100002585 3300005330 Bacteria 9747
54 Ga0070690_100009186 3300005330 Bacteria 5722
55 Ga0070690_100028398 3300005330 Bacteria 3465
56 Ga0070690_100073706 3300005330 Bacteria 2222
57 Ga0070690_100079694 3300005330 Bacteria 2141
58 Ga0070690_100104304 3300005330 Bacteria 1883
59 Ga0070690_100107500 3300005330 Bacteria 1857
60 Ga0070690_100218525 3300005330 Bacteria 1334
61 Ga0070690_100312464 3300005330 Bacteria 1130
62 Ga0070670_100001636 3300005331 Bacteria 18122
63 Ga0070670_100004308 3300005331 Bacteria 11908
64 Ga0070670_100011871 3300005331 Bacteria 7449
65 Ga0070670_100022339 3300005331 Bacteria 5446
66 Ga0070670_100042947 3300005331 Bacteria 3887
67 Ga0070670_100092342 3300005331 Bacteria 2603
68 Ga0070670_100137400 3300005331 Bacteria 2112
69 Ga0070670_100188009 3300005331 Bacteria 1793
70 Ga0068869_100003292 3300005334 Bacteria 9862
71 Ga0068869_100006292 3300005334 Bacteria 7516
72 Ga0068869_100013861 3300005334 Bacteria 5374
73 Ga0068869_100036396 3300005334 Bacteria 3494
74 Ga0068869_100049286 3300005334 Bacteria 3048
75 Ga0068869_100063548 3300005334 Bacteria 2713
76 Ga0068869_100089436 3300005334 Bacteria 2313
77 Ga0068869_100188572 3300005334 Bacteria 1620
78 Ga0070666_10017358 3300005335 Bacteria 4614
79 Ga0070666_10028650 3300005335 Bacteria 3655
80 Ga0070666_10104196 3300005335 Bacteria 1958
81 Ga0070666_10111455 3300005335 Bacteria 1892
82 Ga0070666_10141439 3300005335 Bacteria 1676
83 Ga0070680_100008580 3300005336 Bacteria 7830
84 Ga0070680_100010318 3300005336 Bacteria 7202
85 Ga0070680_100166776 3300005336 Bacteria 1852
86 Ga0070680_100259800 3300005336 Bacteria 1469
87 Ga0070682_100000253 3300005337 Bacteria 38717
88 Ga0070682_100077459 3300005337 Bacteria 2142
89 Ga0068868_100007979 3300005338 Bacteria 7564
90 Ga0068868_100022079 3300005338 Bacteria 4799
91 Ga0068868_100026576 3300005338 Bacteria 4413
92 Ga0068868_100230220 3300005338 Bacteria 1555
93 Ga0068868_100387104 3300005338 Bacteria 1204
94 Ga0070660_100243944 3300005339 Bacteria 1464
95 Ga0070689_100004613 3300005340 Bacteria 9337
96 Ga0070689_100011796 3300005340 Bacteria 6270
97 Ga0070689_100039966 3300005340 Bacteria 3594
98 Ga0070689_100041858 3300005340 Bacteria 3516
99 Ga0070689_100145231 3300005340 Bacteria 1910
100 Ga0070689_100182134 3300005340 Bacteria 1707
101 Ga0070689_100525104 3300005340 Bacteria 1017
102 Ga0070687_100000609 3300005343 Bacteria 11879
103 Ga0070687_100016555 3300005343 Bacteria 3366
104 Ga0070687_100016663 3300005343 Bacteria 3359
105 Ga0070687_100024449 3300005343 Bacteria 2884
106 Ga0070687_100072239 3300005343 Bacteria 1856
107 Ga0070687_100072424 3300005343 Bacteria 1854
108 Ga0070661_100005522 3300005344 Bacteria 8714
109 Ga0070661_100112565 3300005344 Bacteria 2033
110 Ga0070661_100192596 3300005344 Bacteria 1555
111 Ga0070692_10018539 3300005345 Bacteria 3349
112 Ga0070692_10041591 3300005345 Bacteria 2355
113 Ga0070692_10074320 3300005345 Bacteria 1818
114 Ga0070692_10166493 3300005345 Bacteria 1267
115 Ga0070692_10186495 3300005345 Bacteria 1206
116 Ga0070692_10252860 3300005345 Bacteria 1056
117 Ga0070692_10355656 3300005345 Bacteria 911
118 Ga0070668_100002227 3300005347 Bacteria 14250
119 Ga0070669_100004306 3300005353 Bacteria 10289
120 Ga0070669_100006019 3300005353 Bacteria 8749
121 Ga0070669_100044834 3300005353 Bacteria 3222
122 Ga0070669_100067350 3300005353 Bacteria 2641
123 Ga0070669_100070748 3300005353 Bacteria 2580
124 Ga0070669_100127714 3300005353 Bacteria 1947
125 Ga0070669_100172893 3300005353 Bacteria 1685
126 Ga0070675_100000141 3300005354 Bacteria 43075
127 Ga0070675_100001264 3300005354 Bacteria 18485
128 Ga0070675_100006676 3300005354 Bacteria 8869
129 Ga0070675_100028453 3300005354 Bacteria 4498
130 Ga0070675_100079490 3300005354 Bacteria 2733
131 Ga0070675_100114140 3300005354 Bacteria 2289
132 Ga0070675_100122018 3300005354 Bacteria 2214
133 Ga0070675_100132893 3300005354 Bacteria 2122
134 Ga0070671_100005634 3300005355 Bacteria 9966
135 Ga0070671_100014706 3300005355 Bacteria 6324
136 Ga0070671_100038308 3300005355 Bacteria 3979
137 Ga0070671_100169845 3300005355 Bacteria 1844
138 Ga0070671_100378231 3300005355 Bacteria 1210
139 Ga0070674_100007461 3300005356 Bacteria 6451
140 Ga0070674_100018632 3300005356 Bacteria 4394
141 Ga0070674_100034079 3300005356 Bacteria 3397
142 Ga0070674_100067989 3300005356 Bacteria 2508
143 Ga0070674_100101347 3300005356 Bacteria 2099
144 Ga0070674_100301113 3300005356 Bacteria 1278
145 Ga0070673_100008472 3300005364 Bacteria 6836
146 Ga0070673_100012172 3300005364 Bacteria 5897
147 Ga0070673_100016636 3300005364 Bacteria 5207
148 Ga0070673_100029004 3300005364 Bacteria 4122
149 Ga0070673_100038421 3300005364 Bacteria 3655
150 Ga0070673_100039432 3300005364 Bacteria 3615
151 Ga0070673_100156919 3300005364 Bacteria 1932
152 Ga0070673_100176242 3300005364 Bacteria 1828
153 Ga0070673_100201966 3300005364 Bacteria 1712
154 Ga0070673_100266504 3300005364 Bacteria 1498
155 Ga0070673_100278028 3300005364 Bacteria 1467
156 Ga0070673_100513960 3300005364 Bacteria 1085
157 Ga0070688_100015724 3300005365 Bacteria 4312
158 Ga0070688_100021608 3300005365 Bacteria 3761
159 Ga0070688_100078839 3300005365 Bacteria 2126
160 Ga0070688_100175414 3300005365 Bacteria 1483
161 Ga0070688_100203014 3300005365 Bacteria 1388
162 Ga0070688_100297267 3300005365 Bacteria 1166
163 Ga0070659_100002910 3300005366 Bacteria 12198
164 Ga0070659_100476075 3300005366 Bacteria 1062
165 Ga0070667_100113212 3300005367 Bacteria 2354
166 Ga0070667_100116276 3300005367 Bacteria 2323
167 Ga0070667_100130743 3300005367 Bacteria 2191
168 Ga0070667_100390968 3300005367 Bacteria 1265
169 Ga0070703_10001162 3300005406 Bacteria 8118
170 Ga0070703_10001430 3300005406 Bacteria 7194
171 Ga0070703_10032550 3300005406 Bacteria 1584
172 Ga0070709_10037070 3300005434 Bacteria 2975
173 Ga0070701_10019960 3300005438 Bacteria 3173
174 Ga0070701_10057955 3300005438 Bacteria 2031
175 Ga0070701_10095807 3300005438 Bacteria 1635
176 Ga0070701_10142326 3300005438 Bacteria 1373
177 Ga0070705_100000051 3300005440 Bacteria 61251
178 Ga0070705_100000633 3300005440 Bacteria 20228
179 Ga0070705_100074618 3300005440 Bacteria 2063
180 Ga0070705_100329919 3300005440 Bacteria 1105
181 Ga0070700_100000183 3300005441 Bacteria 35579
182 Ga0070700_100001066 3300005441 Bacteria 13595
183 Ga0070700_100003819 3300005441 Bacteria 7805
184 Ga0070700_100011785 3300005441 Bacteria 4853
185 Ga0070700_100034619 3300005441 Bacteria 3052
186 Ga0070700_100043469 3300005441 Bacteria 2764
187 Ga0070700_100086806 3300005441 Bacteria 2032
188 Ga0070700_100194440 3300005441 Bacteria 1421
189 Ga0070700_100232871 3300005441 Bacteria 1312
190 Ga0070700_100299160 3300005441 Bacteria 1174
191 Ga0070694_100002021 3300005444 Bacteria 12040
192 Ga0070694_100002448 3300005444 Bacteria 10962
193 Ga0070694_100017738 3300005444 Bacteria 4500
194 Ga0070694_100029136 3300005444 Bacteria 3600
195 Ga0070694_100032673 3300005444 Bacteria 3418
196 Ga0070694_100075487 3300005444 Bacteria 2332
197 Ga0070694_100079314 3300005444 Bacteria 2279
198 Ga0070694_100079887 3300005444 Bacteria 2271
199 Ga0070694_100082009 3300005444 Bacteria 2245
200 Ga0070694_100111746 3300005444 Bacteria 1947
201 Ga0070694_100154760 3300005444 Bacteria 1677
202 Ga0070694_100167957 3300005444 Bacteria 1614
203 Ga0070694_100281649 3300005444 Bacteria 1268
204 Ga0070694_100346537 3300005444 Bacteria 1150
205 Ga0070694_100376765 3300005444 Bacteria 1106
206 Ga0070708_100039904 3300005445 Bacteria 4110
207 Ga0070708_100042407 3300005445 Bacteria 3994
208 Ga0070708_100110782 3300005445 Bacteria 2523
209 Ga0070708_100116265 3300005445 Bacteria 2463
210 Ga0070708_100122212 3300005445 Bacteria 2403
211 Ga0070708_100406911 3300005445 Bacteria 1283
212 Ga0070708_100454274 3300005445 Bacteria 1209
213 Ga0070678_100012839 3300005456 Bacteria 5226
214 Ga0070678_100076008 3300005456 Bacteria 2528
215 Ga0070678_100100704 3300005456 Bacteria 2238
216 Ga0070678_100106503 3300005456 Bacteria 2185
217 Ga0070678_100205901 3300005456 Bacteria 1627
218 Ga0070678_100228295 3300005456 Bacteria 1551
219 Ga0070678_100248199 3300005456 Bacteria 1491
220 Ga0070662_100017717 3300005457 Bacteria 4805
221 Ga0070662_100037449 3300005457 Bacteria 3439
222 Ga0070662_100115676 3300005457 Bacteria 2049
223 Ga0070662_100131772 3300005457 Bacteria 1928
224 Ga0070662_100181044 3300005457 Bacteria 1661
225 Ga0070681_10002251 3300005458 Bacteria 17609
226 Ga0070681_10016366 3300005458 Bacteria 7402
227 Ga0070681_10022564 3300005458 Bacteria 6321
228 Ga0070681_10134852 3300005458 Bacteria 2400
229 Ga0068867_100001877 3300005459 Bacteria 14605
230 Ga0068867_100005057 3300005459 Bacteria 9309
231 Ga0068867_100013310 3300005459 Bacteria 5828
232 Ga0068867_100022319 3300005459 Bacteria 4525
233 Ga0068867_100107227 3300005459 Bacteria 2141
234 Ga0068867_100204305 3300005459 Bacteria 1583
235 Ga0068867_100352428 3300005459 Bacteria 1229
236 Ga0070706_100000044 3300005467 Bacteria 146303
237 Ga0070706_100001113 3300005467 Bacteria 29083
238 Ga0070706_100009673 3300005467 Bacteria 8961
239 Ga0070706_100019128 3300005467 Bacteria 6319
240 Ga0070706_100057275 3300005467 Bacteria 3596
241 Ga0070706_100097781 3300005467 Bacteria 2727
242 Ga0070706_100111661 3300005467 Bacteria 2544
243 Ga0070706_100249513 3300005467 Bacteria 1657
244 Ga0070706_100293716 3300005467 Bacteria 1516
245 Ga0070706_100358386 3300005467 Bacteria 1359
246 Ga0070706_100412303 3300005467 Bacteria 1258
247 Ga0070706_100653522 3300005467 Bacteria 976
248 Ga0070707_100000081 3300005468 Bacteria 85320
249 Ga0070707_100013569 3300005468 Bacteria 7626
250 Ga0070707_100318068 3300005468 Bacteria 1512
251 Ga0070707_100494571 3300005468 Bacteria 1185
252 Ga0070698_100003580 3300005471 Bacteria 17066
253 Ga0070698_100004987 3300005471 Bacteria 14548
254 Ga0070698_100005833 3300005471 Bacteria 13467
255 Ga0070698_100010135 3300005471 Bacteria 10067
256 Ga0070698_100027680 3300005471 Bacteria 5893
257 Ga0070698_100034824 3300005471 Bacteria 5209
258 Ga0070698_100037375 3300005471 Bacteria 5007
259 Ga0070698_100058436 3300005471 Bacteria 3899
260 Ga0070698_100187558 3300005471 Bacteria 2006
261 Ga0070698_100228575 3300005471 Bacteria 1794
262 Ga0070698_100273366 3300005471 Bacteria 1621
263 Ga0070698_100394595 3300005471 Bacteria 1317
264 Ga0070698_100397165 3300005471 Bacteria 1312
265 Ga0070698_100469167 3300005471 Bacteria 1195
266 Ga0070699_100000856 3300005518 Bacteria 28295
267 Ga0070699_100003161 3300005518 Bacteria 14577
268 Ga0070699_100005758 3300005518 Bacteria 10843
269 Ga0070699_100013377 3300005518 Bacteria 7072
270 Ga0070699_100016326 3300005518 Bacteria 6376
271 Ga0070699_100044718 3300005518 Bacteria 3833
272 Ga0070699_100097715 3300005518 Bacteria 2572
273 Ga0070699_100178947 3300005518 Bacteria 1881
274 Ga0070699_100301931 3300005518 Bacteria 1436
275 Ga0070699_100327703 3300005518 Bacteria 1377
276 Ga0070679_100002201 3300005530 Bacteria 17609
277 Ga0070679_100387491 3300005530 Bacteria 1344
278 Ga0070684_100005890 3300005535 Bacteria 9438
279 Ga0070697_100000466 3300005536 Bacteria 30951
280 Ga0070697_100000619 3300005536 Bacteria 27010
281 Ga0070697_100006741 3300005536 Bacteria 8907
282 Ga0070697_100191773 3300005536 Bacteria 1735
283 Ga0070697_100210880 3300005536 Bacteria 1654
284 Ga0070697_100274614 3300005536 Bacteria 1445
285 Ga0070697_100307745 3300005536 Bacteria 1363
286 Ga0070697_100373534 3300005536 Bacteria 1234
287 Ga0070697_100526869 3300005536 Bacteria 1035
288 Ga0068853_100228410 3300005539 Bacteria 1702
289 Ga0068853_100255020 3300005539 Bacteria 1611
290 Ga0070672_100016168 3300005543 Bacteria 5337
291 Ga0070672_100018785 3300005543 Bacteria 5006
292 Ga0070672_100065971 3300005543 Bacteria 2864
293 Ga0070672_100092743 3300005543 Bacteria 2439
294 Ga0070672_100098503 3300005543 Bacteria 2368
295 Ga0070672_100116219 3300005543 Bacteria 2185
296 Ga0070672_100200827 3300005543 Bacteria 1667
297 Ga0070672_100636089 3300005543 Bacteria 931
298 Ga0070686_100005143 3300005544 Bacteria 7220
299 Ga0070686_100010067 3300005544 Bacteria 5321
300 Ga0070686_100034397 3300005544 Bacteria 3123
301 Ga0070686_100095918 3300005544 Bacteria 1993
302 Ga0070686_100139598 3300005544 Bacteria 1685
303 Ga0070695_100000114 3300005545 Bacteria 35920
304 Ga0070695_100027184 3300005545 Bacteria 3543
305 Ga0070695_100044381 3300005545 Bacteria 2830
306 Ga0070695_100046227 3300005545 Bacteria 2777
307 Ga0070695_100062571 3300005545 Bacteria 2417
308 Ga0070695_100094494 3300005545 Bacteria 2002
309 Ga0070695_100135407 3300005545 Bacteria 1702
310 Ga0070695_100160061 3300005545 Bacteria 1579
311 Ga0070695_100441709 3300005545 Bacteria 995
312 Ga0070696_100000875 3300005546 Bacteria 19482
313 Ga0070696_100003223 3300005546 Bacteria 10868
314 Ga0070696_100004873 3300005546 Bacteria 8968
315 Ga0070696_100018393 3300005546 Bacteria 4721
316 Ga0070696_100026451 3300005546 Bacteria 3947
317 Ga0070696_100061516 3300005546 Bacteria 2627
318 Ga0070696_100077055 3300005546 Bacteria 2355
319 Ga0070696_100080794 3300005546 Bacteria 2302
320 Ga0070696_100207418 3300005546 Bacteria 1465
321 Ga0070696_100321060 3300005546 Bacteria 1192
322 Ga0070696_100369235 3300005546 Bacteria 1115
323 Ga0070693_100057168 3300005547 Bacteria 2254
324 Ga0070693_100098871 3300005547 Bacteria 1774
325 Ga0070693_100131728 3300005547 Bacteria 1564
326 Ga0070693_100284535 3300005547 Bacteria 1109
327 Ga0070665_100030321 3300005548 Bacteria 5443
328 Ga0070665_100170715 3300005548 Bacteria 2176
329 Ga0070704_100000657 3300005549 Bacteria 16672
330 Ga0070704_100051077 3300005549 Bacteria 2910
331 Ga0070704_100073974 3300005549 Bacteria 2484
332 Ga0070704_100098317 3300005549 Bacteria 2199
333 Ga0070704_100129461 3300005549 Bacteria 1953
334 Ga0070704_100168755 3300005549 Bacteria 1738
335 Ga0070704_100278990 3300005549 Bacteria 1383
336 Ga0070704_100418075 3300005549 Bacteria 1148
337 Ga0068855_100466595 3300005563 Bacteria 1376
338 Ga0070664_100004142 3300005564 Bacteria 11650
339 Ga0070664_100004288 3300005564 Bacteria 11473
340 Ga0070664_100004582 3300005564 Bacteria 11094
341 Ga0070664_100007577 3300005564 Bacteria 8764
342 Ga0070664_100069672 3300005564 Bacteria 3010
343 Ga0070664_100164285 3300005564 Bacteria 1966
344 Ga0070664_100274536 3300005564 Bacteria 1519
345 Ga0070664_100443707 3300005564 Bacteria 1191
346 Ga0068857_100002169 3300005577 Bacteria 15952
347 Ga0068857_100025554 3300005577 Bacteria 5200
348 Ga0068857_100058757 3300005577 Bacteria 3416
349 Ga0068857_100094535 3300005577 Bacteria 2677
350 Ga0068857_100723369 3300005577 Bacteria 947
351 Ga0068854_100051857 3300005578 Bacteria 2941
352 Ga0068854_100124346 3300005578 Bacteria 1963
353 Ga0068854_100223684 3300005578 Bacteria 1490
354 Ga0068854_100497883 3300005578 Bacteria 1026
355 Ga0068856_100071378 3300005614 Bacteria 3437
356 Ga0070702_100001793 3300005615 Bacteria 8919
357 Ga0070702_100005407 3300005615 Bacteria 5943
358 Ga0070702_100053878 3300005615 Bacteria 2312
359 Ga0070702_100071732 3300005615 Bacteria 2048
360 Ga0070702_100113111 3300005615 Bacteria 1687
361 Ga0070702_100120139 3300005615 Bacteria 1644
362 Ga0068852_100189256 3300005616 Bacteria 1941
363 Ga0068859_100001192 3300005617 Bacteria 26539
364 Ga0068859_100001429 3300005617 Bacteria 24213
365 Ga0068859_100012299 3300005617 Bacteria 8611
366 Ga0068859_100013911 3300005617 Bacteria 8072
367 Ga0068859_100016492 3300005617 Bacteria 7418
368 Ga0068859_100021872 3300005617 Bacteria 6414
369 Ga0068859_100026107 3300005617 Bacteria 5860
370 Ga0068859_100038260 3300005617 Bacteria 4813
371 Ga0068859_100049457 3300005617 Bacteria 4221
372 Ga0068859_100072181 3300005617 Bacteria 3488
373 Ga0068859_100095547 3300005617 Bacteria 3024
374 Ga0068859_100117143 3300005617 Bacteria 2729
375 Ga0068859_100120605 3300005617 Bacteria 2689
376 Ga0068859_100137105 3300005617 Bacteria 2520
377 Ga0068859_100182703 3300005617 Bacteria 2180
378 Ga0068859_100359165 3300005617 Bacteria 1552
379 Ga0068859_100359634 3300005617 Bacteria 1551
380 Ga0068859_100565677 3300005617 Bacteria 1231
381 Ga0068859_100607269 3300005617 Bacteria 1187
382 Ga0068864_100072718 3300005618 Bacteria 2997
383 Ga0068864_100091528 3300005618 Bacteria 2683
384 Ga0068864_100117221 3300005618 Bacteria 2377
385 Ga0068864_100138000 3300005618 Bacteria 2197
386 Ga0068864_100142785 3300005618 Bacteria 2161
387 Ga0068864_100150999 3300005618 Bacteria 2104
388 Ga0068864_100199170 3300005618 Bacteria 1839
389 Ga0068864_100240907 3300005618 Bacteria 1676
390 Ga0068864_100429737 3300005618 Bacteria 1260
391 Ga0068866_10005443 3300005718 Bacteria 5253
392 Ga0068866_10020249 3300005718 Bacteria 3046
393 Ga0068866_10117830 3300005718 Bacteria 1492
394 Ga0068866_10204119 3300005718 Bacteria 1183
395 Ga0068861_100000953 3300005719 Bacteria 17595
396 Ga0068861_100014770 3300005719 Bacteria 5487
397 Ga0068861_100024976 3300005719 Bacteria 4327
398 Ga0068861_100053326 3300005719 Bacteria 3076
399 Ga0068861_100062240 3300005719 Bacteria 2866
400 Ga0068861_100065430 3300005719 Bacteria 2800
401 Ga0068861_100081423 3300005719 Bacteria 2535
402 Ga0068861_100175687 3300005719 Bacteria 1778
403 Ga0068861_100232092 3300005719 Bacteria 1565
404 Ga0068861_100243823 3300005719 Bacteria 1530
405 Ga0068861_100454792 3300005719 Bacteria 1148
406 Ga0068861_100775151 3300005719 Bacteria 898
407 Ga0068851_10000522 3300005834 Bacteria 16803
408 Ga0068851_10009745 3300005834 Bacteria 4474
409 Ga0068851_10151217 3300005834 Bacteria 1269
410 Ga0068870_10000669 3300005840 Bacteria 13042
411 Ga0068870_10001537 3300005840 Bacteria 9367
412 Ga0068870_10023312 3300005840 Bacteria 3051
413 Ga0068870_10047307 3300005840 Bacteria 2261
414 Ga0068870_10053081 3300005840 Bacteria 2151
415 Ga0068863_100022685 3300005841 Bacteria 5995
416 Ga0068863_100141853 3300005841 Bacteria 2297
417 Ga0068863_100263275 3300005841 Bacteria 1667
418 Ga0068863_100278254 3300005841 Bacteria 1621
419 Ga0068858_100000051 3300005842 Bacteria 120692
420 Ga0068858_100010751 3300005842 Bacteria 8654
421 Ga0068858_100014841 3300005842 Bacteria 7329
422 Ga0068858_100021997 3300005842 Bacteria 5955
423 Ga0068858_100057635 3300005842 Bacteria 3590
424 Ga0068858_100079189 3300005842 Bacteria 3053
425 Ga0068858_100082117 3300005842 Bacteria 2995
426 Ga0068858_100143718 3300005842 Bacteria 2240
427 Ga0068858_100323322 3300005842 Bacteria 1475
428 Ga0068858_100389880 3300005842 Bacteria 1337
429 Ga0068860_100007382 3300005843 Bacteria 10992
430 Ga0068860_100021864 3300005843 Bacteria 6189
431 Ga0068860_100068217 3300005843 Bacteria 3379
432 Ga0068860_100117261 3300005843 Bacteria 2547
433 Ga0068860_100299556 3300005843 Bacteria 1575
434 Ga0068860_100370336 3300005843 Bacteria 1413
435 Ga0068860_100420697 3300005843 Bacteria 1324
436 Ga0068860_100436946 3300005843 Bacteria 1299
437 Ga0068860_100825165 3300005843 Bacteria 941
438 Ga0068862_100000751 3300005844 Bacteria 32494
439 Ga0068862_100011099 3300005844 Bacteria 7440
440 Ga0068862_100017802 3300005844 Bacteria 5915
441 Ga0068862_100019561 3300005844 Bacteria 5653
442 Ga0068862_100029639 3300005844 Bacteria 4611
443 Ga0068862_100036371 3300005844 Bacteria 4174
444 Ga0068862_100052208 3300005844 Bacteria 3497
445 Ga0068862_100070111 3300005844 Bacteria 3026
446 Ga0068862_100108386 3300005844 Bacteria 2436
447 Ga0068862_100187541 3300005844 Bacteria 1859
448 Ga0068862_100225882 3300005844 Bacteria 1697
449 Ga0068862_100256023 3300005844 Bacteria 1596
450 Ga0081455_10118850 3300005937 Bacteria 2086
451 Ga0081539_10000033 3300005985 Bacteria 309306
452 Ga0081539_10000112 3300005985 Bacteria 190218
453 Ga0081539_10000351 3300005985 Bacteria 101228
454 Ga0081539_10001228 3300005985 Bacteria 45804
455 Ga0081539_10001299 3300005985 Bacteria 43815
456 Ga0081539_10001310 3300005985 Bacteria 43539
457 Ga0081539_10004329 3300005985 Bacteria 15834
458 Ga0081539_10008561 3300005985 Bacteria 8853
459 Ga0081539_10045948 3300005985 Bacteria 2506
460 Ga0081539_10050409 3300005985 Bacteria 2356
461 Ga0075368_10010861 3300006042 Bacteria 3301
462 Ga0075363_100212939 3300006048 Bacteria 1106
463 Ga0075364_10031542 3300006051 Bacteria 3405
464 Ga0075432_10068987 3300006058 Bacteria 1268
465 Ga0070715_10000006 3300006163 Bacteria 216296
466 Ga0070716_100000013 3300006173 Bacteria 100600
467 Ga0070716_100026086 3300006173 Bacteria 3126
468 Ga0070716_100078326 3300006173 Bacteria 1965
469 Ga0075367_10013792 3300006178 Bacteria 4358
470 Ga0075367_10085085 3300006178 Bacteria 1919
471 Ga0075366_10016822 3300006195 Bacteria 4203
472 Ga0075366_10067559 3300006195 Bacteria 2127
473 Ga0097621_100011165 3300006237 Bacteria 6611
474 Ga0097621_100078334 3300006237 Bacteria 2746
475 Ga0097621_100416960 3300006237 Bacteria 1204
476 Ga0075370_10002965 3300006353 Bacteria 7977
477 Ga0075370_10107821 3300006353 Bacteria 1616
478 Ga0068871_100004556 3300006358 Bacteria 9665
479 Ga0068871_100026202 3300006358 Bacteria 4547
480 Ga0068871_100081859 3300006358 Bacteria 2676
481 Ga0068871_100095903 3300006358 Bacteria 2477
482 Ga0075428_100000008 3300006844 Bacteria 271300
483 Ga0075428_100000892 3300006844 Bacteria 31443
484 Ga0075428_100005810 3300006844 Bacteria 13705
485 Ga0075428_100006735 3300006844 Bacteria 12779
486 Ga0075428_100007083 3300006844 Bacteria 12423
487 Ga0075428_100011956 3300006844 Bacteria 9657
488 Ga0075428_100024211 3300006844 Bacteria 6717
489 Ga0075428_100032916 3300006844 Bacteria 5724
490 Ga0075428_100239818 3300006844 Bacteria 1956
491 Ga0075428_100349553 3300006844 Bacteria 1587
492 Ga0075428_100364437 3300006844 Bacteria 1550
493 Ga0075428_100584973 3300006844 Bacteria 1193
494 Ga0075428_100609628 3300006844 Bacteria 1166
495 Ga0075428_100731347 3300006844 Bacteria 1053
496 Ga0075430_100005511 3300006846 Bacteria 10694
497 Ga0075430_100008529 3300006846 Bacteria 8656
498 Ga0075430_100010337 3300006846 Bacteria 7903
499 Ga0075430_100015854 3300006846 Bacteria 6418
500 Ga0075430_100016137 3300006846 Bacteria 6361
501 Ga0075430_100022496 3300006846 Bacteria 5365
502 Ga0075430_100027343 3300006846 Bacteria 4847
503 Ga0075430_100037733 3300006846 Bacteria 4095
504 Ga0075430_100080071 3300006846 Bacteria 2736
505 Ga0075430_100103545 3300006846 Bacteria 2376
506 Ga0075430_100117498 3300006846 Bacteria 2217
507 Ga0075430_100135828 3300006846 Bacteria 2049
508 Ga0075430_100227222 3300006846 Bacteria 1548
509 Ga0075430_100291515 3300006846 Bacteria 1350
510 Ga0075430_100421977 3300006846 Bacteria 1101
511 Ga0075430_100435738 3300006846 Bacteria 1082
512 Ga0075431_100005006 3300006847 Bacteria 13032
513 Ga0075431_100005877 3300006847 Bacteria 12148
514 Ga0075431_100009964 3300006847 Bacteria 9545
515 Ga0075431_100013476 3300006847 Bacteria 8256
516 Ga0075431_100028899 3300006847 Bacteria 5701
517 Ga0075431_100030809 3300006847 Bacteria 5525
518 Ga0075431_100044463 3300006847 Bacteria 4581
519 Ga0075431_100046654 3300006847 Bacteria 4468
520 Ga0075431_100049867 3300006847 Bacteria 4316
521 Ga0075431_100060504 3300006847 Bacteria 3908
522 Ga0075431_100060897 3300006847 Bacteria 3895
523 Ga0075431_100098071 3300006847 Bacteria 3026
524 Ga0075431_100104535 3300006847 Bacteria 2922
525 Ga0075431_100696073 3300006847 Bacteria 994
526 Ga0075431_100829290 3300006847 Bacteria 897
527 Ga0075433_10005987 3300006852 Bacteria 9581
528 Ga0075433_10006901 3300006852 Bacteria 8999
529 Ga0075433_10008988 3300006852 Bacteria 7979
530 Ga0075433_10014278 3300006852 Bacteria 6487
531 Ga0075433_10066473 3300006852 Bacteria 3164
532 Ga0075433_10074924 3300006852 Bacteria 2978
533 Ga0075433_10077386 3300006852 Bacteria 2930
534 Ga0075433_10085982 3300006852 Bacteria 2777
535 Ga0075433_10139845 3300006852 Bacteria 2152
536 Ga0075433_10172052 3300006852 Bacteria 1927
537 Ga0075433_10284866 3300006852 Bacteria 1464
538 Ga0075433_10362231 3300006852 Bacteria 1281
539 Ga0075434_100000616 3300006871 Bacteria 27507
540 Ga0075434_100001025 3300006871 Bacteria 22733
541 Ga0075434_100002357 3300006871 Bacteria 16547
542 Ga0075434_100003234 3300006871 Bacteria 14541
543 Ga0075434_100015423 3300006871 Bacteria 7325
544 Ga0075434_100027139 3300006871 Bacteria 5620
545 Ga0075434_100039197 3300006871 Bacteria 4695
546 Ga0075434_100040045 3300006871 Bacteria 4641
547 Ga0075434_100040547 3300006871 Bacteria 4611
548 Ga0075434_100051729 3300006871 Bacteria 4082
549 Ga0075434_100064033 3300006871 Bacteria 3660
550 Ga0075434_100065669 3300006871 Bacteria 3614
551 Ga0075434_100217415 3300006871 Bacteria 1931
552 Ga0075434_100298591 3300006871 Bacteria 1631
553 Ga0075434_100429321 3300006871 Bacteria 1342
554 Ga0075434_100540127 3300006871 Bacteria 1186
555 Ga0075434_100640000 3300006871 Bacteria 1082
556 Ga0075429_100053859 3300006880 Bacteria 3500
557 Ga0075429_100061303 3300006880 Bacteria 3277
558 Ga0075429_100079654 3300006880 Bacteria 2855
559 Ga0075429_100092883 3300006880 Bacteria 2631
560 Ga0075429_100184122 3300006880 Bacteria 1830
561 Ga0075429_100250925 3300006880 Bacteria 1550
562 Ga0075429_100324592 3300006880 Bacteria 1347
563 Ga0075429_100355789 3300006880 Bacteria 1282
564 Ga0068865_100005604 3300006881 Bacteria 7619
565 Ga0068865_100009470 3300006881 Bacteria 6043
566 Ga0068865_100040643 3300006881 Bacteria 3162
567 Ga0068865_100253438 3300006881 Bacteria 1390
568 Ga0068865_100439572 3300006881 Bacteria 1076
569 Ga0075436_100000044 3300006914 Bacteria 77101
570 Ga0075436_100022162 3300006914 Bacteria 4363
571 Ga0097620_100001192 3300006931 Bacteria 26539
572 Ga0097620_100001429 3300006931 Bacteria 24213
573 Ga0097620_100012299 3300006931 Bacteria 8611
574 Ga0097620_100013911 3300006931 Bacteria 8072
575 Ga0097620_100016493 3300006931 Bacteria 7418
576 Ga0097620_100021872 3300006931 Bacteria 6414
577 Ga0097620_100026106 3300006931 Bacteria 5860
578 Ga0097620_100038257 3300006931 Bacteria 4813
579 Ga0097620_100049461 3300006931 Bacteria 4221
580 Ga0097620_100072184 3300006931 Bacteria 3488
581 Ga0097620_100095548 3300006931 Bacteria 3024
582 Ga0097620_100117148 3300006931 Bacteria 2729
583 Ga0097620_100120606 3300006931 Bacteria 2689
584 Ga0097620_100137105 3300006931 Bacteria 2520
585 Ga0097620_100182706 3300006931 Bacteria 2180
586 Ga0097620_100359183 3300006931 Bacteria 1552
587 Ga0097620_100359626 3300006931 Bacteria 1551
588 Ga0097620_100565669 3300006931 Bacteria 1231
589 Ga0097620_100607262 3300006931 Bacteria 1187
590 Ga0075435_100000183 3300007076 Bacteria 37284
591 Ga0075435_100002015 3300007076 Bacteria 13295
592 Ga0075435_100003512 3300007076 Bacteria 10644
593 Ga0075435_100011227 3300007076 Bacteria 6576
594 Ga0075435_100025147 3300007076 Bacteria 4632
595 Ga0075435_100029566 3300007076 Bacteria 4301
596 Ga0075435_100060103 3300007076 Bacteria 3081
597 Ga0075435_100065453 3300007076 Bacteria 2955
598 Ga0075435_100147858 3300007076 Bacteria 1974
599 Ga0099794_10037385 3300007265 Bacteria 2298
600 Ga0105240_10232149 3300009093 Bacteria 2143
601 Ga0105240_10337304 3300009093 Bacteria 1713
602 Ga0111539_10000020 3300009094 Bacteria 265282
603 Ga0111539_10000848 3300009094 Bacteria 39851
604 Ga0111539_10001306 3300009094 Bacteria 33285
605 Ga0111539_10003191 3300009094 Bacteria 21698
606 Ga0111539_10003912 3300009094 Bacteria 19587
607 Ga0111539_10013300 3300009094 Bacteria 10284
608 Ga0111539_10013426 3300009094 Bacteria 10240
609 Ga0111539_10021872 3300009094 Bacteria 7863
610 Ga0111539_10038854 3300009094 Bacteria 5741
611 Ga0111539_10078917 3300009094 Bacteria 3872
612 Ga0111539_10120419 3300009094 Bacteria 3075
613 Ga0111539_10130183 3300009094 Bacteria 2947
614 Ga0111539_10151925 3300009094 Bacteria 2710
615 Ga0111539_10177321 3300009094 Bacteria 2490
616 Ga0111539_10183471 3300009094 Bacteria 2444
617 Ga0111539_10454486 3300009094 Bacteria 1491
618 Ga0111539_10629621 3300009094 Bacteria 1249
619 Ga0105245_10046841 3300009098 Bacteria 3863
620 Ga0105245_10377406 3300009098 Bacteria 1411
621 Ga0105247_10000004 3300009101 Bacteria 455497
622 Ga0105247_10007231 3300009101 Bacteria 6816
623 Ga0105247_10030558 3300009101 Bacteria 3265
624 Ga0105247_10038471 3300009101 Bacteria 2921
625 Ga0114129_10002555 3300009147 Bacteria 25286
626 Ga0114129_10005399 3300009147 Bacteria 18044
627 Ga0114129_10008257 3300009147 Bacteria 14850
628 Ga0114129_10021210 3300009147 Bacteria 9227
629 Ga0114129_10040516 3300009147 Bacteria 6566
630 Ga0114129_10040634 3300009147 Bacteria 6555
631 Ga0114129_10044727 3300009147 Bacteria 6228
632 Ga0114129_10046757 3300009147 Bacteria 6082
633 Ga0114129_10065833 3300009147 Bacteria 5056
634 Ga0114129_10090044 3300009147 Bacteria 4253
635 Ga0114129_10265943 3300009147 Bacteria 2296
636 Ga0114129_10345858 3300009147 Bacteria 1971
637 Ga0114129_10376358 3300009147 Bacteria 1876
638 Ga0114129_10389917 3300009147 Bacteria 1837
639 Ga0114129_10416995 3300009147 Bacteria 1767
640 Ga0114129_10820424 3300009147 Bacteria 1185
641 Ga0105243_10000446 3300009148 Bacteria 43049
642 Ga0105243_10005705 3300009148 Bacteria 9675
643 Ga0105243_10005941 3300009148 Bacteria 9457
644 Ga0105243_10025294 3300009148 Bacteria 4535
645 Ga0105243_10111551 3300009148 Bacteria 2289
646 Ga0105243_10112978 3300009148 Bacteria 2277
647 Ga0105243_10344097 3300009148 Bacteria 1367
648 Ga0105241_10015949 3300009174 Bacteria 5505
649 Ga0105241_10038980 3300009174 Bacteria 3583
650 Ga0105241_10552885 3300009174 Bacteria 1034
651 Ga0105242_10000928 3300009176 Bacteria 22787
652 Ga0105242_10008624 3300009176 Bacteria 7826
653 Ga0105242_10010031 3300009176 Bacteria 7251
654 Ga0105242_10012013 3300009176 Bacteria 6666
655 Ga0105242_10112931 3300009176 Bacteria 2320
656 Ga0105242_10157771 3300009176 Bacteria 1983
657 Ga0105242_10346935 3300009176 Bacteria 1370
658 Ga0105242_10415569 3300009176 Bacteria 1259
659 Ga0105248_10005677 3300009177 Bacteria 13712
660 Ga0105248_10011939 3300009177 Bacteria 9580
661 Ga0105248_10081421 3300009177 Bacteria 3639
662 Ga0105248_10136310 3300009177 Bacteria 2769
663 Ga0105248_10207818 3300009177 Bacteria 2206
664 Ga0105248_10286794 3300009177 Bacteria 1854
665 Ga0105248_10321099 3300009177 Bacteria 1744
666 Ga0105237_10001434 3300009545 Bacteria 31525
667 Ga0105237_10084994 3300009545 Bacteria 3154
668 Ga0105238_10008489 3300009551 Bacteria 10284
669 Ga0105238_10012505 3300009551 Bacteria 8562
670 Ga0105238_10041514 3300009551 Bacteria 4658
671 Ga0105238_10393195 3300009551 Bacteria 1379
672 Ga0105249_10000369 3300009553 Bacteria 44503
673 Ga0105249_10001159 3300009553 Bacteria 23309
674 Ga0105249_10008936 3300009553 Bacteria 8754
675 Ga0105249_10015748 3300009553 Bacteria 6697
676 Ga0105249_10035705 3300009553 Bacteria 4507
677 Ga0105249_10038910 3300009553 Bacteria 4317
678 Ga0105249_10083211 3300009553 Bacteria 2978
679 Ga0105249_10112975 3300009553 Bacteria 2570
680 Ga0105249_10198834 3300009553 Bacteria 1961
681 Ga0105249_10386021 3300009553 Bacteria 1427
682 Ga0105249_10471712 3300009553 Bacteria 1297
683 Ga0105239_10002095 3300010375 Bacteria 25841
684 Ga0105239_10098218 3300010375 Bacteria 3237
685 Ga0105239_10106037 3300010375 Bacteria 3113
686 Ga0105239_10349899 3300010375 Bacteria 1668
687 Ga0105246_10123115 3300011119 Bacteria 1925
688 Ga0105246_10157610 3300011119 Bacteria 1726
689 Ga0105246_10450580 3300011119 Bacteria 1081
690 Ga0105246_10508780 3300011119 Bacteria 1024
691 Ga0157373_10002117 3300013100 Bacteria 15029
692 Ga0157371_10065731 3300013102 Bacteria 2568
693 Ga0157371_10147042 3300013102 Bacteria 1679
694 Ga0157374_10011236 3300013296 Bacteria 7744
695 Ga0157374_10019103 3300013296 Bacteria 6063
696 Ga0157374_10025686 3300013296 Bacteria 5292
697 Ga0157374_10144343 3300013296 Bacteria 2312
698 Ga0157378_10000004 3300013297 Bacteria 201051
699 Ga0157378_10005813 3300013297 Bacteria 10814
700 Ga0157378_10012885 3300013297 Bacteria 7322
701 Ga0157378_10019296 3300013297 Bacteria 5993
702 Ga0157378_10068569 3300013297 Bacteria 3181
703 Ga0157378_10895245 3300013297 Bacteria 918
704 Ga0163162_10000019 3300013306 Bacteria 220603
705 Ga0163162_10001443 3300013306 Bacteria 22109
706 Ga0163162_10005531 3300013306 Bacteria 12213
707 Ga0163162_10013874 3300013306 Bacteria 7873
708 Ga0163162_10020047 3300013306 Bacteria 6567
709 Ga0163162_10080844 3300013306 Bacteria 3319
710 Ga0163162_10137245 3300013306 Bacteria 2557
711 Ga0163162_10149774 3300013306 Bacteria 2450
712 Ga0163162_10174767 3300013306 Bacteria 2273
713 Ga0163162_10208316 3300013306 Bacteria 2084
714 Ga0163162_10217183 3300013306 Bacteria 2042
715 Ga0163162_10338156 3300013306 Bacteria 1638
716 Ga0157372_10002034 3300013307 Bacteria 21997
717 Ga0157372_10049885 3300013307 Bacteria 4656
718 Ga0157372_10406054 3300013307 Bacteria 1587
719 Ga0157375_10022884 3300013308 Bacteria 5758
720 Ga0157375_10026328 3300013308 Bacteria 5418
721 Ga0157375_10213484 3300013308 Bacteria 2087
722 Ga0157375_10327524 3300013308 Bacteria 1697
723 Ga0157375_10517021 3300013308 Bacteria 1357
724 Ga0157375_10836285 3300013308 Bacteria 1068
725 Ga0163163_10001375 3300014325 Bacteria 20531
726 Ga0163163_10003120 3300014325 Bacteria 14042
727 Ga0163163_10003397 3300014325 Bacteria 13522
728 Ga0163163_10013092 3300014325 Bacteria 7578
729 Ga0163163_10067918 3300014325 Bacteria 3546
730 Ga0163163_10078520 3300014325 Bacteria 3298
731 Ga0163163_10088082 3300014325 Bacteria 3116
732 Ga0163163_10110382 3300014325 Bacteria 2778
733 Ga0163163_10121246 3300014325 Bacteria 2649
734 Ga0163163_10121886 3300014325 Bacteria 2642
735 Ga0163163_10443867 3300014325 Bacteria 1357
736 Ga0163163_10511830 3300014325 Bacteria 1262
737 Ga0157380_10002550 3300014326 Bacteria 12297
738 Ga0157380_10008103 3300014326 Bacteria 7487
739 Ga0157380_10012272 3300014326 Bacteria 6208
740 Ga0157380_10020775 3300014326 Bacteria 4914
741 Ga0157380_10080111 3300014326 Bacteria 2669
742 Ga0157380_10082532 3300014326 Bacteria 2631
743 Ga0157380_10205199 3300014326 Bacteria 1752
744 Ga0157380_10223179 3300014326 Bacteria 1687
745 Ga0157380_10311548 3300014326 Bacteria 1455
746 Ga0157380_10352426 3300014326 Bacteria 1378
747 Ga0157377_10009104 3300014745 Bacteria 4862
748 Ga0157377_10015858 3300014745 Bacteria 3862
749 Ga0157377_10028661 3300014745 Bacteria 2999
750 Ga0157377_10073723 3300014745 Bacteria 1979
751 Ga0157377_10084663 3300014745 Bacteria 1860
752 Ga0157377_10161764 3300014745 Bacteria 1393
753 Ga0157379_10007906 3300014968 Bacteria 9218
754 Ga0157379_10087600 3300014968 Bacteria 2791
755 Ga0157379_10095877 3300014968 Bacteria 2662
756 Ga0157379_10116903 3300014968 Bacteria 2399
757 Ga0157379_10394000 3300014968 Bacteria 1272
758 Ga0157376_10027415 3300014969 Bacteria 4515
759 Ga0157376_10074180 3300014969 Bacteria 2900
760 Ga0157376_10325412 3300014969 Bacteria 1463
761 Ga0157376_10408705 3300014969 Bacteria 1314
762 Ga0157376_10476560 3300014969 Bacteria 1222
763 Ga0163161_10040705 3300017792 Bacteria 3338
764 Ga0163161_10068135 3300017792 Bacteria 2600
765 Ga0163161_10144095 3300017792 Bacteria 1806
766 Ga0163161_10401799 3300017792 Bacteria 1099
767 Ga0163161_10416907 3300017792 Bacteria 1079
768 Ga0213876_10000089 3300021384 Bacteria 104386
769 Ga0213876_10000246 3300021384 Bacteria 51765
770 Ga0207672_1000589 3300025223 Bacteria 4395
771 Ga0209676_1000126 3300025292 Bacteria 191340
772 Ga0209050_1009637 3300025298 Bacteria 4905
773 Ga0207697_10001898 3300025315 Bacteria 11153
774 Ga0207697_10003386 3300025315 Bacteria 7917
775 Ga0207697_10016114 3300025315 Bacteria 3082
776 Ga0207697_10032149 3300025315 Bacteria 2147
777 Ga0207656_10010387 3300025321 Bacteria 3486
778 Ga0207656_10029500 3300025321 Bacteria 2260
779 Ga0207653_10002170 3300025885 Bacteria 6242
780 Ga0207653_10003256 3300025885 Bacteria 5127
781 Ga0207682_10002777 3300025893 Bacteria 7753
782 Ga0207682_10009256 3300025893 Bacteria 3892
783 Ga0207682_10027821 3300025893 Bacteria 2253
784 Ga0207682_10066939 3300025893 Bacteria 1514
785 Ga0207682_10166543 3300025893 Bacteria 1001
786 Ga0207642_10022700 3300025899 Bacteria 2494
787 Ga0207642_10028854 3300025899 Bacteria 2290
788 Ga0207642_10123959 3300025899 Bacteria 1337
789 Ga0207642_10148566 3300025899 Bacteria 1244
790 Ga0207710_10000002 3300025900 Bacteria 1251998
791 Ga0207710_10002333 3300025900 Bacteria 8871
792 Ga0207688_10005226 3300025901 Bacteria 7056
793 Ga0207688_10013425 3300025901 Bacteria 4451
794 Ga0207688_10068296 3300025901 Bacteria 2012
795 Ga0207680_10025834 3300025903 Bacteria 3245
796 Ga0207647_10077278 3300025904 Bacteria 2001
797 Ga0207685_10000010 3300025905 Bacteria 216792
798 Ga0207699_10030831 3300025906 Bacteria 3004
799 Ga0207645_10004600 3300025907 Bacteria 10169
800 Ga0207645_10009925 3300025907 Bacteria 6558
801 Ga0207645_10030648 3300025907 Bacteria 3465
802 Ga0207645_10040733 3300025907 Bacteria 2975
803 Ga0207645_10088985 3300025907 Bacteria 1985
804 Ga0207643_10001361 3300025908 Bacteria 14114
805 Ga0207643_10001583 3300025908 Bacteria 12887
806 Ga0207643_10007744 3300025908 Bacteria 5771
807 Ga0207643_10010011 3300025908 Bacteria 5096
808 Ga0207643_10038732 3300025908 Bacteria 2679
809 Ga0207643_10040080 3300025908 Bacteria 2636
810 Ga0207643_10053092 3300025908 Bacteria 2302
811 Ga0207684_10000611 3300025910 Bacteria 42502
812 Ga0207684_10001598 3300025910 Bacteria 24083
813 Ga0207684_10003111 3300025910 Bacteria 16372
814 Ga0207684_10012154 3300025910 Bacteria 7493
815 Ga0207684_10033034 3300025910 Bacteria 4401
816 Ga0207684_10073130 3300025910 Bacteria 2911
817 Ga0207684_10141548 3300025910 Bacteria 2068
818 Ga0207684_10158833 3300025910 Bacteria 1946
819 Ga0207654_10032217 3300025911 Bacteria 2894
820 Ga0207654_10096949 3300025911 Bacteria 1810
821 Ga0207707_10000571 3300025912 Bacteria 37397
822 Ga0207707_10002505 3300025912 Bacteria 16535
823 Ga0207707_10092390 3300025912 Bacteria 2644
824 Ga0207707_10217783 3300025912 Bacteria 1662
825 Ga0207695_10121226 3300025913 Bacteria 2583
826 Ga0207695_10360374 3300025913 Bacteria 1340
827 Ga0207671_10000811 3300025914 Bacteria 39493
828 Ga0207671_10038185 3300025914 Bacteria 3559
829 Ga0207660_10044338 3300025917 Bacteria 3129
830 Ga0207662_10000549 3300025918 Bacteria 16650
831 Ga0207662_10001880 3300025918 Bacteria 10337
832 Ga0207662_10003709 3300025918 Bacteria 7912
833 Ga0207662_10003864 3300025918 Bacteria 7795
834 Ga0207662_10029280 3300025918 Bacteria 3190
835 Ga0207662_10106043 3300025918 Bacteria 1747
836 Ga0207649_10008693 3300025920 Bacteria 5545
837 Ga0207649_10208999 3300025920 Bacteria 1383
838 Ga0207649_10333939 3300025920 Bacteria 1117
839 Ga0207652_10002002 3300025921 Bacteria 17598
840 Ga0207646_10000518 3300025922 Bacteria 51449
841 Ga0207646_10003043 3300025922 Bacteria 19296
842 Ga0207646_10034664 3300025922 Bacteria 4562
843 Ga0207646_10043292 3300025922 Bacteria 4044
844 Ga0207646_10047946 3300025922 Bacteria 3830
845 Ga0207646_10083588 3300025922 Bacteria 2856
846 Ga0207646_10138040 3300025922 Bacteria 2195
847 Ga0207646_10273806 3300025922 Bacteria 1526
848 Ga0207681_10000903 3300025923 Bacteria 19410
849 Ga0207681_10017696 3300025923 Bacteria 4479
850 Ga0207681_10034210 3300025923 Bacteria 3339
851 Ga0207681_10073981 3300025923 Bacteria 2385
852 Ga0207681_10086197 3300025923 Bacteria 2231
853 Ga0207681_10271628 3300025923 Bacteria 1331
854 Ga0207681_10302748 3300025923 Bacteria 1265
855 Ga0207681_10313814 3300025923 Bacteria 1244
856 Ga0207681_10397707 3300025923 Bacteria 1112
857 Ga0207694_10009585 3300025924 Bacteria 7304
858 Ga0207650_10000028 3300025925 Bacteria 236867
859 Ga0207650_10001186 3300025925 Bacteria 19153
860 Ga0207650_10005051 3300025925 Bacteria 9003
861 Ga0207650_10005345 3300025925 Bacteria 8759
862 Ga0207650_10007866 3300025925 Bacteria 7258
863 Ga0207650_10013990 3300025925 Bacteria 5570
864 Ga0207650_10023246 3300025925 Bacteria 4394
865 Ga0207650_10122005 3300025925 Bacteria 2030
866 Ga0207650_10148683 3300025925 Bacteria 1847
867 Ga0207650_10240554 3300025925 Bacteria 1463
868 Ga0207659_10000186 3300025926 Bacteria 37035
869 Ga0207659_10000878 3300025926 Bacteria 17870
870 Ga0207659_10002292 3300025926 Bacteria 11411
871 Ga0207659_10034429 3300025926 Bacteria 3492
872 Ga0207659_10036646 3300025926 Bacteria 3399
873 Ga0207659_10072292 3300025926 Bacteria 2521
874 Ga0207659_10088610 3300025926 Bacteria 2305
875 Ga0207659_10096339 3300025926 Bacteria 2221
876 Ga0207659_10122540 3300025926 Bacteria 1994
877 Ga0207644_10001949 3300025931 Bacteria 13370
878 Ga0207644_10017680 3300025931 Bacteria 4821
879 Ga0207644_10036067 3300025931 Bacteria 3469
880 Ga0207644_10036907 3300025931 Bacteria 3433
881 Ga0207644_10046234 3300025931 Bacteria 3100
882 Ga0207644_10055818 3300025931 Bacteria 2848
883 Ga0207690_10013212 3300025932 Bacteria 4957
884 Ga0207706_10043007 3300025933 Bacteria 4004
885 Ga0207706_10052570 3300025933 Bacteria 3596
886 Ga0207706_10054781 3300025933 Bacteria 3519
887 Ga0207706_10142969 3300025933 Bacteria 2105
888 Ga0207706_10311383 3300025933 Bacteria 1371
889 Ga0207686_10003763 3300025934 Bacteria 8141
890 Ga0207686_10007515 3300025934 Bacteria 5866
891 Ga0207686_10019899 3300025934 Bacteria 3827
892 Ga0207686_10098549 3300025934 Bacteria 1946
893 Ga0207686_10149569 3300025934 Bacteria 1624
894 Ga0207686_10191526 3300025934 Bacteria 1458
895 Ga0207709_10000718 3300025935 Bacteria 26589
896 Ga0207709_10011308 3300025935 Bacteria 4923
897 Ga0207709_10013951 3300025935 Bacteria 4437
898 Ga0207709_10103493 3300025935 Bacteria 1887
899 Ga0207709_10300914 3300025935 Bacteria 1192
900 Ga0207709_10347234 3300025935 Bacteria 1119
901 Ga0207670_10002960 3300025936 Bacteria 8966
902 Ga0207670_10008388 3300025936 Bacteria 5831
903 Ga0207670_10013101 3300025936 Bacteria 4878
904 Ga0207670_10039118 3300025936 Bacteria 3103
905 Ga0207670_10063722 3300025936 Bacteria 2523
906 Ga0207670_10090445 3300025936 Bacteria 2162
907 Ga0207670_10094445 3300025936 Bacteria 2122
908 Ga0207670_10192912 3300025936 Bacteria 1542
909 Ga0207670_10247817 3300025936 Bacteria 1375
910 Ga0207669_10016336 3300025937 Bacteria 3768
911 Ga0207669_10044616 3300025937 Bacteria 2606
912 Ga0207669_10082580 3300025937 Bacteria 2063
913 Ga0207669_10096956 3300025937 Bacteria 1937
914 Ga0207669_10109517 3300025937 Bacteria 1847
915 Ga0207669_10280953 3300025937 Bacteria 1255
916 Ga0207704_10016206 3300025938 Bacteria 3823
917 Ga0207704_10028466 3300025938 Bacteria 3100
918 Ga0207704_10150845 3300025938 Bacteria 1640
919 Ga0207704_10333419 3300025938 Bacteria 1175
920 Ga0207665_10000025 3300025939 Bacteria 100584
921 Ga0207665_10024763 3300025939 Bacteria 3958
922 Ga0207691_10001303 3300025940 Bacteria 24901
923 Ga0207691_10017523 3300025940 Bacteria 6790
924 Ga0207691_10020173 3300025940 Bacteria 6304
925 Ga0207691_10052567 3300025940 Bacteria 3721
926 Ga0207691_10093345 3300025940 Bacteria 2695
927 Ga0207691_10103872 3300025940 Bacteria 2533
928 Ga0207691_10168176 3300025940 Bacteria 1921
929 Ga0207691_10188399 3300025940 Bacteria 1800
930 Ga0207691_10197726 3300025940 Bacteria 1751
931 Ga0207691_10204698 3300025940 Bacteria 1716
932 Ga0207691_10503185 3300025940 Bacteria 1029
933 Ga0207711_10005724 3300025941 Bacteria 10487
934 Ga0207711_10018903 3300025941 Bacteria 5730
935 Ga0207711_10055056 3300025941 Bacteria 3415
936 Ga0207711_10068194 3300025941 Bacteria 3080
937 Ga0207711_10080066 3300025941 Bacteria 2852
938 Ga0207711_10109616 3300025941 Bacteria 2453
939 Ga0207711_10141882 3300025941 Bacteria 2162
940 Ga0207711_10203368 3300025941 Bacteria 1808
941 Ga0207689_10001365 3300025942 Bacteria 23398
942 Ga0207689_10002233 3300025942 Bacteria 18143
943 Ga0207689_10002826 3300025942 Bacteria 16029
944 Ga0207689_10018311 3300025942 Bacteria 5912
945 Ga0207689_10022495 3300025942 Bacteria 5300
946 Ga0207689_10023903 3300025942 Bacteria 5126
947 Ga0207689_10076094 3300025942 Bacteria 2760
948 Ga0207661_10254041 3300025944 Bacteria 1563
949 Ga0207679_10001272 3300025945 Bacteria 15982
950 Ga0207679_10021619 3300025945 Bacteria 4366
951 Ga0207679_10022608 3300025945 Bacteria 4285
952 Ga0207679_10068048 3300025945 Bacteria 2673
953 Ga0207679_10103414 3300025945 Bacteria 2232
954 Ga0207679_10250364 3300025945 Bacteria 1506
955 Ga0207679_10253166 3300025945 Bacteria 1498
956 Ga0207679_10441189 3300025945 Bacteria 1153
957 Ga0207679_10665467 3300025945 Bacteria 943
958 Ga0207651_10004256 3300025960 Bacteria 7182
959 Ga0207651_10011063 3300025960 Bacteria 5032
960 Ga0207651_10029642 3300025960 Bacteria 3470
961 Ga0207651_10033611 3300025960 Bacteria 3310
962 Ga0207651_10048587 3300025960 Bacteria 2869
963 Ga0207651_10123411 3300025960 Bacteria 1969
964 Ga0207651_10133125 3300025960 Bacteria 1907
965 Ga0207712_10000544 3300025961 Bacteria 30557
966 Ga0207712_10002956 3300025961 Bacteria 10847
967 Ga0207712_10079082 3300025961 Bacteria 2388
968 Ga0207712_10160624 3300025961 Bacteria 1746
969 Ga0207712_10219070 3300025961 Bacteria 1520
970 Ga0207712_10224992 3300025961 Bacteria 1502
971 Ga0207712_10245551 3300025961 Bacteria 1444
972 Ga0207712_10363539 3300025961 Bacteria 1206
973 Ga0207668_10002854 3300025972 Bacteria 10126
974 Ga0207640_10028938 3300025981 Bacteria 3394
975 Ga0207640_10039847 3300025981 Bacteria 2977
976 Ga0207640_10049435 3300025981 Bacteria 2723
977 Ga0207640_10102312 3300025981 Bacteria 2012
978 Ga0207640_10302223 3300025981 Bacteria 1266
979 Ga0207658_10015094 3300025986 Bacteria 5298
980 Ga0207677_10046843 3300026023 Bacteria 2898
981 Ga0207677_10060900 3300026023 Bacteria 2611
982 Ga0207677_10071212 3300026023 Bacteria 2453
983 Ga0207677_10295900 3300026023 Bacteria 1335
984 Ga0207677_10342391 3300026023 Bacteria 1250
985 Ga0207703_10000114 3300026035 Bacteria 96051
986 Ga0207703_10020002 3300026035 Bacteria 5230
987 Ga0207703_10046964 3300026035 Bacteria 3480
988 Ga0207703_10110202 3300026035 Bacteria 2348
989 Ga0207703_10152576 3300026035 Bacteria 2016
990 Ga0207703_10320917 3300026035 Bacteria 1418
991 Ga0207703_10340810 3300026035 Bacteria 1378
992 Ga0207703_10439054 3300026035 Bacteria 1217
993 Ga0207639_10218927 3300026041 Bacteria 1643
994 Ga0207639_10292758 3300026041 Bacteria 1436
995 Ga0207678_10018608 3300026067 Bacteria 6098
996 Ga0207678_10202913 3300026067 Bacteria 1696
997 Ga0207678_10249878 3300026067 Bacteria 1519
998 Ga0207708_10000100 3300026075 Bacteria 65501
999 Ga0207708_10006192 3300026075 Bacteria 8866
1000 Ga0207708_10007505 3300026075 Bacteria 8060
1001 Ga0207708_10009407 3300026075 Bacteria 7235
1002 Ga0207708_10021502 3300026075 Bacteria 4866
1003 Ga0207708_10030633 3300026075 Bacteria 4080
1004 Ga0207708_10030991 3300026075 Bacteria 4058
1005 Ga0207708_10048203 3300026075 Bacteria 3243
1006 Ga0207708_10158821 3300026075 Bacteria 1784
1007 Ga0207708_10163149 3300026075 Bacteria 1761
1008 Ga0207708_10245434 3300026075 Bacteria 1441
1009 Ga0207708_10333990 3300026075 Bacteria 1240
1010 Ga0207708_10424420 3300026075 Bacteria 1103
1011 Ga0207702_10765554 3300026078 Bacteria 953
1012 Ga0207641_10101524 3300026088 Bacteria 2535
1013 Ga0207641_10224357 3300026088 Bacteria 1744
1014 Ga0207641_10228663 3300026088 Bacteria 1728
1015 Ga0207641_10238756 3300026088 Bacteria 1692
1016 Ga0207641_10509219 3300026088 Bacteria 1170
1017 Ga0207641_10584452 3300026088 Bacteria 1092
1018 Ga0207641_10720177 3300026088 Bacteria 983
1019 Ga0207648_10000896 3300026089 Bacteria 33615
1020 Ga0207648_10003098 3300026089 Bacteria 17559
1021 Ga0207648_10007004 3300026089 Bacteria 11149
1022 Ga0207648_10085778 3300026089 Bacteria 2746
1023 Ga0207648_10123405 3300026089 Bacteria 2278
1024 Ga0207648_10165821 3300026089 Bacteria 1952
1025 Ga0207648_10237586 3300026089 Bacteria 1622
1026 Ga0207648_10488563 3300026089 Bacteria 1125
1027 Ga0207676_10010391 3300026095 Bacteria 6629
1028 Ga0207676_10046156 3300026095 Bacteria 3370
1029 Ga0207676_10048653 3300026095 Bacteria 3293
1030 Ga0207676_10100200 3300026095 Bacteria 2399
1031 Ga0207676_10123564 3300026095 Bacteria 2187
1032 Ga0207676_10172776 3300026095 Bacteria 1884
1033 Ga0207676_10184151 3300026095 Bacteria 1831
1034 Ga0207676_10188228 3300026095 Bacteria 1814
1035 Ga0207676_10213850 3300026095 Bacteria 1712
1036 Ga0207676_10226488 3300026095 Bacteria 1668
1037 Ga0207676_10496213 3300026095 Bacteria 1158
1038 Ga0207676_10757565 3300026095 Bacteria 945
1039 Ga0207674_10000790 3300026116 Bacteria 41276
1040 Ga0207674_10012851 3300026116 Bacteria 9347
1041 Ga0207674_10071565 3300026116 Bacteria 3484
1042 Ga0207674_10082451 3300026116 Bacteria 3217
1043 Ga0207674_10119025 3300026116 Bacteria 2610
1044 Ga0207674_10164769 3300026116 Bacteria 2171
1045 Ga0207674_10166878 3300026116 Bacteria 2156
1046 Ga0207674_10476131 3300026116 Bacteria 1207
1047 Ga0207675_100002272 3300026118 Bacteria 19109
1048 Ga0207675_100002665 3300026118 Bacteria 17610
1049 Ga0207675_100003723 3300026118 Bacteria 14848
1050 Ga0207675_100010590 3300026118 Bacteria 8640
1051 Ga0207675_100010666 3300026118 Bacteria 8608
1052 Ga0207675_100013286 3300026118 Bacteria 7687
1053 Ga0207675_100015058 3300026118 Bacteria 7217
1054 Ga0207675_100055436 3300026118 Bacteria 3698
1055 Ga0207675_100076608 3300026118 Bacteria 3132
1056 Ga0207675_100088496 3300026118 Bacteria 2909
1057 Ga0207675_100095740 3300026118 Bacteria 2794
1058 Ga0207675_100182268 3300026118 Bacteria 2011
1059 Ga0207675_100258242 3300026118 Bacteria 1688
1060 Ga0207675_100420112 3300026118 Bacteria 1320
1061 Ga0207683_10003915 3300026121 Bacteria 12911
1062 Ga0207683_10021539 3300026121 Bacteria 5521
1063 Ga0207683_10076195 3300026121 Bacteria 2970
1064 Ga0207683_10076480 3300026121 Bacteria 2964
1065 Ga0207683_10086987 3300026121 Bacteria 2779
1066 Ga0207683_10090971 3300026121 Bacteria 2718
1067 Ga0207683_10112338 3300026121 Bacteria 2440
1068 Ga0207683_10311877 3300026121 Bacteria 1440
1069 Ga0207683_10371897 3300026121 Bacteria 1313
1070 Ga0209813_10037590 3300027866 Bacteria 1459
1071 Ga0209974_10051767 3300027876 Bacteria 1381
1072 Ga0209974_10073848 3300027876 Bacteria 1166
1073 Ga0207428_10000021 3300027907 Bacteria 276436
1074 Ga0207428_10001755 3300027907 Bacteria 22212
1075 Ga0207428_10001933 3300027907 Bacteria 20997
1076 Ga0207428_10002646 3300027907 Bacteria 17849
1077 Ga0207428_10003981 3300027907 Bacteria 14174
1078 Ga0207428_10012852 3300027907 Bacteria 7339
1079 Ga0207428_10014492 3300027907 Bacteria 6844
1080 Ga0207428_10024941 3300027907 Bacteria 5014
1081 Ga0207428_10027905 3300027907 Bacteria 4696
1082 Ga0207428_10038609 3300027907 Bacteria 3881
1083 Ga0207428_10050815 3300027907 Bacteria 3314
1084 Ga0207428_10122553 3300027907 Bacteria 1993
1085 Ga0268266_10058687 3300028379 Bacteria 3314
1086 Ga0268265_10000446 3300028380 Bacteria 43670
1087 Ga0268265_10012863 3300028380 Bacteria 5681
1088 Ga0268265_10024432 3300028380 Bacteria 4275
1089 Ga0268265_10031941 3300028380 Bacteria 3808
1090 Ga0268265_10043067 3300028380 Bacteria 3353
1091 Ga0268265_10066087 3300028380 Bacteria 2794
1092 Ga0268265_10237756 3300028380 Bacteria 1605
1093 Ga0268265_10279290 3300028380 Bacteria 1494
1094 Ga0268265_10320780 3300028380 Bacteria 1403
1095 Ga0268265_10702162 3300028380 Bacteria 977
1096 Ga0268264_10001064 3300028381 Bacteria 27238
1097 Ga0268264_10011548 3300028381 Bacteria 7296
1098 Ga0268264_10043240 3300028381 Bacteria 3732
1099 Ga0268264_10471711 3300028381 Bacteria 1219
1100 Ga0268264_10530056 3300028381 Bacteria 1152
1101 Ga0268264_10551300 3300028381 Bacteria 1131
1102 Ga0307515_10263806 3300028794 Bacteria 1454
1103 Ga0265327_10001215 3300031251 Bacteria 34710
1104 Ga0307513_10001475 3300031456 Bacteria 33811
1105 Ga0307408_100007332 3300031548 Bacteria 7297
1106 Ga0307408_100035392 3300031548 Bacteria 3504
1107 Ga0307408_100047021 3300031548 Bacteria 3088
1108 Ga0307408_100048556 3300031548 Bacteria 3045
1109 Ga0307408_100056564 3300031548 Bacteria 2845
1110 Ga0307408_100185618 3300031548 Bacteria 1671
1111 Ga0307408_100244931 3300031548 Bacteria 1475
1112 Ga0307408_100277661 3300031548 Bacteria 1394
1113 Ga0307408_100411873 3300031548 Bacteria 1163
1114 Ga0316576_10016621 3300031727 Bacteria 4976
1115 Ga0307405_10009672 3300031731 Bacteria 4954
1116 Ga0307405_10039303 3300031731 Bacteria 2858
1117 Ga0307405_10169535 3300031731 Bacteria 1556
1118 Ga0307405_10644143 3300031731 Bacteria 870
1119 Ga0307413_10003155 3300031824 Bacteria 6880
1120 Ga0307413_10003900 3300031824 Bacteria 6380
1121 Ga0307413_10012643 3300031824 Bacteria 4208
1122 Ga0307413_10137897 3300031824 Bacteria 1681
1123 Ga0307413_10286721 3300031824 Bacteria 1241
1124 Ga0307410_10000925 3300031852 Bacteria 12548
1125 Ga0307410_10004363 3300031852 Bacteria 7298
1126 Ga0307410_10058667 3300031852 Bacteria 2625
1127 Ga0307410_10065240 3300031852 Bacteria 2504
1128 Ga0307410_10213769 3300031852 Bacteria 1479
1129 Ga0307410_10380897 3300031852 Bacteria 1135
1130 Ga0307406_10009137 3300031901 Bacteria 5550
1131 Ga0307406_10021661 3300031901 Bacteria 3805
1132 Ga0307406_10036853 3300031901 Bacteria 3016
1133 Ga0307406_10044013 3300031901 Bacteria 2796
1134 Ga0307406_10047951 3300031901 Bacteria 2695
1135 Ga0307406_10125120 3300031901 Bacteria 1794
1136 Ga0307407_10001659 3300031903 Bacteria 8237
1137 Ga0307407_10002477 3300031903 Bacteria 7238
1138 Ga0307407_10016324 3300031903 Bacteria 3695
1139 Ga0307407_10020511 3300031903 Bacteria 3389
1140 Ga0307407_10065074 3300031903 Bacteria 2145
1141 Ga0307407_10075659 3300031903 Bacteria 2019
1142 Ga0307412_10009164 3300031911 Bacteria 5672
1143 Ga0307412_10015909 3300031911 Bacteria 4469
1144 Ga0307412_10026352 3300031911 Bacteria 3612
1145 Ga0307412_10039384 3300031911 Bacteria 3051
1146 Ga0307412_10086548 3300031911 Bacteria 2181
1147 Ga0307409_100018639 3300031995 Bacteria 4674
1148 Ga0307409_100034921 3300031995 Bacteria 3679
1149 Ga0307409_100049981 3300031995 Bacteria 3191
1150 Ga0307409_100133012 3300031995 Bacteria 2129
1151 Ga0307409_100154125 3300031995 Bacteria 1999
1152 Ga0307409_100371878 3300031995 Bacteria 1356
1153 Ga0307416_100001034 3300032002 Bacteria 14786
1154 Ga0307416_100021625 3300032002 Bacteria 4623
1155 Ga0307416_100021733 3300032002 Bacteria 4614
1156 Ga0307416_100045895 3300032002 Bacteria 3444
1157 Ga0307416_100064298 3300032002 Bacteria 3009
1158 Ga0307416_100077626 3300032002 Bacteria 2790
1159 Ga0307416_100138362 3300032002 Bacteria 2208
1160 Ga0307416_100161939 3300032002 Bacteria 2069
1161 Ga0307416_100165656 3300032002 Bacteria 2050
1162 Ga0307416_100201577 3300032002 Bacteria 1888
1163 Ga0307416_100312969 3300032002 Bacteria 1568
1164 Ga0307416_100539066 3300032002 Bacteria 1238
1165 Ga0307416_100591831 3300032002 Bacteria 1188
1166 Ga0307414_10006777 3300032004 Bacteria 6407
1167 Ga0307414_10020082 3300032004 Bacteria 4155
1168 Ga0307414_10024037 3300032004 Bacteria 3878
1169 Ga0307414_10078578 3300032004 Bacteria 2406
1170 Ga0307414_10273523 3300032004 Bacteria 1416
1171 Ga0307411_10004081 3300032005 Bacteria 6920
1172 Ga0307411_10018080 3300032005 Bacteria 4036
1173 Ga0307411_10035380 3300032005 Bacteria 3118
1174 Ga0307411_10053053 3300032005 Bacteria 2654
1175 Ga0307411_10057455 3300032005 Bacteria 2570
1176 Ga0307411_10166660 3300032005 Bacteria 1657
1177 Ga0307411_10208860 3300032005 Bacteria 1506
1178 Ga0307411_10254703 3300032005 Bacteria 1382
1179 Ga0307411_10285452 3300032005 Bacteria 1316
1180 Ga0307415_100001309 3300032126 Bacteria 11777
1181 Ga0307415_100003706 3300032126 Bacteria 7819
1182 Ga0307415_100025452 3300032126 Bacteria 3714
1183 Ga0307415_100186237 3300032126 Bacteria 1634
1184 Ga0307415_100186992 3300032126 Bacteria 1631
1185 Ga0307415_100197895 3300032126 Bacteria 1592
1186 Ga0307415_100232061 3300032126 Bacteria 1487
1187 Ga0307415_100276149 3300032126 Bacteria 1379
1188 Ga0307415_100309984 3300032126 Bacteria 1311
1189 Ga0307415_100359917 3300032126 Bacteria 1228
1190 Ga0373934_0019423 3300035086 Bacteria 2608
1191 Ga0373934_0080813 3300035086 Bacteria 1306
1192 Ga0373940_0006288 3300035088 Bacteria 2628
1193 Ga0373949_0016966 3300035090 Bacteria 1637
1194 Ga0373932_0016704 3300035112 Bacteria 1876
1195 Ga0373941_0052168 3300035115 Bacteria 1304
1196 Ga0373953_0046528 3300035117 Bacteria 1742
1197 Ga0373955_0050754 3300035172 Bacteria 2257
1198 Ga0373931_0021797 3300035691 Bacteria 3218
1199 Ga0373935_0097932 3300035692 Bacteria 1930
1200 Ga0373935_0123266 3300035692 Bacteria 1734
1201 Ga0373927_0006039 3300035695 Bacteria 8295
1202 Ga0373933_0044855 3300035724 Bacteria 2620
1203 Ga0373933_0080690 3300035724 Bacteria 1994
1204 Ga0373937_0001055 3300036401 Bacteria 23258
1205 Ga0373937_0004439 3300036401 Bacteria 11924
1206 Ga0373937_0271633 3300036401 Bacteria 1600
1207 Ga0373937_0381883 3300036401 Bacteria 1336
1208 Ga0373937_0463967 3300036401 Bacteria 1203
1209 Ga0395898_0149532 3300037466 Bacteria 2235
1210 Ga0395898_0389523 3300037466 Bacteria 1329
1211 Ga0395905_0002717 3300037471 Bacteria 19386
1212 Ga0436364_0471062 3300037853 Bacteria 1770
1213 Ga0395901_0217830 3300038443 Bacteria 1996
1214 Ga0395901_0482596 3300038443 Bacteria 1264
1215 Ga0242420_004956 3300038996 Bacteria 2040
1216 Ga0436365_0213934 3300039437 Bacteria 51788
1217 Ga0436365_1738066 3300039437 Bacteria 103785
1218 Ga0439448_0005210 3300042005 Bacteria 3703
1219 Ga0439449_0078563 3300042007 Bacteria 1217
1220 Ga0439450_006593 3300042008 Bacteria 2096
1221 Ga0439450_045881 3300042008 Bacteria 1027
1222 Ga0450920_016392 3300042122 Bacteria 1412
1223 Ga0450894_002846 3300042131 Bacteria 2298
1224 Ga0450896_000909 3300042133 Bacteria 3412
1225 Ga0439458_0004884 3300042157 Bacteria 3044
1226 Ga0450908_006780 3300042184 Bacteria 2168
1227 Ga0450908_017698 3300042184 Bacteria 1264
1228 Ga0439434_0008236 3300042435 Bacteria 3058
1229 Ga0439435_0013974 3300042436 Bacteria 1976
1230 Ga0439435_0092614 3300042436 Bacteria 920
1231 Ga0439464_0009591 3300042439 Bacteria 2550
1232 Ga0439464_0099460 3300042439 Bacteria 883
1233 Ga0451577_0547199 3300042876 Bacteria 1051
1234 Ga0453683_0267466 3300044673 Bacteria 1091
1235 Ga0451576_0009630 3300045051 Bacteria 11177
1236 Ga0451576_0092358 3300045051 Bacteria 3148
1237 Ga0451576_0160068 3300045051 Bacteria 2349
1238 Ga0451576_0176179 3300045051 Bacteria 2232
1239 Ga0495629_0010091 3300046459 Bacteria 6890
1240 Ga0495651_0095330 3300046462 Bacteria 2226
1241 Ga0495653_0089557 3300046463 Bacteria 2254
1242 Ga0495584_0146077 3300046491 Bacteria 1201
1243 Ga0495594_0038493 3300046499 Bacteria 2612
1244 Ga0495643_0007881 3300046522 Bacteria 6806
1245 Ga0495663_0003174 3300046525 Bacteria 4791
1246 Ga0495663_0006358 3300046525 Bacteria 3262
1247 Ga0495586_0192872 3300046535 Bacteria 1154
1248 Ga0495598_0004460 3300046537 Bacteria 3031
1249 Ga0495598_0041174 3300046537 Bacteria 1350
1250 Ga0495621_0000018 3300046539 Bacteria 31033
1251 Ga0495621_0003499 3300046539 Bacteria 4334
1252 Ga0495621_0006089 3300046539 Bacteria 3504
1253 Ga0495621_0014741 3300046539 Bacteria 2480
1254 Ga0495621_0095964 3300046539 Bacteria 1123
1255 Ga0495645_0136661 3300046543 Bacteria 1714
1256 Ga0495656_0057586 3300046615 Bacteria 1683
1257 Ga0495659_0007336 3300046664 Bacteria 3496
1258 Ga0495659_0065838 3300046664 Bacteria 1348
1259 Ga0495659_0090540 3300046664 Bacteria 1174
1260 Ga0495659_0172235 3300046664 Bacteria 878
1261 Ga0495669_0053527 3300046684 Bacteria 1815
1262 Ga0495613_0266641 3300046689 Bacteria 1192
1263 Ga0495670_0014126 3300046691 Bacteria 3930
1264 Ga0495600_0196953 3300046809 Bacteria 1295
1265 Ga0495636_0036371 3300047318 Bacteria 2030
1266 Ga0495636_0067949 3300047318 Bacteria 1517
1267 Ga0495685_006116 3300047447 Bacteria 3939
1268 Ga0496100_0101472 3300048903 Bacteria 1984
1269 Ga0496100_0524983 3300048903 Bacteria 914
1270 Ga0496101_0485938 3300048904 Bacteria 975
1271 Ga0496102_0023956 3300048905 Bacteria 5426
1272 Ga0496102_0074011 3300048905 Bacteria 3131
1273 Ga0496102_0268990 3300048905 Bacteria 1607
1274 Ga0496102_0437862 3300048905 Bacteria 1227
1275 Ga0496104_0014579 3300048907 Bacteria 7101
1276 Ga0496104_0206568 3300048907 Bacteria 1876
1277 Ga0496104_0280924 3300048907 Bacteria 1578
1278 Ga0496104_0385329 3300048907 Bacteria 1314
1279 Ga0496105_0020887 3300048908 Bacteria 5295
1280 Ga0496106_0040133 3300048909 Bacteria 3505
1281 Ga0496107_0100557 3300048910 Bacteria 2120
1282 Ga0496107_0146580 3300048910 Bacteria 1746
1283 Ga0496107_0357410 3300048910 Bacteria 1087
1284 Ga0496108_0012631 3300048911 Bacteria 6881
1285 Ga0496109_0004973 3300048912 Bacteria 11096
1286 Ga0496109_0051136 3300048912 Bacteria 3764
1287 Ga0496109_0201124 3300048912 Bacteria 1873
1288 Ga0496110_0003082 3300048913 Bacteria 12641
1289 Ga0496110_0240273 3300048913 Bacteria 1648
1290 Ga0496112_0000767 3300048915 Bacteria 22587
1291 Ga0496112_0046092 3300048915 Bacteria 4275
1292 Ga0496112_0125048 3300048915 Bacteria 2542
1293 Ga0496112_0409571 3300048915 Bacteria 1295
1294 Ga0496112_0486541 3300048915 Bacteria 1170
1295 Ga0496113_0104510 3300048916 Bacteria 2198
1296 Ga0496115_0327575 3300048918 Bacteria 1252
1297 Ga0501291_000471 3300049514 Bacteria 4737
1298 Ga0501291_004129 3300049514 Bacteria 1840
1299 Ga0501292_006351 3300049515 Bacteria 1675
1300 Ga0501292_018671 3300049515 Bacteria 1105
1301 Ga0501296_007502 3300049519 Bacteria 1252
1302 Ga0501298_001140 3300049521 Bacteria 3841
1303 Ga0501299_000411 3300049522 Bacteria 5080
1304 Ga0501299_003673 3300049522 Bacteria 2242
1305 Ga0501032_0003907 3300049569 Bacteria 11304
1306 Ga0501033_0006400 3300049570 Bacteria 9223
1307 Ga0501033_0101008 3300049570 Bacteria 2104
1308 Ga0501034_0012200 3300049571 Bacteria 8887
1309 Ga0501034_0708237 3300049571 Bacteria 905
1310 Ga0501036_0006885 3300049572 Bacteria 9239
1311 Ga0501036_0198140 3300049572 Bacteria 1689
1312 Ga0501036_0290076 3300049572 Bacteria 1369
1313 Ga0501037_0210026 3300049573 Bacteria 1373
1314 Ga0501038_0001430 3300049574 Bacteria 21883
1315 Ga0501038_0086871 3300049574 Bacteria 2627
1316 Ga0501038_0141405 3300049574 Bacteria 1969
1317 Ga0501039_0006831 3300049575 Bacteria 8681
1318 Ga0501039_0028659 3300049575 Bacteria 4287
1319 Ga0501039_0093607 3300049575 Bacteria 2342
1320 Ga0501039_0228170 3300049575 Bacteria 1464
1321 Ga0501040_0004671 3300049576 Bacteria 8884
1322 Ga0501040_0124483 3300049576 Bacteria 1810
1323 Ga0501040_0197333 3300049576 Bacteria 1429
1324 Ga0501041_0135543 3300049577 Bacteria 1534
1325 Ga0501042_0001834 3300049578 Bacteria 12752
1326 Ga0501042_0010365 3300049578 Bacteria 6245
1327 Ga0501042_0019545 3300049578 Bacteria 4706
1328 Ga0501042_0021704 3300049578 Bacteria 4477
1329 Ga0501042_0105418 3300049578 Bacteria 2029
1330 Ga0501043_0014997 3300049579 Bacteria 6068
1331 Ga0501043_0085823 3300049579 Bacteria 2474
1332 Ga0501046_0038669 3300049580 Bacteria 3826
1333 Ga0501046_0089819 3300049580 Bacteria 2364
1334 Ga0501048_0012926 3300049582 Bacteria 6201
1335 Ga0501048_0017206 3300049582 Bacteria 5327
1336 Ga0501048_0046776 3300049582 Bacteria 3089
1337 Ga0501048_0205886 3300049582 Bacteria 1395
1338 Ga0501067_0002039 3300049583 Bacteria 11138
1339 Ga0501069_0000895 3300049585 Bacteria 14204
1340 Ga0501070_0051397 3300049586 Bacteria 3421
1341 Ga0501071_0017152 3300049587 Bacteria 4989
1342 Ga0501071_0087251 3300049587 Bacteria 2289
1343 Ga0501071_0134020 3300049587 Bacteria 1842
1344 Ga0501071_0156802 3300049587 Bacteria 1700
1345 Ga0501072_0020902 3300049588 Bacteria 5074
1346 Ga0501072_0032056 3300049588 Bacteria 4114
1347 Ga0501072_0053968 3300049588 Bacteria 3166
1348 Ga0501072_0056352 3300049588 Bacteria 3097
1349 Ga0501072_0094260 3300049588 Bacteria 2378
1350 Ga0501073_0029470 3300049589 Bacteria 3921
1351 Ga0501073_0078471 3300049589 Bacteria 2298
1352 Ga0501073_0262346 3300049589 Bacteria 1192
1353 Ga0501074_0036613 3300049590 Bacteria 3554
1354 Ga0501074_0249729 3300049590 Bacteria 1261
1355 Ga0501075_0000554 3300049591 Bacteria 22626
1356 Ga0501075_0003285 3300049591 Bacteria 10826
1357 Ga0501075_0009033 3300049591 Bacteria 6957
1358 Ga0501075_0015728 3300049591 Bacteria 5437
1359 Ga0501075_0023327 3300049591 Bacteria 4529
1360 Ga0501075_0125940 3300049591 Bacteria 1950
1361 Ga0501075_0138264 3300049591 Bacteria 1856
1362 Ga0501075_0180846 3300049591 Bacteria 1609
1363 Ga0501075_0190850 3300049591 Bacteria 1563
1364 Ga0501076_0003510 3300049592 Bacteria 11020
1365 Ga0501076_0009529 3300049592 Bacteria 7171
1366 Ga0501076_0084176 3300049592 Bacteria 2555
1367 Ga0501076_0109399 3300049592 Bacteria 2233
1368 Ga0501076_0150532 3300049592 Bacteria 1893
1369 Ga0501076_0269759 3300049592 Bacteria 1393
1370 Ga0501076_0273731 3300049592 Bacteria 1383
1371 Ga0501076_0309603 3300049592 Bacteria 1295
1372 Ga0501077_0016546 3300049593 Bacteria 4647
1373 Ga0501077_0033158 3300049593 Bacteria 3288
1374 Ga0501077_0046508 3300049593 Bacteria 2757
1375 Ga0501202_002593 3300049652 Bacteria 3048
1376 Ga0501202_003915 3300049652 Bacteria 2577
1377 Ga0501202_026551 3300049652 Bacteria 1186
1378 Ga0501216_001643 3300049660 Bacteria 3060
1379 Ga0501216_002560 3300049660 Bacteria 2595
1380 Ga0501217_001547 3300049661 Bacteria 4344
1381 Ga0501217_006352 3300049661 Bacteria 2509
1382 Ga0501217_040076 3300049661 Bacteria 1189
1383 Ga0501223_002885 3300049663 Bacteria 3771
1384 Ga0501224_004812 3300049664 Bacteria 1926
1385 Ga0501227_005642 3300049665 Bacteria 2679
1386 Ga0501227_067562 3300049665 Bacteria 924
1387 Ga0501235_021985 3300049669 Bacteria 1418
1388 Ga0501235_059760 3300049669 Bacteria 892
1389 Ga0501242_000951 3300049674 Bacteria 2777
1390 Ga0501249_009340 3300049679 Bacteria 2040
1391 Ga0501251_002546 3300049681 Bacteria 1774
1392 Ga0501079_0002354 3300049741 Bacteria 13717
1393 Ga0501079_0055209 3300049741 Bacteria 3065
1394 Ga0501079_0109721 3300049741 Bacteria 2143
1395 Ga0501079_0237402 3300049741 Bacteria 1424
1396 Ga0501080_0061125 3300049742 Bacteria 3507
1397 Ga0501080_0115617 3300049742 Bacteria 2487
1398 Ga0501080_0295103 3300049742 Bacteria 1471
1399 Ga0501081_0000345 3300049743 Bacteria 24974
1400 Ga0501081_0013818 3300049743 Bacteria 5313
1401 Ga0501081_0058384 3300049743 Bacteria 2669
1402 Ga0501081_0090799 3300049743 Bacteria 2148
1403 Ga0501081_0143135 3300049743 Bacteria 1714
1404 Ga0501081_0173823 3300049743 Bacteria 1556
1405 Ga0501083_0104087 3300049744 Bacteria 1870
1406 Ga0501083_0157014 3300049744 Bacteria 1489
1407 Ga0501262_009716 3300049759 Bacteria 1194
1408 Ga0501263_002220 3300049760 Bacteria 1951
1409 Ga0501267_003283 3300049764 Bacteria 1471
1410 Ga0501268_000144 3300049765 Bacteria 6357
1411 Ga0501273_004123 3300049770 Bacteria 1582
1412 Ga0501283_000404 3300049779 Bacteria 5763
1413 Ga0501045_0002668 3300049824 Bacteria 12169
1414 Ga0501045_0007589 3300049824 Bacteria 7539
1415 Ga0501045_0017006 3300049824 Bacteria 5165
1416 Ga0501045_0017621 3300049824 Bacteria 5072
1417 Ga0501045_0021686 3300049824 Bacteria 4598
1418 nmdc:mga03683_87618_c1 3300050489 Bacteria 908
1419 nmdc:mga00v17_201280_c1 3300050491 Bacteria 1287
1420 nmdc:mga00v17_27042_c1 3300050491 Bacteria 3346
1421 nmdc:mga00v17_42408_c1 3300050491 Bacteria 2737
1422 nmdc:mga0yw44_135505_c1 3300050492 Bacteria 1597
1423 nmdc:mga0k408_87695_c1 3300050493 Bacteria 1828
1424 nmdc:mga06z11_17629_c1 3300050494 Bacteria 3245
1425 nmdc:mga06z11_23541_c1 3300050494 Bacteria 2895
1426 nmdc:mga06z11_304065_c1 3300050494 Bacteria 949
1427 nmdc:mga06z11_50743_c1 3300050494 Bacteria 2121
1428 nmdc:mga06z11_69102_c1 3300050494 Bacteria 1864
1429 nmdc:mga06z11_98423_c1 3300050494 Bacteria 1601
1430 nmdc:mga04h51_29563_c1 3300050495 Bacteria 1717
1431 nmdc:mga07m45_35137_c1 3300050496 Bacteria 2787
1432 nmdc:mga07m45_4123_c1 3300050496 Bacteria 7090
1433 nmdc:mga07m45_72950_c1 3300050496 Bacteria 1954
1434 nmdc:mga05p37_100845_c1 3300050507 Bacteria 3556
1435 nmdc:mga05p37_135988_c1 3300050507 Bacteria 3014
1436 nmdc:mga05p37_139882_c1 3300050507 Bacteria 2966
1437 nmdc:mga05p37_157982_c1 3300050507 Bacteria 2770
1438 nmdc:mga05p37_182298_c1 3300050507 Bacteria 2554
1439 nmdc:mga05p37_182887_c1 3300050507 Bacteria 2549
1440 nmdc:mga05p37_22797_c1 3300050507 Bacteria 7594
1441 nmdc:mga05p37_23000_c1 3300050507 Bacteria 7561
1442 nmdc:mga05p37_27139_c1 3300050507 Bacteria 6970
1443 nmdc:mga05p37_293512_c1 3300050507 Bacteria 1934
1444 nmdc:mga05p37_30648_c1 3300050507 Bacteria 6563
1445 nmdc:mga05p37_3248_c1 3300050507 Bacteria 18933
1446 nmdc:mga05p37_410214_c1 3300050507 Bacteria 1579
1447 nmdc:mga05p37_4358_c1 3300050507 Bacteria 16518
1448 nmdc:mga05p37_499553_c1 3300050507 Bacteria 1396
1449 nmdc:mga05p37_56197_c1 3300050507 Bacteria 4845
1450 nmdc:mga05p37_5656_c1 3300050507 Bacteria 14697
1451 nmdc:mga05p37_5966_c1 3300050507 Bacteria 14334
1452 nmdc:mga05p37_710271_c1 3300050507 Bacteria 1115
1453 nmdc:mga05p37_77520_c1 3300050507 Bacteria 4092
1454 nmdc:mga05p37_819968_c1 3300050507 Bacteria 1015
1455 nmdc:mga05p37_9004_c1 3300050507 Bacteria 11808
1456 nmdc:mga05p37_92793_c1 3300050507 Bacteria 3720
1457 nmdc:mga05p37_92829_c1 3300050507 Bacteria 3719
1458 nmdc:mga09592_102377_c1 3300050508 Bacteria 2453
1459 nmdc:mga09592_140269_c1 3300050508 Bacteria 2083
1460 nmdc:mga09592_200888_c1 3300050508 Bacteria 1726
1461 nmdc:mga09592_21841_c1 3300050508 Bacteria 5277
1462 nmdc:mga09592_229494_c1 3300050508 Bacteria 1608
1463 nmdc:mga09592_305981_c1 3300050508 Bacteria 1378
1464 nmdc:mga09592_33230_c1 3300050508 Bacteria 4305
1465 nmdc:mga09592_350441_c1 3300050508 Bacteria 1278
1466 nmdc:mga09592_501837_c1 3300050508 Bacteria 1045
1467 nmdc:mga09592_53415_c1 3300050508 Bacteria 3412
1468 nmdc:mga0qj67_12053_c1 3300050509 Bacteria 6500
1469 nmdc:mga0qj67_1372_c1 3300050509 Bacteria 17057
1470 nmdc:mga0qj67_140724_c1 3300050509 Bacteria 1956
1471 nmdc:mga0qj67_15564_c1 3300050509 Bacteria 5448
1472 nmdc:mga0qj67_184513_c1 3300050509 Bacteria 1695
1473 nmdc:mga0qj67_18817_c1 3300050509 Bacteria 5267
1474 nmdc:mga0qj67_21250_c1 3300050509 Bacteria 4979
1475 nmdc:mga0qj67_226883_c1 3300050509 Bacteria 1516
1476 nmdc:mga0qj67_278242_c1 3300050509 Bacteria 1356
1477 nmdc:mga0qj67_279919_c1 3300050509 Bacteria 1352
1478 nmdc:mga0qj67_32760_c1 3300050509 Bacteria 4055
1479 nmdc:mga0qj67_3737_c1 3300050509 Bacteria 10986
1480 nmdc:mga0qj67_395383_c1 3300050509 Bacteria 1116
1481 nmdc:mga0qj67_43389_c1 3300050509 Bacteria 3541
1482 nmdc:mga0qj67_60592_c1 3300050509 Bacteria 3004
1483 nmdc:mga0qj67_70845_c1 3300050509 Bacteria 2781
1484 nmdc:mga0qj67_7677_c1 3300050509 Bacteria 7972
1485 nmdc:mga0qj67_78819_c1 3300050509 Bacteria 2637
1486 nmdc:mga06r32_11495_c1 3300050510 Bacteria 7974
1487 nmdc:mga06r32_13337_c1 3300050510 Bacteria 7444
1488 nmdc:mga06r32_140891_c1 3300050510 Bacteria 2387
1489 nmdc:mga06r32_1894_c1 3300050510 Bacteria 18638
1490 nmdc:mga06r32_230360_c1 3300050510 Bacteria 1841
1491 nmdc:mga06r32_2550_c1 3300050510 Bacteria 16303
1492 nmdc:mga06r32_274862_c1 3300050510 Bacteria 1672
1493 nmdc:mga06r32_30469_c1 3300050510 Bacteria 5061
1494 nmdc:mga06r32_33568_c1 3300050510 Bacteria 4834
1495 nmdc:mga06r32_45035_c1 3300050510 Bacteria 4204
1496 nmdc:mga06r32_469572_c1 3300050510 Bacteria 1237
1497 nmdc:mga06r32_573578_c1 3300050510 Bacteria 1101
1498 nmdc:mga06r32_6112_c1 3300050510 Bacteria 10812
1499 nmdc:mga06r32_86937_c1 3300050510 Bacteria 3050
1500 nmdc:mga06r32_88345_c1 3300050510 Bacteria 3025
1501 nmdc:mga08y16_117069_c1 3300050511 Bacteria 2774
1502 nmdc:mga08y16_126947_c1 3300050511 Bacteria 2653
1503 nmdc:mga08y16_1346_c1 3300050511 Bacteria 24536
1504 nmdc:mga08y16_13565_c1 3300050511 Bacteria 8577
1505 nmdc:mga08y16_168920_c1 3300050511 Bacteria 2272
1506 nmdc:mga08y16_172620_c1 3300050511 Bacteria 2246
1507 nmdc:mga08y16_18656_c1 3300050511 Bacteria 7307
1508 nmdc:mga08y16_28899_c1 3300050511 Bacteria 5845
1509 nmdc:mga08y16_3012_c1 3300050511 Bacteria 17384
1510 nmdc:mga08y16_305_c1 3300050511 Bacteria 44208
1511 nmdc:mga08y16_349194_c1 3300050511 Bacteria 1520
1512 nmdc:mga08y16_461735_c1 3300050511 Bacteria 1294
1513 nmdc:mga08y16_492977_c1 3300050511 Bacteria 1246
1514 nmdc:mga08y16_508993_c1 3300050511 Bacteria 1222
1515 nmdc:mga08y16_59256_c1 3300050511 Bacteria 4000
1516 nmdc:mga08y16_631175_c1 3300050511 Bacteria 1077
1517 nmdc:mga08y16_810924_c1 3300050511 Bacteria 928
1518 nmdc:mga08y16_8_c1 3300050511 Bacteria 571177
1519 nmdc:mga08y16_91353_c1 3300050511 Bacteria 3173
1520 nmdc:mga0n895_109387_c1 3300050512 Bacteria 2779
1521 nmdc:mga0n895_154916_c1 3300050512 Bacteria 2322
1522 nmdc:mga0n895_205299_c1 3300050512 Bacteria 2001
1523 nmdc:mga0n895_2061_c1 3300050512 Bacteria 15480
1524 nmdc:mga0n895_21578_c1 3300050512 Bacteria 6026
1525 nmdc:mga0n895_22219_c1 3300050512 Bacteria 5947
1526 nmdc:mga0n895_23833_c1 3300050512 Bacteria 5759
1527 nmdc:mga0n895_23945_c1 3300050512 Bacteria 5747
1528 nmdc:mga0n895_27162_c1 3300050512 Bacteria 5435
1529 nmdc:mga0n895_30660_c1 3300050512 Bacteria 5141
1530 nmdc:mga0n895_321967_c1 3300050512 Bacteria 1567
1531 nmdc:mga0n895_33100_c1 3300050512 Bacteria 4966
1532 nmdc:mga0n895_38796_c1 3300050512 Bacteria 4617
1533 nmdc:mga0n895_4172_c1 3300050512 Bacteria 11796
1534 nmdc:mga0n895_548337_c1 3300050512 Bacteria 1162
1535 nmdc:mga0n895_62356_c1 3300050512 Bacteria 3684
1536 nmdc:mga0n895_731829_c1 3300050512 Bacteria 983
1537 nmdc:mga0rr50_25230_c1 3300050513 Bacteria 4130
1538 nmdc:mga0rr50_3770_c1 3300050513 Bacteria 8791
1539 nmdc:mga0rr50_42515_c1 3300050513 Bacteria 3319
1540 nmdc:mga0rr50_64_c1 3300050513 Bacteria 63318
1541 nmdc:mga0rr50_91448_c1 3300050513 Bacteria 2370
1542 nmdc:mga0rr50_9662_c1 3300050513 Bacteria 6080
1543 nmdc:mga0rr50_97120_c1 3300050513 Bacteria 2306
1544 nmdc:mga08x19_16231_c1 3300050514 Bacteria 4539
1545 nmdc:mga08x19_309497_c1 3300050514 Bacteria 1098
1546 nmdc:mga08x19_61_c1 3300050514 Bacteria 114972
1547 nmdc:mga0a205_103258_c1 3300050515 Bacteria 2749
1548 nmdc:mga0a205_13790_c1 3300050515 Bacteria 7534
1549 nmdc:mga0a205_19136_c1 3300050515 Bacteria 6453
1550 nmdc:mga0a205_193219_c1 3300050515 Bacteria 1927
1551 nmdc:mga0a205_20180_c1 3300050515 Bacteria 6286
1552 nmdc:mga0a205_27347_c1 3300050515 Bacteria 5448
1553 nmdc:mga0a205_2833_c1 3300050515 Bacteria 15361
1554 nmdc:mga0a205_297133_c1 3300050515 Bacteria 1488
1555 nmdc:mga0a205_33889_c1 3300050515 Bacteria 4897
1556 nmdc:mga0a205_3519_c1 3300050515 Bacteria 13993
1557 nmdc:mga0a205_35624_c2 3300050515 Bacteria 4431
1558 nmdc:mga0a205_3571_c1 3300050515 Bacteria 13925
1559 nmdc:mga0a205_37444_c1 3300050515 Bacteria 4664
1560 nmdc:mga0a205_87423_c1 3300050515 Bacteria 3011
1561 nmdc:mga0a205_9790_c1 3300050515 Bacteria 8788
1562 Ga0495601_0139586 3300053077 Bacteria 1580
1563 Ga0495601_0246828 3300053077 Bacteria 1166
1564 Ga0495612_0056643 3300053078 Bacteria 1618
1565 Ga0495595_0035041 3300053084 Bacteria 2273
1566 Ga0495595_0081163 3300053084 Bacteria 1545
1567 Ga0495619_0006723 3300053085 Bacteria 7275
1568 Ga0495619_0012883 3300053085 Bacteria 5266
1569 Ga0495619_0071133 3300053085 Bacteria 2327
1570 Ga0495619_0160885 3300053085 Bacteria 1551
1571 Ga0500651_0045656 3300053093 Bacteria 2756
1572 Ga0500556_0001090 3300053104 Bacteria 13654
1573 Ga0500645_034289 3300053730 Bacteria 1516
1574 Ga0501084_0014504 3300054114 Bacteria 6532
1575 Ga0501084_0056908 3300054114 Bacteria 3272
1576 Ga0501084_0105912 3300054114 Bacteria 2362
1577 Ga0501084_0121238 3300054114 Bacteria 2199
1578 Ga0590071_000965 3300059421 Bacteria 7930
1579 Ga0590071_002752 3300059421 Bacteria 4406
1580 Ga0590071_008132 3300059421 Bacteria 2476
1581 Ga0590071_014816 3300059421 Bacteria 1828
1582 Ga0590074_000608 3300059423 Bacteria 5391
1583 Ga0590074_001645 3300059423 Bacteria 3641
1584 Ga0590075_000105 3300059424 Bacteria 21626
1585 Ga0590075_000249 3300059424 Bacteria 15143
1586 Ga0590075_020314 3300059424 Bacteria 1653
1587 Ga0590077_000321 3300059426 Bacteria 13589
1588 Ga0590077_015262 3300059426 Bacteria 1605
1589 Ga0590077_025773 3300059426 Bacteria 1268
1590 Ga0501082_0001775 3300060353 Bacteria 18973
1591 Ga0501082_0008037 3300060353 Bacteria 9106
1592 Ga0501082_0032570 3300060353 Bacteria 4496
1593 Ga0501082_0035427 3300060353 Bacteria 4302
1594 Ga0501082_0051533 3300060353 Bacteria 3548
1595 Ga0501082_0119175 3300060353 Bacteria 2287
1596 Ga0530510_0013516 3300061734 Bacteria 5741
1597 Ga0530510_0017452 3300061734 Bacteria 5088
1598 Ga0530510_0076081 3300061734 Bacteria 2438
1599 Ga0530510_0144411 3300061734 Bacteria 1755
1600 Ga0530510_0177054 3300061734 Bacteria 1581
1601 Ga0530510_0252664 3300061734 Bacteria 1314

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049759 Ga0501262_009716 Ga0501262_009716_66_905 233
2 3300050514 nmdc:mga08x19_309497_c1 nmdc:mga08x19_309497_c1_15_716 233
3 3300049592 Ga0501076_0309603 Ga0501076_0309603_557_1285 242
4 3300006353 Ga0075370_10107821 Ga0075370_101078212 246
5 3300003781 Ga0055536_1014410 Ga0055536_10144103 255
6 3300005289 Ga0065704_10003491 Ga0065704_100034914 255
7 3300005456 Ga0070678_100205901 Ga0070678_1002059012 255
8 3300025292 Ga0209676_1000126 Ga0209676_1000126191 255
9 3300025298 Ga0209050_1009637 Ga0209050_10096374 255
10 3300025926 Ga0207659_10034429 Ga0207659_100344292 255
11 3300025936 Ga0207670_10090445 Ga0207670_100904453 255
12 3300026121 Ga0207683_10076480 Ga0207683_100764802 255
13 3300005366 Ga0070659_100476075 Ga0070659_1004760752 256
14 3300005617 Ga0068859_100182703 Ga0068859_1001827032 256
15 3300006353 Ga0075370_10002965 Ga0075370_100029653 256
16 3300006931 Ga0097620_100182706 Ga0097620_1001827062 256
17 3300025940 Ga0207691_10204698 Ga0207691_102046981 256
18 3300032002 Ga0307416_100539066 Ga0307416_1005390662 256
19 3300050494 nmdc:mga06z11_23541_c1 nmdc:mga06z11_23541_c1_1420_2277 256
20 3300050496 nmdc:mga07m45_35137_c1 nmdc:mga07m45_35137_c1_109_966 256
21 3300005331 Ga0070670_100188009 Ga0070670_1001880092 257
22 3300005471 Ga0070698_100005833 Ga0070698_10000583310 257
23 3300005844 Ga0068862_100036371 Ga0068862_1000363715 257
24 3300006846 Ga0075430_100227222 Ga0075430_1002272222 257
25 3300009094 Ga0111539_10177321 Ga0111539_101773212 257
26 3300013307 Ga0157372_10002034 Ga0157372_100020346 257
27 3300014326 Ga0157380_10205199 Ga0157380_102051993 257
28 3300025925 Ga0207650_10148683 Ga0207650_101486832 257
29 3300049589 Ga0501073_0262346 Ga0501073_0262346_172_984 257
30 3300050509 nmdc:mga0qj67_278242_c1 nmdc:mga0qj67_278242_c1_244_1035 257
31 3300050511 nmdc:mga08y16_91353_c1 nmdc:mga08y16_91353_c1_1517_2308 257
32 3300005834 Ga0068851_10009745 Ga0068851_100097452 258
33 3300006847 Ga0075431_100829290 Ga0075431_1008292901 258
34 3300009551 Ga0105238_10041514 Ga0105238_100415143 258
35 3300025321 Ga0207656_10029500 Ga0207656_100295002 258
36 3300042008 Ga0439450_006593 Ga0439450_006593_154_948 258
37 3300048907 Ga0496104_0385329 Ga0496104_0385329_39_920 258
38 3300048915 Ga0496112_0409571 Ga0496112_0409571_344_1225 258
39 3300049578 Ga0501042_0010365 Ga0501042_0010365_174_968 258
40 3300049587 Ga0501071_0156802 Ga0501071_0156802_643_1437 258
41 3300049824 Ga0501045_0017621 Ga0501045_0017621_3880_4674 258
42 3300050509 nmdc:mga0qj67_1372_c1 nmdc:mga0qj67_1372_c1_10516_11310 258
43 3300050510 nmdc:mga06r32_1894_c1 nmdc:mga06r32_1894_c1_14246_15040 258
44 3300050510 nmdc:mga06r32_573578_c1 nmdc:mga06r32_573578_c1_72_866 258
45 3300027866 Ga0209813_10037590 Ga0209813_100375902 259
46 3300031903 Ga0307407_10016324 Ga0307407_100163243 259
47 3300031911 Ga0307412_10015909 Ga0307412_100159093 259
48 3300031995 Ga0307409_100018639 Ga0307409_1000186394 259
49 3300032002 Ga0307416_100021733 Ga0307416_1000217332 259
50 3300032005 Ga0307411_10053053 Ga0307411_100530532 259
51 3300032126 Ga0307415_100276149 Ga0307415_1002761492 259
52 3300048904 Ga0496101_0485938 Ga0496101_0485938_159_950 259
53 3300050489 nmdc:mga03683_87618_c1 nmdc:mga03683_87618_c1_25_858 259
54 3300050494 nmdc:mga06z11_17629_c1 nmdc:mga06z11_17629_c1_1925_2758 259
55 3300050495 nmdc:mga04h51_29563_c1 nmdc:mga04h51_29563_c1_487_1320 259
56 3300005518 Ga0070699_100013377 Ga0070699_1000133773 260
57 3300005985 Ga0081539_10008561 Ga0081539_100085613 260
58 3300006178 Ga0075367_10013792 Ga0075367_100137924 260
59 3300009094 Ga0111539_10454486 Ga0111539_104544862 260
60 3300026067 Ga0207678_10018608 Ga0207678_100186085 260
61 3300026089 Ga0207648_10237586 Ga0207648_102375862 260
62 3300046664 Ga0495659_0007336 Ga0495659_0007336_1917_2768 260
63 3300049588 Ga0501072_0032056 Ga0501072_0032056_809_1636 260
64 3300050494 nmdc:mga06z11_98423_c1 nmdc:mga06z11_98423_c1_335_1192 260
65 3300053104 Ga0500556_0001090 Ga0500556_0001090_6078_6887 260
66 3300053730 Ga0500645_034289 Ga0500645_034289_604_1413 260
67 3300054114 Ga0501084_0056908 Ga0501084_0056908_843_1670 260
68 3300005329 Ga0070683_100312240 Ga0070683_1003122401 261
69 3300005843 Ga0068860_100370336 Ga0068860_1003703362 261
70 3300005985 Ga0081539_10001310 Ga0081539_1000131012 261
71 3300006048 Ga0075363_100212939 Ga0075363_1002129391 261
72 3300009094 Ga0111539_10629621 Ga0111539_106296212 261
73 3300031548 Ga0307408_100007332 Ga0307408_1000073326 261
74 3300031731 Ga0307405_10009672 Ga0307405_100096723 261
75 3300031824 Ga0307413_10003155 Ga0307413_100031555 261
76 3300031852 Ga0307410_10000925 Ga0307410_100009258 261
77 3300031901 Ga0307406_10021661 Ga0307406_100216612 261
78 3300031903 Ga0307407_10001659 Ga0307407_100016595 261
79 3300031995 Ga0307409_100034921 Ga0307409_1000349214 261
80 3300032002 Ga0307416_100001034 Ga0307416_1000010345 261
81 3300032002 Ga0307416_100138362 Ga0307416_1001383622 261
82 3300032004 Ga0307414_10006777 Ga0307414_100067775 261
83 3300032005 Ga0307411_10004081 Ga0307411_100040814 261
84 3300032005 Ga0307411_10208860 Ga0307411_102088602 261
85 3300032126 Ga0307415_100001309 Ga0307415_1000013099 261
86 3300035086 Ga0373934_0080813 Ga0373934_0080813_463_1275 261
87 3300035117 Ga0373953_0046528 Ga0373953_0046528_352_1164 261
88 3300035692 Ga0373935_0123266 Ga0373935_0123266_189_1001 261
89 3300035724 Ga0373933_0080690 Ga0373933_0080690_831_1643 261
90 3300036401 Ga0373937_0271633 Ga0373937_0271633_543_1355 261
91 3300046809 Ga0495600_0196953 Ga0495600_0196953_245_1057 261
92 3300048903 Ga0496100_0101472 Ga0496100_0101472_822_1634 261
93 3300048905 Ga0496102_0074011 Ga0496102_0074011_373_1185 261
94 3300048918 Ga0496115_0327575 Ga0496115_0327575_150_962 261
95 3300049575 Ga0501039_0028659 Ga0501039_0028659_2508_3314 261
96 3300049575 Ga0501039_0093607 Ga0501039_0093607_144_944 261
97 3300049576 Ga0501040_0124483 Ga0501040_0124483_974_1774 261
98 3300049578 Ga0501042_0019545 Ga0501042_0019545_657_1457 261
99 3300049582 Ga0501048_0046776 Ga0501048_0046776_1860_2660 261
100 3300049588 Ga0501072_0020902 Ga0501072_0020902_1651_2451 261
101 3300049588 Ga0501072_0056352 Ga0501072_0056352_1747_2553 261
102 3300049590 Ga0501074_0249729 Ga0501074_0249729_69_869 261
103 3300049591 Ga0501075_0023327 Ga0501075_0023327_3024_3824 261
104 3300049591 Ga0501075_0125940 Ga0501075_0125940_284_1090 261
105 3300049591 Ga0501075_0180846 Ga0501075_0180846_383_1201 261
106 3300049592 Ga0501076_0084176 Ga0501076_0084176_622_1422 261
107 3300049592 Ga0501076_0150532 Ga0501076_0150532_555_1361 261
108 3300049593 Ga0501077_0033158 Ga0501077_0033158_174_992 261
109 3300049741 Ga0501079_0055209 Ga0501079_0055209_109_909 261
110 3300049741 Ga0501079_0109721 Ga0501079_0109721_795_1601 261
111 3300049743 Ga0501081_0013818 Ga0501081_0013818_3855_4673 261
112 3300049743 Ga0501081_0090799 Ga0501081_0090799_1080_1886 261
113 3300049824 Ga0501045_0021686 Ga0501045_0021686_3010_3810 261
114 3300050491 nmdc:mga00v17_201280_c1 nmdc:mga00v17_201280_c1_117_974 261
115 3300050492 nmdc:mga0yw44_135505_c1 nmdc:mga0yw44_135505_c1_345_1151 261
116 3300050509 nmdc:mga0qj67_395383_c1 nmdc:mga0qj67_395383_c1_242_1045 261
117 3300050509 nmdc:mga0qj67_70845_c1 nmdc:mga0qj67_70845_c1_640_1443 261
118 3300050511 nmdc:mga08y16_117069_c1 nmdc:mga08y16_117069_c1_1635_2438 261
119 3300050511 nmdc:mga08y16_631175_c1 nmdc:mga08y16_631175_c1_182_982 261
120 3300050511 nmdc:mga08y16_810924_c1 nmdc:mga08y16_810924_c1_109_915 261
121 3300053077 Ga0495601_0139586 Ga0495601_0139586_552_1364 261
122 3300053077 Ga0495601_0246828 Ga0495601_0246828_343_1152 261
123 3300053078 Ga0495612_0056643 Ga0495612_0056643_336_1148 261
124 3300053084 Ga0495595_0035041 Ga0495595_0035041_1173_1985 261
125 3300053085 Ga0495619_0006723 Ga0495619_0006723_6234_7043 261
126 3300053085 Ga0495619_0071133 Ga0495619_0071133_752_1564 261
127 3300060353 Ga0501082_0051533 Ga0501082_0051533_761_1561 261
128 3300005327 Ga0070658_10144941 Ga0070658_101449413 262
129 3300005547 Ga0070693_100131728 Ga0070693_1001317282 262
130 3300005617 Ga0068859_100359634 Ga0068859_1003596342 262
131 3300006846 Ga0075430_100022496 Ga0075430_1000224962 262
132 3300006847 Ga0075431_100005006 Ga0075431_1000050064 262
133 3300006871 Ga0075434_100001025 Ga0075434_10000102510 262
134 3300006931 Ga0097620_100359626 Ga0097620_1003596262 262
135 3300007076 Ga0075435_100147858 Ga0075435_1001478582 262
136 3300009147 Ga0114129_10345858 Ga0114129_103458582 262
137 3300025936 Ga0207670_10247817 Ga0207670_102478172 262
138 3300025945 Ga0207679_10665467 Ga0207679_106654671 262
139 3300026116 Ga0207674_10166878 Ga0207674_101668783 262
140 3300032002 Ga0307416_100045895 Ga0307416_1000458954 262
141 3300032126 Ga0307415_100197895 Ga0307415_1001978952 262
142 3300049575 Ga0501039_0228170 Ga0501039_0228170_255_1076 262
143 3300049578 Ga0501042_0105418 Ga0501042_0105418_37_858 262
144 3300049582 Ga0501048_0205886 Ga0501048_0205886_251_1072 262
145 3300049592 Ga0501076_0269759 Ga0501076_0269759_394_1215 262
146 3300050507 nmdc:mga05p37_139882_c1 nmdc:mga05p37_139882_c1_1551_2369 262
147 3300050507 nmdc:mga05p37_182298_c1 nmdc:mga05p37_182298_c1_1563_2426 262
148 3300050508 nmdc:mga09592_21841_c1 nmdc:mga09592_21841_c1_2361_3179 262
149 3300050509 nmdc:mga0qj67_3737_c1 nmdc:mga0qj67_3737_c1_2361_3179 262
150 3300050510 nmdc:mga06r32_2550_c1 nmdc:mga06r32_2550_c1_8450_9268 262
151 3300050510 nmdc:mga06r32_33568_c1 nmdc:mga06r32_33568_c1_2545_3363 262
152 3300061734 Ga0530510_0144411 Ga0530510_0144411_455_1276 262
153 iso_pu_bacteria 2574179768 2574430547 262
154 3300002459 JGI24751J29686_10000006 JGI24751J29686_1000000616 263
155 3300005293 Ga0065715_10137126 Ga0065715_101371261 263
156 3300005364 Ga0070673_100176242 Ga0070673_1001762421 263
157 3300005365 Ga0070688_100175414 Ga0070688_1001754142 263
158 3300005539 Ga0068853_100228410 Ga0068853_1002284102 263
159 3300005985 Ga0081539_10045948 Ga0081539_100459482 263
160 3300005985 Ga0081539_10050409 Ga0081539_100504092 263
161 3300006195 Ga0075366_10067559 Ga0075366_100675592 263
162 3300009553 Ga0105249_10035705 Ga0105249_100357055 263
163 3300009553 Ga0105249_10198834 Ga0105249_101988342 263
164 3300013306 Ga0163162_10080844 Ga0163162_100808444 263
165 3300013307 Ga0157372_10049885 Ga0157372_100498856 263
166 3300014326 Ga0157380_10012272 Ga0157380_100122724 263
167 3300021384 Ga0213876_10000246 Ga0213876_1000024621 263
168 3300027907 Ga0207428_10027905 Ga0207428_100279055 263
169 3300028794 Ga0307515_10263806 Ga0307515_102638062 263
170 3300031456 Ga0307513_10001475 Ga0307513_1000147511 263
171 3300035695 Ga0373927_0006039 Ga0373927_0006039_3275_4123 263
172 3300037853 Ga0436364_0471062 Ga0436364_0471062_174_1016 263
173 3300038996 Ga0242420_004956 Ga0242420_004956_1098_1952 263
174 3300039437 Ga0436365_0213934 Ga0436365_0213934_26116_26946 263
175 3300042007 Ga0439449_0078563 Ga0439449_0078563_349_1155 263
176 3300046535 Ga0495586_0192872 Ga0495586_0192872_135_980 263
177 3300046543 Ga0495645_0136661 Ga0495645_0136661_198_1013 263
178 3300047318 Ga0495636_0036371 Ga0495636_0036371_54_863 263
179 3300049569 Ga0501032_0003907 Ga0501032_0003907_780_1613 263
180 3300049570 Ga0501033_0006400 Ga0501033_0006400_170_1003 263
181 3300049571 Ga0501034_0012200 Ga0501034_0012200_1992_2819 263
182 3300049575 Ga0501039_0006831 Ga0501039_0006831_7792_8625 263
183 3300049576 Ga0501040_0197333 Ga0501040_0197333_51_884 263
184 3300049579 Ga0501043_0014997 Ga0501043_0014997_4456_5289 263
185 3300049580 Ga0501046_0038669 Ga0501046_0038669_434_1267 263
186 3300049582 Ga0501048_0012926 Ga0501048_0012926_2809_3642 263
187 3300049583 Ga0501067_0002039 Ga0501067_0002039_8768_9601 263
188 3300049585 Ga0501069_0000895 Ga0501069_0000895_10734_11567 263
189 3300049586 Ga0501070_0051397 Ga0501070_0051397_29_862 263
190 3300049587 Ga0501071_0134020 Ga0501071_0134020_546_1358 263
191 3300049588 Ga0501072_0053968 Ga0501072_0053968_1145_1957 263
192 3300049588 Ga0501072_0094260 Ga0501072_0094260_171_1004 263
193 3300049589 Ga0501073_0029470 Ga0501073_0029470_529_1362 263
194 3300049590 Ga0501074_0036613 Ga0501074_0036613_1978_2811 263
195 3300049593 Ga0501077_0046508 Ga0501077_0046508_220_1032 263
196 3300049742 Ga0501080_0061125 Ga0501080_0061125_590_1423 263
197 3300050507 nmdc:mga05p37_157982_c1 nmdc:mga05p37_157982_c1_749_1561 263
198 3300050511 nmdc:mga08y16_59256_c1 nmdc:mga08y16_59256_c1_3047_3865 263
199 3300054114 Ga0501084_0121238 Ga0501084_0121238_739_1551 263
200 3300060353 Ga0501082_0008037 Ga0501082_0008037_384_1217 263
201 3300060353 Ga0501082_0119175 Ga0501082_0119175_591_1403 263
202 3300061734 Ga0530510_0252664 Ga0530510_0252664_491_1303 263
203 3300005288 Ga0065714_10064454 Ga0065714_1006445420 264
204 3300005290 Ga0065712_10000129 Ga0065712_1000012949 264
205 3300005290 Ga0065712_10033042 Ga0065712_100330421 264
206 3300005290 Ga0065712_10096094 Ga0065712_100960944 264
207 3300005293 Ga0065715_10009486 Ga0065715_100094864 264
208 3300005293 Ga0065715_10011827 Ga0065715_100118274 264
209 3300005293 Ga0065715_10096915 Ga0065715_100969153 264
210 3300005293 Ga0065715_10097145 Ga0065715_100971453 264
211 3300005293 Ga0065715_10136337 Ga0065715_101363372 264
212 3300005295 Ga0065707_10004325 Ga0065707_100043251 264
213 3300005295 Ga0065707_10234035 Ga0065707_102340351 264
214 3300005329 Ga0070683_100058248 Ga0070683_1000582485 264
215 3300005335 Ga0070666_10111455 Ga0070666_101114551 264
216 3300005336 Ga0070680_100259800 Ga0070680_1002598002 264
217 3300005338 Ga0068868_100230220 Ga0068868_1002302201 264
218 3300005340 Ga0070689_100041858 Ga0070689_1000418584 264
219 3300005343 Ga0070687_100072424 Ga0070687_1000724242 264
220 3300005354 Ga0070675_100079490 Ga0070675_1000794902 264
221 3300005355 Ga0070671_100038308 Ga0070671_1000383082 264
222 3300005356 Ga0070674_100034079 Ga0070674_1000340793 264
223 3300005364 Ga0070673_100008472 Ga0070673_1000084727 264
224 3300005364 Ga0070673_100039432 Ga0070673_1000394322 264
225 3300005365 Ga0070688_100078839 Ga0070688_1000788392 264
226 3300005367 Ga0070667_100130743 Ga0070667_1001307432 264
227 3300005440 Ga0070705_100074618 Ga0070705_1000746182 264
228 3300005441 Ga0070700_100001066 Ga0070700_10000106611 264
229 3300005444 Ga0070694_100154760 Ga0070694_1001547602 264
230 3300005444 Ga0070694_100376765 Ga0070694_1003767652 264
231 3300005457 Ga0070662_100017717 Ga0070662_1000177175 264
232 3300005459 Ga0068867_100005057 Ga0068867_1000050577 264
233 3300005543 Ga0070672_100116219 Ga0070672_1001162192 264
234 3300005545 Ga0070695_100027184 Ga0070695_1000271842 264
235 3300005546 Ga0070696_100321060 Ga0070696_1003210602 264
236 3300005564 Ga0070664_100007577 Ga0070664_1000075773 264
237 3300005578 Ga0068854_100124346 Ga0068854_1001243462 264
238 3300005615 Ga0070702_100005407 Ga0070702_1000054074 264
239 3300005617 Ga0068859_100072181 Ga0068859_1000721814 264
240 3300005618 Ga0068864_100429737 Ga0068864_1004297372 264
241 3300005718 Ga0068866_10204119 Ga0068866_102041191 264
242 3300005719 Ga0068861_100175687 Ga0068861_1001756872 264
243 3300005834 Ga0068851_10151217 Ga0068851_101512172 264
244 3300005841 Ga0068863_100278254 Ga0068863_1002782542 264
245 3300005842 Ga0068858_100014841 Ga0068858_1000148412 264
246 3300005844 Ga0068862_100108386 Ga0068862_1001083864 264
247 3300005985 Ga0081539_10000033 Ga0081539_10000033210 264
248 3300005985 Ga0081539_10001228 Ga0081539_1000122821 264
249 3300006846 Ga0075430_100291515 Ga0075430_1002915152 264
250 3300006852 Ga0075433_10139845 Ga0075433_101398453 264
251 3300006914 Ga0075436_100022162 Ga0075436_1000221625 264
252 3300006931 Ga0097620_100072184 Ga0097620_1000721842 264
253 3300007076 Ga0075435_100002015 Ga0075435_10000201510 264
254 3300009094 Ga0111539_10021872 Ga0111539_100218723 264
255 3300009148 Ga0105243_10344097 Ga0105243_103440972 264
256 3300009174 Ga0105241_10038980 Ga0105241_100389803 264
257 3300009176 Ga0105242_10012013 Ga0105242_100120132 264
258 3300009177 Ga0105248_10005677 Ga0105248_1000567710 264
259 3300009177 Ga0105248_10081421 Ga0105248_100814214 264
260 3300009553 Ga0105249_10083211 Ga0105249_100832112 264
261 3300014325 Ga0163163_10121246 Ga0163163_101212463 264
262 3300014969 Ga0157376_10325412 Ga0157376_103254121 264
263 3300021384 Ga0213876_10000089 Ga0213876_1000008938 264
264 3300025899 Ga0207642_10123959 Ga0207642_101239591 264
265 3300025901 Ga0207688_10068296 Ga0207688_100682963 264
266 3300025911 Ga0207654_10032217 Ga0207654_100322171 264
267 3300025918 Ga0207662_10003864 Ga0207662_100038646 264
268 3300025923 Ga0207681_10397707 Ga0207681_103977071 264
269 3300025925 Ga0207650_10005345 Ga0207650_100053459 264
270 3300025925 Ga0207650_10023246 Ga0207650_100232462 264
271 3300025931 Ga0207644_10036907 Ga0207644_100369074 264
272 3300025934 Ga0207686_10019899 Ga0207686_100198994 264
273 3300025935 Ga0207709_10300914 Ga0207709_103009142 264
274 3300025936 Ga0207670_10039118 Ga0207670_100391184 264
275 3300025940 Ga0207691_10103872 Ga0207691_101038722 264
276 3300025941 Ga0207711_10018903 Ga0207711_100189032 264
277 3300025942 Ga0207689_10023903 Ga0207689_100239035 264
278 3300025945 Ga0207679_10068048 Ga0207679_100680483 264
279 3300025960 Ga0207651_10004256 Ga0207651_100042566 264
280 3300025960 Ga0207651_10033611 Ga0207651_100336112 264
281 3300025961 Ga0207712_10363539 Ga0207712_103635392 264
282 3300025981 Ga0207640_10302223 Ga0207640_103022232 264
283 3300026067 Ga0207678_10249878 Ga0207678_102498782 264
284 3300026075 Ga0207708_10007505 Ga0207708_100075059 264
285 3300026088 Ga0207641_10224357 Ga0207641_102243572 264
286 3300026089 Ga0207648_10007004 Ga0207648_100070049 264
287 3300026095 Ga0207676_10123564 Ga0207676_101235642 264
288 3300026118 Ga0207675_100010590 Ga0207675_1000105902 264
289 3300027907 Ga0207428_10003981 Ga0207428_100039812 264
290 3300027907 Ga0207428_10050815 Ga0207428_100508153 264
291 3300031548 Ga0307408_100056564 Ga0307408_1000565643 264
292 3300035115 Ga0373941_0052168 Ga0373941_0052168_346_1170 264
293 3300035692 Ga0373935_0097932 Ga0373935_0097932_884_1705 264
294 3300036401 Ga0373937_0381883 Ga0373937_0381883_373_1194 264
295 3300036401 Ga0373937_0463967 Ga0373937_0463967_160_999 264
296 3300039437 Ga0436365_1738066 Ga0436365_1738066_69185_70021 264
297 3300042131 Ga0450894_002846 Ga0450894_002846_1035_1862 264
298 3300042133 Ga0450896_000909 Ga0450896_000909_2152_2979 264
299 3300042184 Ga0450908_017698 Ga0450908_017698_82_909 264
300 3300048905 Ga0496102_0268990 Ga0496102_0268990_633_1457 264
301 3300048910 Ga0496107_0146580 Ga0496107_0146580_704_1528 264
302 3300048912 Ga0496109_0051136 Ga0496109_0051136_75_899 264
303 3300048915 Ga0496112_0046092 Ga0496112_0046092_2157_2978 264
304 3300050509 nmdc:mga0qj67_279919_c1 nmdc:mga0qj67_279919_c1_323_1156 264
305 3300050511 nmdc:mga08y16_168920_c1 nmdc:mga08y16_168920_c1_1303_2127 264
306 3300050511 nmdc:mga08y16_172620_c1 nmdc:mga08y16_172620_c1_1353_2177 264
307 3300050511 nmdc:mga08y16_492977_c1 nmdc:mga08y16_492977_c1_276_1106 264
308 3300050513 nmdc:mga0rr50_25230_c1 nmdc:mga0rr50_25230_c1_276_1100 264
309 3300050514 nmdc:mga08x19_16231_c1 nmdc:mga08x19_16231_c1_3093_3899 264
310 3300053085 Ga0495619_0012883 Ga0495619_0012883_2090_2911 264
311 3300005295 Ga0065707_10139719 Ga0065707_101397191 265
312 3300005339 Ga0070660_100243944 Ga0070660_1002439441 265
313 3300005345 Ga0070692_10355656 Ga0070692_103556561 265
314 3300005354 Ga0070675_100114140 Ga0070675_1001141402 265
315 3300005444 Ga0070694_100082009 Ga0070694_1000820092 265
316 3300005445 Ga0070708_100116265 Ga0070708_1001162653 265
317 3300005459 Ga0068867_100022319 Ga0068867_1000223193 265
318 3300005471 Ga0070698_100010135 Ga0070698_1000101358 265
319 3300005471 Ga0070698_100228575 Ga0070698_1002285752 265
320 3300005518 Ga0070699_100003161 Ga0070699_10000316110 265
321 3300005544 Ga0070686_100010067 Ga0070686_1000100673 265
322 3300005545 Ga0070695_100441709 Ga0070695_1004417091 265
323 3300005546 Ga0070696_100004873 Ga0070696_1000048732 265
324 3300005577 Ga0068857_100723369 Ga0068857_1007233691 265
325 3300006846 Ga0075430_100015854 Ga0075430_1000158549 265
326 3300006871 Ga0075434_100040045 Ga0075434_1000400452 265
327 3300009093 Ga0105240_10232149 Ga0105240_102321493 265
328 3300009101 Ga0105247_10000004 Ga0105247_10000004150 265
329 3300009147 Ga0114129_10389917 Ga0114129_103899172 265
330 3300009147 Ga0114129_10820424 Ga0114129_108204242 265
331 3300009551 Ga0105238_10393195 Ga0105238_103931952 265
332 3300014968 Ga0157379_10095877 Ga0157379_100958774 265
333 3300025912 Ga0207707_10217783 Ga0207707_102177832 265
334 3300025913 Ga0207695_10121226 Ga0207695_101212263 265
335 3300025926 Ga0207659_10096339 Ga0207659_100963392 265
336 3300025933 Ga0207706_10311383 Ga0207706_103113832 265
337 3300026089 Ga0207648_10123405 Ga0207648_101234053 265
338 3300026089 Ga0207648_10488563 Ga0207648_104885632 265
339 3300026116 Ga0207674_10476131 Ga0207674_104761312 265
340 3300031548 Ga0307408_100277661 Ga0307408_1002776612 265
341 3300032126 Ga0307415_100232061 Ga0307415_1002320612 265
342 3300042008 Ga0439450_045881 Ga0439450_045881_83_910 265
343 3300042439 Ga0439464_0099460 Ga0439464_0099460_45_872 265
344 3300046525 Ga0495663_0006358 Ga0495663_0006358_2204_3037 265
345 3300046537 Ga0495598_0041174 Ga0495598_0041174_465_1283 265
346 3300046664 Ga0495659_0065838 Ga0495659_0065838_296_1114 265
347 3300046664 Ga0495659_0090540 Ga0495659_0090540_80_883 265
348 3300047447 Ga0495685_006116 Ga0495685_006116_1725_2558 265
349 3300049652 Ga0501202_026551 Ga0501202_026551_19_843 265
350 3300050507 nmdc:mga05p37_5656_c1 nmdc:mga05p37_5656_c1_4548_5351 265
351 3300050509 nmdc:mga0qj67_12053_c1 nmdc:mga0qj67_12053_c1_673_1497 265
352 3300050515 nmdc:mga0a205_13790_c1 nmdc:mga0a205_13790_c1_599_1402 265
353 3300053084 Ga0495595_0081163 Ga0495595_0081163_161_1000 265
354 3300059421 Ga0590071_000965 Ga0590071_000965_4064_4885 265
355 3300059421 Ga0590071_002752 Ga0590071_002752_1500_2321 265
356 3300059421 Ga0590071_014816 Ga0590071_014816_510_1340 265
357 3300059423 Ga0590074_000608 Ga0590074_000608_1574_2395 265
358 3300059424 Ga0590075_000105 Ga0590075_000105_249_1070 265
359 3300059426 Ga0590077_000321 Ga0590077_000321_11742_12563 265
360 3300059426 Ga0590077_015262 Ga0590077_015262_55_885 265
361 3300003203 JGI25406J46586_10001261 JGI25406J46586_100012616 266
362 3300003203 JGI25406J46586_10025534 JGI25406J46586_100255342 266
363 3300005295 Ga0065707_10001718 Ga0065707_100017185 266
364 3300005549 Ga0070704_100168755 Ga0070704_1001687552 266
365 3300005844 Ga0068862_100052208 Ga0068862_1000522084 266
366 3300005985 Ga0081539_10000112 Ga0081539_1000011284 266
367 3300005985 Ga0081539_10000351 Ga0081539_100003517 266
368 3300006844 Ga0075428_100000008 Ga0075428_10000000864 266
369 3300006844 Ga0075428_100011956 Ga0075428_1000119564 266
370 3300006846 Ga0075430_100005511 Ga0075430_1000055119 266
371 3300006846 Ga0075430_100421977 Ga0075430_1004219772 266
372 3300006847 Ga0075431_100060897 Ga0075431_1000608973 266
373 3300006847 Ga0075431_100098071 Ga0075431_1000980711 266
374 3300006880 Ga0075429_100092883 Ga0075429_1000928831 266
375 3300009094 Ga0111539_10000020 Ga0111539_100000208 266
376 3300009094 Ga0111539_10120419 Ga0111539_101204193 266
377 3300009147 Ga0114129_10416995 Ga0114129_104169952 266
378 3300011119 Ga0105246_10450580 Ga0105246_104505802 266
379 3300017792 Ga0163161_10401799 Ga0163161_104017991 266
380 3300025923 Ga0207681_10271628 Ga0207681_102716282 266
381 3300025941 Ga0207711_10109616 Ga0207711_101096162 266
382 3300026118 Ga0207675_100076608 Ga0207675_1000766084 266
383 3300027876 Ga0209974_10073848 Ga0209974_100738481 266
384 3300027907 Ga0207428_10000021 Ga0207428_10000021144 266
385 3300028380 Ga0268265_10012863 Ga0268265_100128631 266
386 3300031548 Ga0307408_100048556 Ga0307408_1000485562 266
387 3300031824 Ga0307413_10003900 Ga0307413_100039003 266
388 3300031852 Ga0307410_10004363 Ga0307410_100043636 266
389 3300031901 Ga0307406_10047951 Ga0307406_100479513 266
390 3300031903 Ga0307407_10002477 Ga0307407_100024773 266
391 3300032002 Ga0307416_100077626 Ga0307416_1000776263 266
392 3300032004 Ga0307414_10020082 Ga0307414_100200822 266
393 3300032005 Ga0307411_10285452 Ga0307411_102854522 266
394 3300032126 Ga0307415_100003706 Ga0307415_1000037066 266
395 3300032126 Ga0307415_100186992 Ga0307415_1001869922 266
396 3300045051 Ga0451576_0009630 Ga0451576_0009630_4693_5526 266
397 3300049570 Ga0501033_0101008 Ga0501033_0101008_1178_2011 266
398 3300049572 Ga0501036_0006885 Ga0501036_0006885_4086_4919 266
399 3300049573 Ga0501037_0210026 Ga0501037_0210026_495_1319 266
400 3300049574 Ga0501038_0086871 Ga0501038_0086871_302_1135 266
401 3300049576 Ga0501040_0004671 Ga0501040_0004671_4094_4927 266
402 3300049577 Ga0501041_0135543 Ga0501041_0135543_44_868 266
403 3300049578 Ga0501042_0001834 Ga0501042_0001834_1365_2198 266
404 3300049579 Ga0501043_0085823 Ga0501043_0085823_1049_1882 266
405 3300049587 Ga0501071_0017152 Ga0501071_0017152_1746_2579 266
406 3300049591 Ga0501075_0000554 Ga0501075_0000554_11448_12281 266
407 3300049591 Ga0501075_0015728 Ga0501075_0015728_123_947 266
408 3300049592 Ga0501076_0003510 Ga0501076_0003510_971_1804 266
409 3300049592 Ga0501076_0109399 Ga0501076_0109399_90_914 266
410 3300049593 Ga0501077_0016546 Ga0501077_0016546_724_1557 266
411 3300049665 Ga0501227_067562 Ga0501227_067562_13_855 266
412 3300049674 Ga0501242_000951 Ga0501242_000951_1687_2562 266
413 3300049679 Ga0501249_009340 Ga0501249_009340_612_1487 266
414 3300049741 Ga0501079_0002354 Ga0501079_0002354_5038_5871 266
415 3300049742 Ga0501080_0115617 Ga0501080_0115617_775_1608 266
416 3300049743 Ga0501081_0000345 Ga0501081_0000345_18154_18987 266
417 3300049743 Ga0501081_0058384 Ga0501081_0058384_429_1253 266
418 3300049744 Ga0501083_0104087 Ga0501083_0104087_605_1438 266
419 3300049760 Ga0501263_002220 Ga0501263_002220_376_1251 266
420 3300049764 Ga0501267_003283 Ga0501267_003283_99_941 266
421 3300049765 Ga0501268_000144 Ga0501268_000144_3766_4641 266
422 3300049770 Ga0501273_004123 Ga0501273_004123_673_1548 266
423 3300049824 Ga0501045_0007589 Ga0501045_0007589_3395_4228 266
424 3300049824 Ga0501045_0017006 Ga0501045_0017006_2397_3221 266
425 3300050507 nmdc:mga05p37_77520_c1 nmdc:mga05p37_77520_c1_2401_3207 266
426 3300050507 nmdc:mga05p37_9004_c1 nmdc:mga05p37_9004_c1_8552_9379 266
427 3300050508 nmdc:mga09592_200888_c1 nmdc:mga09592_200888_c1_52_864 266
428 3300050508 nmdc:mga09592_501837_c1 nmdc:mga09592_501837_c1_97_924 266
429 3300050509 nmdc:mga0qj67_21250_c1 nmdc:mga0qj67_21250_c1_2974_3801 266
430 3300050509 nmdc:mga0qj67_78819_c1 nmdc:mga0qj67_78819_c1_1049_1876 266
431 3300050510 nmdc:mga06r32_88345_c1 nmdc:mga06r32_88345_c1_2178_3005 266
432 3300050511 nmdc:mga08y16_8_c1 nmdc:mga08y16_8_c1_259549_260376 266
433 3300054114 Ga0501084_0014504 Ga0501084_0014504_4510_5343 266
434 3300060353 Ga0501082_0001775 Ga0501082_0001775_12066_12899 266
435 3300060353 Ga0501082_0032570 Ga0501082_0032570_2834_3658 266
436 3300061734 Ga0530510_0076081 Ga0530510_0076081_1071_1904 266
437 3300061734 Ga0530510_0177054 Ga0530510_0177054_716_1540 266
438 3300005293 Ga0065715_10126373 Ga0065715_101263733 267
439 3300005293 Ga0065715_10132364 Ga0065715_101323642 267
440 3300005331 Ga0070670_100001636 Ga0070670_10000163616 267
441 3300005331 Ga0070670_100011871 Ga0070670_1000118714 267
442 3300005334 Ga0068869_100003292 Ga0068869_1000032927 267
443 3300005338 Ga0068868_100387104 Ga0068868_1003871042 267
444 3300005340 Ga0070689_100039966 Ga0070689_1000399662 267
445 3300005343 Ga0070687_100024449 Ga0070687_1000244491 267
446 3300005345 Ga0070692_10018539 Ga0070692_100185394 267
447 3300005354 Ga0070675_100000141 Ga0070675_10000014122 267
448 3300005354 Ga0070675_100006676 Ga0070675_1000066764 267
449 3300005354 Ga0070675_100028453 Ga0070675_1000284533 267
450 3300005355 Ga0070671_100014706 Ga0070671_1000147064 267
451 3300005356 Ga0070674_100007461 Ga0070674_1000074614 267
452 3300005356 Ga0070674_100101347 Ga0070674_1001013472 267
453 3300005356 Ga0070674_100301113 Ga0070674_1003011132 267
454 3300005364 Ga0070673_100016636 Ga0070673_1000166361 267
455 3300005364 Ga0070673_100029004 Ga0070673_1000290043 267
456 3300005406 Ga0070703_10032550 Ga0070703_100325502 267
457 3300005438 Ga0070701_10057955 Ga0070701_100579552 267
458 3300005438 Ga0070701_10095807 Ga0070701_100958072 267
459 3300005440 Ga0070705_100000633 Ga0070705_1000006336 267
460 3300005441 Ga0070700_100003819 Ga0070700_1000038195 267
461 3300005441 Ga0070700_100232871 Ga0070700_1002328712 267
462 3300005444 Ga0070694_100002021 Ga0070694_1000020217 267
463 3300005444 Ga0070694_100002448 Ga0070694_1000024486 267
464 3300005444 Ga0070694_100029136 Ga0070694_1000291363 267
465 3300005444 Ga0070694_100111746 Ga0070694_1001117462 267
466 3300005456 Ga0070678_100100704 Ga0070678_1001007043 267
467 3300005456 Ga0070678_100106503 Ga0070678_1001065032 267
468 3300005456 Ga0070678_100228295 Ga0070678_1002282952 267
469 3300005457 Ga0070662_100181044 Ga0070662_1001810442 267
470 3300005459 Ga0068867_100001877 Ga0068867_10000187710 267
471 3300005467 Ga0070706_100249513 Ga0070706_1002495132 267
472 3300005471 Ga0070698_100004987 Ga0070698_10000498712 267
473 3300005518 Ga0070699_100301931 Ga0070699_1003019311 267
474 3300005536 Ga0070697_100373534 Ga0070697_1003735342 267
475 3300005543 Ga0070672_100016168 Ga0070672_1000161684 267
476 3300005543 Ga0070672_100092743 Ga0070672_1000927432 267
477 3300005543 Ga0070672_100200827 Ga0070672_1002008272 267
478 3300005544 Ga0070686_100034397 Ga0070686_1000343974 267
479 3300005545 Ga0070695_100000114 Ga0070695_10000011416 267
480 3300005545 Ga0070695_100046227 Ga0070695_1000462272 267
481 3300005546 Ga0070696_100000875 Ga0070696_10000087516 267
482 3300005546 Ga0070696_100026451 Ga0070696_1000264514 267
483 3300005549 Ga0070704_100129461 Ga0070704_1001294612 267
484 3300005549 Ga0070704_100278990 Ga0070704_1002789902 267
485 3300005564 Ga0070664_100164285 Ga0070664_1001642853 267
486 3300005577 Ga0068857_100025554 Ga0068857_1000255544 267
487 3300005617 Ga0068859_100016492 Ga0068859_1000164927 267
488 3300005617 Ga0068859_100021872 Ga0068859_1000218722 267
489 3300005618 Ga0068864_100240907 Ga0068864_1002409072 267
490 3300005718 Ga0068866_10117830 Ga0068866_101178302 267
491 3300005719 Ga0068861_100065430 Ga0068861_1000654303 267
492 3300005840 Ga0068870_10047307 Ga0068870_100473073 267
493 3300005842 Ga0068858_100021997 Ga0068858_1000219972 267
494 3300005843 Ga0068860_100299556 Ga0068860_1002995562 267
495 3300005844 Ga0068862_100187541 Ga0068862_1001875411 267
496 3300005844 Ga0068862_100225882 Ga0068862_1002258821 267
497 3300006844 Ga0075428_100005810 Ga0075428_1000058108 267
498 3300006844 Ga0075428_100584973 Ga0075428_1005849731 267
499 3300006846 Ga0075430_100016137 Ga0075430_1000161376 267
500 3300006846 Ga0075430_100103545 Ga0075430_1001035453 267
501 3300006847 Ga0075431_100009964 Ga0075431_1000099645 267
502 3300006847 Ga0075431_100104535 Ga0075431_1001045353 267
503 3300006852 Ga0075433_10172052 Ga0075433_101720521 267
504 3300006871 Ga0075434_100002357 Ga0075434_1000023579 267
505 3300006871 Ga0075434_100051729 Ga0075434_1000517294 267
506 3300006871 Ga0075434_100064033 Ga0075434_1000640334 267
507 3300006871 Ga0075434_100065669 Ga0075434_1000656694 267
508 3300006880 Ga0075429_100250925 Ga0075429_1002509252 267
509 3300006881 Ga0068865_100005604 Ga0068865_1000056042 267
510 3300006931 Ga0097620_100016493 Ga0097620_1000164937 267
511 3300006931 Ga0097620_100021872 Ga0097620_1000218722 267
512 3300007076 Ga0075435_100011227 Ga0075435_1000112272 267
513 3300007076 Ga0075435_100060103 Ga0075435_1000601031 267
514 3300009147 Ga0114129_10046757 Ga0114129_100467574 267
515 3300009148 Ga0105243_10111551 Ga0105243_101115512 267
516 3300009176 Ga0105242_10008624 Ga0105242_100086246 267
517 3300009177 Ga0105248_10136310 Ga0105248_101363102 267
518 3300011119 Ga0105246_10157610 Ga0105246_101576102 267
519 3300013296 Ga0157374_10144343 Ga0157374_101443432 267
520 3300013297 Ga0157378_10895245 Ga0157378_108952451 267
521 3300014325 Ga0163163_10013092 Ga0163163_100130922 267
522 3300014325 Ga0163163_10088082 Ga0163163_100880822 267
523 3300014326 Ga0157380_10311548 Ga0157380_103115482 267
524 3300014326 Ga0157380_10352426 Ga0157380_103524261 267
525 3300014745 Ga0157377_10084663 Ga0157377_100846632 267
526 3300025315 Ga0207697_10001898 Ga0207697_100018985 267
527 3300025899 Ga0207642_10028854 Ga0207642_100288542 267
528 3300025907 Ga0207645_10009925 Ga0207645_100099254 267
529 3300025908 Ga0207643_10038732 Ga0207643_100387322 267
530 3300025922 Ga0207646_10083588 Ga0207646_100835882 267
531 3300025923 Ga0207681_10034210 Ga0207681_100342102 267
532 3300025925 Ga0207650_10007866 Ga0207650_100078663 267
533 3300025925 Ga0207650_10013990 Ga0207650_100139906 267
534 3300025926 Ga0207659_10000186 Ga0207659_1000018621 267
535 3300025926 Ga0207659_10002292 Ga0207659_1000229211 267
536 3300025926 Ga0207659_10036646 Ga0207659_100366462 267
537 3300025931 Ga0207644_10036067 Ga0207644_100360674 267
538 3300025934 Ga0207686_10007515 Ga0207686_100075157 267
539 3300025935 Ga0207709_10013951 Ga0207709_100139514 267
540 3300025936 Ga0207670_10013101 Ga0207670_100131014 267
541 3300025936 Ga0207670_10094445 Ga0207670_100944452 267
542 3300025937 Ga0207669_10082580 Ga0207669_100825802 267
543 3300025937 Ga0207669_10109517 Ga0207669_101095171 267
544 3300025938 Ga0207704_10028466 Ga0207704_100284662 267
545 3300025940 Ga0207691_10052567 Ga0207691_100525672 267
546 3300025940 Ga0207691_10188399 Ga0207691_101883991 267
547 3300025940 Ga0207691_10197726 Ga0207691_101977262 267
548 3300025941 Ga0207711_10203368 Ga0207711_102033682 267
549 3300025942 Ga0207689_10001365 Ga0207689_1000136524 267
550 3300025960 Ga0207651_10029642 Ga0207651_100296422 267
551 3300025981 Ga0207640_10102312 Ga0207640_101023122 267
552 3300026023 Ga0207677_10295900 Ga0207677_102959001 267
553 3300026035 Ga0207703_10020002 Ga0207703_100200022 267
554 3300026075 Ga0207708_10009407 Ga0207708_100094075 267
555 3300026075 Ga0207708_10163149 Ga0207708_101631492 267
556 3300026075 Ga0207708_10333990 Ga0207708_103339902 267
557 3300026089 Ga0207648_10000896 Ga0207648_1000089627 267
558 3300026095 Ga0207676_10184151 Ga0207676_101841512 267
559 3300026116 Ga0207674_10082451 Ga0207674_100824512 267
560 3300026118 Ga0207675_100013286 Ga0207675_1000132867 267
561 3300026121 Ga0207683_10003915 Ga0207683_1000391513 267
562 3300026121 Ga0207683_10090971 Ga0207683_100909712 267
563 3300027907 Ga0207428_10024941 Ga0207428_100249412 267
564 3300028380 Ga0268265_10320780 Ga0268265_103207802 267
565 3300031548 Ga0307408_100411873 Ga0307408_1004118732 267
566 3300031731 Ga0307405_10169535 Ga0307405_101695352 267
567 3300031852 Ga0307410_10065240 Ga0307410_100652403 267
568 3300031901 Ga0307406_10044013 Ga0307406_100440132 267
569 3300031903 Ga0307407_10020511 Ga0307407_100205112 267
570 3300031995 Ga0307409_100154125 Ga0307409_1001541252 267
571 3300032002 Ga0307416_100165656 Ga0307416_1001656562 267
572 3300032002 Ga0307416_100312969 Ga0307416_1003129692 267
573 3300032004 Ga0307414_10024037 Ga0307414_100240374 267
574 3300032005 Ga0307411_10035380 Ga0307411_100353803 267
575 3300032126 Ga0307415_100309984 Ga0307415_1003099842 267
576 3300035086 Ga0373934_0019423 Ga0373934_0019423_651_1487 267
577 3300035088 Ga0373940_0006288 Ga0373940_0006288_975_1793 267
578 3300035172 Ga0373955_0050754 Ga0373955_0050754_131_967 267
579 3300035724 Ga0373933_0044855 Ga0373933_0044855_1367_2203 267
580 3300036401 Ga0373937_0001055 Ga0373937_0001055_7313_8149 267
581 3300037471 Ga0395905_0002717 Ga0395905_0002717_1271_2128 267
582 3300046459 Ga0495629_0010091 Ga0495629_0010091_260_1087 267
583 3300046462 Ga0495651_0095330 Ga0495651_0095330_866_1702 267
584 3300046491 Ga0495584_0146077 Ga0495584_0146077_44_877 267
585 3300046499 Ga0495594_0038493 Ga0495594_0038493_987_1820 267
586 3300046539 Ga0495621_0006089 Ga0495621_0006089_236_1069 267
587 3300046539 Ga0495621_0014741 Ga0495621_0014741_573_1400 267
588 3300048913 Ga0496110_0240273 Ga0496110_0240273_792_1625 267
589 3300050507 nmdc:mga05p37_100845_c1 nmdc:mga05p37_100845_c1_2325_3152 267
590 3300050507 nmdc:mga05p37_22797_c1 nmdc:mga05p37_22797_c1_5597_6430 267
591 3300050508 nmdc:mga09592_229494_c1 nmdc:mga09592_229494_c1_237_1064 267
592 3300050509 nmdc:mga0qj67_15564_c1 nmdc:mga0qj67_15564_c1_1647_2474 267
593 3300050510 nmdc:mga06r32_86937_c1 nmdc:mga06r32_86937_c1_1570_2397 267
594 3300050511 nmdc:mga08y16_508993_c1 nmdc:mga08y16_508993_c1_300_1130 267
595 3300050512 nmdc:mga0n895_154916_c1 nmdc:mga0n895_154916_c1_1318_2151 267
596 3300050512 nmdc:mga0n895_4172_c1 nmdc:mga0n895_4172_c1_4781_5605 267
597 3300050512 nmdc:mga0n895_62356_c1 nmdc:mga0n895_62356_c1_441_1277 267
598 3300050513 nmdc:mga0rr50_42515_c1 nmdc:mga0rr50_42515_c1_2002_2835 267
599 3300050515 nmdc:mga0a205_35624_c2 nmdc:mga0a205_35624_c2_656_1504 267
600 3300005290 Ga0065712_10010777 Ga0065712_100107772 268
601 3300005290 Ga0065712_10068324 Ga0065712_100683248 268
602 3300005293 Ga0065715_10097051 Ga0065715_100970514 268
603 3300005293 Ga0065715_10156255 Ga0065715_101562552 268
604 3300005295 Ga0065707_10003596 Ga0065707_100035964 268
605 3300005295 Ga0065707_10090275 Ga0065707_100902751 268
606 3300005328 Ga0070676_10272225 Ga0070676_102722252 268
607 3300005329 Ga0070683_100182374 Ga0070683_1001823742 268
608 3300005330 Ga0070690_100028398 Ga0070690_1000283983 268
609 3300005331 Ga0070670_100004308 Ga0070670_1000043084 268
610 3300005335 Ga0070666_10141439 Ga0070666_101414392 268
611 3300005340 Ga0070689_100004613 Ga0070689_1000046133 268
612 3300005340 Ga0070689_100182134 Ga0070689_1001821342 268
613 3300005344 Ga0070661_100005522 Ga0070661_1000055223 268
614 3300005353 Ga0070669_100004306 Ga0070669_10000430611 268
615 3300005353 Ga0070669_100127714 Ga0070669_1001277142 268
616 3300005354 Ga0070675_100132893 Ga0070675_1001328932 268
617 3300005364 Ga0070673_100156919 Ga0070673_1001569192 268
618 3300005364 Ga0070673_100201966 Ga0070673_1002019662 268
619 3300005365 Ga0070688_100015724 Ga0070688_1000157244 268
620 3300005365 Ga0070688_100203014 Ga0070688_1002030141 268
621 3300005367 Ga0070667_100116276 Ga0070667_1001162762 268
622 3300005438 Ga0070701_10142326 Ga0070701_101423262 268
623 3300005444 Ga0070694_100017738 Ga0070694_1000177382 268
624 3300005444 Ga0070694_100079314 Ga0070694_1000793143 268
625 3300005456 Ga0070678_100248199 Ga0070678_1002481991 268
626 3300005457 Ga0070662_100115676 Ga0070662_1001156763 268
627 3300005459 Ga0068867_100013310 Ga0068867_1000133102 268
628 3300005467 Ga0070706_100111661 Ga0070706_1001116613 268
629 3300005467 Ga0070706_100293716 Ga0070706_1002937161 268
630 3300005467 Ga0070706_100653522 Ga0070706_1006535221 268
631 3300005518 Ga0070699_100005758 Ga0070699_10000575812 268
632 3300005535 Ga0070684_100005890 Ga0070684_1000058903 268
633 3300005545 Ga0070695_100062571 Ga0070695_1000625712 268
634 3300005546 Ga0070696_100077055 Ga0070696_1000770552 268
635 3300005546 Ga0070696_100080794 Ga0070696_1000807942 268
636 3300005549 Ga0070704_100000657 Ga0070704_10000065716 268
637 3300005549 Ga0070704_100098317 Ga0070704_1000983172 268
638 3300005564 Ga0070664_100004582 Ga0070664_1000045828 268
639 3300005577 Ga0068857_100094535 Ga0068857_1000945352 268
640 3300005615 Ga0070702_100113111 Ga0070702_1001131112 268
641 3300005617 Ga0068859_100001192 Ga0068859_10000119215 268
642 3300005617 Ga0068859_100117143 Ga0068859_1001171432 268
643 3300005617 Ga0068859_100607269 Ga0068859_1006072692 268
644 3300005719 Ga0068861_100053326 Ga0068861_1000533262 268
645 3300005719 Ga0068861_100775151 Ga0068861_1007751511 268
646 3300005840 Ga0068870_10001537 Ga0068870_100015377 268
647 3300005842 Ga0068858_100057635 Ga0068858_1000576354 268
648 3300005844 Ga0068862_100000751 Ga0068862_10000075119 268
649 3300006195 Ga0075366_10016822 Ga0075366_100168222 268
650 3300006844 Ga0075428_100006735 Ga0075428_10000673513 268
651 3300006844 Ga0075428_100024211 Ga0075428_1000242114 268
652 3300006844 Ga0075428_100239818 Ga0075428_1002398181 268
653 3300006844 Ga0075428_100349553 Ga0075428_1003495531 268
654 3300006846 Ga0075430_100008529 Ga0075430_1000085294 268
655 3300006846 Ga0075430_100010337 Ga0075430_1000103375 268
656 3300006846 Ga0075430_100027343 Ga0075430_1000273432 268
657 3300006846 Ga0075430_100435738 Ga0075430_1004357381 268
658 3300006847 Ga0075431_100005877 Ga0075431_1000058776 268
659 3300006847 Ga0075431_100013476 Ga0075431_1000134765 268
660 3300006847 Ga0075431_100030809 Ga0075431_1000308093 268
661 3300006847 Ga0075431_100049867 Ga0075431_1000498675 268
662 3300006847 Ga0075431_100060504 Ga0075431_1000605043 268
663 3300006852 Ga0075433_10005987 Ga0075433_100059872 268
664 3300006852 Ga0075433_10077386 Ga0075433_100773863 268
665 3300006852 Ga0075433_10085982 Ga0075433_100859822 268
666 3300006852 Ga0075433_10362231 Ga0075433_103622311 268
667 3300006871 Ga0075434_100015423 Ga0075434_1000154236 268
668 3300006871 Ga0075434_100298591 Ga0075434_1002985912 268
669 3300006880 Ga0075429_100053859 Ga0075429_1000538593 268
670 3300006880 Ga0075429_100061303 Ga0075429_1000613034 268
671 3300006880 Ga0075429_100184122 Ga0075429_1001841222 268
672 3300006931 Ga0097620_100001192 Ga0097620_10000119215 268
673 3300006931 Ga0097620_100117148 Ga0097620_1001171482 268
674 3300006931 Ga0097620_100607262 Ga0097620_1006072622 268
675 3300007076 Ga0075435_100065453 Ga0075435_1000654533 268
676 3300009094 Ga0111539_10001306 Ga0111539_1000130614 268
677 3300009094 Ga0111539_10003912 Ga0111539_1000391212 268
678 3300009094 Ga0111539_10013300 Ga0111539_100133003 268
679 3300009094 Ga0111539_10038854 Ga0111539_100388542 268
680 3300009094 Ga0111539_10130183 Ga0111539_101301832 268
681 3300009094 Ga0111539_10151925 Ga0111539_101519254 268
682 3300009094 Ga0111539_10183471 Ga0111539_101834712 268
683 3300009147 Ga0114129_10005399 Ga0114129_1000539911 268
684 3300009147 Ga0114129_10008257 Ga0114129_100082579 268
685 3300009147 Ga0114129_10021210 Ga0114129_100212108 268
686 3300009147 Ga0114129_10044727 Ga0114129_100447274 268
687 3300009147 Ga0114129_10065833 Ga0114129_100658332 268
688 3300009147 Ga0114129_10265943 Ga0114129_102659432 268
689 3300009147 Ga0114129_10376358 Ga0114129_103763582 268
690 3300009148 Ga0105243_10112978 Ga0105243_101129782 268
691 3300009553 Ga0105249_10001159 Ga0105249_1000115920 268
692 3300009553 Ga0105249_10008936 Ga0105249_100089365 268
693 3300013296 Ga0157374_10019103 Ga0157374_100191035 268
694 3300013306 Ga0163162_10208316 Ga0163162_102083162 268
695 3300013306 Ga0163162_10217183 Ga0163162_102171832 268
696 3300013308 Ga0157375_10022884 Ga0157375_100228844 268
697 3300014326 Ga0157380_10080111 Ga0157380_100801112 268
698 3300014326 Ga0157380_10223179 Ga0157380_102231792 268
699 3300014745 Ga0157377_10161764 Ga0157377_101617642 268
700 3300014968 Ga0157379_10116903 Ga0157379_101169032 268
701 3300025315 Ga0207697_10016114 Ga0207697_100161144 268
702 3300025907 Ga0207645_10030648 Ga0207645_100306482 268
703 3300025908 Ga0207643_10001583 Ga0207643_100015834 268
704 3300025910 Ga0207684_10158833 Ga0207684_101588332 268
705 3300025920 Ga0207649_10008693 Ga0207649_100086934 268
706 3300025922 Ga0207646_10138040 Ga0207646_101380401 268
707 3300025922 Ga0207646_10273806 Ga0207646_102738062 268
708 3300025923 Ga0207681_10000903 Ga0207681_1000090316 268
709 3300025923 Ga0207681_10086197 Ga0207681_100861973 268
710 3300025925 Ga0207650_10005051 Ga0207650_100050519 268
711 3300025925 Ga0207650_10240554 Ga0207650_102405542 268
712 3300025926 Ga0207659_10072292 Ga0207659_100722922 268
713 3300025926 Ga0207659_10088610 Ga0207659_100886102 268
714 3300025926 Ga0207659_10122540 Ga0207659_101225402 268
715 3300025936 Ga0207670_10002960 Ga0207670_100029605 268
716 3300025937 Ga0207669_10044616 Ga0207669_100446163 268
717 3300025940 Ga0207691_10020173 Ga0207691_100201733 268
718 3300025944 Ga0207661_10254041 Ga0207661_102540412 268
719 3300025945 Ga0207679_10022608 Ga0207679_100226082 268
720 3300025960 Ga0207651_10123411 Ga0207651_101234112 268
721 3300025961 Ga0207712_10002956 Ga0207712_100029568 268
722 3300025961 Ga0207712_10160624 Ga0207712_101606242 268
723 3300026067 Ga0207678_10202913 Ga0207678_102029132 268
724 3300026089 Ga0207648_10003098 Ga0207648_1000309818 268
725 3300026116 Ga0207674_10119025 Ga0207674_101190252 268
726 3300026118 Ga0207675_100010666 Ga0207675_1000106669 268
727 3300026118 Ga0207675_100015058 Ga0207675_1000150584 268
728 3300026118 Ga0207675_100182268 Ga0207675_1001822682 268
729 3300026118 Ga0207675_100258242 Ga0207675_1002582422 268
730 3300027876 Ga0209974_10051767 Ga0209974_100517671 268
731 3300027907 Ga0207428_10001755 Ga0207428_100017552 268
732 3300027907 Ga0207428_10002646 Ga0207428_1000264611 268
733 3300027907 Ga0207428_10014492 Ga0207428_100144925 268
734 3300027907 Ga0207428_10038609 Ga0207428_100386092 268
735 3300027907 Ga0207428_10122553 Ga0207428_101225533 268
736 3300028380 Ga0268265_10000446 Ga0268265_1000044615 268
737 3300028380 Ga0268265_10031941 Ga0268265_100319412 268
738 3300028380 Ga0268265_10702162 Ga0268265_107021621 268
739 3300031251 Ga0265327_10001215 Ga0265327_1000121522 268
740 3300031548 Ga0307408_100047021 Ga0307408_1000470213 268
741 3300031548 Ga0307408_100185618 Ga0307408_1001856182 268
742 3300031548 Ga0307408_100244931 Ga0307408_1002449312 268
743 3300031731 Ga0307405_10644143 Ga0307405_106441431 268
744 3300031824 Ga0307413_10012643 Ga0307413_100126433 268
745 3300031901 Ga0307406_10036853 Ga0307406_100368534 268
746 3300031901 Ga0307406_10125120 Ga0307406_101251203 268
747 3300031903 Ga0307407_10065074 Ga0307407_100650741 268
748 3300031911 Ga0307412_10009164 Ga0307412_100091642 268
749 3300031911 Ga0307412_10086548 Ga0307412_100865482 268
750 3300031995 Ga0307409_100133012 Ga0307409_1001330122 268
751 3300032002 Ga0307416_100064298 Ga0307416_1000642982 268
752 3300032002 Ga0307416_100161939 Ga0307416_1001619392 268
753 3300032002 Ga0307416_100201577 Ga0307416_1002015771 268
754 3300032005 Ga0307411_10057455 Ga0307411_100574554 268
755 3300032005 Ga0307411_10254703 Ga0307411_102547032 268
756 3300032126 Ga0307415_100025452 Ga0307415_1000254523 268
757 3300032126 Ga0307415_100186237 Ga0307415_1001862372 268
758 3300042157 Ga0439458_0004884 Ga0439458_0004884_1612_2436 268
759 3300042436 Ga0439435_0013974 Ga0439435_0013974_215_1051 268
760 3300042436 Ga0439435_0092614 Ga0439435_0092614_59_889 268
761 3300042439 Ga0439464_0009591 Ga0439464_0009591_528_1358 268
762 3300042876 Ga0451577_0547199 Ga0451577_0547199_13_897 268
763 3300045051 Ga0451576_0160068 Ga0451576_0160068_709_1623 268
764 3300046463 Ga0495653_0089557 Ga0495653_0089557_1089_1928 268
765 3300048903 Ga0496100_0524983 Ga0496100_0524983_25_852 268
766 3300048905 Ga0496102_0023956 Ga0496102_0023956_4500_5381 268
767 3300048905 Ga0496102_0437862 Ga0496102_0437862_234_1064 268
768 3300048907 Ga0496104_0014579 Ga0496104_0014579_3036_3863 268
769 3300048908 Ga0496105_0020887 Ga0496105_0020887_55_882 268
770 3300048910 Ga0496107_0357410 Ga0496107_0357410_250_1077 268
771 3300048911 Ga0496108_0012631 Ga0496108_0012631_3473_4300 268
772 3300048912 Ga0496109_0004973 Ga0496109_0004973_6370_7197 268
773 3300048913 Ga0496110_0003082 Ga0496110_0003082_7983_8810 268
774 3300048915 Ga0496112_0000767 Ga0496112_0000767_7565_8392 268
775 3300048915 Ga0496112_0125048 Ga0496112_0125048_863_1744 268
776 3300048916 Ga0496113_0104510 Ga0496113_0104510_1326_2162 268
777 3300049514 Ga0501291_004129 Ga0501291_004129_97_927 268
778 3300049571 Ga0501034_0708237 Ga0501034_0708237_18_848 268
779 3300049572 Ga0501036_0198140 Ga0501036_0198140_839_1672 268
780 3300049572 Ga0501036_0290076 Ga0501036_0290076_378_1208 268
781 3300049587 Ga0501071_0087251 Ga0501071_0087251_1308_2147 268
782 3300049589 Ga0501073_0078471 Ga0501073_0078471_913_1749 268
783 3300049591 Ga0501075_0138264 Ga0501075_0138264_683_1522 268
784 3300049592 Ga0501076_0273731 Ga0501076_0273731_184_1020 268
785 3300049744 Ga0501083_0157014 Ga0501083_0157014_79_915 268
786 3300049824 Ga0501045_0002668 Ga0501045_0002668_722_1552 268
787 3300050493 nmdc:mga0k408_87695_c1 nmdc:mga0k408_87695_c1_270_1100 268
788 3300050494 nmdc:mga06z11_69102_c1 nmdc:mga06z11_69102_c1_375_1205 268
789 3300050496 nmdc:mga07m45_72950_c1 nmdc:mga07m45_72950_c1_1014_1844 268
790 3300050507 nmdc:mga05p37_23000_c1 nmdc:mga05p37_23000_c1_378_1214 268
791 3300050507 nmdc:mga05p37_293512_c1 nmdc:mga05p37_293512_c1_348_1178 268
792 3300050507 nmdc:mga05p37_30648_c1 nmdc:mga05p37_30648_c1_4633_5463 268
793 3300050507 nmdc:mga05p37_3248_c1 nmdc:mga05p37_3248_c1_16519_17349 268
794 3300050507 nmdc:mga05p37_56197_c1 nmdc:mga05p37_56197_c1_667_1494 268
795 3300050507 nmdc:mga05p37_92793_c1 nmdc:mga05p37_92793_c1_326_1162 268
796 3300050508 nmdc:mga09592_140269_c1 nmdc:mga09592_140269_c1_1083_1922 268
797 3300050508 nmdc:mga09592_53415_c1 nmdc:mga09592_53415_c1_366_1196 268
798 3300050509 nmdc:mga0qj67_18817_c1 nmdc:mga0qj67_18817_c1_2048_2878 268
799 3300050509 nmdc:mga0qj67_32760_c1 nmdc:mga0qj67_32760_c1_3090_3923 268
800 3300050509 nmdc:mga0qj67_43389_c1 nmdc:mga0qj67_43389_c1_885_1718 268
801 3300050509 nmdc:mga0qj67_60592_c1 nmdc:mga0qj67_60592_c1_2153_2983 268
802 3300050510 nmdc:mga06r32_11495_c1 nmdc:mga06r32_11495_c1_2943_3773 268
803 3300050510 nmdc:mga06r32_140891_c1 nmdc:mga06r32_140891_c1_1058_1888 268
804 3300050510 nmdc:mga06r32_230360_c1 nmdc:mga06r32_230360_c1_395_1228 268
805 3300050510 nmdc:mga06r32_274862_c1 nmdc:mga06r32_274862_c1_443_1276 268
806 3300050510 nmdc:mga06r32_30469_c1 nmdc:mga06r32_30469_c1_3792_4643 268
807 3300050510 nmdc:mga06r32_45035_c1 nmdc:mga06r32_45035_c1_1290_2117 268
808 3300050510 nmdc:mga06r32_469572_c1 nmdc:mga06r32_469572_c1_50_880 268
809 3300050511 nmdc:mga08y16_126947_c1 nmdc:mga08y16_126947_c1_720_1547 268
810 3300050511 nmdc:mga08y16_1346_c1 nmdc:mga08y16_1346_c1_15748_16578 268
811 3300050511 nmdc:mga08y16_13565_c1 nmdc:mga08y16_13565_c1_1613_2446 268
812 3300050511 nmdc:mga08y16_18656_c1 nmdc:mga08y16_18656_c1_6168_7004 268
813 3300050511 nmdc:mga08y16_3012_c1 nmdc:mga08y16_3012_c1_12920_13747 268
814 3300050511 nmdc:mga08y16_349194_c1 nmdc:mga08y16_349194_c1_408_1238 268
815 3300050512 nmdc:mga0n895_205299_c1 nmdc:mga0n895_205299_c1_647_1474 268
816 3300050512 nmdc:mga0n895_33100_c1 nmdc:mga0n895_33100_c1_1070_1903 268
817 3300050512 nmdc:mga0n895_731829_c1 nmdc:mga0n895_731829_c1_101_940 268
818 3300050513 nmdc:mga0rr50_3770_c1 nmdc:mga0rr50_3770_c1_3545_4372 268
819 3300050515 nmdc:mga0a205_103258_c1 nmdc:mga0a205_103258_c1_362_1198 268
820 3300050515 nmdc:mga0a205_193219_c1 nmdc:mga0a205_193219_c1_345_1178 268
821 3300050515 nmdc:mga0a205_3571_c1 nmdc:mga0a205_3571_c1_3639_4466 268
822 3300050515 nmdc:mga0a205_9790_c1 nmdc:mga0a205_9790_c1_7682_8515 268
823 3300059421 Ga0590071_008132 Ga0590071_008132_1113_1949 268
824 3300059423 Ga0590074_001645 Ga0590074_001645_2311_3147 268
825 3300059424 Ga0590075_000249 Ga0590075_000249_7277_8113 268
826 3300059424 Ga0590075_020314 Ga0590075_020314_535_1380 268
827 3300059426 Ga0590077_025773 Ga0590077_025773_256_1092 268
828 3300060353 Ga0501082_0035427 Ga0501082_0035427_3324_4160 268
829 3300061734 Ga0530510_0017452 Ga0530510_0017452_2327_3157 268
830 3300005293 Ga0065715_10211688 Ga0065715_102116882 269
831 3300005330 Ga0070690_100009186 Ga0070690_1000091867 269
832 3300005334 Ga0068869_100188572 Ga0068869_1001885722 269
833 3300005336 Ga0070680_100166776 Ga0070680_1001667762 269
834 3300005340 Ga0070689_100145231 Ga0070689_1001452312 269
835 3300005345 Ga0070692_10252860 Ga0070692_102528602 269
836 3300005354 Ga0070675_100001264 Ga0070675_1000012644 269
837 3300005354 Ga0070675_100122018 Ga0070675_1001220183 269
838 3300005364 Ga0070673_100513960 Ga0070673_1005139602 269
839 3300005438 Ga0070701_10019960 Ga0070701_100199602 269
840 3300005440 Ga0070705_100329919 Ga0070705_1003299191 269
841 3300005441 Ga0070700_100086806 Ga0070700_1000868062 269
842 3300005441 Ga0070700_100194440 Ga0070700_1001944401 269
843 3300005444 Ga0070694_100281649 Ga0070694_1002816492 269
844 3300005445 Ga0070708_100406911 Ga0070708_1004069112 269
845 3300005545 Ga0070695_100094494 Ga0070695_1000944941 269
846 3300005564 Ga0070664_100443707 Ga0070664_1004437072 269
847 3300005615 Ga0070702_100053878 Ga0070702_1000538782 269
848 3300005617 Ga0068859_100001429 Ga0068859_10000142914 269
849 3300005617 Ga0068859_100012299 Ga0068859_1000122993 269
850 3300005618 Ga0068864_100199170 Ga0068864_1001991702 269
851 3300005719 Ga0068861_100454792 Ga0068861_1004547922 269
852 3300005840 Ga0068870_10000669 Ga0068870_100006698 269
853 3300005840 Ga0068870_10053081 Ga0068870_100530813 269
854 3300005842 Ga0068858_100143718 Ga0068858_1001437184 269
855 3300005843 Ga0068860_100007382 Ga0068860_1000073826 269
856 3300005844 Ga0068862_100017802 Ga0068862_1000178022 269
857 3300006051 Ga0075364_10031542 Ga0075364_100315424 269
858 3300006178 Ga0075367_10085085 Ga0075367_100850852 269
859 3300006358 Ga0068871_100095903 Ga0068871_1000959032 269
860 3300006844 Ga0075428_100007083 Ga0075428_1000070839 269
861 3300006844 Ga0075428_100032916 Ga0075428_1000329166 269
862 3300006844 Ga0075428_100731347 Ga0075428_1007313472 269
863 3300006846 Ga0075430_100037733 Ga0075430_1000377332 269
864 3300006847 Ga0075431_100044463 Ga0075431_1000444631 269
865 3300006852 Ga0075433_10284866 Ga0075433_102848662 269
866 3300006871 Ga0075434_100003234 Ga0075434_10000323412 269
867 3300006931 Ga0097620_100001429 Ga0097620_10000142914 269
868 3300006931 Ga0097620_100012299 Ga0097620_10001229910 269
869 3300007076 Ga0075435_100025147 Ga0075435_1000251474 269
870 3300009094 Ga0111539_10000848 Ga0111539_1000084812 269
871 3300009094 Ga0111539_10013426 Ga0111539_100134264 269
872 3300009101 Ga0105247_10038471 Ga0105247_100384712 269
873 3300009553 Ga0105249_10471712 Ga0105249_104717122 269
874 3300014325 Ga0163163_10001375 Ga0163163_100013753 269
875 3300014326 Ga0157380_10008103 Ga0157380_100081037 269
876 3300014745 Ga0157377_10009104 Ga0157377_100091042 269
877 3300017792 Ga0163161_10144095 Ga0163161_101440952 269
878 3300025315 Ga0207697_10003386 Ga0207697_100033868 269
879 3300025893 Ga0207682_10002777 Ga0207682_100027778 269
880 3300025901 Ga0207688_10005226 Ga0207688_100052267 269
881 3300025907 Ga0207645_10004600 Ga0207645_100046006 269
882 3300025908 Ga0207643_10001361 Ga0207643_100013611 269
883 3300025908 Ga0207643_10053092 Ga0207643_100530924 269
884 3300025918 Ga0207662_10000549 Ga0207662_100005495 269
885 3300025923 Ga0207681_10073981 Ga0207681_100739814 269
886 3300025923 Ga0207681_10313814 Ga0207681_103138142 269
887 3300025925 Ga0207650_10000028 Ga0207650_10000028101 269
888 3300025926 Ga0207659_10000878 Ga0207659_100008786 269
889 3300025936 Ga0207670_10063722 Ga0207670_100637222 269
890 3300025940 Ga0207691_10001303 Ga0207691_1000130315 269
891 3300025941 Ga0207711_10055056 Ga0207711_100550562 269
892 3300025960 Ga0207651_10011063 Ga0207651_100110634 269
893 3300025981 Ga0207640_10028938 Ga0207640_100289383 269
894 3300025981 Ga0207640_10049435 Ga0207640_100494353 269
895 3300026023 Ga0207677_10342391 Ga0207677_103423912 269
896 3300026075 Ga0207708_10030633 Ga0207708_100306333 269
897 3300026075 Ga0207708_10048203 Ga0207708_100482035 269
898 3300026095 Ga0207676_10172776 Ga0207676_101727762 269
899 3300026118 Ga0207675_100003723 Ga0207675_10000372314 269
900 3300026121 Ga0207683_10371897 Ga0207683_103718972 269
901 3300027907 Ga0207428_10001933 Ga0207428_100019333 269
902 3300027907 Ga0207428_10012852 Ga0207428_100128527 269
903 3300028380 Ga0268265_10043067 Ga0268265_100430675 269
904 3300028381 Ga0268264_10001064 Ga0268264_1000106421 269
905 3300028381 Ga0268264_10011548 Ga0268264_100115487 269
906 3300031731 Ga0307405_10039303 Ga0307405_100393033 269
907 3300031824 Ga0307413_10137897 Ga0307413_101378972 269
908 3300031824 Ga0307413_10286721 Ga0307413_102867212 269
909 3300031852 Ga0307410_10058667 Ga0307410_100586673 269
910 3300031852 Ga0307410_10213769 Ga0307410_102137692 269
911 3300031911 Ga0307412_10039384 Ga0307412_100393844 269
912 3300031995 Ga0307409_100371878 Ga0307409_1003718782 269
913 3300032004 Ga0307414_10078578 Ga0307414_100785782 269
914 3300032004 Ga0307414_10273523 Ga0307414_102735232 269
915 3300032005 Ga0307411_10018080 Ga0307411_100180805 269
916 3300035090 Ga0373949_0016966 Ga0373949_0016966_472_1341 269
917 3300035112 Ga0373932_0016704 Ga0373932_0016704_901_1770 269
918 3300045051 Ga0451576_0176179 Ga0451576_0176179_882_1751 269
919 3300046522 Ga0495643_0007881 Ga0495643_0007881_1237_2073 269
920 3300046539 Ga0495621_0095964 Ga0495621_0095964_231_1088 269
921 3300046691 Ga0495670_0014126 Ga0495670_0014126_489_1328 269
922 3300049515 Ga0501292_018671 Ga0501292_018671_258_1079 269
923 3300049519 Ga0501296_007502 Ga0501296_007502_379_1200 269
924 3300049574 Ga0501038_0141405 Ga0501038_0141405_1039_1878 269
925 3300049578 Ga0501042_0021704 Ga0501042_0021704_2804_3643 269
926 3300049580 Ga0501046_0089819 Ga0501046_0089819_513_1352 269
927 3300049582 Ga0501048_0017206 Ga0501048_0017206_1516_2355 269
928 3300049591 Ga0501075_0009033 Ga0501075_0009033_4639_5478 269
929 3300049660 Ga0501216_001643 Ga0501216_001643_1503_2324 269
930 3300049661 Ga0501217_006352 Ga0501217_006352_287_1108 269
931 3300049664 Ga0501224_004812 Ga0501224_004812_90_911 269
932 3300049669 Ga0501235_021985 Ga0501235_021985_63_884 269
933 3300049741 Ga0501079_0237402 Ga0501079_0237402_110_949 269
934 3300049742 Ga0501080_0295103 Ga0501080_0295103_255_1094 269
935 3300049743 Ga0501081_0173823 Ga0501081_0173823_582_1418 269
936 3300050491 nmdc:mga00v17_27042_c1 nmdc:mga00v17_27042_c1_1180_2076 269
937 3300050494 nmdc:mga06z11_304065_c1 nmdc:mga06z11_304065_c1_75_911 269
938 3300050494 nmdc:mga06z11_50743_c1 nmdc:mga06z11_50743_c1_959_1795 269
939 3300050507 nmdc:mga05p37_135988_c1 nmdc:mga05p37_135988_c1_2123_2959 269
940 3300050507 nmdc:mga05p37_182887_c1 nmdc:mga05p37_182887_c1_931_1761 269
941 3300050507 nmdc:mga05p37_819968_c1 nmdc:mga05p37_819968_c1_89_922 269
942 3300050508 nmdc:mga09592_102377_c1 nmdc:mga09592_102377_c1_1101_1931 269
943 3300050508 nmdc:mga09592_33230_c1 nmdc:mga09592_33230_c1_1420_2250 269
944 3300050509 nmdc:mga0qj67_226883_c1 nmdc:mga0qj67_226883_c1_650_1480 269
945 3300050509 nmdc:mga0qj67_7677_c1 nmdc:mga0qj67_7677_c1_6999_7829 269
946 3300050510 nmdc:mga06r32_13337_c1 nmdc:mga06r32_13337_c1_4362_5192 269
947 3300050510 nmdc:mga06r32_6112_c1 nmdc:mga06r32_6112_c1_8201_9037 269
948 3300050511 nmdc:mga08y16_305_c1 nmdc:mga08y16_305_c1_22111_22950 269
949 3300050512 nmdc:mga0n895_27162_c1 nmdc:mga0n895_27162_c1_3136_4005 269
950 3300050512 nmdc:mga0n895_548337_c1 nmdc:mga0n895_548337_c1_190_1029 269
951 3300050513 nmdc:mga0rr50_91448_c1 nmdc:mga0rr50_91448_c1_743_1591 269
952 3300050515 nmdc:mga0a205_3519_c1 nmdc:mga0a205_3519_c1_3920_4789 269
953 3300050515 nmdc:mga0a205_37444_c1 nmdc:mga0a205_37444_c1_3018_3866 269
954 3300053085 Ga0495619_0160885 Ga0495619_0160885_542_1441 269
955 3300054114 Ga0501084_0105912 Ga0501084_0105912_660_1499 269
956 3300061734 Ga0530510_0013516 Ga0530510_0013516_3390_4220 269
957 3300002074 JGI24748J21848_1000001 JGI24748J21848_1000001309 270
958 3300002239 JGI24034J26672_10000001 JGI24034J26672_10000001108 270
959 3300005295 Ga0065707_10149947 Ga0065707_101499472 270
960 3300005330 Ga0070690_100073706 Ga0070690_1000737062 270
961 3300005330 Ga0070690_100079694 Ga0070690_1000796943 270
962 3300005330 Ga0070690_100104304 Ga0070690_1001043042 270
963 3300005331 Ga0070670_100042947 Ga0070670_1000429474 270
964 3300005334 Ga0068869_100049286 Ga0068869_1000492864 270
965 3300005335 Ga0070666_10104196 Ga0070666_101041963 270
966 3300005337 Ga0070682_100000253 Ga0070682_10000025313 270
967 3300005340 Ga0070689_100525104 Ga0070689_1005251041 270
968 3300005343 Ga0070687_100016555 Ga0070687_1000165553 270
969 3300005343 Ga0070687_100072239 Ga0070687_1000722392 270
970 3300005345 Ga0070692_10166493 Ga0070692_101664932 270
971 3300005353 Ga0070669_100006019 Ga0070669_1000060196 270
972 3300005353 Ga0070669_100044834 Ga0070669_1000448342 270
973 3300005353 Ga0070669_100172893 Ga0070669_1001728932 270
974 3300005355 Ga0070671_100169845 Ga0070671_1001698452 270
975 3300005356 Ga0070674_100018632 Ga0070674_1000186324 270
976 3300005356 Ga0070674_100067989 Ga0070674_1000679893 270
977 3300005364 Ga0070673_100012172 Ga0070673_1000121722 270
978 3300005365 Ga0070688_100297267 Ga0070688_1002972672 270
979 3300005434 Ga0070709_10037070 Ga0070709_100370704 270
980 3300005445 Ga0070708_100454274 Ga0070708_1004542741 270
981 3300005457 Ga0070662_100131772 Ga0070662_1001317722 270
982 3300005467 Ga0070706_100009673 Ga0070706_1000096736 270
983 3300005467 Ga0070706_100019128 Ga0070706_1000191282 270
984 3300005467 Ga0070706_100358386 Ga0070706_1003583861 270
985 3300005468 Ga0070707_100000081 Ga0070707_10000008170 270
986 3300005468 Ga0070707_100013569 Ga0070707_1000135696 270
987 3300005471 Ga0070698_100027680 Ga0070698_1000276805 270
988 3300005471 Ga0070698_100187558 Ga0070698_1001875583 270
989 3300005471 Ga0070698_100273366 Ga0070698_1002733662 270
990 3300005471 Ga0070698_100394595 Ga0070698_1003945952 270
991 3300005471 Ga0070698_100469167 Ga0070698_1004691671 270
992 3300005518 Ga0070699_100178947 Ga0070699_1001789472 270
993 3300005518 Ga0070699_100327703 Ga0070699_1003277032 270
994 3300005536 Ga0070697_100006741 Ga0070697_1000067418 270
995 3300005536 Ga0070697_100274614 Ga0070697_1002746142 270
996 3300005536 Ga0070697_100526869 Ga0070697_1005268691 270
997 3300005543 Ga0070672_100065971 Ga0070672_1000659714 270
998 3300005543 Ga0070672_100098503 Ga0070672_1000985032 270
999 3300005548 Ga0070665_100030321 Ga0070665_1000303212 270
1000 3300005563 Ga0068855_100466595 Ga0068855_1004665952 270
1001 3300005577 Ga0068857_100058757 Ga0068857_1000587573 270
1002 3300005615 Ga0070702_100120139 Ga0070702_1001201392 270
1003 3300005718 Ga0068866_10020249 Ga0068866_100202493 270
1004 3300005719 Ga0068861_100062240 Ga0068861_1000622403 270
1005 3300005842 Ga0068858_100000051 Ga0068858_10000005161 270
1006 3300005842 Ga0068858_100010751 Ga0068858_1000107514 270
1007 3300005844 Ga0068862_100070111 Ga0068862_1000701112 270
1008 3300006042 Ga0075368_10010861 Ga0075368_100108612 270
1009 3300006163 Ga0070715_10000006 Ga0070715_10000006146 270
1010 3300006173 Ga0070716_100000013 Ga0070716_10000001335 270
1011 3300006173 Ga0070716_100026086 Ga0070716_1000260863 270
1012 3300006844 Ga0075428_100364437 Ga0075428_1003644372 270
1013 3300006846 Ga0075430_100117498 Ga0075430_1001174982 270
1014 3300006846 Ga0075430_100135828 Ga0075430_1001358282 270
1015 3300006847 Ga0075431_100046654 Ga0075431_1000466543 270
1016 3300006852 Ga0075433_10008988 Ga0075433_100089886 270
1017 3300006852 Ga0075433_10014278 Ga0075433_100142782 270
1018 3300006871 Ga0075434_100039197 Ga0075434_1000391974 270
1019 3300006871 Ga0075434_100429321 Ga0075434_1004293211 270
1020 3300006880 Ga0075429_100079654 Ga0075429_1000796544 270
1021 3300006881 Ga0068865_100040643 Ga0068865_1000406434 270
1022 3300006914 Ga0075436_100000044 Ga0075436_10000004442 270
1023 3300007076 Ga0075435_100000183 Ga0075435_1000001833 270
1024 3300007265 Ga0099794_10037385 Ga0099794_100373853 270
1025 3300009098 Ga0105245_10377406 Ga0105245_103774062 270
1026 3300009148 Ga0105243_10000446 Ga0105243_1000044620 270
1027 3300009148 Ga0105243_10025294 Ga0105243_100252945 270
1028 3300009174 Ga0105241_10015949 Ga0105241_100159496 270
1029 3300009176 Ga0105242_10000928 Ga0105242_1000092814 270
1030 3300009176 Ga0105242_10157771 Ga0105242_101577712 270
1031 3300009176 Ga0105242_10346935 Ga0105242_103469352 270
1032 3300009177 Ga0105248_10286794 Ga0105248_102867941 270
1033 3300009553 Ga0105249_10112975 Ga0105249_101129752 270
1034 3300010375 Ga0105239_10002095 Ga0105239_100020959 270
1035 3300013100 Ga0157373_10002117 Ga0157373_100021179 270
1036 3300013297 Ga0157378_10000004 Ga0157378_10000004120 270
1037 3300013297 Ga0157378_10012885 Ga0157378_100128856 270
1038 3300013306 Ga0163162_10020047 Ga0163162_100200474 270
1039 3300013308 Ga0157375_10213484 Ga0157375_102134842 270
1040 3300014325 Ga0163163_10121886 Ga0163163_101218862 270
1041 3300017792 Ga0163161_10040705 Ga0163161_100407054 270
1042 3300017792 Ga0163161_10416907 Ga0163161_104169071 270
1043 3300025223 Ga0207672_1000589 Ga0207672_10005894 270
1044 3300025893 Ga0207682_10009256 Ga0207682_100092564 270
1045 3300025893 Ga0207682_10027821 Ga0207682_100278213 270
1046 3300025899 Ga0207642_10022700 Ga0207642_100227002 270
1047 3300025900 Ga0207710_10000002 Ga0207710_10000002863 270
1048 3300025901 Ga0207688_10013425 Ga0207688_100134252 270
1049 3300025903 Ga0207680_10025834 Ga0207680_100258344 270
1050 3300025905 Ga0207685_10000010 Ga0207685_1000001045 270
1051 3300025906 Ga0207699_10030831 Ga0207699_100308312 270
1052 3300025907 Ga0207645_10088985 Ga0207645_100889852 270
1053 3300025910 Ga0207684_10001598 Ga0207684_1000159817 270
1054 3300025910 Ga0207684_10012154 Ga0207684_100121542 270
1055 3300025913 Ga0207695_10360374 Ga0207695_103603742 270
1056 3300025918 Ga0207662_10106043 Ga0207662_101060431 270
1057 3300025922 Ga0207646_10000518 Ga0207646_1000051810 270
1058 3300025922 Ga0207646_10003043 Ga0207646_100030436 270
1059 3300025922 Ga0207646_10034664 Ga0207646_100346642 270
1060 3300025923 Ga0207681_10017696 Ga0207681_100176962 270
1061 3300025923 Ga0207681_10302748 Ga0207681_103027482 270
1062 3300025925 Ga0207650_10001186 Ga0207650_100011865 270
1063 3300025925 Ga0207650_10122005 Ga0207650_101220052 270
1064 3300025931 Ga0207644_10001949 Ga0207644_100019493 270
1065 3300025933 Ga0207706_10043007 Ga0207706_100430073 270
1066 3300025933 Ga0207706_10142969 Ga0207706_101429692 270
1067 3300025934 Ga0207686_10003763 Ga0207686_100037638 270
1068 3300025935 Ga0207709_10000718 Ga0207709_1000071813 270
1069 3300025935 Ga0207709_10011308 Ga0207709_100113082 270
1070 3300025935 Ga0207709_10347234 Ga0207709_103472342 270
1071 3300025936 Ga0207670_10192912 Ga0207670_101929122 270
1072 3300025937 Ga0207669_10016336 Ga0207669_100163364 270
1073 3300025937 Ga0207669_10096956 Ga0207669_100969562 270
1074 3300025937 Ga0207669_10280953 Ga0207669_102809532 270
1075 3300025939 Ga0207665_10000025 Ga0207665_1000002535 270
1076 3300025940 Ga0207691_10017523 Ga0207691_100175232 270
1077 3300025960 Ga0207651_10133125 Ga0207651_101331253 270
1078 3300026023 Ga0207677_10046843 Ga0207677_100468433 270
1079 3300026035 Ga0207703_10000114 Ga0207703_1000011413 270
1080 3300026075 Ga0207708_10245434 Ga0207708_102454342 270
1081 3300026116 Ga0207674_10071565 Ga0207674_100715653 270
1082 3300026118 Ga0207675_100002665 Ga0207675_1000026654 270
1083 3300026118 Ga0207675_100055436 Ga0207675_1000554363 270
1084 3300026121 Ga0207683_10076195 Ga0207683_100761953 270
1085 3300028380 Ga0268265_10237756 Ga0268265_102377562 270
1086 3300028380 Ga0268265_10279290 Ga0268265_102792902 270
1087 3300032002 Ga0307416_100591831 Ga0307416_1005918311 270
1088 3300044673 Ga0453683_0267466 Ga0453683_0267466_108_932 270
1089 3300046525 Ga0495663_0003174 Ga0495663_0003174_2411_3241 270
1090 3300046537 Ga0495598_0004460 Ga0495598_0004460_1497_2327 270
1091 3300046539 Ga0495621_0000018 Ga0495621_0000018_7307_8137 270
1092 3300046615 Ga0495656_0057586 Ga0495656_0057586_187_1017 270
1093 3300047318 Ga0495636_0067949 Ga0495636_0067949_183_1007 270
1094 3300049591 Ga0501075_0003285 Ga0501075_0003285_6882_7718 270
1095 3300049591 Ga0501075_0190850 Ga0501075_0190850_435_1271 270
1096 3300049592 Ga0501076_0009529 Ga0501076_0009529_5684_6520 270
1097 3300049743 Ga0501081_0143135 Ga0501081_0143135_684_1520 270
1098 3300050491 nmdc:mga00v17_42408_c1 nmdc:mga00v17_42408_c1_1086_1931 270
1099 3300050496 nmdc:mga07m45_4123_c1 nmdc:mga07m45_4123_c1_5207_6052 270
1100 3300050509 nmdc:mga0qj67_140724_c1 nmdc:mga0qj67_140724_c1_727_1572 270
1101 3300050509 nmdc:mga0qj67_184513_c1 nmdc:mga0qj67_184513_c1_389_1213 270
1102 3300050511 nmdc:mga08y16_461735_c1 nmdc:mga08y16_461735_c1_173_1018 270
1103 3300050512 nmdc:mga0n895_21578_c1 nmdc:mga0n895_21578_c1_2556_3380 270
1104 3300050512 nmdc:mga0n895_23945_c1 nmdc:mga0n895_23945_c1_2038_2862 270
1105 3300050512 nmdc:mga0n895_321967_c1 nmdc:mga0n895_321967_c1_719_1543 270
1106 3300050513 nmdc:mga0rr50_64_c1 nmdc:mga0rr50_64_c1_46125_46949 270
1107 3300050514 nmdc:mga08x19_61_c1 nmdc:mga08x19_61_c1_89190_90014 270
1108 3300050515 nmdc:mga0a205_27347_c1 nmdc:mga0a205_27347_c1_753_1574 270
1109 3300053093 Ga0500651_0045656 Ga0500651_0045656_992_1834 270
1110 3300005290 Ga0065712_10130394 Ga0065712_101303941 271
1111 3300005293 Ga0065715_10030115 Ga0065715_100301152 271
1112 3300005295 Ga0065707_10109967 Ga0065707_101099671 271
1113 3300005295 Ga0065707_10112866 Ga0065707_101128664 271
1114 3300005295 Ga0065707_10217902 Ga0065707_102179022 271
1115 3300005331 Ga0070670_100137400 Ga0070670_1001374002 271
1116 3300005336 Ga0070680_100008580 Ga0070680_1000085804 271
1117 3300005344 Ga0070661_100192596 Ga0070661_1001925962 271
1118 3300005345 Ga0070692_10186495 Ga0070692_101864952 271
1119 3300005367 Ga0070667_100390968 Ga0070667_1003909681 271
1120 3300005458 Ga0070681_10002251 Ga0070681_100022517 271
1121 3300005530 Ga0070679_100002201 Ga0070679_1000022017 271
1122 3300005536 Ga0070697_100210880 Ga0070697_1002108802 271
1123 3300005544 Ga0070686_100139598 Ga0070686_1001395982 271
1124 3300005546 Ga0070696_100061516 Ga0070696_1000615161 271
1125 3300005549 Ga0070704_100418075 Ga0070704_1004180752 271
1126 3300005578 Ga0068854_100497883 Ga0068854_1004978831 271
1127 3300005614 Ga0068856_100071378 Ga0068856_1000713783 271
1128 3300005617 Ga0068859_100095547 Ga0068859_1000955473 271
1129 3300005719 Ga0068861_100243823 Ga0068861_1002438231 271
1130 3300005841 Ga0068863_100263275 Ga0068863_1002632752 271
1131 3300005844 Ga0068862_100019561 Ga0068862_1000195614 271
1132 3300005985 Ga0081539_10004329 Ga0081539_100043296 271
1133 3300006358 Ga0068871_100026202 Ga0068871_1000262025 271
1134 3300006844 Ga0075428_100000892 Ga0075428_10000089213 271
1135 3300006846 Ga0075430_100080071 Ga0075430_1000800712 271
1136 3300006847 Ga0075431_100028899 Ga0075431_1000288995 271
1137 3300006852 Ga0075433_10005987 Ga0075433_100059878 271
1138 3300006852 Ga0075433_10006901 Ga0075433_100069019 271
1139 3300006852 Ga0075433_10066473 Ga0075433_100664732 271
1140 3300006852 Ga0075433_10074924 Ga0075433_100749243 271
1141 3300006871 Ga0075434_100000616 Ga0075434_10000061621 271
1142 3300006871 Ga0075434_100027139 Ga0075434_1000271393 271
1143 3300006871 Ga0075434_100040547 Ga0075434_1000405473 271
1144 3300006871 Ga0075434_100540127 Ga0075434_1005401271 271
1145 3300006871 Ga0075434_100640000 Ga0075434_1006400002 271
1146 3300006880 Ga0075429_100355789 Ga0075429_1003557892 271
1147 3300006931 Ga0097620_100095548 Ga0097620_1000955482 271
1148 3300007076 Ga0075435_100029566 Ga0075435_1000295662 271
1149 3300009094 Ga0111539_10003191 Ga0111539_100031916 271
1150 3300009147 Ga0114129_10002555 Ga0114129_1000255518 271
1151 3300009147 Ga0114129_10040516 Ga0114129_100405164 271
1152 3300009147 Ga0114129_10090044 Ga0114129_100900442 271
1153 3300009545 Ga0105237_10084994 Ga0105237_100849943 271
1154 3300009553 Ga0105249_10038910 Ga0105249_100389102 271
1155 3300010375 Ga0105239_10349899 Ga0105239_103498992 271
1156 3300013308 Ga0157375_10517021 Ga0157375_105170212 271
1157 3300014745 Ga0157377_10073723 Ga0157377_100737232 271
1158 3300014969 Ga0157376_10408705 Ga0157376_104087052 271
1159 3300014969 Ga0157376_10476560 Ga0157376_104765602 271
1160 3300025893 Ga0207682_10066939 Ga0207682_100669391 271
1161 3300025908 Ga0207643_10010011 Ga0207643_100100115 271
1162 3300025912 Ga0207707_10000571 Ga0207707_1000057127 271
1163 3300025914 Ga0207671_10038185 Ga0207671_100381854 271
1164 3300025921 Ga0207652_10002002 Ga0207652_100020028 271
1165 3300025922 Ga0207646_10047946 Ga0207646_100479461 271
1166 3300025931 Ga0207644_10055818 Ga0207644_100558183 271
1167 3300025934 Ga0207686_10149569 Ga0207686_101495692 271
1168 3300025940 Ga0207691_10503185 Ga0207691_105031851 271
1169 3300025945 Ga0207679_10103414 Ga0207679_101034142 271
1170 3300025945 Ga0207679_10253166 Ga0207679_102531662 271
1171 3300025961 Ga0207712_10224992 Ga0207712_102249922 271
1172 3300026041 Ga0207639_10292758 Ga0207639_102927582 271
1173 3300026078 Ga0207702_10765554 Ga0207702_107655541 271
1174 3300026088 Ga0207641_10101524 Ga0207641_101015243 271
1175 3300026088 Ga0207641_10228663 Ga0207641_102286632 271
1176 3300026095 Ga0207676_10046156 Ga0207676_100461563 271
1177 3300026118 Ga0207675_100095740 Ga0207675_1000957403 271
1178 3300026121 Ga0207683_10021539 Ga0207683_100215393 271
1179 3300028380 Ga0268265_10024432 Ga0268265_100244323 271
1180 3300028381 Ga0268264_10530056 Ga0268264_105300561 271
1181 3300035691 Ga0373931_0021797 Ga0373931_0021797_2095_2958 271
1182 3300036401 Ga0373937_0004439 Ga0373937_0004439_8172_9020 271
1183 3300042122 Ga0450920_016392 Ga0450920_016392_533_1372 271
1184 3300042184 Ga0450908_006780 Ga0450908_006780_132_971 271
1185 3300042435 Ga0439434_0008236 Ga0439434_0008236_1045_1881 271
1186 3300045051 Ga0451576_0092358 Ga0451576_0092358_447_1310 271
1187 3300046664 Ga0495659_0172235 Ga0495659_0172235_14_865 271
1188 3300046684 Ga0495669_0053527 Ga0495669_0053527_321_1172 271
1189 3300046689 Ga0495613_0266641 Ga0495613_0266641_288_1136 271
1190 3300048907 Ga0496104_0206568 Ga0496104_0206568_45_947 271
1191 3300048907 Ga0496104_0280924 Ga0496104_0280924_598_1452 271
1192 3300048909 Ga0496106_0040133 Ga0496106_0040133_1360_2214 271
1193 3300048910 Ga0496107_0100557 Ga0496107_0100557_421_1275 271
1194 3300050507 nmdc:mga05p37_27139_c1 nmdc:mga05p37_27139_c1_3589_4428 271
1195 3300050507 nmdc:mga05p37_499553_c1 nmdc:mga05p37_499553_c1_305_1159 271
1196 3300050507 nmdc:mga05p37_5966_c1 nmdc:mga05p37_5966_c1_8660_9523 271
1197 3300050507 nmdc:mga05p37_92829_c1 nmdc:mga05p37_92829_c1_1370_2212 271
1198 3300050508 nmdc:mga09592_350441_c1 nmdc:mga09592_350441_c1_336_1199 271
1199 3300050512 nmdc:mga0n895_2061_c1 nmdc:mga0n895_2061_c1_6797_7636 271
1200 3300050512 nmdc:mga0n895_23833_c1 nmdc:mga0n895_23833_c1_3016_3879 271
1201 3300050512 nmdc:mga0n895_30660_c1 nmdc:mga0n895_30660_c1_1248_2105 271
1202 3300050512 nmdc:mga0n895_38796_c1 nmdc:mga0n895_38796_c1_1513_2352 271
1203 3300050513 nmdc:mga0rr50_9662_c1 nmdc:mga0rr50_9662_c1_5027_5866 271
1204 3300050513 nmdc:mga0rr50_97120_c1 nmdc:mga0rr50_97120_c1_327_1217 271
1205 3300050515 nmdc:mga0a205_19136_c1 nmdc:mga0a205_19136_c1_1978_2835 271
1206 3300050515 nmdc:mga0a205_2833_c1 nmdc:mga0a205_2833_c1_1872_2711 271
1207 3300050515 nmdc:mga0a205_33889_c1 nmdc:mga0a205_33889_c1_3627_4490 271
1208 3300050515 nmdc:mga0a205_87423_c1 nmdc:mga0a205_87423_c1_1723_2577 271
1209 3300050515 nmdc:mga0a205_9790_c1 nmdc:mga0a205_9790_c1_2367_3206 271
1210 3300005290 Ga0065712_10089999 Ga0065712_100899992 272
1211 3300005293 Ga0065715_10092488 Ga0065715_100924884 272
1212 3300005293 Ga0065715_10095993 Ga0065715_100959933 272
1213 3300005293 Ga0065715_10096536 Ga0065715_100965361 272
1214 3300005330 Ga0070690_100312464 Ga0070690_1003124641 272
1215 3300005331 Ga0070670_100022339 Ga0070670_1000223393 272
1216 3300005331 Ga0070670_100092342 Ga0070670_1000923422 272
1217 3300005334 Ga0068869_100013861 Ga0068869_1000138612 272
1218 3300005334 Ga0068869_100036396 Ga0068869_1000363963 272
1219 3300005334 Ga0068869_100063548 Ga0068869_1000635482 272
1220 3300005334 Ga0068869_100089436 Ga0068869_1000894361 272
1221 3300005335 Ga0070666_10017358 Ga0070666_100173584 272
1222 3300005337 Ga0070682_100077459 Ga0070682_1000774593 272
1223 3300005338 Ga0068868_100007979 Ga0068868_1000079796 272
1224 3300005338 Ga0068868_100022079 Ga0068868_1000220795 272
1225 3300005338 Ga0068868_100026576 Ga0068868_1000265764 272
1226 3300005340 Ga0070689_100011796 Ga0070689_1000117964 272
1227 3300005343 Ga0070687_100000609 Ga0070687_10000060911 272
1228 3300005344 Ga0070661_100112565 Ga0070661_1001125652 272
1229 3300005345 Ga0070692_10041591 Ga0070692_100415911 272
1230 3300005347 Ga0070668_100002227 Ga0070668_10000222710 272
1231 3300005353 Ga0070669_100070748 Ga0070669_1000707482 272
1232 3300005355 Ga0070671_100378231 Ga0070671_1003782312 272
1233 3300005364 Ga0070673_100278028 Ga0070673_1002780282 272
1234 3300005365 Ga0070688_100021608 Ga0070688_1000216084 272
1235 3300005367 Ga0070667_100113212 Ga0070667_1001132122 272
1236 3300005406 Ga0070703_10001430 Ga0070703_100014306 272
1237 3300005444 Ga0070694_100167957 Ga0070694_1001679571 272
1238 3300005445 Ga0070708_100042407 Ga0070708_1000424074 272
1239 3300005445 Ga0070708_100110782 Ga0070708_1001107822 272
1240 3300005456 Ga0070678_100012839 Ga0070678_1000128394 272
1241 3300005467 Ga0070706_100057275 Ga0070706_1000572754 272
1242 3300005467 Ga0070706_100097781 Ga0070706_1000977813 272
1243 3300005468 Ga0070707_100494571 Ga0070707_1004945712 272
1244 3300005471 Ga0070698_100003580 Ga0070698_1000035809 272
1245 3300005471 Ga0070698_100058436 Ga0070698_1000584363 272
1246 3300005471 Ga0070698_100397165 Ga0070698_1003971652 272
1247 3300005518 Ga0070699_100044718 Ga0070699_1000447182 272
1248 3300005518 Ga0070699_100097715 Ga0070699_1000977151 272
1249 3300005536 Ga0070697_100000466 Ga0070697_1000004667 272
1250 3300005536 Ga0070697_100000619 Ga0070697_10000061916 272
1251 3300005536 Ga0070697_100191773 Ga0070697_1001917732 272
1252 3300005544 Ga0070686_100095918 Ga0070686_1000959182 272
1253 3300005546 Ga0070696_100018393 Ga0070696_1000183933 272
1254 3300005546 Ga0070696_100207418 Ga0070696_1002074182 272
1255 3300005547 Ga0070693_100057168 Ga0070693_1000571682 272
1256 3300005548 Ga0070665_100170715 Ga0070665_1001707152 272
1257 3300005549 Ga0070704_100051077 Ga0070704_1000510773 272
1258 3300005564 Ga0070664_100004288 Ga0070664_10000428810 272
1259 3300005564 Ga0070664_100274536 Ga0070664_1002745362 272
1260 3300005578 Ga0068854_100223684 Ga0068854_1002236842 272
1261 3300005615 Ga0070702_100071732 Ga0070702_1000717322 272
1262 3300005616 Ga0068852_100189256 Ga0068852_1001892562 272
1263 3300005617 Ga0068859_100026107 Ga0068859_1000261073 272
1264 3300005617 Ga0068859_100120605 Ga0068859_1001206053 272
1265 3300005617 Ga0068859_100359165 Ga0068859_1003591652 272
1266 3300005618 Ga0068864_100091528 Ga0068864_1000915283 272
1267 3300005618 Ga0068864_100117221 Ga0068864_1001172212 272
1268 3300005618 Ga0068864_100142785 Ga0068864_1001427853 272
1269 3300005719 Ga0068861_100024976 Ga0068861_1000249762 272
1270 3300005834 Ga0068851_10000522 Ga0068851_100005226 272
1271 3300005842 Ga0068858_100079189 Ga0068858_1000791894 272
1272 3300005842 Ga0068858_100323322 Ga0068858_1003233222 272
1273 3300005843 Ga0068860_100117261 Ga0068860_1001172612 272
1274 3300005844 Ga0068862_100256023 Ga0068862_1002560232 272
1275 3300006237 Ga0097621_100416960 Ga0097621_1004169602 272
1276 3300006358 Ga0068871_100004556 Ga0068871_1000045566 272
1277 3300006931 Ga0097620_100026106 Ga0097620_1000261065 272
1278 3300006931 Ga0097620_100120606 Ga0097620_1001206062 272
1279 3300006931 Ga0097620_100359183 Ga0097620_1003591832 272
1280 3300009093 Ga0105240_10337304 Ga0105240_103373042 272
1281 3300009101 Ga0105247_10030558 Ga0105247_100305582 272
1282 3300009176 Ga0105242_10415569 Ga0105242_104155692 272
1283 3300009545 Ga0105237_10001434 Ga0105237_1000143426 272
1284 3300009553 Ga0105249_10000369 Ga0105249_1000036939 272
1285 3300013102 Ga0157371_10147042 Ga0157371_101470422 272
1286 3300013296 Ga0157374_10025686 Ga0157374_100256866 272
1287 3300013297 Ga0157378_10005813 Ga0157378_100058139 272
1288 3300013306 Ga0163162_10000019 Ga0163162_10000019123 272
1289 3300013306 Ga0163162_10013874 Ga0163162_100138746 272
1290 3300013306 Ga0163162_10137245 Ga0163162_101372452 272
1291 3300013306 Ga0163162_10174767 Ga0163162_101747673 272
1292 3300013308 Ga0157375_10026328 Ga0157375_100263282 272
1293 3300013308 Ga0157375_10327524 Ga0157375_103275242 272
1294 3300014325 Ga0163163_10003120 Ga0163163_100031205 272
1295 3300014325 Ga0163163_10003397 Ga0163163_100033976 272
1296 3300014325 Ga0163163_10078520 Ga0163163_100785204 272
1297 3300014326 Ga0157380_10082532 Ga0157380_100825322 272
1298 3300014745 Ga0157377_10028661 Ga0157377_100286612 272
1299 3300014968 Ga0157379_10007906 Ga0157379_100079069 272
1300 3300014968 Ga0157379_10087600 Ga0157379_100876004 272
1301 3300014968 Ga0157379_10394000 Ga0157379_103940002 272
1302 3300014969 Ga0157376_10027415 Ga0157376_100274154 272
1303 3300017792 Ga0163161_10068135 Ga0163161_100681351 272
1304 3300025315 Ga0207697_10032149 Ga0207697_100321493 272
1305 3300025321 Ga0207656_10010387 Ga0207656_100103872 272
1306 3300025885 Ga0207653_10002170 Ga0207653_100021705 272
1307 3300025908 Ga0207643_10007744 Ga0207643_100077444 272
1308 3300025910 Ga0207684_10033034 Ga0207684_100330343 272
1309 3300025910 Ga0207684_10073130 Ga0207684_100731302 272
1310 3300025914 Ga0207671_10000811 Ga0207671_1000081116 272
1311 3300025918 Ga0207662_10001880 Ga0207662_100018809 272
1312 3300025920 Ga0207649_10208999 Ga0207649_102089992 272
1313 3300025931 Ga0207644_10046234 Ga0207644_100462342 272
1314 3300025933 Ga0207706_10054781 Ga0207706_100547813 272
1315 3300025934 Ga0207686_10098549 Ga0207686_100985492 272
1316 3300025935 Ga0207709_10103493 Ga0207709_101034932 272
1317 3300025936 Ga0207670_10008388 Ga0207670_100083884 272
1318 3300025938 Ga0207704_10150845 Ga0207704_101508452 272
1319 3300025941 Ga0207711_10068194 Ga0207711_100681942 272
1320 3300025942 Ga0207689_10002826 Ga0207689_1000282612 272
1321 3300025942 Ga0207689_10018311 Ga0207689_100183112 272
1322 3300025942 Ga0207689_10022495 Ga0207689_100224954 272
1323 3300025942 Ga0207689_10076094 Ga0207689_100760942 272
1324 3300025945 Ga0207679_10021619 Ga0207679_100216194 272
1325 3300025945 Ga0207679_10250364 Ga0207679_102503642 272
1326 3300025960 Ga0207651_10048587 Ga0207651_100485873 272
1327 3300025961 Ga0207712_10000544 Ga0207712_100005443 272
1328 3300025972 Ga0207668_10002854 Ga0207668_100028546 272
1329 3300025986 Ga0207658_10015094 Ga0207658_100150942 272
1330 3300026023 Ga0207677_10060900 Ga0207677_100609002 272
1331 3300026023 Ga0207677_10071212 Ga0207677_100712123 272
1332 3300026035 Ga0207703_10046964 Ga0207703_100469644 272
1333 3300026088 Ga0207641_10238756 Ga0207641_102387562 272
1334 3300026089 Ga0207648_10085778 Ga0207648_100857782 272
1335 3300026095 Ga0207676_10010391 Ga0207676_100103913 272
1336 3300026095 Ga0207676_10188228 Ga0207676_101882282 272
1337 3300026095 Ga0207676_10213850 Ga0207676_102138502 272
1338 3300026095 Ga0207676_10757565 Ga0207676_107575651 272
1339 3300026121 Ga0207683_10086987 Ga0207683_100869872 272
1340 3300026121 Ga0207683_10311877 Ga0207683_103118772 272
1341 3300028379 Ga0268266_10058687 Ga0268266_100586874 272
1342 3300028381 Ga0268264_10043240 Ga0268264_100432404 272
1343 3300031852 Ga0307410_10380897 Ga0307410_103808972 272
1344 3300032005 Ga0307411_10166660 Ga0307411_101666601 272
1345 3300032126 Ga0307415_100359917 Ga0307415_1003599171 272
1346 3300046539 Ga0495621_0003499 Ga0495621_0003499_1027_1869 272
1347 3300048912 Ga0496109_0201124 Ga0496109_0201124_635_1504 272
1348 3300048915 Ga0496112_0486541 Ga0496112_0486541_293_1150 272
1349 3300049522 Ga0501299_003673 Ga0501299_003673_227_1048 272
1350 3300049661 Ga0501217_040076 Ga0501217_040076_221_1042 272
1351 3300049669 Ga0501235_059760 Ga0501235_059760_58_879 272
1352 3300000532 CNAas_1000016 CNAas_10000165 273
1353 3300003203 JGI25406J46586_10008161 JGI25406J46586_100081615 273
1354 3300005290 Ga0065712_10080251 Ga0065712_100802512 273
1355 3300005293 Ga0065715_10004182 Ga0065715_100041823 273
1356 3300005293 Ga0065715_10036827 Ga0065715_100368271 273
1357 3300005293 Ga0065715_10144409 Ga0065715_101444093 273
1358 3300005295 Ga0065707_10231281 Ga0065707_102312812 273
1359 3300005330 Ga0070690_100002585 Ga0070690_10000258511 273
1360 3300005330 Ga0070690_100107500 Ga0070690_1001075002 273
1361 3300005330 Ga0070690_100218525 Ga0070690_1002185251 273
1362 3300005334 Ga0068869_100006292 Ga0068869_1000062924 273
1363 3300005335 Ga0070666_10028650 Ga0070666_100286503 273
1364 3300005336 Ga0070680_100010318 Ga0070680_1000103183 273
1365 3300005343 Ga0070687_100016663 Ga0070687_1000166633 273
1366 3300005345 Ga0070692_10074320 Ga0070692_100743201 273
1367 3300005353 Ga0070669_100067350 Ga0070669_1000673502 273
1368 3300005355 Ga0070671_100005634 Ga0070671_10000563411 273
1369 3300005364 Ga0070673_100038421 Ga0070673_1000384212 273
1370 3300005364 Ga0070673_100266504 Ga0070673_1002665042 273
1371 3300005366 Ga0070659_100002910 Ga0070659_1000029106 273
1372 3300005406 Ga0070703_10001162 Ga0070703_100011623 273
1373 3300005440 Ga0070705_100000051 Ga0070705_10000005121 273
1374 3300005441 Ga0070700_100000183 Ga0070700_10000018321 273
1375 3300005441 Ga0070700_100011785 Ga0070700_1000117854 273
1376 3300005441 Ga0070700_100034619 Ga0070700_1000346193 273
1377 3300005441 Ga0070700_100043469 Ga0070700_1000434693 273
1378 3300005441 Ga0070700_100299160 Ga0070700_1002991602 273
1379 3300005444 Ga0070694_100032673 Ga0070694_1000326732 273
1380 3300005444 Ga0070694_100075487 Ga0070694_1000754873 273
1381 3300005444 Ga0070694_100079887 Ga0070694_1000798872 273
1382 3300005444 Ga0070694_100346537 Ga0070694_1003465372 273
1383 3300005445 Ga0070708_100039904 Ga0070708_1000399044 273
1384 3300005445 Ga0070708_100122212 Ga0070708_1001222123 273
1385 3300005456 Ga0070678_100076008 Ga0070678_1000760081 273
1386 3300005457 Ga0070662_100037449 Ga0070662_1000374494 273
1387 3300005458 Ga0070681_10016366 Ga0070681_100163663 273
1388 3300005458 Ga0070681_10022564 Ga0070681_100225644 273
1389 3300005458 Ga0070681_10134852 Ga0070681_101348522 273
1390 3300005459 Ga0068867_100107227 Ga0068867_1001072272 273
1391 3300005459 Ga0068867_100204305 Ga0068867_1002043051 273
1392 3300005459 Ga0068867_100352428 Ga0068867_1003524282 273
1393 3300005467 Ga0070706_100000044 Ga0070706_10000004488 273
1394 3300005467 Ga0070706_100001113 Ga0070706_1000011132 273
1395 3300005467 Ga0070706_100412303 Ga0070706_1004123031 273
1396 3300005468 Ga0070707_100318068 Ga0070707_1003180682 273
1397 3300005471 Ga0070698_100034824 Ga0070698_1000348246 273
1398 3300005471 Ga0070698_100037375 Ga0070698_1000373753 273
1399 3300005518 Ga0070699_100000856 Ga0070699_1000008568 273
1400 3300005518 Ga0070699_100016326 Ga0070699_1000163265 273
1401 3300005530 Ga0070679_100387491 Ga0070679_1003874912 273
1402 3300005536 Ga0070697_100307745 Ga0070697_1003077451 273
1403 3300005539 Ga0068853_100255020 Ga0068853_1002550202 273
1404 3300005543 Ga0070672_100018785 Ga0070672_1000187854 273
1405 3300005543 Ga0070672_100636089 Ga0070672_1006360891 273
1406 3300005544 Ga0070686_100005143 Ga0070686_1000051437 273
1407 3300005545 Ga0070695_100044381 Ga0070695_1000443814 273
1408 3300005545 Ga0070695_100135407 Ga0070695_1001354072 273
1409 3300005545 Ga0070695_100160061 Ga0070695_1001600612 273
1410 3300005546 Ga0070696_100003223 Ga0070696_1000032237 273
1411 3300005546 Ga0070696_100369235 Ga0070696_1003692351 273
1412 3300005547 Ga0070693_100098871 Ga0070693_1000988712 273
1413 3300005547 Ga0070693_100284535 Ga0070693_1002845352 273
1414 3300005549 Ga0070704_100073974 Ga0070704_1000739743 273
1415 3300005564 Ga0070664_100004142 Ga0070664_1000041424 273
1416 3300005564 Ga0070664_100069672 Ga0070664_1000696724 273
1417 3300005577 Ga0068857_100002169 Ga0068857_1000021699 273
1418 3300005578 Ga0068854_100051857 Ga0068854_1000518573 273
1419 3300005615 Ga0070702_100001793 Ga0070702_10000179310 273
1420 3300005617 Ga0068859_100013911 Ga0068859_1000139113 273
1421 3300005617 Ga0068859_100038260 Ga0068859_1000382603 273
1422 3300005617 Ga0068859_100049457 Ga0068859_1000494575 273
1423 3300005617 Ga0068859_100137105 Ga0068859_1001371053 273
1424 3300005617 Ga0068859_100565677 Ga0068859_1005656772 273
1425 3300005618 Ga0068864_100072718 Ga0068864_1000727182 273
1426 3300005618 Ga0068864_100138000 Ga0068864_1001380002 273
1427 3300005618 Ga0068864_100150999 Ga0068864_1001509993 273
1428 3300005718 Ga0068866_10005443 Ga0068866_100054431 273
1429 3300005719 Ga0068861_100000953 Ga0068861_1000009536 273
1430 3300005719 Ga0068861_100014770 Ga0068861_1000147704 273
1431 3300005719 Ga0068861_100081423 Ga0068861_1000814232 273
1432 3300005719 Ga0068861_100232092 Ga0068861_1002320922 273
1433 3300005840 Ga0068870_10023312 Ga0068870_100233123 273
1434 3300005841 Ga0068863_100022685 Ga0068863_1000226853 273
1435 3300005841 Ga0068863_100141853 Ga0068863_1001418532 273
1436 3300005842 Ga0068858_100082117 Ga0068858_1000821173 273
1437 3300005842 Ga0068858_100389880 Ga0068858_1003898802 273
1438 3300005843 Ga0068860_100021864 Ga0068860_1000218643 273
1439 3300005843 Ga0068860_100068217 Ga0068860_1000682173 273
1440 3300005843 Ga0068860_100420697 Ga0068860_1004206972 273
1441 3300005843 Ga0068860_100436946 Ga0068860_1004369462 273
1442 3300005843 Ga0068860_100825165 Ga0068860_1008251651 273
1443 3300005844 Ga0068862_100011099 Ga0068862_1000110993 273
1444 3300005844 Ga0068862_100029639 Ga0068862_1000296394 273
1445 3300005937 Ga0081455_10118850 Ga0081455_101188502 273
1446 3300005985 Ga0081539_10001299 Ga0081539_1000129919 273
1447 3300006058 Ga0075432_10068987 Ga0075432_100689871 273
1448 3300006173 Ga0070716_100078326 Ga0070716_1000783262 273
1449 3300006237 Ga0097621_100011165 Ga0097621_1000111654 273
1450 3300006237 Ga0097621_100078334 Ga0097621_1000783343 273
1451 3300006358 Ga0068871_100081859 Ga0068871_1000818593 273
1452 3300006844 Ga0075428_100609628 Ga0075428_1006096282 273
1453 3300006847 Ga0075431_100696073 Ga0075431_1006960731 273
1454 3300006871 Ga0075434_100217415 Ga0075434_1002174152 273
1455 3300006880 Ga0075429_100324592 Ga0075429_1003245921 273
1456 3300006881 Ga0068865_100009470 Ga0068865_1000094706 273
1457 3300006881 Ga0068865_100253438 Ga0068865_1002534382 273
1458 3300006881 Ga0068865_100439572 Ga0068865_1004395722 273
1459 3300006931 Ga0097620_100013911 Ga0097620_1000139113 273
1460 3300006931 Ga0097620_100038257 Ga0097620_1000382574 273
1461 3300006931 Ga0097620_100049461 Ga0097620_1000494615 273
1462 3300006931 Ga0097620_100137105 Ga0097620_1001371053 273
1463 3300006931 Ga0097620_100565669 Ga0097620_1005656691 273
1464 3300007076 Ga0075435_100003512 Ga0075435_10000351211 273
1465 3300009094 Ga0111539_10078917 Ga0111539_100789173 273
1466 3300009098 Ga0105245_10046841 Ga0105245_100468414 273
1467 3300009101 Ga0105247_10007231 Ga0105247_100072318 273
1468 3300009147 Ga0114129_10040634 Ga0114129_100406346 273
1469 3300009148 Ga0105243_10005705 Ga0105243_1000570510 273
1470 3300009148 Ga0105243_10005941 Ga0105243_100059413 273
1471 3300009174 Ga0105241_10552885 Ga0105241_105528852 273
1472 3300009176 Ga0105242_10010031 Ga0105242_100100318 273
1473 3300009176 Ga0105242_10112931 Ga0105242_101129313 273
1474 3300009177 Ga0105248_10011939 Ga0105248_100119398 273
1475 3300009177 Ga0105248_10207818 Ga0105248_102078181 273
1476 3300009177 Ga0105248_10321099 Ga0105248_103210992 273
1477 3300009551 Ga0105238_10008489 Ga0105238_100084896 273
1478 3300009551 Ga0105238_10012505 Ga0105238_100125054 273
1479 3300009553 Ga0105249_10015748 Ga0105249_100157487 273
1480 3300009553 Ga0105249_10386021 Ga0105249_103860212 273
1481 3300010375 Ga0105239_10098218 Ga0105239_100982184 273
1482 3300010375 Ga0105239_10106037 Ga0105239_101060374 273
1483 3300011119 Ga0105246_10123115 Ga0105246_101231153 273
1484 3300011119 Ga0105246_10508780 Ga0105246_105087801 273
1485 3300013102 Ga0157371_10065731 Ga0157371_100657312 273
1486 3300013296 Ga0157374_10011236 Ga0157374_100112366 273
1487 3300013297 Ga0157378_10019296 Ga0157378_100192962 273
1488 3300013297 Ga0157378_10068569 Ga0157378_100685692 273
1489 3300013306 Ga0163162_10001443 Ga0163162_1000144323 273
1490 3300013306 Ga0163162_10005531 Ga0163162_100055312 273
1491 3300013306 Ga0163162_10149774 Ga0163162_101497741 273
1492 3300013306 Ga0163162_10338156 Ga0163162_103381562 273
1493 3300013307 Ga0157372_10406054 Ga0157372_104060542 273
1494 3300013308 Ga0157375_10836285 Ga0157375_108362851 273
1495 3300014325 Ga0163163_10067918 Ga0163163_100679184 273
1496 3300014325 Ga0163163_10110382 Ga0163163_101103823 273
1497 3300014325 Ga0163163_10443867 Ga0163163_104438672 273
1498 3300014325 Ga0163163_10511830 Ga0163163_105118301 273
1499 3300014326 Ga0157380_10002550 Ga0157380_100025506 273
1500 3300014326 Ga0157380_10020775 Ga0157380_100207753 273
1501 3300014745 Ga0157377_10015858 Ga0157377_100158583 273
1502 3300014969 Ga0157376_10074180 Ga0157376_100741804 273
1503 3300025885 Ga0207653_10003256 Ga0207653_100032564 273
1504 3300025893 Ga0207682_10166543 Ga0207682_101665431 273
1505 3300025899 Ga0207642_10148566 Ga0207642_101485661 273
1506 3300025900 Ga0207710_10002333 Ga0207710_100023336 273
1507 3300025904 Ga0207647_10077278 Ga0207647_100772782 273
1508 3300025907 Ga0207645_10040733 Ga0207645_100407333 273
1509 3300025908 Ga0207643_10040080 Ga0207643_100400803 273
1510 3300025910 Ga0207684_10000611 Ga0207684_1000061135 273
1511 3300025910 Ga0207684_10003111 Ga0207684_1000311120 273
1512 3300025910 Ga0207684_10141548 Ga0207684_101415483 273
1513 3300025911 Ga0207654_10096949 Ga0207654_100969492 273
1514 3300025912 Ga0207707_10002505 Ga0207707_1000250514 273
1515 3300025912 Ga0207707_10092390 Ga0207707_100923903 273
1516 3300025917 Ga0207660_10044338 Ga0207660_100443384 273
1517 3300025918 Ga0207662_10003709 Ga0207662_100037096 273
1518 3300025918 Ga0207662_10029280 Ga0207662_100292803 273
1519 3300025920 Ga0207649_10333939 Ga0207649_103339391 273
1520 3300025922 Ga0207646_10043292 Ga0207646_100432923 273
1521 3300025924 Ga0207694_10009585 Ga0207694_100095858 273
1522 3300025931 Ga0207644_10017680 Ga0207644_100176803 273
1523 3300025932 Ga0207690_10013212 Ga0207690_100132124 273
1524 3300025933 Ga0207706_10052570 Ga0207706_100525704 273
1525 3300025934 Ga0207686_10191526 Ga0207686_101915262 273
1526 3300025938 Ga0207704_10016206 Ga0207704_100162064 273
1527 3300025938 Ga0207704_10333419 Ga0207704_103334192 273
1528 3300025939 Ga0207665_10024763 Ga0207665_100247634 273
1529 3300025940 Ga0207691_10093345 Ga0207691_100933453 273
1530 3300025940 Ga0207691_10168176 Ga0207691_101681762 273
1531 3300025941 Ga0207711_10005724 Ga0207711_100057249 273
1532 3300025941 Ga0207711_10080066 Ga0207711_100800663 273
1533 3300025941 Ga0207711_10141882 Ga0207711_101418823 273
1534 3300025942 Ga0207689_10002233 Ga0207689_100022334 273
1535 3300025945 Ga0207679_10001272 Ga0207679_100012726 273
1536 3300025945 Ga0207679_10441189 Ga0207679_104411892 273
1537 3300025961 Ga0207712_10079082 Ga0207712_100790823 273
1538 3300025961 Ga0207712_10219070 Ga0207712_102190702 273
1539 3300025961 Ga0207712_10245551 Ga0207712_102455512 273
1540 3300025981 Ga0207640_10039847 Ga0207640_100398473 273
1541 3300026035 Ga0207703_10110202 Ga0207703_101102023 273
1542 3300026035 Ga0207703_10152576 Ga0207703_101525762 273
1543 3300026035 Ga0207703_10320917 Ga0207703_103209172 273
1544 3300026035 Ga0207703_10340810 Ga0207703_103408101 273
1545 3300026035 Ga0207703_10439054 Ga0207703_104390542 273
1546 3300026041 Ga0207639_10218927 Ga0207639_102189271 273
1547 3300026075 Ga0207708_10000100 Ga0207708_1000010013 273
1548 3300026075 Ga0207708_10006192 Ga0207708_100061922 273
1549 3300026075 Ga0207708_10021502 Ga0207708_100215023 273
1550 3300026075 Ga0207708_10030991 Ga0207708_100309912 273
1551 3300026075 Ga0207708_10158821 Ga0207708_101588213 273
1552 3300026075 Ga0207708_10424420 Ga0207708_104244201 273
1553 3300026088 Ga0207641_10509219 Ga0207641_105092192 273
1554 3300026088 Ga0207641_10584452 Ga0207641_105844521 273
1555 3300026088 Ga0207641_10720177 Ga0207641_107201771 273
1556 3300026089 Ga0207648_10165821 Ga0207648_101658212 273
1557 3300026095 Ga0207676_10048653 Ga0207676_100486534 273
1558 3300026095 Ga0207676_10100200 Ga0207676_101002003 273
1559 3300026095 Ga0207676_10226488 Ga0207676_102264882 273
1560 3300026095 Ga0207676_10496213 Ga0207676_104962132 273
1561 3300026116 Ga0207674_10000790 Ga0207674_1000079033 273
1562 3300026116 Ga0207674_10012851 Ga0207674_100128515 273
1563 3300026116 Ga0207674_10164769 Ga0207674_101647692 273
1564 3300026118 Ga0207675_100002272 Ga0207675_1000022726 273
1565 3300026118 Ga0207675_100088496 Ga0207675_1000884963 273
1566 3300026118 Ga0207675_100420112 Ga0207675_1004201122 273
1567 3300026121 Ga0207683_10112338 Ga0207683_101123381 273
1568 3300028380 Ga0268265_10066087 Ga0268265_100660872 273
1569 3300028381 Ga0268264_10471711 Ga0268264_104717111 273
1570 3300028381 Ga0268264_10551300 Ga0268264_105513002 273
1571 3300031548 Ga0307408_100035392 Ga0307408_1000353923 273
1572 3300031727 Ga0316576_10016621 Ga0316576_100166213 273
1573 3300031901 Ga0307406_10009137 Ga0307406_100091373 273
1574 3300031903 Ga0307407_10075659 Ga0307407_100756592 273
1575 3300031911 Ga0307412_10026352 Ga0307412_100263524 273
1576 3300031995 Ga0307409_100049981 Ga0307409_1000499812 273
1577 3300032002 Ga0307416_100021625 Ga0307416_1000216254 273
1578 3300037466 Ga0395898_0149532 Ga0395898_0149532_339_1160 273
1579 3300037466 Ga0395898_0389523 Ga0395898_0389523_310_1134 273
1580 3300038443 Ga0395901_0217830 Ga0395901_0217830_699_1532 273
1581 3300038443 Ga0395901_0482596 Ga0395901_0482596_429_1250 273
1582 3300042005 Ga0439448_0005210 Ga0439448_0005210_2707_3531 273
1583 3300049514 Ga0501291_000471 Ga0501291_000471_3181_4014 273
1584 3300049515 Ga0501292_006351 Ga0501292_006351_577_1410 273
1585 3300049521 Ga0501298_001140 Ga0501298_001140_1625_2458 273
1586 3300049522 Ga0501299_000411 Ga0501299_000411_2114_2947 273
1587 3300049574 Ga0501038_0001430 Ga0501038_0001430_7240_8073 273
1588 3300049652 Ga0501202_002593 Ga0501202_002593_1622_2446 273
1589 3300049652 Ga0501202_003915 Ga0501202_003915_266_1099 273
1590 3300049660 Ga0501216_002560 Ga0501216_002560_546_1370 273
1591 3300049661 Ga0501217_001547 Ga0501217_001547_1652_2476 273
1592 3300049663 Ga0501223_002885 Ga0501223_002885_1011_1835 273
1593 3300049665 Ga0501227_005642 Ga0501227_005642_204_1028 273
1594 3300049681 Ga0501251_002546 Ga0501251_002546_482_1315 273
1595 3300049779 Ga0501283_000404 Ga0501283_000404_4242_5075 273
1596 3300050507 nmdc:mga05p37_410214_c1 nmdc:mga05p37_410214_c1_174_1007 273
1597 3300050507 nmdc:mga05p37_4358_c1 nmdc:mga05p37_4358_c1_10865_11719 273
1598 3300050507 nmdc:mga05p37_710271_c1 nmdc:mga05p37_710271_c1_252_1091 273
1599 3300050508 nmdc:mga09592_305981_c1 nmdc:mga09592_305981_c1_11_871 273
1600 3300050511 nmdc:mga08y16_28899_c1 nmdc:mga08y16_28899_c1_2284_3108 273
1601 3300050512 nmdc:mga0n895_109387_c1 nmdc:mga0n895_109387_c1_1387_2211 273
1602 3300050512 nmdc:mga0n895_22219_c1 nmdc:mga0n895_22219_c1_3219_4103 273
1603 3300050515 nmdc:mga0a205_20180_c1 nmdc:mga0a205_20180_c1_4665_5549 273
1604 3300050515 nmdc:mga0a205_297133_c1 nmdc:mga0a205_297133_c1_520_1344 273

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

92

249

0.97

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

158

280

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c41-assembly1.cif.gz_K abc protein artp in complex with amp-pnp/mg2+ 0.9187 23 270
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9176 25 270
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9139 23 271
4yms-assembly1.cif.gz_A crystal structure of an amino acid abc transporter 0.9112 26 270
7ch8-assembly1.cif.gz_I cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9106 23 271
ID Description Score Start End Superfamily
af_Q2FYQ0_38_279_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9842 28 268 3.40.50.300
af_P9WQK9_23_275_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9725 28 271 3.40.50.300
af_Q2FYQ0_38_279_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9722 28 268 3.40.50.300
af_P9WQK9_23_275_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9273 28 271 3.40.50.300
af_Q58762_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9253 26 268 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A5A5T585-F1-model_v4 Phosphate ABC transporter ATP-binding protein 0.9879 22 273 GO:0005524
GO:0015415
GO:0016020
GO:0016887
GO:0035435
AF-A0A5C7R8B7-F1-model_v4 Phosphate ABC transporter ATP-binding protein 0.9874 24 273 GO:0005524
GO:0015415
GO:0016020
GO:0016887
GO:0035435
AF-A0A6C1KJS2-F1-model_v4 Phosphate ABC transporter ATP-binding protein PstB 0.9861 22 273 GO:0005524
GO:0005886
GO:0015415
GO:0016887
GO:0035435
AF-A0A7J3HNY0-F1-model_v4 Phosphate ABC transporter ATP-binding protein 0.9849 21 273 GO:0005524
GO:0015415
GO:0016020
GO:0016887
GO:0035435
AF-A0A7U9C389-F1-model_v4 Phosphate import ATP-binding protein pstB 2 0.9846 24 273 GO:0005315
GO:0005524
GO:0016020
GO:0016887
GO:0035435

Feature Viewer

pLDDT pTM Quality
91.27 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map