F495012

General Info

Members Datasets Scaffolds Average Seq Length
1604 646 3208 213

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10042032|Ga0265338_100420323
Length 225
Sequence MAWNRDQMAARAARELRDGFYVNLGIGIPTLVANFIPDGMEVTLQSENGMLGMGPFPFAGDEDPDLINAGKQTITQLPKTSYFSSADSFAMIRGGHIDLSILGAMQVSATGDLANWMVPGKMVKGMGGAMDLVAGVKKVVVVMEHTNKDGEHKIRDWCSLPLTGVGVVDMIITDLAVFTVDKHAGGLTLIELAPGVELAEIGDKTGAPFDVKLADGVRGSFAPAM

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
12 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
13 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
14 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
15 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
16 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
17 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
18 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
19 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
20 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
21 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
22 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
23 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
24 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
25 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
27 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
28 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
29 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
30 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
31 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
32 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
33 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
34 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
35 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
36 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
37 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
38 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
39 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
40 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
41 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
42 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
43 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
44 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
45 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
46 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
47 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
48 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
49 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
50 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
51 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
52 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
53 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
54 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
55 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
56 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
57 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
58 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
59 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
60 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
61 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
62 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
63 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
64 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
65 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
66 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
67 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
68 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
69 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
70 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
71 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
72 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
73 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
74 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
75 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
76 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
77 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
78 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
79 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
80 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
81 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
82 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
83 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
84 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
85 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
86 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
87 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
88 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
89 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
92 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
93 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
94 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
95 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
96 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
97 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
98 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
101 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
104 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
105 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
106 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
107 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
108 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
109 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
110 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
111 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
112 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
113 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
114 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
115 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
116 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
117 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
118 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
120 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
121 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
122 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
123 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
124 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
126 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
127 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
128 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
129 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
130 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
131 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
132 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
133 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
134 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
135 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
136 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
137 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
138 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
139 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
140 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
141 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
142 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
143 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
144 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
145 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
146 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
147 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
148 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
149 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
150 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
151 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
152 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
153 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
154 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
155 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
156 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
157 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
158 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
159 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
160 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
161 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
162 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
163 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
164 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
165 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
166 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
167 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
175 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
176 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
178 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
179 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
180 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
183 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
184 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
185 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
189 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
192 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
194 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
196 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
197 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
256 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
257 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
263 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
265 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
266 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
270 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
271 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
272 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
273 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
274 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
275 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
276 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
277 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
278 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
279 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
281 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
282 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
283 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
284 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
285 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
286 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
287 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
288 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
289 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
290 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
291 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
292 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
293 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
294 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
295 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
296 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
297 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
298 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
299 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
300 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
301 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
302 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
303 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
304 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
305 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
306 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
307 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
308 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
309 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
310 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
311 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
312 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
313 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
314 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
315 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
316 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
317 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
318 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
319 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
320 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
321 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
322 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
323 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
324 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
325 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
326 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
327 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
328 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
329 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
330 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
331 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
332 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
333 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
334 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
335 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
336 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
337 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
338 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
339 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
340 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
341 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
342 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
343 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
344 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
345 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
346 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
347 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
348 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
349 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
350 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
351 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
352 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
353 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
354 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
355 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
356 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
357 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
358 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
359 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
360 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
361 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
362 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
363 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
364 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
365 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
366 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
367 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
368 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
369 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
370 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
371 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
372 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
373 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
374 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
375 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
376 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
377 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
378 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
379 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
380 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
381 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
382 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
383 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
384 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
385 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
386 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
387 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
388 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
389 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
390 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
391 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
392 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
393 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
394 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
395 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
396 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
397 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
398 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
399 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
400 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
401 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
402 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
403 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
404 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
405 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
406 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
407 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
408 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
409 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
410 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
411 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
412 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
413 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
414 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
415 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
416 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
417 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
418 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
419 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
420 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
421 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
422 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
423 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
424 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
425 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
426 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
427 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
428 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
429 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
430 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
431 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
432 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
433 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
434 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
435 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
436 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
437 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
438 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
439 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
440 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
441 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
442 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
443 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
444 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
445 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
446 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
447 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
448 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
449 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
450 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
451 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
452 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
453 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
454 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
455 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
456 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
457 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
458 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
459 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
460 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
461 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
462 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
463 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
464 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
465 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
466 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
467 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
468 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
469 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
470 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
471 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
472 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
473 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
474 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
475 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
476 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
477 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
478 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
479 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
480 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
481 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
482 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
483 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
484 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
485 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
486 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
487 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
488 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
489 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
490 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
491 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
492 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
493 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
494 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
495 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
496 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
497 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
498 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
499 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
500 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
501 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
502 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
503 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
504 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
505 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
506 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
507 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
508 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
509 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
510 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
511 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
512 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
513 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
514 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
515 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
516 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
517 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
518 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
519 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
520 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
521 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
522 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
523 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
524 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
525 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
526 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
527 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
528 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
529 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
530 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
531 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
532 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
533 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
534 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
535 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
536 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
537 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
538 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
539 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
542 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
543 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
544 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
545 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
546 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
547 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
548 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
549 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
550 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
551 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
552 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
553 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
554 2643221556 Massilia sp. Root1485 Isolate Unclassified
555 2643221569 Achromobacter sp. Root565 Isolate Unclassified
556 2643221570 Acidovorax sp. Root568 Isolate Unclassified
557 2643221594 Achromobacter sp. Root170 Isolate Unclassified
558 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
559 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
560 2643221621 Achromobacter sp. Root83 Isolate Unclassified
561 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
562 2643221640 Caulobacter sp. Root342 Isolate Unclassified
563 2643221642 Caulobacter sp. Root343 Isolate Unclassified
564 2643221645 Massilia sp. Root351 Isolate Unclassified
565 2643221652 Acidovorax sp. Root402 Isolate Unclassified
566 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
567 2643221664 Massilia sp. Root418 Isolate Unclassified
568 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
569 2643221684 Massilia sp. Root133 Isolate Unclassified
570 2643221718 Rhizobium sp. Root268 Isolate Unclassified
571 2643221723 Ensifer sp. Root278 Isolate Unclassified
572 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
573 2738541280 Massilia sp. GV090 Isolate Unclassified
574 2738541297 Duganella sp. GV083 Isolate Unclassified
575 2738541300 Massilia sp. GV016 Isolate Unclassified
576 2738541357 Duganella sp. GV053 Isolate Unclassified
577 2738543003 Duganella sp. GV066 Isolate Unclassified
578 2738543018 Massilia sp. GV045 Isolate Unclassified
579 2738543026 Duganella sp. GV089 Isolate Unclassified
580 2738543029 Duganella sp. GV039 Isolate Unclassified
581 2738543030 Massilia sp. GV097 Isolate Unclassified
582 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
583 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
584 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
585 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
586 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
587 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
588 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
589 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
590 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
591 2818991435 Caulobacter henricii 536 Isolate Unclassified
592 2818991436 Collimonas arenae 515 Isolate Unclassified
593 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
594 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
595 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
596 2821131069 Duganella sp. 1224 Isolate Unclassified
597 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
598 2842711865 Duganella sp. R-73148 Isolate Unclassified
599 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
600 2855730933 Achromobacter sp. HZ28 Isolate Nodule
601 2855767633 Achromobacter sp. HZ34 Isolate Nodule
602 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
603 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
604 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
605 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
606 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
607 2857553236 Duganella sp. R-74557 Isolate Unclassified
608 2857558681 Duganella sp. R-74565 Isolate Unclassified
609 2857564685 Duganella sp. R-74599 Isolate Unclassified
610 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
611 2858950400 Achromobacter sp. K91 Isolate Unclassified
612 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
613 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
614 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
615 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
616 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
617 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
618 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
619 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
620 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
621 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
622 2902330777 Methylobacterium sp. 2A Isolate Unclassified
623 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
624 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
625 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
626 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
627 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
628 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
629 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
630 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
631 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
632 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
633 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
634 2919476304 Duganella sp. 3397 Isolate Unclassified
635 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
636 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
637 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
638 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
639 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
640 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
641 2941479691
642 2952252522 Salinicola sp. DM10 Isolate Unclassified
643 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
644 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
645 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
646 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.46
Metatranscriptomes 0.87
Isolates 6.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.57
Nodule 0.81
Rhizoplane 2.18
Rhizosphere 65.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10042032 3300028800 Bacteria 4265
2 JGI24752J21851_1000255 3300001976 Bacteria 7368
3 JGI24740J21852_10003031 3300001979 Bacteria 7435
4 JGI24739J22299_10038407 3300001989 Bacteria 1609
5 JGI24743J22301_10001118 3300001991 Bacteria 3593
6 JGI24735J21928_10018757 3300002067 Bacteria 2131
7 JGI24735J21928_10052533 3300002067 Bacteria 1175
8 JGI24748J21848_1000053 3300002074 Bacteria 50665
9 JGI24749J21850_1001230 3300002076 Bacteria 3642
10 JGI24034J26672_10000036 3300002239 Bacteria 84333
11 JGI24742J22300_10002780 3300002244 Bacteria 2822
12 JGI25155J39150_1000073 3300002704 Bacteria 62972
13 JGI25156J39149_1000609 3300002705 Bacteria 19855
14 JGI25156J39149_1004731 3300002705 Bacteria 4079
15 JGI25162J39368_1000001 3300002737 Bacteria 740113
16 JGI25162J39368_1006819 3300002737 Bacteria 1886
17 JGI25154J39366_1000118 3300002738 Bacteria 64203
18 JGI25154J39366_1000258 3300002738 Bacteria 33918
19 JGI25154J39366_1000270 3300002738 Bacteria 32293
20 JGI25157J39369_1000001 3300002741 Bacteria 363277
21 JGI25164J39214_1001808 3300002772 Bacteria 4125
22 JGI25152J39213_1001584 3300002773 Bacteria 9542
23 JGI25152J39213_1015800 3300002773 Bacteria 1478
24 JGI25150J39212_1000428 3300002774 Bacteria 19227
25 JGI25150J39212_1001402 3300002774 Bacteria 6805
26 JGI25150J39212_1010535 3300002774 Bacteria 1713
27 JGI25159J45721_1000675 3300002987 Bacteria 15067
28 JGI25159J45721_1001076 3300002987 Bacteria 11675
29 JGI25159J45721_1001508 3300002987 Bacteria 9542
30 JGI25159J45721_1001707 3300002987 Bacteria 8878
31 JGI25159J45721_1007198 3300002987 Bacteria 3219
32 JGI25151J46595_10003026 3300003187 Bacteria 9542
33 JGI25151J46595_10010417 3300003187 Bacteria 4324
34 JGI25151J46595_10023110 3300003187 Bacteria 2568
35 JGI25151J46595_10036981 3300003187 Bacteria 1835
36 JGI25165J46597_1000001 3300003214 Bacteria 1111887
37 JGI25153J46596_10000395 3300003215 Bacteria 29365
38 JGI25153J46596_10021825 3300003215 Bacteria 2378
39 JGI25160J50197_1000259 3300003354 Bacteria 39883
40 JGI25160J50197_1000962 3300003354 Bacteria 15067
41 JGI25160J50197_1002071 3300003354 Bacteria 9542
42 JGI25160J50197_1003470 3300003354 Bacteria 7046
43 JGI25161J50226_1000092 3300003374 Bacteria 72932
44 JGI25161J50226_1002450 3300003374 Bacteria 4751
45 JGI25161J50226_1003326 3300003374 Bacteria 3724
46 Ga0007417J51691_1023165 3300003544 Bacteria 2041
47 Ga0007410J51695_1034713 3300003574 Bacteria 1937
48 Ga0007409J51694_1016496 3300003575 Bacteria 2565
49 Ga0007416J51690_1013575 3300003577 Bacteria 2318
50 Ga0007416J51690_1033019 3300003577 Bacteria 1140
51 Ga0006562J51391_1148455 3300003578 Bacteria 1322
52 Ga0007411J51799_112918 3300003611 Bacteria 981
53 Ga0032354_1022659 3300003693 Bacteria 3337
54 Ga0055538_1000001 3300003751 Bacteria 1111887
55 Ga0055539_1000001 3300003752 Bacteria 1111887
56 Ga0055533_1000003 3300003756 Bacteria 1111887
57 Ga0055525_1000001 3300003759 Bacteria 1016948
58 Ga0055525_1000003 3300003759 Bacteria 962094
59 Ga0055525_1000046 3300003759 Bacteria 261587
60 Ga0055535_1000215 3300003761 Bacteria 61211
61 Ga0055535_1001710 3300003761 Bacteria 9959
62 Ga0055535_1003636 3300003761 Bacteria 4215
63 Ga0055542_1000004 3300003762 Bacteria 553532
64 Ga0055542_1000412 3300003762 Bacteria 41756
65 Ga0055529_1000032 3300003763 Bacteria 255895
66 Ga0055529_1000306 3300003763 Bacteria 56382
67 Ga0055526_1000951 3300003771 Bacteria 21419
68 Ga0055526_1001576 3300003771 Bacteria 16041
69 Ga0055526_1002557 3300003771 Bacteria 12209
70 Ga0055526_1003709 3300003771 Bacteria 9542
71 Ga0055526_1004461 3300003771 Bacteria 8396
72 Ga0055526_1004811 3300003771 Bacteria 7981
73 Ga0055526_1006869 3300003771 Bacteria 6066
74 Ga0055526_1008931 3300003771 Bacteria 4912
75 Ga0055537_1000030 3300003773 Bacteria 100491
76 Ga0055537_1000086 3300003773 Bacteria 67416
77 Ga0055537_1000587 3300003773 Bacteria 20267
78 Ga0055537_1001401 3300003773 Bacteria 9542
79 Ga0055524_1000093 3300003775 Bacteria 111953
80 Ga0055524_1000194 3300003775 Bacteria 66522
81 Ga0055524_1002243 3300003775 Bacteria 10121
82 Ga0055524_1002452 3300003775 Bacteria 9542
83 Ga0055524_1002681 3300003775 Bacteria 9017
84 Ga0055536_1000715 3300003781 Bacteria 22226
85 Ga0055536_1003152 3300003781 Bacteria 8948
86 Ga0055536_1014255 3300003781 Bacteria 2806
87 Ga0055534_1000024 3300003784 Bacteria 131674
88 Ga0055534_1000447 3300003784 Bacteria 24217
89 Ga0055534_1000820 3300003784 Bacteria 14368
90 Ga0055534_1001417 3300003784 Bacteria 9542
91 Ga0055534_1001838 3300003784 Bacteria 7925
92 Ga0055534_1021827 3300003784 Bacteria 1066
93 Ga0055528_1000439 3300003790 Bacteria 33348
94 Ga0055528_1000961 3300003790 Bacteria 19107
95 Ga0055528_1002611 3300003790 Bacteria 9542
96 Ga0055528_1014420 3300003790 Bacteria 2924
97 Ga0055530_10000541 3300003791 Bacteria 32834
98 Ga0055530_10057965 3300003791 Bacteria 873
99 Ga0055540_1000089 3300003792 Bacteria 100214
100 Ga0055540_1004954 3300003792 Bacteria 5802
101 Ga0055540_1006243 3300003792 Bacteria 4778
102 Ga0055540_1013378 3300003792 Bacteria 2509
103 Ga0055531_10000269 3300003794 Bacteria 53905
104 Ga0055531_10002978 3300003794 Bacteria 11006
105 Ga0055531_10005739 3300003794 Bacteria 7190
106 Ga0055531_10009722 3300003794 Bacteria 4882
107 Ga0055531_10042077 3300003794 Bacteria 1312
108 Ga0055541_1000001 3300003841 Bacteria 1111887
109 Ga0055541_1001138 3300003841 Bacteria 5964
110 Ga0055543_1001474 3300004625 Bacteria 9297
111 Ga0055543_1003203 3300004625 Bacteria 4977
112 Ga0055543_1004025 3300004625 Bacteria 4123
113 Ga0055543_1005432 3300004625 Bacteria 3256
114 Ga0055543_1009685 3300004625 Bacteria 2056
115 Ga0065165_1000353 3300005262 Bacteria 75343
116 Ga0065165_1000600 3300005262 Bacteria 52753
117 Ga0065165_1001802 3300005262 Bacteria 21054
118 Ga0065165_1002550 3300005262 Bacteria 15105
119 Ga0065165_1005751 3300005262 Bacteria 6806
120 Ga0065165_1014470 3300005262 Bacteria 3060
121 Ga0065165_1036832 3300005262 Bacteria 1488
122 Ga0065165_1038483 3300005262 Bacteria 1441
123 Ga0065714_10014905 3300005288 Bacteria 2916
124 Ga0065714_10151557 3300005288 Bacteria 1103
125 Ga0065704_10180239 3300005289 Bacteria 1241
126 Ga0065704_10198711 3300005289 Bacteria 1156
127 Ga0065704_10215718 3300005289 Bacteria 1092
128 Ga0065704_10457162 3300005289 Bacteria 700
129 Ga0065712_10250585 3300005290 Bacteria 957
130 Ga0065707_10085375 3300005295 Bacteria 6202
131 Ga0070658_10009563 3300005327 Bacteria 7783
132 Ga0070658_10028610 3300005327 Bacteria 4475
133 Ga0070658_10080132 3300005327 Bacteria 2682
134 Ga0070658_10327550 3300005327 Bacteria 1308
135 Ga0070658_10452422 3300005327 Bacteria 1106
136 Ga0070676_10124788 3300005328 Bacteria 1620
137 Ga0070676_10138541 3300005328 Bacteria 1546
138 Ga0070683_100001966 3300005329 Bacteria 16104
139 Ga0070683_100036898 3300005329 Bacteria 4472
140 Ga0070683_100421886 3300005329 Bacteria 1273
141 Ga0070670_100002397 3300005331 Bacteria 15444
142 Ga0070670_100049854 3300005331 Bacteria 3599
143 Ga0070670_100074892 3300005331 Bacteria 2908
144 Ga0070670_100299937 3300005331 Bacteria 1405
145 Ga0070670_100555591 3300005331 Bacteria 1024
146 Ga0070677_10000523 3300005333 Bacteria 13180
147 Ga0070677_10032192 3300005333 Bacteria 2009
148 Ga0068869_100008423 3300005334 Bacteria 6649
149 Ga0068869_100010764 3300005334 Bacteria 5975
150 Ga0068869_100249632 3300005334 Bacteria 1417
151 Ga0070666_10084706 3300005335 Bacteria 2170
152 Ga0070680_100006104 3300005336 Bacteria 9131
153 Ga0068868_100000004 3300005338 Bacteria 150718
154 Ga0068868_100001107 3300005338 Bacteria 18443
155 Ga0070660_100176833 3300005339 Bacteria 1726
156 Ga0070660_100259759 3300005339 Bacteria 1418
157 Ga0070660_100406251 3300005339 Bacteria 1126
158 Ga0070689_100318277 3300005340 Bacteria 1298
159 Ga0070661_100000006 3300005344 Bacteria 216544
160 Ga0070661_100000994 3300005344 Bacteria 20120
161 Ga0070661_100006933 3300005344 Bacteria 7821
162 Ga0070668_100008742 3300005347 Bacteria 7522
163 Ga0070668_100129046 3300005347 Bacteria 2028
164 Ga0070668_100239734 3300005347 Bacteria 1502
165 Ga0070668_100576965 3300005347 Bacteria 981
166 Ga0070669_100012993 3300005353 Bacteria 5912
167 Ga0070669_100040177 3300005353 Bacteria 3400
168 Ga0070669_100049127 3300005353 Bacteria 3080
169 Ga0070669_100201034 3300005353 Bacteria 1568
170 Ga0070669_100265299 3300005353 Bacteria 1371
171 Ga0070669_100267171 3300005353 Bacteria 1367
172 Ga0070675_100002143 3300005354 Bacteria 14606
173 Ga0070675_100002327 3300005354 Bacteria 14133
174 Ga0070675_100091547 3300005354 Bacteria 2548
175 Ga0070675_100133314 3300005354 Bacteria 2119
176 Ga0070671_100003169 3300005355 Bacteria 12826
177 Ga0070671_100009039 3300005355 Bacteria 7995
178 Ga0070671_100011946 3300005355 Bacteria 6986
179 Ga0070671_100022247 3300005355 Bacteria 5179
180 Ga0070671_100125957 3300005355 Bacteria 2156
181 Ga0070671_100224309 3300005355 Bacteria 1594
182 Ga0070671_100250235 3300005355 Bacteria 1505
183 Ga0070671_100342328 3300005355 Bacteria 1276
184 Ga0070674_100034507 3300005356 Bacteria 3380
185 Ga0070674_100044141 3300005356 Bacteria 3037
186 Ga0070674_100182252 3300005356 Bacteria 1609
187 Ga0070674_100348366 3300005356 Bacteria 1195
188 Ga0070674_100406579 3300005356 Bacteria 1114
189 Ga0070674_100452768 3300005356 Bacteria 1060
190 Ga0070673_100007098 3300005364 Bacteria 7356
191 Ga0070673_100021209 3300005364 Bacteria 4703
192 Ga0070673_100043576 3300005364 Bacteria 3469
193 Ga0070673_100174672 3300005364 Bacteria 1835
194 Ga0070673_100182855 3300005364 Bacteria 1795
195 Ga0070673_100186388 3300005364 Bacteria 1779
196 Ga0070673_100767541 3300005364 Bacteria 889
197 Ga0070688_100473180 3300005365 Bacteria 941
198 Ga0070659_100000929 3300005366 Bacteria 21500
199 Ga0070659_100006995 3300005366 Bacteria 8167
200 Ga0070659_100259547 3300005366 Bacteria 1441
201 Ga0070659_100324528 3300005366 Bacteria 1287
202 Ga0070667_100001557 3300005367 Bacteria 20558
203 Ga0070667_100016942 3300005367 Bacteria 6030
204 Ga0070667_100480287 3300005367 Bacteria 1138
205 Ga0070667_100732944 3300005367 Bacteria 916
206 Ga0070667_100865492 3300005367 Bacteria 840
207 Ga0070714_100089631 3300005435 Bacteria 2693
208 Ga0070713_100089448 3300005436 Bacteria 2645
209 Ga0070713_100501445 3300005436 Bacteria 1145
210 Ga0070713_100858097 3300005436 Bacteria 872
211 Ga0070710_10202944 3300005437 Bacteria 1253
212 Ga0070711_100071388 3300005439 Bacteria 2447
213 Ga0070711_100747873 3300005439 Bacteria 826
214 Ga0070700_100170991 3300005441 Bacteria 1505
215 Ga0070700_100315320 3300005441 Bacteria 1147
216 Ga0070663_100012236 3300005455 Bacteria 5418
217 Ga0070663_100024503 3300005455 Bacteria 4063
218 Ga0070663_100451472 3300005455 Bacteria 1059
219 Ga0070678_100004119 3300005456 Bacteria 8191
220 Ga0070678_100359840 3300005456 Bacteria 1253
221 Ga0070681_10011352 3300005458 Bacteria 8812
222 Ga0070681_10269042 3300005458 Bacteria 1616
223 Ga0068867_100000048 3300005459 Bacteria 73813
224 Ga0068867_100004827 3300005459 Bacteria 9491
225 Ga0068867_100025498 3300005459 Bacteria 4242
226 Ga0068867_100090559 3300005459 Bacteria 2321
227 Ga0068867_100134811 3300005459 Bacteria 1923
228 Ga0068867_100290668 3300005459 Bacteria 1344
229 Ga0070685_10191940 3300005466 Bacteria 1322
230 Ga0070707_100181678 3300005468 Bacteria 2051
231 Ga0070698_100095994 3300005471 Bacteria 2941
232 Ga0070679_100000001 3300005530 Bacteria 764811
233 Ga0070679_100058491 3300005530 Bacteria 3841
234 Ga0070679_100380720 3300005530 Bacteria 1358
235 Ga0070684_100004982 3300005535 Bacteria 10141
236 Ga0068853_100268022 3300005539 Bacteria 1572
237 Ga0068853_100385407 3300005539 Bacteria 1309
238 Ga0070672_100023179 3300005543 Bacteria 4572
239 Ga0070672_100049884 3300005543 Bacteria 3258
240 Ga0070672_100089641 3300005543 Bacteria 2478
241 Ga0070672_100360506 3300005543 Bacteria 1241
242 Ga0070672_100487623 3300005543 Bacteria 1065
243 Ga0070693_100232520 3300005547 Bacteria 1213
244 Ga0070665_100033278 3300005548 Bacteria 5187
245 Ga0070665_100280727 3300005548 Bacteria 1667
246 Ga0070665_100498020 3300005548 Bacteria 1229
247 Ga0068855_100004740 3300005563 Bacteria 16602
248 Ga0068855_100004765 3300005563 Bacteria 16563
249 Ga0068855_100011354 3300005563 Bacteria 10754
250 Ga0068855_100080833 3300005563 Bacteria 3769
251 Ga0068855_100109993 3300005563 Bacteria 3164
252 Ga0068855_100191596 3300005563 Bacteria 2306
253 Ga0068855_100278184 3300005563 Bacteria 1859
254 Ga0068855_100950038 3300005563 Bacteria 905
255 Ga0070664_100000282 3300005564 Bacteria 36692
256 Ga0070664_100019344 3300005564 Bacteria 5603
257 Ga0070664_100038293 3300005564 Bacteria 4036
258 Ga0070664_100061503 3300005564 Bacteria 3200
259 Ga0068857_100016086 3300005577 Bacteria 6554
260 Ga0068857_100114219 3300005577 Bacteria 2428
261 Ga0068857_100292839 3300005577 Bacteria 1499
262 Ga0068857_100405795 3300005577 Bacteria 1268
263 Ga0068854_100064887 3300005578 Bacteria 2654
264 Ga0068854_100186459 3300005578 Bacteria 1623
265 Ga0068856_100034658 3300005614 Bacteria 4944
266 Ga0068856_100128445 3300005614 Bacteria 2538
267 Ga0068856_100646647 3300005614 Bacteria 1078
268 Ga0068856_100728763 3300005614 Bacteria 1012
269 Ga0068852_100000048 3300005616 Bacteria 87297
270 Ga0068852_100004013 3300005616 Bacteria 10352
271 Ga0068852_100018978 3300005616 Bacteria 5431
272 Ga0068852_100109695 3300005616 Bacteria 2506
273 Ga0068852_100127977 3300005616 Bacteria 2335
274 Ga0068852_100155854 3300005616 Bacteria 2128
275 Ga0068852_100314395 3300005616 Bacteria 1519
276 Ga0068852_100443706 3300005616 Bacteria 1283
277 Ga0068852_100574432 3300005616 Bacteria 1130
278 Ga0068852_100945954 3300005616 Bacteria 879
279 Ga0068859_100013690 3300005617 Bacteria 8132
280 Ga0068859_100036992 3300005617 Bacteria 4900
281 Ga0068859_100097644 3300005617 Bacteria 2991
282 Ga0068864_100002769 3300005618 Bacteria 14470
283 Ga0068864_100011909 3300005618 Bacteria 7183
284 Ga0068864_100063454 3300005618 Bacteria 3201
285 Ga0068864_100325041 3300005618 Bacteria 1445
286 Ga0068861_100010229 3300005719 Bacteria 6512
287 Ga0068861_100694602 3300005719 Bacteria 945
288 Ga0068851_10007313 3300005834 Bacteria 5064
289 Ga0068851_10028110 3300005834 Bacteria 2776
290 Ga0068851_10126671 3300005834 Bacteria 1377
291 Ga0068851_10190658 3300005834 Bacteria 1139
292 Ga0068863_100000323 3300005841 Bacteria 48685
293 Ga0068863_100001631 3300005841 Bacteria 22176
294 Ga0068863_100014569 3300005841 Bacteria 7569
295 Ga0068863_100198971 3300005841 Bacteria 1927
296 Ga0068863_100358823 3300005841 Bacteria 1420
297 Ga0068858_100002617 3300005842 Bacteria 18131
298 Ga0068858_100002948 3300005842 Bacteria 17114
299 Ga0068860_100000069 3300005843 Bacteria 179064
300 Ga0068860_100000524 3300005843 Bacteria 46839
301 Ga0068860_100011518 3300005843 Bacteria 8717
302 Ga0068860_100509105 3300005843 Bacteria 1203
303 Ga0068862_100009227 3300005844 Bacteria 8170
304 Ga0068862_100082302 3300005844 Bacteria 2793
305 Ga0070717_10575880 3300006028 Bacteria 1020
306 Ga0075365_10005295 3300006038 Bacteria 6943
307 Ga0075365_10009750 3300006038 Bacteria 5547
308 Ga0075365_10027139 3300006038 Bacteria 3640
309 Ga0075363_100002405 3300006048 Bacteria 7638
310 Ga0075363_100014482 3300006048 Bacteria 3856
311 Ga0075363_100125351 3300006048 Bacteria 1437
312 Ga0075364_10001014 3300006051 Bacteria 14889
313 Ga0075364_10014348 3300006051 Bacteria 4895
314 Ga0075364_10037369 3300006051 Bacteria 3143
315 Ga0075364_10055355 3300006051 Bacteria 2595
316 Ga0075364_10175136 3300006051 Bacteria 1451
317 Ga0075364_10644528 3300006051 Bacteria 723
318 Ga0075432_10021123 3300006058 Bacteria 2226
319 Ga0070712_100003162 3300006175 Bacteria 10145
320 Ga0070712_100063584 3300006175 Bacteria 2614
321 Ga0075362_10003092 3300006177 Bacteria 5737
322 Ga0075362_10045866 3300006177 Bacteria 1942
323 Ga0075367_10018656 3300006178 Bacteria 3832
324 Ga0075367_10044803 3300006178 Bacteria 2594
325 Ga0075369_10019058 3300006186 Bacteria 2798
326 Ga0075369_10219067 3300006186 Bacteria 881
327 Ga0075366_10023990 3300006195 Bacteria 3556
328 Ga0075366_10085752 3300006195 Bacteria 1884
329 Ga0075366_10134051 3300006195 Bacteria 1495
330 Ga0075366_10136681 3300006195 Bacteria 1480
331 Ga0075366_10174826 3300006195 Bacteria 1303
332 Ga0075366_10194514 3300006195 Bacteria 1233
333 Ga0075366_10492522 3300006195 Bacteria 758
334 Ga0097621_100026937 3300006237 Bacteria 4516
335 Ga0097621_100030071 3300006237 Bacteria 4296
336 Ga0097621_100065452 3300006237 Bacteria 2991
337 Ga0075370_10001129 3300006353 Bacteria 11193
338 Ga0075370_10006235 3300006353 Bacteria 5982
339 Ga0075370_10006846 3300006353 Bacteria 5765
340 Ga0075370_10008342 3300006353 Bacteria 5327
341 Ga0075370_10050137 3300006353 Bacteria 2368
342 Ga0068871_100002247 3300006358 Bacteria 13129
343 Ga0068871_100077837 3300006358 Bacteria 2741
344 Ga0068871_100147195 3300006358 Bacteria 2006
345 Ga0068871_100246610 3300006358 Bacteria 1554
346 Ga0068871_100406335 3300006358 Bacteria 1213
347 Ga0075429_100478892 3300006880 Bacteria 1091
348 Ga0075429_100880813 3300006880 Bacteria 784
349 Ga0068865_100076478 3300006881 Bacteria 2390
350 Ga0068865_100145391 3300006881 Bacteria 1793
351 Ga0068865_100153063 3300006881 Bacteria 1751
352 Ga0075436_100554577 3300006914 Bacteria 844
353 Ga0097620_100013690 3300006931 Bacteria 8132
354 Ga0097620_100036992 3300006931 Bacteria 4900
355 Ga0097620_100097647 3300006931 Bacteria 2991
356 Ga0079104_1000007 3300006946 Bacteria 390531
357 Ga0079104_1005881 3300006946 Bacteria 4778
358 Ga0099826_10000132 3300006948 Bacteria 31946
359 Ga0105251_10166054 3300009011 Bacteria 995
360 Ga0105244_10121953 3300009036 Bacteria 1262
361 Ga0105250_10056123 3300009092 Bacteria 1581
362 Ga0105250_10103416 3300009092 Bacteria 1163
363 Ga0105240_10000084 3300009093 Bacteria 192787
364 Ga0105240_10004442 3300009093 Bacteria 21388
365 Ga0105240_10008224 3300009093 Bacteria 14951
366 Ga0105240_10106546 3300009093 Bacteria 3399
367 Ga0105240_10153246 3300009093 Bacteria 2743
368 Ga0105240_10211667 3300009093 Bacteria 2265
369 Ga0105240_10385039 3300009093 Bacteria 1583
370 Ga0105240_11019860 3300009093 Bacteria 884
371 Ga0105240_11265032 3300009093 Bacteria 779
372 Ga0105245_10001510 3300009098 Bacteria 21074
373 Ga0105245_10731934 3300009098 Bacteria 1024
374 Ga0105247_10001822 3300009101 Bacteria 14946
375 Ga0105243_10000005 3300009148 Bacteria 576265
376 Ga0105241_10174653 3300009174 Bacteria 1777
377 Ga0105242_10236947 3300009176 Bacteria 1638
378 Ga0105248_10001008 3300009177 Bacteria 31117
379 Ga0105248_10006497 3300009177 Bacteria 12823
380 Ga0105248_10028876 3300009177 Bacteria 6183
381 Ga0105248_10180654 3300009177 Bacteria 2378
382 Ga0105237_10010106 3300009545 Bacteria 10062
383 Ga0105237_10048803 3300009545 Bacteria 4255
384 Ga0105237_10130578 3300009545 Bacteria 2506
385 Ga0105237_10158718 3300009545 Bacteria 2259
386 Ga0105238_10000113 3300009551 Bacteria 89675
387 Ga0105238_10000160 3300009551 Bacteria 73564
388 Ga0105238_10017512 3300009551 Bacteria 7285
389 Ga0105238_10177187 3300009551 Bacteria 2109
390 Ga0105238_10194328 3300009551 Bacteria 2005
391 Ga0105238_10450889 3300009551 Bacteria 1283
392 Ga0105238_10455046 3300009551 Bacteria 1277
393 Ga0105238_10556574 3300009551 Bacteria 1152
394 Ga0105238_10977881 3300009551 Bacteria 867
395 Ga0105249_10132588 3300009553 Bacteria 2380
396 Ga0105249_11837142 3300009553 Bacteria 679
397 Ga0105239_10000289 3300010375 Bacteria 74109
398 Ga0105239_10003397 3300010375 Bacteria 19526
399 Ga0105246_10000618 3300011119 Bacteria 19835
400 Ga0157373_10147263 3300013100 Bacteria 1656
401 Ga0157371_10548477 3300013102 Bacteria 857
402 Ga0157370_10002535 3300013104 Bacteria 21958
403 Ga0157369_10000334 3300013105 Bacteria 62941
404 Ga0157369_10003357 3300013105 Bacteria 19001
405 Ga0157369_10232759 3300013105 Bacteria 1926
406 Ga0157369_10303725 3300013105 Bacteria 1660
407 Ga0171462_1031 3300013250 Bacteria 104981
408 Ga0157374_10020568 3300013296 Bacteria 5858
409 Ga0157374_10139935 3300013296 Bacteria 2349
410 Ga0157378_10020749 3300013297 Bacteria 5778
411 Ga0157378_10127308 3300013297 Bacteria 2354
412 Ga0163162_10003717 3300013306 Bacteria 14623
413 Ga0163162_10020731 3300013306 Bacteria 6461
414 Ga0163162_10046081 3300013306 Bacteria 4370
415 Ga0163162_10070533 3300013306 Bacteria 3546
416 Ga0163162_10084914 3300013306 Bacteria 3242
417 Ga0163162_10318325 3300013306 Bacteria 1688
418 Ga0157372_10000092 3300013307 Bacteria 93247
419 Ga0157372_10034949 3300013307 Bacteria 5531
420 Ga0157372_10081286 3300013307 Bacteria 3668
421 Ga0157372_10594982 3300013307 Bacteria 1289
422 Ga0157375_10002806 3300013308 Bacteria 15079
423 Ga0157375_10198861 3300013308 Bacteria 2160
424 Ga0157375_10491870 3300013308 Bacteria 1391
425 Ga0157375_10516563 3300013308 Bacteria 1358
426 Ga0163163_10001715 3300014325 Bacteria 18487
427 Ga0163163_10008501 3300014325 Bacteria 9123
428 Ga0163163_10335608 3300014325 Bacteria 1567
429 Ga0182008_10009226 3300014497 Bacteria 5333
430 Ga0182008_10059354 3300014497 Bacteria 1887
431 Ga0182008_10071746 3300014497 Bacteria 1704
432 Ga0182008_10106183 3300014497 Bacteria 1390
433 Ga0157377_10236796 3300014745 Bacteria 1176
434 Ga0157379_10002856 3300014968 Bacteria 14562
435 Ga0157379_10025217 3300014968 Bacteria 5279
436 Ga0157379_10029132 3300014968 Bacteria 4911
437 Ga0157379_10082697 3300014968 Bacteria 2877
438 Ga0157376_10278536 3300014969 Bacteria 1574
439 Ga0157376_10295651 3300014969 Bacteria 1531
440 Ga0182006_1031937 3300015261 Bacteria 2119
441 Ga0182007_10000921 3300015262 Bacteria 16266
442 Ga0182007_10005649 3300015262 Bacteria 5459
443 Ga0182007_10013824 3300015262 Bacteria 3064
444 Ga0182005_1000534 3300015265 Bacteria 19265
445 Ga0183362_10001 3300015683 Bacteria 2046624
446 Ga0163161_10019141 3300017792 Bacteria 4800
447 Ga0163161_10021781 3300017792 Bacteria 4507
448 Ga0163161_10071729 3300017792 Bacteria 2535
449 Ga0163161_10503648 3300017792 Bacteria 986
450 Ga0213872_10000001 3300021361 Bacteria 662532
451 Ga0213872_10000051 3300021361 Bacteria 107261
452 Ga0213872_10000060 3300021361 Bacteria 100249
453 Ga0213872_10000632 3300021361 Bacteria 26629
454 Ga0213872_10002848 3300021361 Bacteria 9879
455 Ga0213872_10008989 3300021361 Bacteria 4804
456 Ga0213872_10018060 3300021361 Bacteria 3254
457 Ga0213876_10005332 3300021384 Bacteria 7074
458 Ga0213875_10059590 3300021388 Bacteria 1787
459 Ga0209435_100001 3300025206 Bacteria 1424171
460 Ga0209436_100633 3300025208 Bacteria 15033
461 Ga0209436_103318 3300025208 Bacteria 4334
462 Ga0207672_1000282 3300025223 Bacteria 6890
463 Ga0209784_100004 3300025224 Bacteria 1378156
464 Ga0209784_100638 3300025224 Bacteria 10668
465 Ga0209566_100004 3300025225 Bacteria 1531866
466 Ga0209566_100651 3300025225 Bacteria 20982
467 Ga0209674_100006 3300025226 Bacteria 1531866
468 Ga0209674_100160 3300025226 Bacteria 88210
469 Ga0209672_101339 3300025228 Bacteria 9292
470 Ga0209147_100004 3300025229 Bacteria 1371850
471 Ga0209147_100097 3300025229 Bacteria 164034
472 Ga0209147_103938 3300025229 Bacteria 2647
473 Ga0209563_100005 3300025230 Bacteria 1774893
474 Ga0209563_100007 3300025230 Bacteria 1579402
475 Ga0209563_100009 3300025230 Bacteria 1378156
476 Ga0207427_100310 3300025231 Bacteria 33900
477 Ga0207427_112082 3300025231 Bacteria 868
478 Ga0209437_100004 3300025233 Bacteria 1378156
479 Ga0209437_100053 3300025233 Bacteria 375580
480 Ga0209437_100234 3300025233 Bacteria 92856
481 Ga0209437_103429 3300025233 Bacteria 2875
482 Ga0209258_100022 3300025242 Bacteria 553584
483 Ga0209258_100504 3300025242 Bacteria 38241
484 Ga0209258_100720 3300025242 Bacteria 22119
485 Ga0209258_100960 3300025242 Bacteria 13681
486 Ga0207425_1000041 3300025245 Bacteria 210441
487 Ga0207425_1000262 3300025245 Bacteria 38967
488 Ga0207425_1001031 3300025245 Bacteria 12991
489 Ga0207425_1002773 3300025245 Bacteria 5951
490 Ga0207425_1004638 3300025245 Bacteria 4071
491 Ga0207425_1010697 3300025245 Bacteria 2221
492 Ga0209646_1000001 3300025246 Bacteria 3092932
493 Ga0209646_1000019 3300025246 Bacteria 475248
494 Ga0209646_1000103 3300025246 Bacteria 164034
495 Ga0209646_1000109 3300025246 Bacteria 158348
496 Ga0209026_1000001 3300025250 Bacteria 1228671
497 Ga0209026_1000467 3300025250 Bacteria 31163
498 Ga0209026_1005641 3300025250 Bacteria 3302
499 Ga0209677_100005 3300025253 Bacteria 1378156
500 Ga0209677_101739 3300025253 Bacteria 9066
501 Ga0209677_105152 3300025253 Bacteria 3503
502 Ga0209677_109555 3300025253 Bacteria 1723
503 Ga0209148_1000034 3300025254 Bacteria 553584
504 Ga0209148_1000118 3300025254 Bacteria 188330
505 Ga0209148_1002934 3300025254 Bacteria 5173
506 Ga0209148_1006589 3300025254 Bacteria 2502
507 Ga0209148_1016130 3300025254 Bacteria 1291
508 Ga0209759_1000001 3300025256 Bacteria 2799452
509 Ga0209759_1000064 3300025256 Bacteria 193120
510 Ga0209759_1000091 3300025256 Bacteria 164034
511 Ga0209759_1001021 3300025256 Bacteria 18791
512 Ga0209759_1001647 3300025256 Bacteria 11774
513 Ga0209759_1004695 3300025256 Bacteria 5005
514 Ga0209759_1022906 3300025256 Bacteria 1387
515 Ga0209759_1029416 3300025256 Bacteria 1100
516 Ga0209129_1000111 3300025258 Bacteria 148853
517 Ga0209129_1000667 3300025258 Bacteria 22744
518 Ga0209129_1004143 3300025258 Bacteria 5862
519 Ga0209129_1005500 3300025258 Bacteria 4454
520 Ga0209233_1000005 3300025261 Bacteria 1531866
521 Ga0209233_1016765 3300025261 Bacteria 2011
522 Ga0209565_1000017 3300025263 Bacteria 462438
523 Ga0209565_1000028 3300025263 Bacteria 348536
524 Ga0209565_1000040 3300025263 Bacteria 266543
525 Ga0209565_1000110 3300025263 Bacteria 119879
526 Ga0209565_1000673 3300025263 Bacteria 21605
527 Ga0209565_1021834 3300025263 Bacteria 1332
528 Ga0209455_1000043 3300025272 Bacteria 413928
529 Ga0209455_1000128 3300025272 Bacteria 162413
530 Ga0209455_1001018 3300025272 Bacteria 14039
531 Ga0209455_1005410 3300025272 Bacteria 3950
532 Ga0209673_1000007 3300025273 Bacteria 634477
533 Ga0209673_1000035 3300025273 Bacteria 328411
534 Ga0209673_1000109 3300025273 Bacteria 183000
535 Ga0209673_1000175 3300025273 Bacteria 131239
536 Ga0209673_1000664 3300025273 Bacteria 49941
537 Ga0209673_1000944 3300025273 Bacteria 36333
538 Ga0209673_1008587 3300025273 Bacteria 4533
539 Ga0209673_1046346 3300025273 Bacteria 1187
540 Ga0209130_1000118 3300025284 Bacteria 129005
541 Ga0209130_1000156 3300025284 Bacteria 101929
542 Ga0209130_1000205 3300025284 Bacteria 79260
543 Ga0209130_1000231 3300025284 Bacteria 73279
544 Ga0209130_1000332 3300025284 Bacteria 54263
545 Ga0209130_1001496 3300025284 Bacteria 15119
546 Ga0209130_1005762 3300025284 Bacteria 4196
547 Ga0209130_1027397 3300025284 Bacteria 1211
548 Ga0209675_1000009 3300025291 Bacteria 562872
549 Ga0209675_1000024 3300025291 Bacteria 312615
550 Ga0209675_1000111 3300025291 Bacteria 114805
551 Ga0209675_1000677 3300025291 Bacteria 23818
552 Ga0209675_1001309 3300025291 Bacteria 14763
553 Ga0209675_1002194 3300025291 Bacteria 10241
554 Ga0209675_1004947 3300025291 Bacteria 5748
555 Ga0209675_1005028 3300025291 Bacteria 5666
556 Ga0209676_1000005 3300025292 Bacteria 1076001
557 Ga0209676_1000054 3300025292 Bacteria 365890
558 Ga0209676_1000182 3300025292 Bacteria 146373
559 Ga0209676_1000478 3300025292 Bacteria 65984
560 Ga0209676_1001275 3300025292 Bacteria 26098
561 Ga0209676_1001975 3300025292 Bacteria 16337
562 Ga0209676_1003684 3300025292 Bacteria 9169
563 Ga0209676_1030840 3300025292 Bacteria 1633
564 Ga0209676_1040847 3300025292 Bacteria 1302
565 Ga0209025_1000068 3300025294 Bacteria 294129
566 Ga0209025_1000096 3300025294 Bacteria 239153
567 Ga0209025_1000116 3300025294 Bacteria 218293
568 Ga0209025_1000301 3300025294 Bacteria 110450
569 Ga0209025_1000493 3300025294 Bacteria 75884
570 Ga0209025_1002157 3300025294 Bacteria 21934
571 Ga0209025_1009771 3300025294 Bacteria 6621
572 Ga0209025_1010236 3300025294 Bacteria 6384
573 Ga0209025_1027558 3300025294 Bacteria 2814
574 Ga0209025_1039236 3300025294 Bacteria 2069
575 Ga0209025_1089606 3300025294 Bacteria 1010
576 Ga0209564_1000005 3300025295 Bacteria 1147192
577 Ga0209564_1000055 3300025295 Bacteria 343782
578 Ga0209564_1000089 3300025295 Bacteria 249694
579 Ga0209564_1000155 3300025295 Bacteria 165859
580 Ga0209564_1000298 3300025295 Bacteria 99805
581 Ga0209564_1001181 3300025295 Bacteria 30229
582 Ga0209564_1001242 3300025295 Bacteria 28585
583 Ga0209564_1002177 3300025295 Bacteria 16470
584 Ga0209564_1045708 3300025295 Bacteria 1123
585 Ga0209758_1000004 3300025297 Bacteria 1375322
586 Ga0209758_1000107 3300025297 Bacteria 218293
587 Ga0209758_1000625 3300025297 Bacteria 54181
588 Ga0209758_1011921 3300025297 Bacteria 4949
589 Ga0209758_1012663 3300025297 Bacteria 4692
590 Ga0209050_1000001 3300025298 Bacteria 3563507
591 Ga0209050_1000007 3300025298 Bacteria 1187891
592 Ga0209050_1000066 3300025298 Bacteria 305458
593 Ga0209050_1001192 3300025298 Bacteria 30549
594 Ga0209050_1002423 3300025298 Bacteria 16073
595 Ga0209050_1004030 3300025298 Bacteria 10326
596 Ga0209050_1004615 3300025298 Bacteria 9201
597 Ga0209050_1006167 3300025298 Bacteria 7210
598 Ga0209050_1046647 3300025298 Bacteria 1136
599 Ga0209256_1000003 3300025299 Bacteria 1661127
600 Ga0209256_1000038 3300025299 Bacteria 375225
601 Ga0209256_1000078 3300025299 Bacteria 225992
602 Ga0209256_1000087 3300025299 Bacteria 218290
603 Ga0209256_1000559 3300025299 Bacteria 53325
604 Ga0209256_1001512 3300025299 Bacteria 23519
605 Ga0209256_1002806 3300025299 Bacteria 13344
606 Ga0207426_1000090 3300025302 Bacteria 280662
607 Ga0207426_1000123 3300025302 Bacteria 218290
608 Ga0207426_1000197 3300025302 Bacteria 146366
609 Ga0207426_1001904 3300025302 Bacteria 15119
610 Ga0209051_1000009 3300025303 Bacteria 706778
611 Ga0209051_1000044 3300025303 Bacteria 305458
612 Ga0209051_1000092 3300025303 Bacteria 170056
613 Ga0209051_1000115 3300025303 Bacteria 152010
614 Ga0209051_1000191 3300025303 Bacteria 108763
615 Ga0209051_1000598 3300025303 Bacteria 42554
616 Ga0209051_1001071 3300025303 Bacteria 25392
617 Ga0209051_1010665 3300025303 Bacteria 4610
618 Ga0209051_1022825 3300025303 Bacteria 2622
619 Ga0209051_1023358 3300025303 Bacteria 2574
620 Ga0209257_1000011 3300025304 Bacteria 1112630
621 Ga0209257_1000055 3300025304 Bacteria 415534
622 Ga0209257_1000082 3300025304 Bacteria 305458
623 Ga0209257_1000234 3300025304 Bacteria 129712
624 Ga0209257_1000576 3300025304 Bacteria 61751
625 Ga0209257_1000978 3300025304 Bacteria 38851
626 Ga0209257_1001479 3300025304 Bacteria 27607
627 Ga0209257_1004829 3300025304 Bacteria 9989
628 Ga0209257_1005159 3300025304 Bacteria 9427
629 Ga0209257_1005496 3300025304 Bacteria 8855
630 Ga0207697_10016149 3300025315 Bacteria 3079
631 Ga0207656_10006575 3300025321 Bacteria 4189
632 Ga0207656_10070612 3300025321 Bacteria 1551
633 Ga0207656_10084810 3300025321 Bacteria 1429
634 Ga0207696_1010086 3300025711 Bacteria 3484
635 Ga0207696_1060660 3300025711 Bacteria 1064
636 Ga0207655_1000490 3300025728 Bacteria 50941
637 Ga0207655_1001848 3300025728 Bacteria 18290
638 Ga0207655_1032591 3300025728 Bacteria 2378
639 Ga0207713_1023413 3300025735 Bacteria 2907
640 Ga0207713_1043269 3300025735 Bacteria 1862
641 Ga0207710_10000839 3300025900 Bacteria 16567
642 Ga0207710_10138408 3300025900 Bacteria 1174
643 Ga0207680_10011979 3300025903 Bacteria 4404
644 Ga0207699_10282769 3300025906 Bacteria 1153
645 Ga0207645_10004606 3300025907 Bacteria 10162
646 Ga0207645_10074675 3300025907 Bacteria 2170
647 Ga0207645_10085170 3300025907 Bacteria 2029
648 Ga0207705_10000022 3300025909 Bacteria 302232
649 Ga0207705_10011480 3300025909 Bacteria 6407
650 Ga0207705_10054399 3300025909 Bacteria 2885
651 Ga0207705_10058677 3300025909 Bacteria 2776
652 Ga0207705_10225361 3300025909 Bacteria 1425
653 Ga0207705_10232500 3300025909 Bacteria 1403
654 Ga0207654_10000122 3300025911 Bacteria 50286
655 Ga0207654_10072187 3300025911 Bacteria 2054
656 Ga0207654_10111551 3300025911 Bacteria 1703
657 Ga0207707_10020223 3300025912 Bacteria 5812
658 Ga0207707_10768950 3300025912 Bacteria 804
659 Ga0207695_10000115 3300025913 Bacteria 240394
660 Ga0207695_10002097 3300025913 Bacteria 30292
661 Ga0207695_10002265 3300025913 Bacteria 28809
662 Ga0207695_10009870 3300025913 Bacteria 11730
663 Ga0207695_10075283 3300025913 Bacteria 3435
664 Ga0207695_10075549 3300025913 Bacteria 3428
665 Ga0207695_10662262 3300025913 Bacteria 925
666 Ga0207671_10000032 3300025914 Bacteria 245878
667 Ga0207671_10003511 3300025914 Bacteria 15567
668 Ga0207671_10030516 3300025914 Bacteria 4020
669 Ga0207671_10148734 3300025914 Bacteria 1808
670 Ga0207671_10187463 3300025914 Bacteria 1612
671 Ga0207671_10306396 3300025914 Bacteria 1255
672 Ga0207693_10001513 3300025915 Bacteria 20519
673 Ga0207693_10052921 3300025915 Bacteria 3185
674 Ga0207693_10164553 3300025915 Bacteria 1746
675 Ga0207663_10026185 3300025916 Bacteria 3382
676 Ga0207657_10009497 3300025919 Bacteria 9770
677 Ga0207657_10027318 3300025919 Bacteria 5228
678 Ga0207657_10031155 3300025919 Bacteria 4834
679 Ga0207657_10074311 3300025919 Bacteria 2871
680 Ga0207657_10090441 3300025919 Bacteria 2554
681 Ga0207657_10337918 3300025919 Bacteria 1189
682 Ga0207649_10000043 3300025920 Bacteria 115777
683 Ga0207649_10001607 3300025920 Bacteria 13119
684 Ga0207649_10011954 3300025920 Bacteria 4802
685 Ga0207649_10014094 3300025920 Bacteria 4473
686 Ga0207649_10084561 3300025920 Bacteria 2063
687 Ga0207649_10545329 3300025920 Bacteria 887
688 Ga0207652_10000001 3300025921 Bacteria 1006643
689 Ga0207652_10000002 3300025921 Bacteria 878035
690 Ga0207652_10010127 3300025921 Bacteria 7595
691 Ga0207652_10351826 3300025921 Bacteria 1330
692 Ga0207652_10730030 3300025921 Bacteria 883
693 Ga0207694_10000029 3300025924 Bacteria 239107
694 Ga0207694_10000075 3300025924 Bacteria 114693
695 Ga0207694_10044937 3300025924 Bacteria 3411
696 Ga0207694_10223310 3300025924 Bacteria 1537
697 Ga0207694_10355031 3300025924 Bacteria 1214
698 Ga0207694_10801042 3300025924 Bacteria 796
699 Ga0207650_10001122 3300025925 Bacteria 19719
700 Ga0207650_10001617 3300025925 Bacteria 16075
701 Ga0207650_10031834 3300025925 Bacteria 3812
702 Ga0207650_10408127 3300025925 Bacteria 1125
703 Ga0207650_10410813 3300025925 Bacteria 1122
704 Ga0207650_10568842 3300025925 Bacteria 951
705 Ga0207650_10599609 3300025925 Bacteria 926
706 Ga0207650_10958335 3300025925 Bacteria 727
707 Ga0207650_11044370 3300025925 Bacteria 695
708 Ga0207659_10000333 3300025926 Bacteria 28322
709 Ga0207659_10000725 3300025926 Bacteria 19531
710 Ga0207659_10022085 3300025926 Bacteria 4234
711 Ga0207659_10144382 3300025926 Bacteria 1851
712 Ga0207659_10167568 3300025926 Bacteria 1730
713 Ga0207659_10204591 3300025926 Bacteria 1579
714 Ga0207687_10001035 3300025927 Bacteria 18903
715 Ga0207687_10030036 3300025927 Bacteria 3661
716 Ga0207700_10051821 3300025928 Bacteria 3065
717 Ga0207700_10070877 3300025928 Bacteria 2681
718 Ga0207700_10089054 3300025928 Bacteria 2432
719 Ga0207700_10372829 3300025928 Bacteria 1246
720 Ga0207664_10021867 3300025929 Bacteria 4766
721 Ga0207644_10000004 3300025931 Bacteria 566613
722 Ga0207644_10002789 3300025931 Bacteria 11256
723 Ga0207644_10003511 3300025931 Bacteria 10148
724 Ga0207644_10037827 3300025931 Bacteria 3397
725 Ga0207644_10047328 3300025931 Bacteria 3068
726 Ga0207644_10072487 3300025931 Bacteria 2522
727 Ga0207644_10074243 3300025931 Bacteria 2495
728 Ga0207644_10106918 3300025931 Bacteria 2110
729 Ga0207644_10240434 3300025931 Bacteria 1441
730 Ga0207644_10510565 3300025931 Bacteria 992
731 Ga0207690_10001881 3300025932 Bacteria 12883
732 Ga0207690_10004240 3300025932 Bacteria 8469
733 Ga0207690_10017400 3300025932 Bacteria 4387
734 Ga0207690_10068256 3300025932 Bacteria 2442
735 Ga0207690_10076710 3300025932 Bacteria 2321
736 Ga0207690_10283359 3300025932 Bacteria 1291
737 Ga0207706_10003714 3300025933 Bacteria 14563
738 Ga0207706_10388187 3300025933 Bacteria 1211
739 Ga0207686_10001449 3300025934 Bacteria 13451
740 Ga0207686_10039242 3300025934 Bacteria 2873
741 Ga0207686_10169483 3300025934 Bacteria 1538
742 Ga0207686_10275904 3300025934 Bacteria 1239
743 Ga0207686_10328274 3300025934 Bacteria 1145
744 Ga0207709_10000001 3300025935 Bacteria 2228154
745 Ga0207709_10000112 3300025935 Bacteria 127357
746 Ga0207709_10001810 3300025935 Bacteria 14277
747 Ga0207709_10108818 3300025935 Bacteria 1849
748 Ga0207709_10239070 3300025935 Bacteria 1320
749 Ga0207670_10228915 3300025936 Bacteria 1427
750 Ga0207669_10103836 3300025937 Bacteria 1886
751 Ga0207669_10174610 3300025937 Bacteria 1533
752 Ga0207669_10301771 3300025937 Bacteria 1217
753 Ga0207691_10002459 3300025940 Bacteria 18118
754 Ga0207691_10005340 3300025940 Bacteria 12402
755 Ga0207691_10102062 3300025940 Bacteria 2559
756 Ga0207691_10221545 3300025940 Bacteria 1640
757 Ga0207691_10270086 3300025940 Bacteria 1464
758 Ga0207711_10008206 3300025941 Bacteria 8740
759 Ga0207711_10011843 3300025941 Bacteria 7247
760 Ga0207711_10030939 3300025941 Bacteria 4515
761 Ga0207711_10873743 3300025941 Bacteria 836
762 Ga0207689_10002718 3300025942 Bacteria 16358
763 Ga0207689_10023944 3300025942 Bacteria 5122
764 Ga0207689_10031365 3300025942 Bacteria 4425
765 Ga0207689_10079531 3300025942 Bacteria 2694
766 Ga0207689_10197185 3300025942 Bacteria 1662
767 Ga0207689_10563622 3300025942 Bacteria 957
768 Ga0207661_10001150 3300025944 Bacteria 17677
769 Ga0207661_10112065 3300025944 Bacteria 2309
770 Ga0207679_10000225 3300025945 Bacteria 44668
771 Ga0207679_10018810 3300025945 Bacteria 4634
772 Ga0207679_10077585 3300025945 Bacteria 2528
773 Ga0207679_11066314 3300025945 Bacteria 741
774 Ga0207667_10000110 3300025949 Bacteria 131872
775 Ga0207667_10003481 3300025949 Bacteria 19435
776 Ga0207667_10004567 3300025949 Bacteria 16975
777 Ga0207667_10005512 3300025949 Bacteria 15434
778 Ga0207667_10009897 3300025949 Bacteria 11183
779 Ga0207667_10090353 3300025949 Bacteria 3165
780 Ga0207667_10350994 3300025949 Bacteria 1504
781 Ga0207651_10027621 3300025960 Bacteria 3567
782 Ga0207651_10067104 3300025960 Bacteria 2523
783 Ga0207651_10076827 3300025960 Bacteria 2388
784 Ga0207651_10178377 3300025960 Bacteria 1682
785 Ga0207712_10009979 3300025961 Bacteria 6018
786 Ga0207712_10174343 3300025961 Bacteria 1684
787 Ga0207712_10304926 3300025961 Bacteria 1308
788 Ga0207668_10162136 3300025972 Bacteria 1743
789 Ga0207640_10002493 3300025981 Bacteria 9864
790 Ga0207640_10008128 3300025981 Bacteria 5809
791 Ga0207640_10319771 3300025981 Bacteria 1235
792 Ga0207640_10328359 3300025981 Bacteria 1221
793 Ga0207658_10001341 3300025986 Bacteria 19263
794 Ga0207658_10010270 3300025986 Bacteria 6361
795 Ga0207658_10053260 3300025986 Bacteria 2989
796 Ga0207658_10353477 3300025986 Bacteria 1280
797 Ga0207658_10422575 3300025986 Bacteria 1175
798 Ga0207677_10000023 3300026023 Bacteria 128514
799 Ga0207677_10003064 3300026023 Bacteria 8834
800 Ga0207677_10012494 3300026023 Bacteria 4885
801 Ga0207677_10041078 3300026023 Bacteria 3055
802 Ga0207677_10087194 3300026023 Bacteria 2259
803 Ga0207703_10002320 3300026035 Bacteria 16616
804 Ga0207703_10071820 3300026035 Bacteria 2859
805 Ga0207703_10212890 3300026035 Bacteria 1724
806 Ga0207639_10024872 3300026041 Bacteria 4338
807 Ga0207639_10089385 3300026041 Bacteria 2461
808 Ga0207678_10001628 3300026067 Bacteria 20589
809 Ga0207708_10107984 3300026075 Bacteria 2158
810 Ga0207708_10226676 3300026075 Bacteria 1499
811 Ga0207708_10236071 3300026075 Bacteria 1469
812 Ga0207702_10001243 3300026078 Bacteria 25735
813 Ga0207702_10189621 3300026078 Bacteria 1899
814 Ga0207702_10221863 3300026078 Bacteria 1762
815 Ga0207702_10620691 3300026078 Bacteria 1062
816 Ga0207641_10000216 3300026088 Bacteria 74765
817 Ga0207641_10000283 3300026088 Bacteria 63661
818 Ga0207641_10056121 3300026088 Bacteria 3346
819 Ga0207641_10125187 3300026088 Bacteria 2300
820 Ga0207641_10477984 3300026088 Bacteria 1207
821 Ga0207648_10000319 3300026089 Bacteria 52621
822 Ga0207648_10000492 3300026089 Bacteria 44104
823 Ga0207648_10029637 3300026089 Bacteria 4853
824 Ga0207648_10035867 3300026089 Bacteria 4370
825 Ga0207648_10152670 3300026089 Bacteria 2038
826 Ga0207676_10001271 3300026095 Bacteria 18758
827 Ga0207674_10022394 3300026116 Bacteria 6786
828 Ga0207674_10184816 3300026116 Bacteria 2035
829 Ga0207674_10362669 3300026116 Bacteria 1401
830 Ga0207674_11079463 3300026116 Bacteria 772
831 Ga0207675_100007230 3300026118 Bacteria 10492
832 Ga0207675_100712457 3300026118 Bacteria 1013
833 Ga0207683_10005156 3300026121 Bacteria 11217
834 Ga0207683_10006290 3300026121 Bacteria 10176
835 Ga0207683_10036312 3300026121 Bacteria 4290
836 Ga0207683_10099365 3300026121 Bacteria 2597
837 Ga0207683_10121982 3300026121 Bacteria 2341
838 Ga0207683_10407401 3300026121 Bacteria 1251
839 Ga0207683_10984286 3300026121 Bacteria 783
840 Ga0207683_11314589 3300026121 Bacteria 669
841 Ga0207698_10000011 3300026142 Bacteria 260352
842 Ga0207698_10002619 3300026142 Bacteria 10698
843 Ga0207698_10003576 3300026142 Bacteria 9380
844 Ga0207698_10063424 3300026142 Bacteria 2892
845 Ga0207698_10127545 3300026142 Bacteria 2167
846 Ga0207698_10152899 3300026142 Bacteria 2006
847 Ga0207698_10169428 3300026142 Bacteria 1921
848 Ga0207698_10174145 3300026142 Bacteria 1898
849 Ga0207698_10225014 3300026142 Bacteria 1699
850 Ga0207698_10522221 3300026142 Bacteria 1159
851 Ga0209281_1000020 3300027111 Bacteria 575972
852 Ga0209281_1009167 3300027111 Bacteria 2340
853 Ga0209389_1007187 3300027296 Bacteria 9782
854 Ga0209371_1000006 3300027312 Bacteria 1055642
855 Ga0209371_1018881 3300027312 Bacteria 1738
856 Ga0209371_1023446 3300027312 Bacteria 1453
857 Ga0209996_1000765 3300027395 Bacteria 3822
858 Ga0209984_1014278 3300027424 Bacteria 1047
859 Ga0209968_1000652 3300027526 Bacteria 5356
860 Ga0209970_1000415 3300027614 Bacteria 7224
861 Ga0209282_1000127 3300027666 Bacteria 48767
862 Ga0209282_1123307 3300027666 Bacteria 1292
863 Ga0209966_1000005 3300027695 Bacteria 103734
864 Ga0209813_10002725 3300027866 Bacteria 4070
865 Ga0209974_10029328 3300027876 Bacteria 1822
866 Ga0209974_10053136 3300027876 Bacteria 1364
867 Ga0268266_10538720 3300028379 Bacteria 1117
868 Ga0268266_11042751 3300028379 Bacteria 791
869 Ga0268265_10003864 3300028380 Bacteria 10577
870 Ga0268265_10084197 3300028380 Bacteria 2520
871 Ga0268264_10000086 3300028381 Bacteria 239021
872 Ga0268264_10001666 3300028381 Bacteria 20465
873 Ga0268264_10233019 3300028381 Bacteria 1701
874 Ga0268264_10977864 3300028381 Bacteria 852
875 Ga0268264_11198878 3300028381 Bacteria 769
876 Ga0265334_10026852 3300028573 Bacteria 2322
877 Ga0307517_10097661 3300028786 Bacteria 2343
878 Ga0307515_10000459 3300028794 Bacteria 97482
879 Ga0307515_10001963 3300028794 Bacteria 45524
880 Ga0307515_10014710 3300028794 Bacteria 14482
881 Ga0307515_10026050 3300028794 Bacteria 10085
882 Ga0307515_10033350 3300028794 Bacteria 8483
883 Ga0307515_10123381 3300028794 Bacteria 2914
884 Ga0307515_10238926 3300028794 Bacteria 1592
885 Ga0265338_10290040 3300028800 Bacteria 1193
886 Ga0265324_10018140 3300029957 Bacteria 2552
887 Ga0268256_1000007 3300030500 Bacteria 1055326
888 Ga0268256_1025697 3300030500 Bacteria 1492
889 Ga0268256_1026567 3300030500 Bacteria 1453
890 Ga0307512_10113847 3300030522 Bacteria 1768
891 Ga0307512_10310328 3300030522 Bacteria 726
892 Ga0316176_1081397 3300030732 Bacteria 863
893 Ga0314311_1026854 3300030733 Bacteria 1868
894 Ga0316183_1152609 3300030742 Bacteria 1364
895 Ga0316181_1185892 3300030744 Bacteria 676
896 Ga0265760_10021726 3300031090 Bacteria 1858
897 Ga0265330_10000032 3300031235 Bacteria 130592
898 Ga0265332_10000001 3300031238 Bacteria 863783
899 Ga0265332_10000014 3300031238 Bacteria 249035
900 Ga0265332_10008632 3300031238 Bacteria 4573
901 Ga0265320_10006647 3300031240 Bacteria 7266
902 Ga0265320_10025753 3300031240 Bacteria 3088
903 Ga0265325_10017822 3300031241 Bacteria 3945
904 Ga0265340_10071377 3300031247 Bacteria 1646
905 Ga0265340_10072242 3300031247 Bacteria 1634
906 Ga0265339_10229013 3300031249 Bacteria 906
907 Ga0265331_10013807 3300031250 Bacteria 4330
908 Ga0265327_10000028 3300031251 Bacteria 361066
909 Ga0265327_10000842 3300031251 Bacteria 45767
910 Ga0265327_10009661 3300031251 Bacteria 6919
911 Ga0265327_10011906 3300031251 Bacteria 5935
912 Ga0265327_10025911 3300031251 Bacteria 3408
913 Ga0265327_10153951 3300031251 Bacteria 1066
914 Ga0265316_10004128 3300031344 Bacteria 14537
915 Ga0307513_10000006 3300031456 Bacteria 470848
916 Ga0307513_10000011 3300031456 Bacteria 354929
917 Ga0307513_10000433 3300031456 Bacteria 60335
918 Ga0307513_10008993 3300031456 Bacteria 12672
919 Ga0307513_10141275 3300031456 Bacteria 2334
920 Ga0307513_10177890 3300031456 Bacteria 1995
921 Ga0307513_10221498 3300031456 Bacteria 1713
922 Ga0307513_10354415 3300031456 Bacteria 1214
923 Ga0307509_10000120 3300031507 Bacteria 114238
924 Ga0307509_10060404 3300031507 Bacteria 4007
925 Ga0307509_10100657 3300031507 Bacteria 2927
926 Ga0307408_100000046 3300031548 Bacteria 167686
927 Ga0307408_100000048 3300031548 Bacteria 165579
928 Ga0307408_100005071 3300031548 Bacteria 8838
929 Ga0307408_100005727 3300031548 Bacteria 8282
930 Ga0307408_100012484 3300031548 Bacteria 5630
931 Ga0307408_100027533 3300031548 Bacteria 3918
932 Ga0307408_100049122 3300031548 Bacteria 3029
933 Ga0307408_100154703 3300031548 Bacteria 1814
934 Ga0307408_100241318 3300031548 Bacteria 1485
935 Ga0307408_100281943 3300031548 Bacteria 1384
936 Ga0307408_100374721 3300031548 Bacteria 1215
937 Ga0307408_101257036 3300031548 Bacteria 692
938 Ga0307508_10000163 3300031616 Bacteria 80086
939 Ga0307508_10078880 3300031616 Bacteria 2873
940 Ga0307508_10120167 3300031616 Bacteria 2229
941 Ga0307514_10000225 3300031649 Bacteria 151002
942 Ga0307514_10024041 3300031649 Bacteria 4936
943 Ga0265314_10000022 3300031711 Bacteria 297299
944 Ga0265314_10014338 3300031711 Bacteria 6350
945 Ga0265314_10027819 3300031711 Bacteria 4226
946 Ga0265314_10187104 3300031711 Bacteria 1235
947 Ga0307516_10000446 3300031730 Bacteria 54416
948 Ga0307516_10003308 3300031730 Bacteria 20859
949 Ga0307516_10004343 3300031730 Bacteria 17529
950 Ga0307516_10005782 3300031730 Bacteria 14650
951 Ga0307516_10014293 3300031730 Bacteria 8405
952 Ga0307516_10076972 3300031730 Bacteria 3186
953 Ga0307516_10137321 3300031730 Bacteria 2218
954 Ga0307516_10210348 3300031730 Bacteria 1660
955 Ga0307516_10325589 3300031730 Bacteria 1207
956 Ga0307516_10579188 3300031730 Bacteria 776
957 Ga0307405_10042818 3300031731 Bacteria 2758
958 Ga0307405_10108573 3300031731 Bacteria 1875
959 Ga0307405_10749787 3300031731 Bacteria 813
960 Ga0307413_10001777 3300031824 Bacteria 8441
961 Ga0307413_10095542 3300031824 Bacteria 1949
962 Ga0307413_10337263 3300031824 Bacteria 1158
963 Ga0307410_10169218 3300031852 Bacteria 1645
964 Ga0307410_10280996 3300031852 Bacteria 1306
965 Ga0307410_10428096 3300031852 Bacteria 1075
966 Ga0307410_10490870 3300031852 Bacteria 1009
967 Ga0307406_10000575 3300031901 Bacteria 21150
968 Ga0307406_10003389 3300031901 Bacteria 8685
969 Ga0307412_10001140 3300031911 Bacteria 15222
970 Ga0307412_10003407 3300031911 Bacteria 8831
971 Ga0307412_10053482 3300031911 Bacteria 2676
972 Ga0307412_10113530 3300031911 Bacteria 1938
973 Ga0307412_10368830 3300031911 Bacteria 1158
974 Ga0307412_10487675 3300031911 Bacteria 1023
975 Ga0307409_100309358 3300031995 Bacteria 1474
976 Ga0307409_100380848 3300031995 Bacteria 1341
977 Ga0307416_100010513 3300032002 Bacteria 6117
978 Ga0307416_100293906 3300032002 Bacteria 1610
979 Ga0307416_100481892 3300032002 Bacteria 1301
980 Ga0307416_100608617 3300032002 Bacteria 1173
981 Ga0307414_10022421 3300032004 Bacteria 3982
982 Ga0307414_10023710 3300032004 Bacteria 3897
983 Ga0307414_10030245 3300032004 Bacteria 3535
984 Ga0307414_10171863 3300032004 Bacteria 1733
985 Ga0307411_10033683 3300032005 Bacteria 3179
986 Ga0307411_10161100 3300032005 Bacteria 1680
987 Ga0307411_10167987 3300032005 Bacteria 1651
988 Ga0307411_10402030 3300032005 Bacteria 1132
989 Ga0307411_11259227 3300032005 Bacteria 672
990 Ga0307415_100005526 3300032126 Bacteria 6723
991 Ga0307415_100957934 3300032126 Bacteria 793
992 Ga0307507_10074397 3300033179 Bacteria 3046
993 Ga0307507_10293737 3300033179 Bacteria 1003
994 Ga0307510_10002394 3300033180 Bacteria 21269
995 Ga0307510_10052763 3300033180 Bacteria 4281
996 Ga0307510_10137639 3300033180 Bacteria 2095
997 Ga0373926_0002266 3300035083 Bacteria 6080
998 Ga0373936_0244956 3300035113 Bacteria 799
999 Ga0373939_0000004 3300035114 Bacteria 106519
1000 Ga0373939_0016008 3300035114 Bacteria 1971
1001 Ga0373939_0186460 3300035114 Bacteria 777
1002 Ga0373941_0094452 3300035115 Bacteria 1031
1003 Ga0373945_0042844 3300035116 Bacteria 1641
1004 Ga0373957_0077988 3300035120 Bacteria 1304
1005 Ga0373960_0001434 3300035121 Bacteria 5279
1006 Ga0373943_0000102 3300035170 Bacteria 31578
1007 Ga0373943_0027135 3300035170 Bacteria 2688
1008 Ga0373946_0000763 3300035171 Bacteria 10962
1009 Ga0373946_0024658 3300035171 Bacteria 2359
1010 Ga0373946_0028107 3300035171 Bacteria 2229
1011 Ga0373955_0010364 3300035172 Bacteria 4399
1012 Ga0373924_0239035 3300035410 Bacteria 803
1013 Ga0373931_0001005 3300035691 Bacteria 11928
1014 Ga0373935_0005950 3300035692 Bacteria 7236
1015 Ga0373935_0014152 3300035692 Bacteria 4816
1016 Ga0373927_0003194 3300035695 Bacteria 11808
1017 Ga0373927_0013278 3300035695 Bacteria 5475
1018 Ga0373927_0109177 3300035695 Bacteria 1802
1019 Ga0373933_0005427 3300035724 Bacteria 6939
1020 Ga0373947_0002970 3300035725 Bacteria 10120
1021 Ga0373947_0008316 3300035725 Bacteria 5976
1022 Ga0373937_0027556 3300036401 Bacteria 5138
1023 Ga0373925_0001514 3300037068 Bacteria 19868
1024 Ga0373925_0018543 3300037068 Bacteria 5058
1025 Ga0373925_0033277 3300037068 Bacteria 3799
1026 Ga0395899_0001751 3300037312 Bacteria 18046
1027 Ga0395899_0003063 3300037312 Bacteria 13332
1028 Ga0395899_0011805 3300037312 Bacteria 6686
1029 Ga0395899_0032509 3300037312 Bacteria 3919
1030 Ga0395899_0033535 3300037312 Bacteria 3855
1031 Ga0395900_0008788 3300037418 Bacteria 10380
1032 Ga0395900_0009935 3300037418 Bacteria 9742
1033 Ga0395900_0012770 3300037418 Bacteria 8584
1034 Ga0395900_0029682 3300037418 Bacteria 5610
1035 Ga0395900_0079898 3300037418 Bacteria 3360
1036 Ga0395900_0086114 3300037418 Bacteria 3229
1037 Ga0395900_0120862 3300037418 Bacteria 2687
1038 Ga0395900_0130517 3300037418 Bacteria 2575
1039 Ga0395900_0268895 3300037418 Bacteria 1700
1040 Ga0395900_0437272 3300037418 Bacteria 1266
1041 Ga0395900_0449471 3300037418 Bacteria 1245
1042 Ga0395900_0474203 3300037418 Bacteria 1205
1043 Ga0395898_0000337 3300037466 Bacteria 106044
1044 Ga0395898_0014216 3300037466 Bacteria 8185
1045 Ga0395898_0184649 3300037466 Bacteria 1993
1046 Ga0395898_0390742 3300037466 Bacteria 1326
1047 Ga0395905_0000249 3300037471 Bacteria 80584
1048 Ga0395905_0000416 3300037471 Bacteria 59735
1049 Ga0395905_0000704 3300037471 Bacteria 44377
1050 Ga0395905_0003638 3300037471 Bacteria 16382
1051 Ga0395905_0012379 3300037471 Bacteria 8213
1052 Ga0395905_0018706 3300037471 Bacteria 6571
1053 Ga0395905_0024829 3300037471 Bacteria 5656
1054 Ga0395905_0052002 3300037471 Bacteria 3836
1055 Ga0395905_0074093 3300037471 Bacteria 3190
1056 Ga0395905_0087681 3300037471 Bacteria 2917
1057 Ga0395905_0090163 3300037471 Bacteria 2874
1058 Ga0395905_0185233 3300037471 Bacteria 1954
1059 Ga0395905_0261590 3300037471 Bacteria 1615
1060 Ga0395905_0336830 3300037471 Bacteria 1399
1061 Ga0436364_0543976 3300037853 Bacteria 1192
1062 Ga0436364_1388333 3300037853 Bacteria 18576
1063 Ga0395901_0003716 3300038443 Bacteria 15380
1064 Ga0395901_0037770 3300038443 Bacteria 4994
1065 Ga0395901_0044289 3300038443 Bacteria 4615
1066 Ga0395901_0077228 3300038443 Bacteria 3476
1067 Ga0395901_0157318 3300038443 Bacteria 2387
1068 Ga0395901_0311600 3300038443 Bacteria 1630
1069 Ga0395901_1125135 3300038443 Bacteria 754
1070 Ga0436365_0267961 3300039437 Bacteria 8545
1071 Ga0436365_0442834 3300039437 Bacteria 1389
1072 Ga0436365_1653741 3300039437 Bacteria 3486
1073 Ga0436361_0120947 3300039447 Bacteria 26467
1074 Ga0436361_0174260 3300039447 Bacteria 101834
1075 Ga0436361_0287651 3300039447 Bacteria 35780
1076 Ga0436361_0292057 3300039447 Bacteria 25019
1077 Ga0436361_0360722 3300039447 Bacteria 3555
1078 Ga0436361_0457180 3300039447 Bacteria 5473
1079 Ga0436361_0727856 3300039447 Bacteria 4487
1080 Ga0436361_0810743 3300039447 Bacteria 2785
1081 Ga0436361_0829339 3300039447 Bacteria 5899
1082 Ga0436361_0850691 3300039447 Bacteria 5463
1083 Ga0436361_0939166 3300039447 Bacteria 85026
1084 Ga0439436_0051941 3300041404 Bacteria 1157
1085 Ga0439438_042417 3300041405 Bacteria 1177
1086 Ga0439439_0041034 3300041406 Bacteria 1199
1087 Ga0439439_0068984 3300041406 Bacteria 945
1088 Ga0439447_051123 3300041407 Bacteria 987
1089 Ga0439465_0001001 3300041413 Bacteria 9009
1090 Ga0451793_0331504 3300041452 Bacteria 1356
1091 Ga0451802_0500530 3300041460 Bacteria 2018
1092 Ga0451837_0453168 3300041494 Bacteria 688
1093 Ga0439431_0000135 3300041997 Bacteria 13228
1094 Ga0439433_0005311 3300041999 Bacteria 2767
1095 Ga0439448_0134225 3300042005 Bacteria 854
1096 Ga0439432_099548 3300042006 Bacteria 870
1097 Ga0439449_0002755 3300042007 Bacteria 6839
1098 Ga0439449_0011957 3300042007 Bacteria 3262
1099 Ga0439451_000253 3300042009 Bacteria 10322
1100 Ga0439456_015159 3300042013 Bacteria 1609
1101 Ga0439462_0042294 3300042015 Bacteria 1217
1102 Ga0450911_000860 3300042115 Bacteria 8275
1103 Ga0450915_006225 3300042119 Bacteria 755
1104 Ga0450917_001159 3300042120 Bacteria 1921
1105 Ga0450888_000211 3300042126 Bacteria 5225
1106 Ga0450890_002103 3300042127 Bacteria 2792
1107 Ga0450890_002841 3300042127 Bacteria 2344
1108 Ga0450891_002311 3300042129 Bacteria 1929
1109 Ga0450892_000342 3300042130 Bacteria 5523
1110 Ga0450898_008464 3300042134 Bacteria 1624
1111 Ga0450889_000406 3300042144 Bacteria 4808
1112 Ga0439434_0030089 3300042435 Bacteria 1647
1113 Ga0439459_0000732 3300042438 Bacteria 4495
1114 Ga0439464_0009922 3300042439 Bacteria 2511
1115 Ga0450893_0003052 3300042532 Bacteria 2634
1116 Ga0450893_0027811 3300042532 Bacteria 998
1117 Ga0451577_0007579 3300042876 Bacteria 10645
1118 Ga0451577_0012178 3300042876 Bacteria 8086
1119 Ga0451577_0014424 3300042876 Bacteria 7368
1120 Ga0451577_0254152 3300042876 Bacteria 1591
1121 Ga0466969_0014612 3300044656 Bacteria 4127
1122 Ga0453683_0001511 3300044673 Bacteria 19858
1123 Ga0453683_0040629 3300044673 Bacteria 2920
1124 Ga0453683_0151115 3300044673 Bacteria 1467
1125 Ga0466965_0004319 3300044683 Bacteria 6313
1126 Ga0466966_0016505 3300044684 Bacteria 4876
1127 Ga0466966_0058836 3300044684 Bacteria 2428
1128 Ga0466966_0075667 3300044684 Bacteria 2103
1129 Ga0466966_0153289 3300044684 Bacteria 1404
1130 Ga0466961_0013324 3300044693 Bacteria 5263
1131 Ga0466961_0116803 3300044693 Bacteria 1676
1132 Ga0466961_0196671 3300044693 Bacteria 1248
1133 Ga0453684_0000126 3300044712 Bacteria 336395
1134 Ga0453684_0713817 3300044712 Bacteria 1088
1135 Ga0466957_0109818 3300044842 Bacteria 1748
1136 Ga0466960_0266513 3300044901 Bacteria 956
1137 Ga0466959_0065867 3300045049 Bacteria 2628
1138 Ga0466959_0097689 3300045049 Bacteria 2104
1139 Ga0451576_0009548 3300045051 Bacteria 11238
1140 Ga0451576_0030419 3300045051 Bacteria 5770
1141 Ga0451576_0065938 3300045051 Bacteria 3769
1142 Ga0466967_0066727 3300045976 Bacteria 3207
1143 Ga0495592_0005124 3300046454 Bacteria 9653
1144 Ga0495592_0033858 3300046454 Bacteria 3853
1145 Ga0495603_0012974 3300046455 Bacteria 5038
1146 Ga0495603_0030464 3300046455 Bacteria 3249
1147 Ga0495629_0001156 3300046459 Bacteria 20848
1148 Ga0495629_0052790 3300046459 Bacteria 2844
1149 Ga0495629_0080113 3300046459 Bacteria 2280
1150 Ga0495651_0000976 3300046462 Bacteria 22172
1151 Ga0495651_0014296 3300046462 Bacteria 6135
1152 Ga0495651_0056416 3300046462 Bacteria 3017
1153 Ga0495653_0002352 3300046463 Bacteria 15015
1154 Ga0495653_0007349 3300046463 Bacteria 9024
1155 Ga0495653_0036253 3300046463 Bacteria 3885
1156 Ga0495650_0000224 3300046471 Bacteria 118058
1157 Ga0495650_0047032 3300046471 Bacteria 1807
1158 Ga0495580_0095758 3300046472 Bacteria 2065
1159 Ga0495582_0158586 3300046473 Bacteria 1286
1160 Ga0495582_0400906 3300046473 Bacteria 791
1161 Ga0495639_0003038 3300046475 Bacteria 7306
1162 Ga0495639_0011256 3300046475 Bacteria 3854
1163 Ga0495662_0001205 3300046476 Bacteria 12769
1164 Ga0495664_0000600 3300046477 Bacteria 18276
1165 Ga0495664_0187161 3300046477 Bacteria 1255
1166 Ga0495584_0088564 3300046491 Bacteria 1560
1167 Ga0495585_0000102 3300046492 Bacteria 91414
1168 Ga0495585_0004598 3300046492 Bacteria 8919
1169 Ga0495585_0007926 3300046492 Bacteria 6458
1170 Ga0495594_0005917 3300046499 Bacteria 6285
1171 Ga0495594_0028138 3300046499 Bacteria 3031
1172 Ga0495594_0120239 3300046499 Bacteria 1484
1173 Ga0495607_0008021 3300046501 Bacteria 7251
1174 Ga0495607_0021370 3300046501 Bacteria 4073
1175 Ga0495583_0000127 3300046506 Bacteria 127780
1176 Ga0495606_0000001 3300046507 Bacteria 592123
1177 Ga0495606_0008822 3300046507 Bacteria 8647
1178 Ga0495608_0002654 3300046511 Bacteria 12846
1179 Ga0495608_0004989 3300046511 Bacteria 9503
1180 Ga0495608_0307865 3300046511 Bacteria 980
1181 Ga0495610_0004596 3300046512 Bacteria 10125
1182 Ga0495610_0011303 3300046512 Bacteria 5467
1183 Ga0495616_0000184 3300046513 Bacteria 52694
1184 Ga0495616_0005947 3300046513 Bacteria 7441
1185 Ga0495616_0094813 3300046513 Bacteria 1407
1186 Ga0495618_0005805 3300046514 Bacteria 7504
1187 Ga0495618_0029268 3300046514 Bacteria 3435
1188 Ga0495618_0131487 3300046514 Bacteria 1601
1189 Ga0495618_0284887 3300046514 Bacteria 1030
1190 Ga0495620_0048787 3300046515 Bacteria 1815
1191 Ga0495628_0008815 3300046516 Bacteria 8632
1192 Ga0495628_0013432 3300046516 Bacteria 6889
1193 Ga0495628_0125817 3300046516 Bacteria 1964
1194 Ga0495628_0483126 3300046516 Bacteria 896
1195 Ga0495630_0005764 3300046517 Bacteria 8754
1196 Ga0495630_0031440 3300046517 Bacteria 3953
1197 Ga0495630_0670853 3300046517 Bacteria 793
1198 Ga0495632_0000081 3300046519 Bacteria 99136
1199 Ga0495632_0030420 3300046519 Bacteria 2802
1200 Ga0495632_0030570 3300046519 Bacteria 2794
1201 Ga0495637_0023019 3300046520 Bacteria 2836
1202 Ga0495643_0000630 3300046522 Bacteria 41718
1203 Ga0495643_0001320 3300046522 Bacteria 23471
1204 Ga0495643_0056018 3300046522 Bacteria 2105
1205 Ga0495643_0126760 3300046522 Bacteria 1285
1206 Ga0495648_0061322 3300046524 Bacteria 2234
1207 Ga0495648_0085982 3300046524 Bacteria 1775
1208 Ga0495663_0033616 3300046525 Bacteria 1532
1209 Ga0495666_0030665 3300046526 Bacteria 2637
1210 Ga0495642_0002999 3300046528 Bacteria 6728
1211 Ga0495652_0004595 3300046529 Bacteria 13160
1212 Ga0495652_0019591 3300046529 Bacteria 6023
1213 Ga0495652_0023823 3300046529 Bacteria 5423
1214 Ga0495652_0027916 3300046529 Bacteria 4971
1215 Ga0495652_0092105 3300046529 Bacteria 2477
1216 Ga0495665_0016891 3300046531 Bacteria 3929
1217 Ga0495665_0136570 3300046531 Bacteria 1282
1218 Ga0495640_0002848 3300046533 Bacteria 13917
1219 Ga0495640_0003109 3300046533 Bacteria 13396
1220 Ga0495640_0093329 3300046533 Bacteria 1983
1221 Ga0495586_0036434 3300046535 Bacteria 2640
1222 Ga0495586_0307160 3300046535 Bacteria 909
1223 Ga0495587_0000911 3300046536 Bacteria 19535
1224 Ga0495587_0051847 3300046536 Bacteria 2423
1225 Ga0495609_0000039 3300046538 Bacteria 179384
1226 Ga0495621_0045216 3300046539 Bacteria 1559
1227 Ga0495621_0119144 3300046539 Bacteria 1019
1228 Ga0495597_0000251 3300046542 Bacteria 48899
1229 Ga0495597_0000514 3300046542 Bacteria 32036
1230 Ga0495597_0002116 3300046542 Bacteria 13162
1231 Ga0495645_0010920 3300046543 Bacteria 6381
1232 Ga0495645_0036308 3300046543 Bacteria 3592
1233 Ga0495645_0072307 3300046543 Bacteria 2485
1234 Ga0495645_0169277 3300046543 Bacteria 1504
1235 Ga0495645_0289206 3300046543 Bacteria 1075
1236 Ga0495622_0011733 3300046557 Bacteria 4051
1237 Ga0495633_0001747 3300046558 Bacteria 16154
1238 Ga0495633_0002178 3300046558 Bacteria 14050
1239 Ga0495633_0066789 3300046558 Bacteria 1679
1240 Ga0495667_0013049 3300046559 Bacteria 5627
1241 Ga0495656_0000072 3300046615 Bacteria 45119
1242 Ga0495668_0000285 3300046616 Bacteria 70023
1243 Ga0495668_0001521 3300046616 Bacteria 22039
1244 Ga0495634_0004529 3300046642 Bacteria 10883
1245 Ga0495634_0014172 3300046642 Bacteria 5752
1246 Ga0495634_0054769 3300046642 Bacteria 2668
1247 Ga0495611_0006200 3300046648 Bacteria 5101
1248 Ga0495611_0167124 3300046648 Bacteria 1028
1249 Ga0495625_0000877 3300046660 Bacteria 40871
1250 Ga0495625_0023894 3300046660 Bacteria 4661
1251 Ga0495625_0027726 3300046660 Bacteria 4256
1252 Ga0495625_0054015 3300046660 Bacteria 2870
1253 Ga0495625_0112635 3300046660 Bacteria 1858
1254 Ga0495635_0014561 3300046663 Bacteria 5501
1255 Ga0495635_0025468 3300046663 Bacteria 4121
1256 Ga0495635_0033601 3300046663 Bacteria 3558
1257 Ga0495635_0043108 3300046663 Bacteria 3114
1258 Ga0495635_0187482 3300046663 Bacteria 1405
1259 Ga0495635_0409522 3300046663 Bacteria 900
1260 Ga0495659_0011166 3300046664 Bacteria 2893
1261 Ga0495661_0000094 3300046665 Bacteria 109394
1262 Ga0495661_0021839 3300046665 Bacteria 4166
1263 Ga0495661_0035155 3300046665 Bacteria 3147
1264 Ga0495661_0049153 3300046665 Bacteria 2559
1265 Ga0495588_0054750 3300046674 Bacteria 2058
1266 Ga0495588_0095435 3300046674 Bacteria 1559
1267 Ga0495657_0139398 3300046675 Bacteria 1513
1268 Ga0495599_0021832 3300046678 Bacteria 3996
1269 Ga0495623_0003590 3300046679 Bacteria 10258
1270 Ga0495623_0015491 3300046679 Bacteria 4928
1271 Ga0495623_0047779 3300046679 Bacteria 2716
1272 Ga0495646_0001661 3300046680 Bacteria 13293
1273 Ga0495646_0002551 3300046680 Bacteria 11188
1274 Ga0495646_0066311 3300046680 Bacteria 2135
1275 Ga0495646_0279299 3300046680 Bacteria 888
1276 Ga0495658_0025453 3300046683 Bacteria 3163
1277 Ga0495658_0228703 3300046683 Bacteria 1166
1278 Ga0495669_0000164 3300046684 Bacteria 42542
1279 Ga0495613_0023024 3300046689 Bacteria 4642
1280 Ga0495613_0026725 3300046689 Bacteria 4299
1281 Ga0495624_0004448 3300046690 Bacteria 10256
1282 Ga0495624_0005580 3300046690 Bacteria 9047
1283 Ga0495670_0038087 3300046691 Bacteria 2397
1284 Ga0495649_0001564 3300046694 Bacteria 17171
1285 Ga0495649_0121797 3300046694 Bacteria 1379
1286 Ga0495589_0000019 3300046794 Bacteria 200814
1287 Ga0495589_0001712 3300046794 Bacteria 12483
1288 Ga0495589_0110138 3300046794 Bacteria 1329
1289 Ga0495600_0003478 3300046809 Bacteria 9261
1290 Ga0495600_0006775 3300046809 Bacteria 6987
1291 Ga0495660_0090374 3300046810 Bacteria 1592
1292 Ga0495581_0087492 3300047315 Bacteria 1806
1293 Ga0495581_0272960 3300047315 Bacteria 988
1294 Ga0495604_0001863 3300047317 Bacteria 17177
1295 Ga0495604_0013119 3300047317 Bacteria 6601
1296 Ga0495604_0030390 3300047317 Bacteria 4290
1297 Ga0495604_0255656 3300047317 Bacteria 1192
1298 Ga0495604_0344532 3300047317 Bacteria 991
1299 Ga0495636_0012076 3300047318 Bacteria 3423
1300 Ga0495674_0001578 3300047319 Bacteria 22344
1301 Ga0495674_0004086 3300047319 Bacteria 14114
1302 Ga0495674_0025320 3300047319 Bacteria 5441
1303 Ga0495672_0001684 3300047320 Bacteria 21407
1304 Ga0495672_0018332 3300047320 Bacteria 4651
1305 Ga0495672_0021435 3300047320 Bacteria 4215
1306 Ga0495676_0007228 3300047321 Bacteria 10184
1307 Ga0495676_0007289 3300047321 Bacteria 10143
1308 Ga0495676_0016920 3300047321 Bacteria 6456
1309 Ga0495676_0100509 3300047321 Bacteria 2141
1310 Ga0495676_0316428 3300047321 Bacteria 1049
1311 Ga0495680_0003432 3300047322 Bacteria 15646
1312 Ga0495680_0041286 3300047322 Bacteria 3670
1313 Ga0495683_0139536 3300047323 Bacteria 1137
1314 Ga0495687_000059 3300047443 Bacteria 179357
1315 Ga0495687_011487 3300047443 Bacteria 4755
1316 Ga0495675_0103322 3300047444 Bacteria 1782
1317 Ga0495675_0286106 3300047444 Bacteria 982
1318 Ga0495677_0000006 3300047445 Bacteria 199230
1319 Ga0495685_013611 3300047447 Bacteria 2761
1320 Ga0495681_0003047 3300047470 Bacteria 11774
1321 Ga0495681_0064113 3300047470 Bacteria 1684
1322 Ga0495684_0013069 3300047471 Bacteria 6408
1323 Ga0495684_0021915 3300047471 Bacteria 4919
1324 Ga0495686_0006497 3300047472 Bacteria 8936
1325 Ga0495686_0010836 3300047472 Bacteria 6461
1326 Ga0495686_0017129 3300047472 Bacteria 4891
1327 Ga0495593_0090265 3300047673 Bacteria 1578
1328 Ga0495602_0006678 3300048088 Bacteria 12091
1329 Ga0495602_0029352 3300048088 Bacteria 5239
1330 Ga0495614_0006650 3300048089 Bacteria 5177
1331 Ga0495626_0000494 3300048091 Bacteria 39727
1332 Ga0495626_0000821 3300048091 Bacteria 27909
1333 Ga0495626_0001165 3300048091 Bacteria 21902
1334 Ga0495626_0001278 3300048091 Bacteria 20542
1335 Ga0496101_0009683 3300048904 Bacteria 6341
1336 Ga0496102_0037805 3300048905 Bacteria 4355
1337 Ga0496102_0946470 3300048905 Bacteria 782
1338 Ga0496102_0997117 3300048905 Bacteria 758
1339 Ga0496103_0032658 3300048906 Bacteria 3177
1340 Ga0496103_0170893 3300048906 Bacteria 1396
1341 Ga0496104_0003204 3300048907 Bacteria 14068
1342 Ga0496104_0086164 3300048907 Bacteria 2999
1343 Ga0496104_0157257 3300048907 Bacteria 2181
1344 Ga0496104_0305695 3300048907 Bacteria 1503
1345 Ga0496105_0003462 3300048908 Bacteria 11674
1346 Ga0496105_0025378 3300048908 Bacteria 4825
1347 Ga0496105_0072207 3300048908 Bacteria 2852
1348 Ga0496105_0093421 3300048908 Bacteria 2484
1349 Ga0496107_0020407 3300048910 Bacteria 4680
1350 Ga0496107_0521993 3300048910 Bacteria 880
1351 Ga0496107_0728200 3300048910 Bacteria 729
1352 Ga0496108_0114489 3300048911 Bacteria 2309
1353 Ga0496108_0309879 3300048911 Bacteria 1375
1354 Ga0496109_0100430 3300048912 Bacteria 2684
1355 Ga0496109_0337033 3300048912 Bacteria 1424
1356 Ga0496110_0054927 3300048913 Bacteria 3503
1357 Ga0496110_0907212 3300048913 Bacteria 787
1358 Ga0496111_0030956 3300048914 Bacteria 3808
1359 Ga0496111_0044917 3300048914 Bacteria 3176
1360 Ga0496112_0150025 3300048915 Bacteria 2298
1361 Ga0496112_0213950 3300048915 Bacteria 1884
1362 Ga0496113_0012960 3300048916 Bacteria 5624
1363 Ga0496114_0686916 3300048917 Bacteria 898
1364 Ga0496115_0284153 3300048918 Bacteria 1358
1365 Ga0496116_0033181 3300048919 Bacteria 3666
1366 Ga0496116_0036895 3300048919 Bacteria 3415
1367 Ga0496116_0052530 3300048919 Bacteria 2699
1368 Ga0496117_0024823 3300048920 Bacteria 4727
1369 Ga0496118_0011398 3300048921 Bacteria 8681
1370 Ga0496119_0012065 3300048922 Bacteria 7062
1371 Ga0496119_0018999 3300048922 Bacteria 5086
1372 Ga0496121_0000567 3300048924 Bacteria 69706
1373 Ga0496121_0006746 3300048924 Bacteria 14087
1374 Ga0496121_0012939 3300048924 Bacteria 9020
1375 Ga0496121_0026546 3300048924 Bacteria 5452
1376 Ga0496121_0028452 3300048924 Bacteria 5201
1377 Ga0496121_0036698 3300048924 Bacteria 4364
1378 Ga0496121_0167049 3300048924 Bacteria 1602
1379 Ga0496122_0000644 3300048925 Bacteria 70937
1380 Ga0496122_0005337 3300048925 Bacteria 15366
1381 Ga0496122_0196473 3300048925 Bacteria 1184
1382 Ga0496123_0000057 3300048926 Bacteria 228608
1383 Ga0496123_0000203 3300048926 Bacteria 121361
1384 Ga0496123_0034513 3300048926 Bacteria 3622
1385 Ga0496124_0000024 3300048927 Bacteria 414291
1386 Ga0496124_0034858 3300048927 Bacteria 4409
1387 Ga0496124_0081990 3300048927 Bacteria 2649
1388 Ga0496124_0298057 3300048927 Bacteria 1166
1389 Ga0496125_0000011 3300048928 Bacteria 655895
1390 Ga0496125_0033728 3300048928 Bacteria 4524
1391 Ga0495678_001541 3300049459 Bacteria 17802
1392 Ga0501031_0004268 3300049568 Bacteria 9236
1393 Ga0501032_0001868 3300049569 Bacteria 16653
1394 Ga0501032_0271036 3300049569 Bacteria 1100
1395 Ga0501032_0409307 3300049569 Bacteria 871
1396 Ga0501033_0000491 3300049570 Bacteria 37247
1397 Ga0501033_0014446 3300049570 Bacteria 5996
1398 Ga0501034_0165962 3300049571 Bacteria 2176
1399 Ga0501034_0273556 3300049571 Bacteria 1629
1400 Ga0501034_0462341 3300049571 Bacteria 1185
1401 Ga0501036_0000389 3300049572 Bacteria 30927
1402 Ga0501036_0178885 3300049572 Bacteria 1786
1403 Ga0501037_0001552 3300049573 Bacteria 16758
1404 Ga0501037_0003775 3300049573 Bacteria 10987
1405 Ga0501037_0142292 3300049573 Bacteria 1716
1406 Ga0501038_0000414 3300049574 Bacteria 36995
1407 Ga0501038_0026046 3300049574 Bacteria 5209
1408 Ga0501038_0348534 3300049574 Bacteria 1154
1409 Ga0501043_0015683 3300049579 Bacteria 5939
1410 Ga0501043_0222465 3300049579 Bacteria 1460
1411 Ga0501046_0028661 3300049580 Bacteria 4533
1412 Ga0501047_0007765 3300049581 Bacteria 10101
1413 Ga0501047_0019806 3300049581 Bacteria 6457
1414 Ga0501076_0347967 3300049592 Bacteria 1217
1415 Ga0501198_000021 3300049649 Bacteria 70854
1416 Ga0501222_000018 3300049662 Bacteria 71805
1417 Ga0501257_003248 3300049686 Bacteria 3474
1418 Ga0501229_013039 3300049706 Bacteria 1065
1419 Ga0501080_0787502 3300049742 Bacteria 835
1420 Ga0501241_004893 3300049758 Bacteria 2500
1421 Ga0501035_0002711 3300049822 Bacteria 17218
1422 Ga0501035_0010322 3300049822 Bacteria 8665
1423 Ga0501035_0015605 3300049822 Bacteria 7010
1424 Ga0501035_0100847 3300049822 Bacteria 2534
1425 Ga0501044_0001056 3300049823 Bacteria 33138
1426 Ga0501044_0001117 3300049823 Bacteria 31880
1427 Ga0501044_0005223 3300049823 Bacteria 14450
1428 Ga0501044_0032525 3300049823 Bacteria 5483
1429 Ga0501044_0043140 3300049823 Bacteria 4687
1430 nmdc:mga03683_1332_c1 3300050489 Bacteria 7311
1431 nmdc:mga03683_81758_c1 3300050489 Bacteria 1396
1432 nmdc:mga03n38_8009_c1 3300050490 Bacteria 3770
1433 nmdc:mga00v17_114337_c1 3300050491 Bacteria 1714
1434 nmdc:mga00v17_7626_c1 3300050491 Bacteria 5786
1435 nmdc:mga0yw44_10267_c1 3300050492 Bacteria 4776
1436 nmdc:mga0k408_119132_c1 3300050493 Bacteria 1563
1437 nmdc:mga0k408_32769_c1 3300050493 Bacteria 2969
1438 nmdc:mga0k408_5324_c1 3300050493 Bacteria 6835
1439 nmdc:mga06z11_16406_c1 3300050494 Bacteria 3336
1440 nmdc:mga04h51_2254_c1 3300050495 Bacteria 4546
1441 nmdc:mga07m45_3456_c1 3300050496 Bacteria 7619
1442 nmdc:mga07m45_81165_c1 3300050496 Bacteria 1852
1443 Ga0495601_0001015 3300053077 Bacteria 15352
1444 Ga0495601_0062988 3300053077 Bacteria 2356
1445 Ga0495601_0164118 3300053077 Bacteria 1452
1446 Ga0495601_0277200 3300053077 Bacteria 1093
1447 Ga0495612_0000523 3300053078 Bacteria 15440
1448 Ga0495612_0142801 3300053078 Bacteria 1039
1449 Ga0495595_0000244 3300053084 Bacteria 21433
1450 Ga0495619_0001492 3300053085 Bacteria 15422
1451 Ga0495619_0007733 3300053085 Bacteria 6802
1452 Ga0495619_0216970 3300053085 Bacteria 1325
1453 Ga0495619_0416771 3300053085 Bacteria 927
1454 Ga0500643_002719 3300053087 Bacteria 8878
1455 Ga0500643_004495 3300053087 Bacteria 6283
1456 Ga0500644_0008465 3300053088 Bacteria 2717
1457 Ga0500644_0118860 3300053088 Bacteria 1027
1458 Ga0500583_0019278 3300053092 Bacteria 2793
1459 Ga0500651_0000052 3300053093 Bacteria 76301
1460 Ga0500566_0090743 3300053094 Bacteria 1689
1461 Ga0500566_0221184 3300053094 Bacteria 941
1462 Ga0500594_0028715 3300053118 Bacteria 1449
1463 Ga0500594_0094382 3300053118 Bacteria 912
1464 Ga0500607_000003 3300053121 Bacteria 149664
1465 Ga0500608_000074 3300053122 Bacteria 42636
1466 Ga0500608_135974 3300053122 Bacteria 1096
1467 Ga0500618_001117 3300053125 Bacteria 13113
1468 Ga0500626_073827 3300053128 Bacteria 1515
1469 Ga0500655_000281 3300053133 Bacteria 11746
1470 Ga0500658_0000033 3300053134 Bacteria 89738
1471 Ga0500658_0000040 3300053134 Bacteria 79293
1472 Ga0500559_0000011 3300053136 Bacteria 164751
1473 Ga0500559_0000400 3300053136 Bacteria 31323
1474 Ga0500559_0006122 3300053136 Bacteria 5446
1475 Ga0500568_0004186 3300053139 Bacteria 7782
1476 Ga0500568_0006369 3300053139 Bacteria 5930
1477 Ga0500573_0005745 3300053140 Bacteria 6656
1478 Ga0500574_000287 3300053141 Bacteria 6183
1479 Ga0500574_066915 3300053141 Bacteria 1049
1480 Ga0500590_001152 3300053148 Bacteria 10437
1481 Ga0500604_0000025 3300053151 Bacteria 68203
1482 Ga0500604_0007438 3300053151 Bacteria 2901
1483 Ga0500616_0000254 3300053153 Bacteria 82664
1484 Ga0500616_0219060 3300053153 Bacteria 831
1485 Ga0500619_000035 3300053154 Bacteria 41663
1486 Ga0500622_0013799 3300053156 Bacteria 4352
1487 Ga0500622_0017687 3300053156 Bacteria 3793
1488 Ga0500622_0018708 3300053156 Bacteria 3680
1489 Ga0500645_002612 3300053730 Bacteria 7896
1490 Ga0590075_036627 3300059424 Bacteria 1250
1491 Ga0590077_033052 3300059426 Bacteria 1134
1492 Ga0587084_048259 3300059477 Bacteria 746
1493 Ga0587088_008258 3300059508 Bacteria 1467
1494 Ga0587092_019830 3300059512 Bacteria 1029
1495 Ga0587098_014045 3300059604 Bacteria 939
1496 Ga0587072_003368 3300059643 Bacteria 2241
1497 Ga0466962_0009549 3300061719 Bacteria 4652
1498 2511248470 2511231003 Bacteria 5606035
1499 2511385044 2511231026 Bacteria 5225445
1500 2521560555 2521172590 Bacteria 5047645
1501 2553005660 2551306416 Bacteria 6152985
1502 2596375848 2595698237 Bacteria 6712432
1503 2599903268 2599185292 Bacteria 6290804
1504 2600197984 2599185352 Bacteria 7228948
1505 2601669708 2600255292 Bacteria 6300551
1506 2640734230 2639762793 Bacteria 3943681
1507 2643790602 2643221554 Bacteria 6603920
1508 2643799913 2643221556 Bacteria 7251154
1509 2643862236 2643221569 Bacteria 6064337
1510 2643866594 2643221570 Bacteria 5103772
1511 2643980737 2643221594 Bacteria 5811388
1512 2644028954 2643221603 Bacteria 6147767
1513 2644087942 2643221614 Bacteria 4260023
1514 2644122162 2643221621 Bacteria 6212786
1515 2644207495 2643221637 Bacteria 5345260
1516 2644225910 2643221640 Bacteria 5258820
1517 2644235399 2643221642 Bacteria 5357871
1518 2644253376 2643221645 Bacteria 7207331
1519 2644296352 2643221652 Bacteria 5140275
1520 2644344171 2643221661 Bacteria 4267604
1521 2644355576 2643221664 Bacteria 7272945
1522 2644367299 2643221666 Bacteria 4265935
1523 2644474914 2643221684 Bacteria 7145183
1524 2644651244 2643221718 Bacteria 5345506
1525 2644675278 2643221723 Bacteria 7095460
1526 2678231208 2675903507 Bacteria 3737791
1527 2738737303 2738541280 Bacteria 6630198
1528 2738830074 2738541297 Bacteria 6549566
1529 2738841524 2738541300 Bacteria 6675882
1530 2739153870 2738541357 Bacteria 6549408
1531 2739195790 2738543003 Bacteria 6549560
1532 2739272395 2738543018 Bacteria 6718814
1533 2739322266 2738543026 Bacteria 6549408
1534 2739340507 2738543029 Bacteria 6549249
1535 2739341439 2738543030 Bacteria 6719714
1536 2739612225 2739367655 Bacteria 4051151
1537 2739790265 2739367756 Bacteria 4553612
1538 2765571806 2765235838 Bacteria 5445269
1539 2774388237 2773857761 Bacteria 3837365
1540 2808982188 2808606386 Bacteria 4471946
1541 2809031946 2808606395 Bacteria 6020352
1542 2809130012 2808606415 Bacteria 4576710
1543 2809146730 2808606418 Bacteria 6724496
1544 2809148933 2808606419 Bacteria 4576925
1545 2819539152 2818991435 Bacteria 5433759
1546 2819540680 2818991436 Bacteria 5376622
1547 2819593496 2818991445 Bacteria 4955017
1548 2819617248 2818991449 Bacteria 5518009
1549 2819648334 2818991454 Bacteria 5563326
1550 2821132013 2821131069 Bacteria 6108407
1551 2839098473 2839094727 Bacteria 5534556
1552 2842712744 2842711865 Bacteria 7155354
1553 2852619069 2852618963 Bacteria 4577824
1554 2855734543 2855730933 Bacteria 7047938
1555 2855770133 2855767633 Bacteria 7049357
1556 2856294109 2856287931 Bacteria 7223934
1557 2857366272 2857357740 Bacteria 9937880
1558 2857538428 2857537821 Bacteria 5248181
1559 2857545256 2857542790 Bacteria 5326616
1560 2857551225 2857547612 Bacteria 6179999
1561 2857557717 2857553236 Bacteria 6166726
1562 2857563989 2857558681 Bacteria 6617694
1563 2857568532 2857564685 Bacteria 6290584
1564 2857578636 2857576091 Bacteria 5465855
1565 2858955689 2858950400 Bacteria 6783797
1566 2881104189 2881101125 Bacteria 4590519
1567 2881414347 2881412998 Bacteria 6492157
1568 2881930324 2881927736 Bacteria 3993927
1569 2884812569 2884811622 Bacteria 5552861
1570 2884816163 2884811622 Bacteria 5552861
1571 2884839394 2884836552 Bacteria 5219991
1572 2884840030 2884836552 Bacteria 5219991
1573 2884856796 2884852848 Bacteria 5221161
1574 2884857202 2884852848 Bacteria 5221161
1575 2887377920 2887375801 Bacteria 5334027
1576 2896157789 2896154374 Bacteria 5221518
1577 2896158142 2896154374 Bacteria 5221518
1578 2896256048 2896253425 Bacteria 3418029
1579 2896430966 2896429255 Bacteria 2557483
1580 2902331375 2902330777 Bacteria 6395352
1581 2902408447 2902405164 Bacteria 6784948
1582 2904442886 2904439833 Bacteria 5931679
1583 2904481859 2904479285 Bacteria 5073931
1584 2904534918 2904530477 Bacteria 5876334
1585 2904588743 2904584206 Bacteria 6028872
1586 2904594183 2904589729 Bacteria 6113573
1587 2904604979 2904601388 Bacteria 5884906
1588 2916699728 2916699645 Bacteria 3568996
1589 2919048618 2919046199 Bacteria 5567169
1590 2919083212 2919079590 Bacteria 5946433
1591 2919184125 2919182534 Bacteria 3907101
1592 2919480296 2919476304 Bacteria 5888696
1593 2923514333 2923510766 Bacteria 5926163
1594 2928125394 2928125067 Bacteria 5937560
1595 2928133069 2928130867 Bacteria 5467269
1596 2932413194 2932410948 Bacteria 6312192
1597 2932417255 2932416698 Bacteria 6315112
1598 2939632171 2939631187 Bacteria 6118131
1599 2941481975
1600 2952255615 2952252522 Bacteria 4171745
1601 8002394976 8002392321 Bacteria 4159911
1602 8047673309 8047673197 Bacteria 7395230
1603 8048749800 8048746797 Bacteria 3557226
1604 8055227904 8055225921 Bacteria 3341787
1605 Ga0265338_10042032
1606 JGI24752J21851_1000255
1607 JGI24740J21852_10003031
1608 JGI24739J22299_10038407
1609 JGI24743J22301_10001118
1610 JGI24735J21928_10018757
1611 JGI24735J21928_10052533
1612 JGI24748J21848_1000053
1613 JGI24749J21850_1001230
1614 JGI24034J26672_10000036
1615 JGI24742J22300_10002780
1616 JGI25155J39150_1000073
1617 JGI25156J39149_1000609
1618 JGI25156J39149_1004731
1619 JGI25162J39368_1000001
1620 JGI25162J39368_1006819
1621 JGI25154J39366_1000118
1622 JGI25154J39366_1000258
1623 JGI25154J39366_1000270
1624 JGI25157J39369_1000001
1625 JGI25164J39214_1001808
1626 JGI25152J39213_1001584
1627 JGI25152J39213_1015800
1628 JGI25150J39212_1000428
1629 JGI25150J39212_1001402
1630 JGI25150J39212_1010535
1631 JGI25159J45721_1000675
1632 JGI25159J45721_1001076
1633 JGI25159J45721_1001508
1634 JGI25159J45721_1001707
1635 JGI25159J45721_1007198
1636 JGI25151J46595_10003026
1637 JGI25151J46595_10010417
1638 JGI25151J46595_10023110
1639 JGI25151J46595_10036981
1640 JGI25165J46597_1000001
1641 JGI25153J46596_10000395
1642 JGI25153J46596_10021825
1643 JGI25160J50197_1000259
1644 JGI25160J50197_1000962
1645 JGI25160J50197_1002071
1646 JGI25160J50197_1003470
1647 JGI25161J50226_1000092
1648 JGI25161J50226_1002450
1649 JGI25161J50226_1003326
1650 Ga0007417J51691_1023165
1651 Ga0007410J51695_1034713
1652 Ga0007409J51694_1016496
1653 Ga0007416J51690_1013575
1654 Ga0007416J51690_1033019
1655 Ga0006562J51391_1148455
1656 Ga0007411J51799_112918
1657 Ga0032354_1022659
1658 Ga0055538_1000001
1659 Ga0055539_1000001
1660 Ga0055533_1000003
1661 Ga0055525_1000001
1662 Ga0055525_1000003
1663 Ga0055525_1000046
1664 Ga0055535_1000215
1665 Ga0055535_1001710
1666 Ga0055535_1003636
1667 Ga0055542_1000004
1668 Ga0055542_1000412
1669 Ga0055529_1000032
1670 Ga0055529_1000306
1671 Ga0055526_1000951
1672 Ga0055526_1001576
1673 Ga0055526_1002557
1674 Ga0055526_1003709
1675 Ga0055526_1004461
1676 Ga0055526_1004811
1677 Ga0055526_1006869
1678 Ga0055526_1008931
1679 Ga0055537_1000030
1680 Ga0055537_1000086
1681 Ga0055537_1000587
1682 Ga0055537_1001401
1683 Ga0055524_1000093
1684 Ga0055524_1000194
1685 Ga0055524_1002243
1686 Ga0055524_1002452
1687 Ga0055524_1002681
1688 Ga0055536_1000715
1689 Ga0055536_1003152
1690 Ga0055536_1014255
1691 Ga0055534_1000024
1692 Ga0055534_1000447
1693 Ga0055534_1000820
1694 Ga0055534_1001417
1695 Ga0055534_1001838
1696 Ga0055534_1021827
1697 Ga0055528_1000439
1698 Ga0055528_1000961
1699 Ga0055528_1002611
1700 Ga0055528_1014420
1701 Ga0055530_10000541
1702 Ga0055530_10057965
1703 Ga0055540_1000089
1704 Ga0055540_1004954
1705 Ga0055540_1006243
1706 Ga0055540_1013378
1707 Ga0055531_10000269
1708 Ga0055531_10002978
1709 Ga0055531_10005739
1710 Ga0055531_10009722
1711 Ga0055531_10042077
1712 Ga0055541_1000001
1713 Ga0055541_1001138
1714 Ga0055543_1001474
1715 Ga0055543_1003203
1716 Ga0055543_1004025
1717 Ga0055543_1005432
1718 Ga0055543_1009685
1719 Ga0065165_1000353
1720 Ga0065165_1000600
1721 Ga0065165_1001802
1722 Ga0065165_1002550
1723 Ga0065165_1005751
1724 Ga0065165_1014470
1725 Ga0065165_1036832
1726 Ga0065165_1038483
1727 Ga0065714_10014905
1728 Ga0065714_10151557
1729 Ga0065704_10180239
1730 Ga0065704_10198711
1731 Ga0065704_10215718
1732 Ga0065704_10457162
1733 Ga0065712_10250585
1734 Ga0065707_10085375
1735 Ga0070658_10009563
1736 Ga0070658_10028610
1737 Ga0070658_10080132
1738 Ga0070658_10327550
1739 Ga0070658_10452422
1740 Ga0070676_10124788
1741 Ga0070676_10138541
1742 Ga0070683_100001966
1743 Ga0070683_100036898
1744 Ga0070683_100421886
1745 Ga0070670_100002397
1746 Ga0070670_100049854
1747 Ga0070670_100074892
1748 Ga0070670_100299937
1749 Ga0070670_100555591
1750 Ga0070677_10000523
1751 Ga0070677_10032192
1752 Ga0068869_100008423
1753 Ga0068869_100010764
1754 Ga0068869_100249632
1755 Ga0070666_10084706
1756 Ga0070680_100006104
1757 Ga0068868_100000004
1758 Ga0068868_100001107
1759 Ga0070660_100176833
1760 Ga0070660_100259759
1761 Ga0070660_100406251
1762 Ga0070689_100318277
1763 Ga0070661_100000006
1764 Ga0070661_100000994
1765 Ga0070661_100006933
1766 Ga0070668_100008742
1767 Ga0070668_100129046
1768 Ga0070668_100239734
1769 Ga0070668_100576965
1770 Ga0070669_100012993
1771 Ga0070669_100040177
1772 Ga0070669_100049127
1773 Ga0070669_100201034
1774 Ga0070669_100265299
1775 Ga0070669_100267171
1776 Ga0070675_100002143
1777 Ga0070675_100002327
1778 Ga0070675_100091547
1779 Ga0070675_100133314
1780 Ga0070671_100003169
1781 Ga0070671_100009039
1782 Ga0070671_100011946
1783 Ga0070671_100022247
1784 Ga0070671_100125957
1785 Ga0070671_100224309
1786 Ga0070671_100250235
1787 Ga0070671_100342328
1788 Ga0070674_100034507
1789 Ga0070674_100044141
1790 Ga0070674_100182252
1791 Ga0070674_100348366
1792 Ga0070674_100406579
1793 Ga0070674_100452768
1794 Ga0070673_100007098
1795 Ga0070673_100021209
1796 Ga0070673_100043576
1797 Ga0070673_100174672
1798 Ga0070673_100182855
1799 Ga0070673_100186388
1800 Ga0070673_100767541
1801 Ga0070688_100473180
1802 Ga0070659_100000929
1803 Ga0070659_100006995
1804 Ga0070659_100259547
1805 Ga0070659_100324528
1806 Ga0070667_100001557
1807 Ga0070667_100016942
1808 Ga0070667_100480287
1809 Ga0070667_100732944
1810 Ga0070667_100865492
1811 Ga0070714_100089631
1812 Ga0070713_100089448
1813 Ga0070713_100501445
1814 Ga0070713_100858097
1815 Ga0070710_10202944
1816 Ga0070711_100071388
1817 Ga0070711_100747873
1818 Ga0070700_100170991
1819 Ga0070700_100315320
1820 Ga0070663_100012236
1821 Ga0070663_100024503
1822 Ga0070663_100451472
1823 Ga0070678_100004119
1824 Ga0070678_100359840
1825 Ga0070681_10011352
1826 Ga0070681_10269042
1827 Ga0068867_100000048
1828 Ga0068867_100004827
1829 Ga0068867_100025498
1830 Ga0068867_100090559
1831 Ga0068867_100134811
1832 Ga0068867_100290668
1833 Ga0070685_10191940
1834 Ga0070707_100181678
1835 Ga0070698_100095994
1836 Ga0070679_100000001
1837 Ga0070679_100058491
1838 Ga0070679_100380720
1839 Ga0070684_100004982
1840 Ga0068853_100268022
1841 Ga0068853_100385407
1842 Ga0070672_100023179
1843 Ga0070672_100049884
1844 Ga0070672_100089641
1845 Ga0070672_100360506
1846 Ga0070672_100487623
1847 Ga0070693_100232520
1848 Ga0070665_100033278
1849 Ga0070665_100280727
1850 Ga0070665_100498020
1851 Ga0068855_100004740
1852 Ga0068855_100004765
1853 Ga0068855_100011354
1854 Ga0068855_100080833
1855 Ga0068855_100109993
1856 Ga0068855_100191596
1857 Ga0068855_100278184
1858 Ga0068855_100950038
1859 Ga0070664_100000282
1860 Ga0070664_100019344
1861 Ga0070664_100038293
1862 Ga0070664_100061503
1863 Ga0068857_100016086
1864 Ga0068857_100114219
1865 Ga0068857_100292839
1866 Ga0068857_100405795
1867 Ga0068854_100064887
1868 Ga0068854_100186459
1869 Ga0068856_100034658
1870 Ga0068856_100128445
1871 Ga0068856_100646647
1872 Ga0068856_100728763
1873 Ga0068852_100000048
1874 Ga0068852_100004013
1875 Ga0068852_100018978
1876 Ga0068852_100109695
1877 Ga0068852_100127977
1878 Ga0068852_100155854
1879 Ga0068852_100314395
1880 Ga0068852_100443706
1881 Ga0068852_100574432
1882 Ga0068852_100945954
1883 Ga0068859_100013690
1884 Ga0068859_100036992
1885 Ga0068859_100097644
1886 Ga0068864_100002769
1887 Ga0068864_100011909
1888 Ga0068864_100063454
1889 Ga0068864_100325041
1890 Ga0068861_100010229
1891 Ga0068861_100694602
1892 Ga0068851_10007313
1893 Ga0068851_10028110
1894 Ga0068851_10126671
1895 Ga0068851_10190658
1896 Ga0068863_100000323
1897 Ga0068863_100001631
1898 Ga0068863_100014569
1899 Ga0068863_100198971
1900 Ga0068863_100358823
1901 Ga0068858_100002617
1902 Ga0068858_100002948
1903 Ga0068860_100000069
1904 Ga0068860_100000524
1905 Ga0068860_100011518
1906 Ga0068860_100509105
1907 Ga0068862_100009227
1908 Ga0068862_100082302
1909 Ga0070717_10575880
1910 Ga0075365_10005295
1911 Ga0075365_10009750
1912 Ga0075365_10027139
1913 Ga0075363_100002405
1914 Ga0075363_100014482
1915 Ga0075363_100125351
1916 Ga0075364_10001014
1917 Ga0075364_10014348
1918 Ga0075364_10037369
1919 Ga0075364_10055355
1920 Ga0075364_10175136
1921 Ga0075364_10644528
1922 Ga0075432_10021123
1923 Ga0070712_100003162
1924 Ga0070712_100063584
1925 Ga0075362_10003092
1926 Ga0075362_10045866
1927 Ga0075367_10018656
1928 Ga0075367_10044803
1929 Ga0075369_10019058
1930 Ga0075369_10219067
1931 Ga0075366_10023990
1932 Ga0075366_10085752
1933 Ga0075366_10134051
1934 Ga0075366_10136681
1935 Ga0075366_10174826
1936 Ga0075366_10194514
1937 Ga0075366_10492522
1938 Ga0097621_100026937
1939 Ga0097621_100030071
1940 Ga0097621_100065452
1941 Ga0075370_10001129
1942 Ga0075370_10006235
1943 Ga0075370_10006846
1944 Ga0075370_10008342
1945 Ga0075370_10050137
1946 Ga0068871_100002247
1947 Ga0068871_100077837
1948 Ga0068871_100147195
1949 Ga0068871_100246610
1950 Ga0068871_100406335
1951 Ga0075429_100478892
1952 Ga0075429_100880813
1953 Ga0068865_100076478
1954 Ga0068865_100145391
1955 Ga0068865_100153063
1956 Ga0075436_100554577
1957 Ga0097620_100013690
1958 Ga0097620_100036992
1959 Ga0097620_100097647
1960 Ga0079104_1000007
1961 Ga0079104_1005881
1962 Ga0099826_10000132
1963 Ga0105251_10166054
1964 Ga0105244_10121953
1965 Ga0105250_10056123
1966 Ga0105250_10103416
1967 Ga0105240_10000084
1968 Ga0105240_10004442
1969 Ga0105240_10008224
1970 Ga0105240_10106546
1971 Ga0105240_10153246
1972 Ga0105240_10211667
1973 Ga0105240_10385039
1974 Ga0105240_11019860
1975 Ga0105240_11265032
1976 Ga0105245_10001510
1977 Ga0105245_10731934
1978 Ga0105247_10001822
1979 Ga0105243_10000005
1980 Ga0105241_10174653
1981 Ga0105242_10236947
1982 Ga0105248_10001008
1983 Ga0105248_10006497
1984 Ga0105248_10028876
1985 Ga0105248_10180654
1986 Ga0105237_10010106
1987 Ga0105237_10048803
1988 Ga0105237_10130578
1989 Ga0105237_10158718
1990 Ga0105238_10000113
1991 Ga0105238_10000160
1992 Ga0105238_10017512
1993 Ga0105238_10177187
1994 Ga0105238_10194328
1995 Ga0105238_10450889
1996 Ga0105238_10455046
1997 Ga0105238_10556574
1998 Ga0105238_10977881
1999 Ga0105249_10132588
2000 Ga0105249_11837142
2001 Ga0105239_10000289
2002 Ga0105239_10003397
2003 Ga0105246_10000618
2004 Ga0157373_10147263
2005 Ga0157371_10548477
2006 Ga0157370_10002535
2007 Ga0157369_10000334
2008 Ga0157369_10003357
2009 Ga0157369_10232759
2010 Ga0157369_10303725
2011 Ga0171462_1031
2012 Ga0157374_10020568
2013 Ga0157374_10139935
2014 Ga0157378_10020749
2015 Ga0157378_10127308
2016 Ga0163162_10003717
2017 Ga0163162_10020731
2018 Ga0163162_10046081
2019 Ga0163162_10070533
2020 Ga0163162_10084914
2021 Ga0163162_10318325
2022 Ga0157372_10000092
2023 Ga0157372_10034949
2024 Ga0157372_10081286
2025 Ga0157372_10594982
2026 Ga0157375_10002806
2027 Ga0157375_10198861
2028 Ga0157375_10491870
2029 Ga0157375_10516563
2030 Ga0163163_10001715
2031 Ga0163163_10008501
2032 Ga0163163_10335608
2033 Ga0182008_10009226
2034 Ga0182008_10059354
2035 Ga0182008_10071746
2036 Ga0182008_10106183
2037 Ga0157377_10236796
2038 Ga0157379_10002856
2039 Ga0157379_10025217
2040 Ga0157379_10029132
2041 Ga0157379_10082697
2042 Ga0157376_10278536
2043 Ga0157376_10295651
2044 Ga0182006_1031937
2045 Ga0182007_10000921
2046 Ga0182007_10005649
2047 Ga0182007_10013824
2048 Ga0182005_1000534
2049 Ga0183362_10001
2050 Ga0163161_10019141
2051 Ga0163161_10021781
2052 Ga0163161_10071729
2053 Ga0163161_10503648
2054 Ga0213872_10000001
2055 Ga0213872_10000051
2056 Ga0213872_10000060
2057 Ga0213872_10000632
2058 Ga0213872_10002848
2059 Ga0213872_10008989
2060 Ga0213872_10018060
2061 Ga0213876_10005332
2062 Ga0213875_10059590
2063 Ga0209435_100001
2064 Ga0209436_100633
2065 Ga0209436_103318
2066 Ga0207672_1000282
2067 Ga0209784_100004
2068 Ga0209784_100638
2069 Ga0209566_100004
2070 Ga0209566_100651
2071 Ga0209674_100006
2072 Ga0209674_100160
2073 Ga0209672_101339
2074 Ga0209147_100004
2075 Ga0209147_100097
2076 Ga0209147_103938
2077 Ga0209563_100005
2078 Ga0209563_100007
2079 Ga0209563_100009
2080 Ga0207427_100310
2081 Ga0207427_112082
2082 Ga0209437_100004
2083 Ga0209437_100053
2084 Ga0209437_100234
2085 Ga0209437_103429
2086 Ga0209258_100022
2087 Ga0209258_100504
2088 Ga0209258_100720
2089 Ga0209258_100960
2090 Ga0207425_1000041
2091 Ga0207425_1000262
2092 Ga0207425_1001031
2093 Ga0207425_1002773
2094 Ga0207425_1004638
2095 Ga0207425_1010697
2096 Ga0209646_1000001
2097 Ga0209646_1000019
2098 Ga0209646_1000103
2099 Ga0209646_1000109
2100 Ga0209026_1000001
2101 Ga0209026_1000467
2102 Ga0209026_1005641
2103 Ga0209677_100005
2104 Ga0209677_101739
2105 Ga0209677_105152
2106 Ga0209677_109555
2107 Ga0209148_1000034
2108 Ga0209148_1000118
2109 Ga0209148_1002934
2110 Ga0209148_1006589
2111 Ga0209148_1016130
2112 Ga0209759_1000001
2113 Ga0209759_1000064
2114 Ga0209759_1000091
2115 Ga0209759_1001021
2116 Ga0209759_1001647
2117 Ga0209759_1004695
2118 Ga0209759_1022906
2119 Ga0209759_1029416
2120 Ga0209129_1000111
2121 Ga0209129_1000667
2122 Ga0209129_1004143
2123 Ga0209129_1005500
2124 Ga0209233_1000005
2125 Ga0209233_1016765
2126 Ga0209565_1000017
2127 Ga0209565_1000028
2128 Ga0209565_1000040
2129 Ga0209565_1000110
2130 Ga0209565_1000673
2131 Ga0209565_1021834
2132 Ga0209455_1000043
2133 Ga0209455_1000128
2134 Ga0209455_1001018
2135 Ga0209455_1005410
2136 Ga0209673_1000007
2137 Ga0209673_1000035
2138 Ga0209673_1000109
2139 Ga0209673_1000175
2140 Ga0209673_1000664
2141 Ga0209673_1000944
2142 Ga0209673_1008587
2143 Ga0209673_1046346
2144 Ga0209130_1000118
2145 Ga0209130_1000156
2146 Ga0209130_1000205
2147 Ga0209130_1000231
2148 Ga0209130_1000332
2149 Ga0209130_1001496
2150 Ga0209130_1005762
2151 Ga0209130_1027397
2152 Ga0209675_1000009
2153 Ga0209675_1000024
2154 Ga0209675_1000111
2155 Ga0209675_1000677
2156 Ga0209675_1001309
2157 Ga0209675_1002194
2158 Ga0209675_1004947
2159 Ga0209675_1005028
2160 Ga0209676_1000005
2161 Ga0209676_1000054
2162 Ga0209676_1000182
2163 Ga0209676_1000478
2164 Ga0209676_1001275
2165 Ga0209676_1001975
2166 Ga0209676_1003684
2167 Ga0209676_1030840
2168 Ga0209676_1040847
2169 Ga0209025_1000068
2170 Ga0209025_1000096
2171 Ga0209025_1000116
2172 Ga0209025_1000301
2173 Ga0209025_1000493
2174 Ga0209025_1002157
2175 Ga0209025_1009771
2176 Ga0209025_1010236
2177 Ga0209025_1027558
2178 Ga0209025_1039236
2179 Ga0209025_1089606
2180 Ga0209564_1000005
2181 Ga0209564_1000055
2182 Ga0209564_1000089
2183 Ga0209564_1000155
2184 Ga0209564_1000298
2185 Ga0209564_1001181
2186 Ga0209564_1001242
2187 Ga0209564_1002177
2188 Ga0209564_1045708
2189 Ga0209758_1000004
2190 Ga0209758_1000107
2191 Ga0209758_1000625
2192 Ga0209758_1011921
2193 Ga0209758_1012663
2194 Ga0209050_1000001
2195 Ga0209050_1000007
2196 Ga0209050_1000066
2197 Ga0209050_1001192
2198 Ga0209050_1002423
2199 Ga0209050_1004030
2200 Ga0209050_1004615
2201 Ga0209050_1006167
2202 Ga0209050_1046647
2203 Ga0209256_1000003
2204 Ga0209256_1000038
2205 Ga0209256_1000078
2206 Ga0209256_1000087
2207 Ga0209256_1000559
2208 Ga0209256_1001512
2209 Ga0209256_1002806
2210 Ga0207426_1000090
2211 Ga0207426_1000123
2212 Ga0207426_1000197
2213 Ga0207426_1001904
2214 Ga0209051_1000009
2215 Ga0209051_1000044
2216 Ga0209051_1000092
2217 Ga0209051_1000115
2218 Ga0209051_1000191
2219 Ga0209051_1000598
2220 Ga0209051_1001071
2221 Ga0209051_1010665
2222 Ga0209051_1022825
2223 Ga0209051_1023358
2224 Ga0209257_1000011
2225 Ga0209257_1000055
2226 Ga0209257_1000082
2227 Ga0209257_1000234
2228 Ga0209257_1000576
2229 Ga0209257_1000978
2230 Ga0209257_1001479
2231 Ga0209257_1004829
2232 Ga0209257_1005159
2233 Ga0209257_1005496
2234 Ga0207697_10016149
2235 Ga0207656_10006575
2236 Ga0207656_10070612
2237 Ga0207656_10084810
2238 Ga0207696_1010086
2239 Ga0207696_1060660
2240 Ga0207655_1000490
2241 Ga0207655_1001848
2242 Ga0207655_1032591
2243 Ga0207713_1023413
2244 Ga0207713_1043269
2245 Ga0207710_10000839
2246 Ga0207710_10138408
2247 Ga0207680_10011979
2248 Ga0207699_10282769
2249 Ga0207645_10004606
2250 Ga0207645_10074675
2251 Ga0207645_10085170
2252 Ga0207705_10000022
2253 Ga0207705_10011480
2254 Ga0207705_10054399
2255 Ga0207705_10058677
2256 Ga0207705_10225361
2257 Ga0207705_10232500
2258 Ga0207654_10000122
2259 Ga0207654_10072187
2260 Ga0207654_10111551
2261 Ga0207707_10020223
2262 Ga0207707_10768950
2263 Ga0207695_10000115
2264 Ga0207695_10002097
2265 Ga0207695_10002265
2266 Ga0207695_10009870
2267 Ga0207695_10075283
2268 Ga0207695_10075549
2269 Ga0207695_10662262
2270 Ga0207671_10000032
2271 Ga0207671_10003511
2272 Ga0207671_10030516
2273 Ga0207671_10148734
2274 Ga0207671_10187463
2275 Ga0207671_10306396
2276 Ga0207693_10001513
2277 Ga0207693_10052921
2278 Ga0207693_10164553
2279 Ga0207663_10026185
2280 Ga0207657_10009497
2281 Ga0207657_10027318
2282 Ga0207657_10031155
2283 Ga0207657_10074311
2284 Ga0207657_10090441
2285 Ga0207657_10337918
2286 Ga0207649_10000043
2287 Ga0207649_10001607
2288 Ga0207649_10011954
2289 Ga0207649_10014094
2290 Ga0207649_10084561
2291 Ga0207649_10545329
2292 Ga0207652_10000001
2293 Ga0207652_10000002
2294 Ga0207652_10010127
2295 Ga0207652_10351826
2296 Ga0207652_10730030
2297 Ga0207694_10000029
2298 Ga0207694_10000075
2299 Ga0207694_10044937
2300 Ga0207694_10223310
2301 Ga0207694_10355031
2302 Ga0207694_10801042
2303 Ga0207650_10001122
2304 Ga0207650_10001617
2305 Ga0207650_10031834
2306 Ga0207650_10408127
2307 Ga0207650_10410813
2308 Ga0207650_10568842
2309 Ga0207650_10599609
2310 Ga0207650_10958335
2311 Ga0207650_11044370
2312 Ga0207659_10000333
2313 Ga0207659_10000725
2314 Ga0207659_10022085
2315 Ga0207659_10144382
2316 Ga0207659_10167568
2317 Ga0207659_10204591
2318 Ga0207687_10001035
2319 Ga0207687_10030036
2320 Ga0207700_10051821
2321 Ga0207700_10070877
2322 Ga0207700_10089054
2323 Ga0207700_10372829
2324 Ga0207664_10021867
2325 Ga0207644_10000004
2326 Ga0207644_10002789
2327 Ga0207644_10003511
2328 Ga0207644_10037827
2329 Ga0207644_10047328
2330 Ga0207644_10072487
2331 Ga0207644_10074243
2332 Ga0207644_10106918
2333 Ga0207644_10240434
2334 Ga0207644_10510565
2335 Ga0207690_10001881
2336 Ga0207690_10004240
2337 Ga0207690_10017400
2338 Ga0207690_10068256
2339 Ga0207690_10076710
2340 Ga0207690_10283359
2341 Ga0207706_10003714
2342 Ga0207706_10388187
2343 Ga0207686_10001449
2344 Ga0207686_10039242
2345 Ga0207686_10169483
2346 Ga0207686_10275904
2347 Ga0207686_10328274
2348 Ga0207709_10000001
2349 Ga0207709_10000112
2350 Ga0207709_10001810
2351 Ga0207709_10108818
2352 Ga0207709_10239070
2353 Ga0207670_10228915
2354 Ga0207669_10103836
2355 Ga0207669_10174610
2356 Ga0207669_10301771
2357 Ga0207691_10002459
2358 Ga0207691_10005340
2359 Ga0207691_10102062
2360 Ga0207691_10221545
2361 Ga0207691_10270086
2362 Ga0207711_10008206
2363 Ga0207711_10011843
2364 Ga0207711_10030939
2365 Ga0207711_10873743
2366 Ga0207689_10002718
2367 Ga0207689_10023944
2368 Ga0207689_10031365
2369 Ga0207689_10079531
2370 Ga0207689_10197185
2371 Ga0207689_10563622
2372 Ga0207661_10001150
2373 Ga0207661_10112065
2374 Ga0207679_10000225
2375 Ga0207679_10018810
2376 Ga0207679_10077585
2377 Ga0207679_11066314
2378 Ga0207667_10000110
2379 Ga0207667_10003481
2380 Ga0207667_10004567
2381 Ga0207667_10005512
2382 Ga0207667_10009897
2383 Ga0207667_10090353
2384 Ga0207667_10350994
2385 Ga0207651_10027621
2386 Ga0207651_10067104
2387 Ga0207651_10076827
2388 Ga0207651_10178377
2389 Ga0207712_10009979
2390 Ga0207712_10174343
2391 Ga0207712_10304926
2392 Ga0207668_10162136
2393 Ga0207640_10002493
2394 Ga0207640_10008128
2395 Ga0207640_10319771
2396 Ga0207640_10328359
2397 Ga0207658_10001341
2398 Ga0207658_10010270
2399 Ga0207658_10053260
2400 Ga0207658_10353477
2401 Ga0207658_10422575
2402 Ga0207677_10000023
2403 Ga0207677_10003064
2404 Ga0207677_10012494
2405 Ga0207677_10041078
2406 Ga0207677_10087194
2407 Ga0207703_10002320
2408 Ga0207703_10071820
2409 Ga0207703_10212890
2410 Ga0207639_10024872
2411 Ga0207639_10089385
2412 Ga0207678_10001628
2413 Ga0207708_10107984
2414 Ga0207708_10226676
2415 Ga0207708_10236071
2416 Ga0207702_10001243
2417 Ga0207702_10189621
2418 Ga0207702_10221863
2419 Ga0207702_10620691
2420 Ga0207641_10000216
2421 Ga0207641_10000283
2422 Ga0207641_10056121
2423 Ga0207641_10125187
2424 Ga0207641_10477984
2425 Ga0207648_10000319
2426 Ga0207648_10000492
2427 Ga0207648_10029637
2428 Ga0207648_10035867
2429 Ga0207648_10152670
2430 Ga0207676_10001271
2431 Ga0207674_10022394
2432 Ga0207674_10184816
2433 Ga0207674_10362669
2434 Ga0207674_11079463
2435 Ga0207675_100007230
2436 Ga0207675_100712457
2437 Ga0207683_10005156
2438 Ga0207683_10006290
2439 Ga0207683_10036312
2440 Ga0207683_10099365
2441 Ga0207683_10121982
2442 Ga0207683_10407401
2443 Ga0207683_10984286
2444 Ga0207683_11314589
2445 Ga0207698_10000011
2446 Ga0207698_10002619
2447 Ga0207698_10003576
2448 Ga0207698_10063424
2449 Ga0207698_10127545
2450 Ga0207698_10152899
2451 Ga0207698_10169428
2452 Ga0207698_10174145
2453 Ga0207698_10225014
2454 Ga0207698_10522221
2455 Ga0209281_1000020
2456 Ga0209281_1009167
2457 Ga0209389_1007187
2458 Ga0209371_1000006
2459 Ga0209371_1018881
2460 Ga0209371_1023446
2461 Ga0209996_1000765
2462 Ga0209984_1014278
2463 Ga0209968_1000652
2464 Ga0209970_1000415
2465 Ga0209282_1000127
2466 Ga0209282_1123307
2467 Ga0209966_1000005
2468 Ga0209813_10002725
2469 Ga0209974_10029328
2470 Ga0209974_10053136
2471 Ga0268266_10538720
2472 Ga0268266_11042751
2473 Ga0268265_10003864
2474 Ga0268265_10084197
2475 Ga0268264_10000086
2476 Ga0268264_10001666
2477 Ga0268264_10233019
2478 Ga0268264_10977864
2479 Ga0268264_11198878
2480 Ga0265334_10026852
2481 Ga0307517_10097661
2482 Ga0307515_10000459
2483 Ga0307515_10001963
2484 Ga0307515_10014710
2485 Ga0307515_10026050
2486 Ga0307515_10033350
2487 Ga0307515_10123381
2488 Ga0307515_10238926
2489 Ga0265338_10290040
2490 Ga0265324_10018140
2491 Ga0268256_1000007
2492 Ga0268256_1025697
2493 Ga0268256_1026567
2494 Ga0307512_10113847
2495 Ga0307512_10310328
2496 Ga0316176_1081397
2497 Ga0314311_1026854
2498 Ga0316183_1152609
2499 Ga0316181_1185892
2500 Ga0265760_10021726
2501 Ga0265330_10000032
2502 Ga0265332_10000001
2503 Ga0265332_10000014
2504 Ga0265332_10008632
2505 Ga0265320_10006647
2506 Ga0265320_10025753
2507 Ga0265325_10017822
2508 Ga0265340_10071377
2509 Ga0265340_10072242
2510 Ga0265339_10229013
2511 Ga0265331_10013807
2512 Ga0265327_10000028
2513 Ga0265327_10000842
2514 Ga0265327_10009661
2515 Ga0265327_10011906
2516 Ga0265327_10025911
2517 Ga0265327_10153951
2518 Ga0265316_10004128
2519 Ga0307513_10000006
2520 Ga0307513_10000011
2521 Ga0307513_10000433
2522 Ga0307513_10008993
2523 Ga0307513_10141275
2524 Ga0307513_10177890
2525 Ga0307513_10221498
2526 Ga0307513_10354415
2527 Ga0307509_10000120
2528 Ga0307509_10060404
2529 Ga0307509_10100657
2530 Ga0307408_100000046
2531 Ga0307408_100000048
2532 Ga0307408_100005071
2533 Ga0307408_100005727
2534 Ga0307408_100012484
2535 Ga0307408_100027533
2536 Ga0307408_100049122
2537 Ga0307408_100154703
2538 Ga0307408_100241318
2539 Ga0307408_100281943
2540 Ga0307408_100374721
2541 Ga0307408_101257036
2542 Ga0307508_10000163
2543 Ga0307508_10078880
2544 Ga0307508_10120167
2545 Ga0307514_10000225
2546 Ga0307514_10024041
2547 Ga0265314_10000022
2548 Ga0265314_10014338
2549 Ga0265314_10027819
2550 Ga0265314_10187104
2551 Ga0307516_10000446
2552 Ga0307516_10003308
2553 Ga0307516_10004343
2554 Ga0307516_10005782
2555 Ga0307516_10014293
2556 Ga0307516_10076972
2557 Ga0307516_10137321
2558 Ga0307516_10210348
2559 Ga0307516_10325589
2560 Ga0307516_10579188
2561 Ga0307405_10042818
2562 Ga0307405_10108573
2563 Ga0307405_10749787
2564 Ga0307413_10001777
2565 Ga0307413_10095542
2566 Ga0307413_10337263
2567 Ga0307410_10169218
2568 Ga0307410_10280996
2569 Ga0307410_10428096
2570 Ga0307410_10490870
2571 Ga0307406_10000575
2572 Ga0307406_10003389
2573 Ga0307412_10001140
2574 Ga0307412_10003407
2575 Ga0307412_10053482
2576 Ga0307412_10113530
2577 Ga0307412_10368830
2578 Ga0307412_10487675
2579 Ga0307409_100309358
2580 Ga0307409_100380848
2581 Ga0307416_100010513
2582 Ga0307416_100293906
2583 Ga0307416_100481892
2584 Ga0307416_100608617
2585 Ga0307414_10022421
2586 Ga0307414_10023710
2587 Ga0307414_10030245
2588 Ga0307414_10171863
2589 Ga0307411_10033683
2590 Ga0307411_10161100
2591 Ga0307411_10167987
2592 Ga0307411_10402030
2593 Ga0307411_11259227
2594 Ga0307415_100005526
2595 Ga0307415_100957934
2596 Ga0307507_10074397
2597 Ga0307507_10293737
2598 Ga0307510_10002394
2599 Ga0307510_10052763
2600 Ga0307510_10137639
2601 Ga0373926_0002266
2602 Ga0373936_0244956
2603 Ga0373939_0000004
2604 Ga0373939_0016008
2605 Ga0373939_0186460
2606 Ga0373941_0094452
2607 Ga0373945_0042844
2608 Ga0373957_0077988
2609 Ga0373960_0001434
2610 Ga0373943_0000102
2611 Ga0373943_0027135
2612 Ga0373946_0000763
2613 Ga0373946_0024658
2614 Ga0373946_0028107
2615 Ga0373955_0010364
2616 Ga0373924_0239035
2617 Ga0373931_0001005
2618 Ga0373935_0005950
2619 Ga0373935_0014152
2620 Ga0373927_0003194
2621 Ga0373927_0013278
2622 Ga0373927_0109177
2623 Ga0373933_0005427
2624 Ga0373947_0002970
2625 Ga0373947_0008316
2626 Ga0373937_0027556
2627 Ga0373925_0001514
2628 Ga0373925_0018543
2629 Ga0373925_0033277
2630 Ga0395899_0001751
2631 Ga0395899_0003063
2632 Ga0395899_0011805
2633 Ga0395899_0032509
2634 Ga0395899_0033535
2635 Ga0395900_0008788
2636 Ga0395900_0009935
2637 Ga0395900_0012770
2638 Ga0395900_0029682
2639 Ga0395900_0079898
2640 Ga0395900_0086114
2641 Ga0395900_0120862
2642 Ga0395900_0130517
2643 Ga0395900_0268895
2644 Ga0395900_0437272
2645 Ga0395900_0449471
2646 Ga0395900_0474203
2647 Ga0395898_0000337
2648 Ga0395898_0014216
2649 Ga0395898_0184649
2650 Ga0395898_0390742
2651 Ga0395905_0000249
2652 Ga0395905_0000416
2653 Ga0395905_0000704
2654 Ga0395905_0003638
2655 Ga0395905_0012379
2656 Ga0395905_0018706
2657 Ga0395905_0024829
2658 Ga0395905_0052002
2659 Ga0395905_0074093
2660 Ga0395905_0087681
2661 Ga0395905_0090163
2662 Ga0395905_0185233
2663 Ga0395905_0261590
2664 Ga0395905_0336830
2665 Ga0436364_0543976
2666 Ga0436364_1388333
2667 Ga0395901_0003716
2668 Ga0395901_0037770
2669 Ga0395901_0044289
2670 Ga0395901_0077228
2671 Ga0395901_0157318
2672 Ga0395901_0311600
2673 Ga0395901_1125135
2674 Ga0436365_0267961
2675 Ga0436365_0442834
2676 Ga0436365_1653741
2677 Ga0436361_0120947
2678 Ga0436361_0174260
2679 Ga0436361_0287651
2680 Ga0436361_0292057
2681 Ga0436361_0360722
2682 Ga0436361_0457180
2683 Ga0436361_0727856
2684 Ga0436361_0810743
2685 Ga0436361_0829339
2686 Ga0436361_0850691
2687 Ga0436361_0939166
2688 Ga0439436_0051941
2689 Ga0439438_042417
2690 Ga0439439_0041034
2691 Ga0439439_0068984
2692 Ga0439447_051123
2693 Ga0439465_0001001
2694 Ga0451793_0331504
2695 Ga0451802_0500530
2696 Ga0451837_0453168
2697 Ga0439431_0000135
2698 Ga0439433_0005311
2699 Ga0439448_0134225
2700 Ga0439432_099548
2701 Ga0439449_0002755
2702 Ga0439449_0011957
2703 Ga0439451_000253
2704 Ga0439456_015159
2705 Ga0439462_0042294
2706 Ga0450911_000860
2707 Ga0450915_006225
2708 Ga0450917_001159
2709 Ga0450888_000211
2710 Ga0450890_002103
2711 Ga0450890_002841
2712 Ga0450891_002311
2713 Ga0450892_000342
2714 Ga0450898_008464
2715 Ga0450889_000406
2716 Ga0439434_0030089
2717 Ga0439459_0000732
2718 Ga0439464_0009922
2719 Ga0450893_0003052
2720 Ga0450893_0027811
2721 Ga0451577_0007579
2722 Ga0451577_0012178
2723 Ga0451577_0014424
2724 Ga0451577_0254152
2725 Ga0466969_0014612
2726 Ga0453683_0001511
2727 Ga0453683_0040629
2728 Ga0453683_0151115
2729 Ga0466965_0004319
2730 Ga0466966_0016505
2731 Ga0466966_0058836
2732 Ga0466966_0075667
2733 Ga0466966_0153289
2734 Ga0466961_0013324
2735 Ga0466961_0116803
2736 Ga0466961_0196671
2737 Ga0453684_0000126
2738 Ga0453684_0713817
2739 Ga0466957_0109818
2740 Ga0466960_0266513
2741 Ga0466959_0065867
2742 Ga0466959_0097689
2743 Ga0451576_0009548
2744 Ga0451576_0030419
2745 Ga0451576_0065938
2746 Ga0466967_0066727
2747 Ga0495592_0005124
2748 Ga0495592_0033858
2749 Ga0495603_0012974
2750 Ga0495603_0030464
2751 Ga0495629_0001156
2752 Ga0495629_0052790
2753 Ga0495629_0080113
2754 Ga0495651_0000976
2755 Ga0495651_0014296
2756 Ga0495651_0056416
2757 Ga0495653_0002352
2758 Ga0495653_0007349
2759 Ga0495653_0036253
2760 Ga0495650_0000224
2761 Ga0495650_0047032
2762 Ga0495580_0095758
2763 Ga0495582_0158586
2764 Ga0495582_0400906
2765 Ga0495639_0003038
2766 Ga0495639_0011256
2767 Ga0495662_0001205
2768 Ga0495664_0000600
2769 Ga0495664_0187161
2770 Ga0495584_0088564
2771 Ga0495585_0000102
2772 Ga0495585_0004598
2773 Ga0495585_0007926
2774 Ga0495594_0005917
2775 Ga0495594_0028138
2776 Ga0495594_0120239
2777 Ga0495607_0008021
2778 Ga0495607_0021370
2779 Ga0495583_0000127
2780 Ga0495606_0000001
2781 Ga0495606_0008822
2782 Ga0495608_0002654
2783 Ga0495608_0004989
2784 Ga0495608_0307865
2785 Ga0495610_0004596
2786 Ga0495610_0011303
2787 Ga0495616_0000184
2788 Ga0495616_0005947
2789 Ga0495616_0094813
2790 Ga0495618_0005805
2791 Ga0495618_0029268
2792 Ga0495618_0131487
2793 Ga0495618_0284887
2794 Ga0495620_0048787
2795 Ga0495628_0008815
2796 Ga0495628_0013432
2797 Ga0495628_0125817
2798 Ga0495628_0483126
2799 Ga0495630_0005764
2800 Ga0495630_0031440
2801 Ga0495630_0670853
2802 Ga0495632_0000081
2803 Ga0495632_0030420
2804 Ga0495632_0030570
2805 Ga0495637_0023019
2806 Ga0495643_0000630
2807 Ga0495643_0001320
2808 Ga0495643_0056018
2809 Ga0495643_0126760
2810 Ga0495648_0061322
2811 Ga0495648_0085982
2812 Ga0495663_0033616
2813 Ga0495666_0030665
2814 Ga0495642_0002999
2815 Ga0495652_0004595
2816 Ga0495652_0019591
2817 Ga0495652_0023823
2818 Ga0495652_0027916
2819 Ga0495652_0092105
2820 Ga0495665_0016891
2821 Ga0495665_0136570
2822 Ga0495640_0002848
2823 Ga0495640_0003109
2824 Ga0495640_0093329
2825 Ga0495586_0036434
2826 Ga0495586_0307160
2827 Ga0495587_0000911
2828 Ga0495587_0051847
2829 Ga0495609_0000039
2830 Ga0495621_0045216
2831 Ga0495621_0119144
2832 Ga0495597_0000251
2833 Ga0495597_0000514
2834 Ga0495597_0002116
2835 Ga0495645_0010920
2836 Ga0495645_0036308
2837 Ga0495645_0072307
2838 Ga0495645_0169277
2839 Ga0495645_0289206
2840 Ga0495622_0011733
2841 Ga0495633_0001747
2842 Ga0495633_0002178
2843 Ga0495633_0066789
2844 Ga0495667_0013049
2845 Ga0495656_0000072
2846 Ga0495668_0000285
2847 Ga0495668_0001521
2848 Ga0495634_0004529
2849 Ga0495634_0014172
2850 Ga0495634_0054769
2851 Ga0495611_0006200
2852 Ga0495611_0167124
2853 Ga0495625_0000877
2854 Ga0495625_0023894
2855 Ga0495625_0027726
2856 Ga0495625_0054015
2857 Ga0495625_0112635
2858 Ga0495635_0014561
2859 Ga0495635_0025468
2860 Ga0495635_0033601
2861 Ga0495635_0043108
2862 Ga0495635_0187482
2863 Ga0495635_0409522
2864 Ga0495659_0011166
2865 Ga0495661_0000094
2866 Ga0495661_0021839
2867 Ga0495661_0035155
2868 Ga0495661_0049153
2869 Ga0495588_0054750
2870 Ga0495588_0095435
2871 Ga0495657_0139398
2872 Ga0495599_0021832
2873 Ga0495623_0003590
2874 Ga0495623_0015491
2875 Ga0495623_0047779
2876 Ga0495646_0001661
2877 Ga0495646_0002551
2878 Ga0495646_0066311
2879 Ga0495646_0279299
2880 Ga0495658_0025453
2881 Ga0495658_0228703
2882 Ga0495669_0000164
2883 Ga0495613_0023024
2884 Ga0495613_0026725
2885 Ga0495624_0004448
2886 Ga0495624_0005580
2887 Ga0495670_0038087
2888 Ga0495649_0001564
2889 Ga0495649_0121797
2890 Ga0495589_0000019
2891 Ga0495589_0001712
2892 Ga0495589_0110138
2893 Ga0495600_0003478
2894 Ga0495600_0006775
2895 Ga0495660_0090374
2896 Ga0495581_0087492
2897 Ga0495581_0272960
2898 Ga0495604_0001863
2899 Ga0495604_0013119
2900 Ga0495604_0030390
2901 Ga0495604_0255656
2902 Ga0495604_0344532
2903 Ga0495636_0012076
2904 Ga0495674_0001578
2905 Ga0495674_0004086
2906 Ga0495674_0025320
2907 Ga0495672_0001684
2908 Ga0495672_0018332
2909 Ga0495672_0021435
2910 Ga0495676_0007228
2911 Ga0495676_0007289
2912 Ga0495676_0016920
2913 Ga0495676_0100509
2914 Ga0495676_0316428
2915 Ga0495680_0003432
2916 Ga0495680_0041286
2917 Ga0495683_0139536
2918 Ga0495687_000059
2919 Ga0495687_011487
2920 Ga0495675_0103322
2921 Ga0495675_0286106
2922 Ga0495677_0000006
2923 Ga0495685_013611
2924 Ga0495681_0003047
2925 Ga0495681_0064113
2926 Ga0495684_0013069
2927 Ga0495684_0021915
2928 Ga0495686_0006497
2929 Ga0495686_0010836
2930 Ga0495686_0017129
2931 Ga0495593_0090265
2932 Ga0495602_0006678
2933 Ga0495602_0029352
2934 Ga0495614_0006650
2935 Ga0495626_0000494
2936 Ga0495626_0000821
2937 Ga0495626_0001165
2938 Ga0495626_0001278
2939 Ga0496101_0009683
2940 Ga0496102_0037805
2941 Ga0496102_0946470
2942 Ga0496102_0997117
2943 Ga0496103_0032658
2944 Ga0496103_0170893
2945 Ga0496104_0003204
2946 Ga0496104_0086164
2947 Ga0496104_0157257
2948 Ga0496104_0305695
2949 Ga0496105_0003462
2950 Ga0496105_0025378
2951 Ga0496105_0072207
2952 Ga0496105_0093421
2953 Ga0496107_0020407
2954 Ga0496107_0521993
2955 Ga0496107_0728200
2956 Ga0496108_0114489
2957 Ga0496108_0309879
2958 Ga0496109_0100430
2959 Ga0496109_0337033
2960 Ga0496110_0054927
2961 Ga0496110_0907212
2962 Ga0496111_0030956
2963 Ga0496111_0044917
2964 Ga0496112_0150025
2965 Ga0496112_0213950
2966 Ga0496113_0012960
2967 Ga0496114_0686916
2968 Ga0496115_0284153
2969 Ga0496116_0033181
2970 Ga0496116_0036895
2971 Ga0496116_0052530
2972 Ga0496117_0024823
2973 Ga0496118_0011398
2974 Ga0496119_0012065
2975 Ga0496119_0018999
2976 Ga0496121_0000567
2977 Ga0496121_0006746
2978 Ga0496121_0012939
2979 Ga0496121_0026546
2980 Ga0496121_0028452
2981 Ga0496121_0036698
2982 Ga0496121_0167049
2983 Ga0496122_0000644
2984 Ga0496122_0005337
2985 Ga0496122_0196473
2986 Ga0496123_0000057
2987 Ga0496123_0000203
2988 Ga0496123_0034513
2989 Ga0496124_0000024
2990 Ga0496124_0034858
2991 Ga0496124_0081990
2992 Ga0496124_0298057
2993 Ga0496125_0000011
2994 Ga0496125_0033728
2995 Ga0495678_001541
2996 Ga0501031_0004268
2997 Ga0501032_0001868
2998 Ga0501032_0271036
2999 Ga0501032_0409307
3000 Ga0501033_0000491
3001 Ga0501033_0014446
3002 Ga0501034_0165962
3003 Ga0501034_0273556
3004 Ga0501034_0462341
3005 Ga0501036_0000389
3006 Ga0501036_0178885
3007 Ga0501037_0001552
3008 Ga0501037_0003775
3009 Ga0501037_0142292
3010 Ga0501038_0000414
3011 Ga0501038_0026046
3012 Ga0501038_0348534
3013 Ga0501043_0015683
3014 Ga0501043_0222465
3015 Ga0501046_0028661
3016 Ga0501047_0007765
3017 Ga0501047_0019806
3018 Ga0501076_0347967
3019 Ga0501198_000021
3020 Ga0501222_000018
3021 Ga0501257_003248
3022 Ga0501229_013039
3023 Ga0501080_0787502
3024 Ga0501241_004893
3025 Ga0501035_0002711
3026 Ga0501035_0010322
3027 Ga0501035_0015605
3028 Ga0501035_0100847
3029 Ga0501044_0001056
3030 Ga0501044_0001117
3031 Ga0501044_0005223
3032 Ga0501044_0032525
3033 Ga0501044_0043140
3034 nmdc:mga03683_1332_c1
3035 nmdc:mga03683_81758_c1
3036 nmdc:mga03n38_8009_c1
3037 nmdc:mga00v17_114337_c1
3038 nmdc:mga00v17_7626_c1
3039 nmdc:mga0yw44_10267_c1
3040 nmdc:mga0k408_119132_c1
3041 nmdc:mga0k408_32769_c1
3042 nmdc:mga0k408_5324_c1
3043 nmdc:mga06z11_16406_c1
3044 nmdc:mga04h51_2254_c1
3045 nmdc:mga07m45_3456_c1
3046 nmdc:mga07m45_81165_c1
3047 Ga0495601_0001015
3048 Ga0495601_0062988
3049 Ga0495601_0164118
3050 Ga0495601_0277200
3051 Ga0495612_0000523
3052 Ga0495612_0142801
3053 Ga0495595_0000244
3054 Ga0495619_0001492
3055 Ga0495619_0007733
3056 Ga0495619_0216970
3057 Ga0495619_0416771
3058 Ga0500643_002719
3059 Ga0500643_004495
3060 Ga0500644_0008465
3061 Ga0500644_0118860
3062 Ga0500583_0019278
3063 Ga0500651_0000052
3064 Ga0500566_0090743
3065 Ga0500566_0221184
3066 Ga0500594_0028715
3067 Ga0500594_0094382
3068 Ga0500607_000003
3069 Ga0500608_000074
3070 Ga0500608_135974
3071 Ga0500618_001117
3072 Ga0500626_073827
3073 Ga0500655_000281
3074 Ga0500658_0000033
3075 Ga0500658_0000040
3076 Ga0500559_0000011
3077 Ga0500559_0000400
3078 Ga0500559_0006122
3079 Ga0500568_0004186
3080 Ga0500568_0006369
3081 Ga0500573_0005745
3082 Ga0500574_000287
3083 Ga0500574_066915
3084 Ga0500590_001152
3085 Ga0500604_0000025
3086 Ga0500604_0007438
3087 Ga0500616_0000254
3088 Ga0500616_0219060
3089 Ga0500619_000035
3090 Ga0500622_0013799
3091 Ga0500622_0017687
3092 Ga0500622_0018708
3093 Ga0500645_002612
3094 Ga0590075_036627
3095 Ga0590077_033052
3096 Ga0587084_048259
3097 Ga0587088_008258
3098 Ga0587092_019830
3099 Ga0587098_014045
3100 Ga0587072_003368
3101 Ga0466962_0009549
3102 2511248470
3103 2511385044
3104 2521560555
3105 2553005660
3106 2596375848
3107 2599903268
3108 2600197984
3109 2601669708
3110 2640734230
3111 2643790602
3112 2643799913
3113 2643862236
3114 2643866594
3115 2643980737
3116 2644028954
3117 2644087942
3118 2644122162
3119 2644207495
3120 2644225910
3121 2644235399
3122 2644253376
3123 2644296352
3124 2644344171
3125 2644355576
3126 2644367299
3127 2644474914
3128 2644651244
3129 2644675278
3130 2678231208
3131 2738737303
3132 2738830074
3133 2738841524
3134 2739153870
3135 2739195790
3136 2739272395
3137 2739322266
3138 2739340507
3139 2739341439
3140 2739612225
3141 2739790265
3142 2765571806
3143 2774388237
3144 2808982188
3145 2809031946
3146 2809130012
3147 2809146730
3148 2809148933
3149 2819539152
3150 2819540680
3151 2819593496
3152 2819617248
3153 2819648334
3154 2821132013
3155 2839098473
3156 2842712744
3157 2852619069
3158 2855734543
3159 2855770133
3160 2856294109
3161 2857366272
3162 2857538428
3163 2857545256
3164 2857551225
3165 2857557717
3166 2857563989
3167 2857568532
3168 2857578636
3169 2858955689
3170 2881104189
3171 2881414347
3172 2881930324
3173 2884812569
3174 2884816163
3175 2884839394
3176 2884840030
3177 2884856796
3178 2884857202
3179 2887377920
3180 2896157789
3181 2896158142
3182 2896256048
3183 2896430966
3184 2902331375
3185 2902408447
3186 2904442886
3187 2904481859
3188 2904534918
3189 2904588743
3190 2904594183
3191 2904604979
3192 2916699728
3193 2919048618
3194 2919083212
3195 2919184125
3196 2919480296
3197 2923514333
3198 2928125394
3199 2928133069
3200 2932413194
3201 2932417255
3202 2939632171
3203 2941481975
3204 2952255615
3205 8002394976
3206 8047673309
3207 8048749800
3208 8055227904

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

5

204

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k6m-assembly2.cif.gz_C dynamic domains of succinyl-coa:3-ketoacid-coenzyme a transferase from pig heart. 0.9195 12 217
3oxo-assembly3.cif.gz_E succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa 0.915 15 217
3oxo-assembly3.cif.gz_F succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa 0.9148 15 217
3oxo-assembly4.cif.gz_H succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa 0.9134 18 217
3oxo-assembly4.cif.gz_G succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa 0.9095 15 217
ID Description Score Start End Superfamily
5dbnD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8831 10 216 3.40.1080.10
2nrcB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8684 12 217 3.40.1080.10
5dbnD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8407 10 216 3.40.1080.10
1o9lB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8376 10 217 3.40.1080.10
2nrcB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8279 12 217 3.40.1080.10
ID Description Score Start End GO Terms
AF-A0A2N3DP54-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9986 138 218 GO:0008410
AF-A0A2N3DP54-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9746 138 218 GO:0008410
AF-A0A352H4X5-F1-model_v4 deleted 0.9648 98 217
AF-A0A5A4WCF4-F1-model_v4 deleted 0.9418 98 217
AF-A0A3D4T0Q5-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9404 102 217 GO:0008410
GO:0016787

Map