F495016

General Info

Members Datasets Scaffolds Average Seq Length
1605 1143 3210 235

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10039093|rootH1_100390935
Length 236
Sequence LRNRKAELXGLDNRADRIIEIGGIELFNHFPTGKTLHIYINPGDRKVHPDALAVHGITDEFLADKPPFETVVDQILEFFGDAKWIAHNATFDMGFVNAEFARLGRPPILPDMVIDTLAMARRKHPMGPNSLDALCRRYGIDNSHRTKHGALLDSELLAEVYIEMIGGRQTALGLGSATGSSMRSRQNDLVEEVVVDIFARPAPLPGRLTEEELAAHAALVAKLGAKGIWSKYSASE

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
29 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
57 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
68 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
81 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
82 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
83 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
84 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
85 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
86 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
87 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
88 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
89 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
93 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
94 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
95 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
96 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
99 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
137 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
139 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
152 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
163 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
164 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
165 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
166 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
167 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
168 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
169 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
170 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
171 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
172 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
173 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
174 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
175 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
178 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
179 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
180 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
181 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
182 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
183 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
184 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
190 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
191 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
192 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
193 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
194 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
197 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
198 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
199 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
200 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
203 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
204 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
205 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
206 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
211 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
212 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
213 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
214 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
219 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
220 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
221 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
222 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
223 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
224 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
234 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
235 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
236 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
237 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
240 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
241 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
245 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
260 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
261 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
262 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
263 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
264 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
265 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
266 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
269 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
274 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
275 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
276 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
277 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
278 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
279 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
280 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
281 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
282 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
283 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
284 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
285 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
286 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
287 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
288 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
289 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
290 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
291 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
292 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
293 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
294 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
295 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
296 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
297 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
298 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
299 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
300 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
301 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
302 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
303 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
304 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
305 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
306 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
307 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
308 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
309 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
310 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
311 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
312 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
313 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
314 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
315 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
316 2509276019 Ensifer aridi TW10 Isolate Nodule
317 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
318 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
319 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
320 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
321 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
322 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
323 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
324 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
325 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
326 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
327 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
328 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
329 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
330 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
331 2512875024
332 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
333 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
334 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
335 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
336 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
337 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
338 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
339 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
340 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
341 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
342 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
343 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
344 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
345 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
346 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
347 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
348 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
349 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
350 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
351 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
352 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
353 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
354 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
355 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
356 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
357 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
358 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
359 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
360 2516143018 Ensifer sp. BR816 Isolate Nodule
361 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
362 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
363 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
364 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
365 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
366 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
367 2519899620 Rhizobium sp. Pop5 Isolate Nodule
368 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
369 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
370 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
371 2534681786 Brucella suis 92/29 Isolate Unclassified
372 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
373 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
374 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
375 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
376 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
377 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
378 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
379 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
380 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
381 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
382 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
383 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
384 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
385 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
386 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
387 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
388 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
389 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
390 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
391 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
392 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
393 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
394 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
395 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
396 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
397 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
398 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
399 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
400 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
401 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
402 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
403 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
404 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
405 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
406 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
407 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
408 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
409 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
410 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
411 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
412 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
413 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
414 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
415 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
416 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
417 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
418 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
419 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
420 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
421 2643221557 Ensifer sp. Root558 Isolate Unclassified
422 2643221558 Rhizobium sp. Root149 Isolate Unclassified
423 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
424 2643221568 Rhizobium sp. Root564 Isolate Unclassified
425 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
426 2643221599 Rhizobium sp. Root708 Isolate Unclassified
427 2643221607 Rhizobium sp. Root73 Isolate Unclassified
428 2643221610 Ensifer sp. Root74 Isolate Unclassified
429 2643221618 Ensifer sp. Root231 Isolate Unclassified
430 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
431 2643221626 Ensifer sp. Root31 Isolate Unclassified
432 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
433 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
434 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
435 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
436 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
437 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
438 2643221655 Ensifer sp. Root1252 Isolate Unclassified
439 2643221659 Ensifer sp. Root127 Isolate Unclassified
440 2643221668 Ensifer sp. Root423 Isolate Unclassified
441 2643221675 Ensifer sp. Root1298 Isolate Unclassified
442 2643221680 Ensifer sp. Root1312 Isolate Unclassified
443 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
444 2643221688 Rhizobium sp. Root482 Isolate Unclassified
445 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
446 2643221693 Rhizobium sp. Root491 Isolate Unclassified
447 2643221698 Ensifer sp. Root142 Isolate Unclassified
448 2643221712 Ensifer sp. Root258 Isolate Unclassified
449 2643221718 Rhizobium sp. Root268 Isolate Unclassified
450 2643221719 Rhizobium sp. Root274 Isolate Unclassified
451 2643221723 Ensifer sp. Root278 Isolate Unclassified
452 2643221726 Ensifer sp. Root954 Isolate Unclassified
453 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
454 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
455 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
456 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
457 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
458 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
459 2718217882 Rhizobium sp. N741 Isolate Nodule
460 2718217927 Rhizobium sp. N324 Isolate Nodule
461 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
462 2718218009 Rhizobium sp. N561 Isolate Nodule
463 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
464 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
465 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
466 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
467 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
468 2718218363 Rhizobium sp. N113 Isolate Nodule
469 2718218365 Rhizobium sp. N731 Isolate Nodule
470 2718218366 Rhizobium sp. N621 Isolate Nodule
471 2718218423 Rhizobium sp. N941 Isolate Nodule
472 2721755514 Rhizobium sp. N6212 Isolate Nodule
473 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
474 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
475 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
476 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
477 2721755809 Rhizobium sp. N541 Isolate Nodule
478 2721755810 Rhizobium sp. N871 Isolate Nodule
479 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
480 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
481 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
482 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
483 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
484 2728369365 Rhizobium sp. N1341 Isolate Nodule
485 2728369397 Rhizobium sp. N1314 Isolate Nodule
486 2738541293 Rhizobium sp. GV031 Isolate Unclassified
487 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
488 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
489 2738543024 Aminobacter sp. AP02 Isolate Unclassified
490 2751185800 Brucella pituitosa AA2 Isolate Unclassified
491 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
492 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
493 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
494 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
495 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
496 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
497 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
498 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
499 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
500 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
501 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
502 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
503 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
504 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
505 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
506 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
507 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
508 2791355256 Rhizobium sp. M10 Isolate Nodule
509 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
510 2791355260 Rhizobium sp. L9 Isolate Nodule
511 2791355261 Rhizobium sp. J15 Isolate Nodule
512 2791355262 Rhizobium sp. M1 Isolate Nodule
513 2791355263 Rhizobium chutanense C5 Isolate Nodule
514 2791355264 Rhizobium sp. S9 Isolate Nodule
515 2791355265 Rhizobium sp. H4 Isolate Nodule
516 2791355266 Rhizobium sp. L43 Isolate Nodule
517 2791355267 Rhizobium sp. L18 Isolate Nodule
518 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
519 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
520 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
521 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
522 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
523 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
524 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
525 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
526 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
527 2802429633 Rhizobium anhuiense J3 Isolate Nodule
528 2802429634 Rhizobium anhuiense S10 Isolate Nodule
529 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
530 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
531 2802429637 Rhizobium anhuiense C15 Isolate Nodule
532 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
533 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
534 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
535 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
536 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
537 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
538 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
539 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
540 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
541 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
542 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
543 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
544 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
545 2838048938 Rhizobium pisi 27/80 Isolate Nodule
546 2838061910 Rhizobium phaseoli L15 Isolate Nodule
547 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
548 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
549 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
550 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
551 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
552 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
553 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
554 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
555 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
556 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
557 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
558 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
559 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
560 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
561 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
562 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
563 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
564 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
565 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
566 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
567 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
568 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
569 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
570 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
571 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
572 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
573 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
574 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
575 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
576 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
577 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
578 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
579 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
580 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
581 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
582 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
583 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
584 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
585 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
586 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
587 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
588 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
589 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
590 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
591 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
592 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
593 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
594 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
595 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
596 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
597 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
598 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
599 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
600 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
601 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
602 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
603 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
604 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
605 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
606 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
607 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
608 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
609 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
610 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
611 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
612 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
613 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
614 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
615 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
616 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
617 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
618 2844163670 Ensifer sp. 1H6 Isolate Unclassified
619 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
620 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
621 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
622 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
623 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
624 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
625 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
626 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
627 2854911287 Brucella lupini LUP21 Isolate Unclassified
628 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
629 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
630 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
631 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
632 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
633 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
634 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
635 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
636 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
637 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
638 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
639 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
640 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
641 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
642 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
643 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
644 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
645 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
646 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
647 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
648 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
649 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
650 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
651 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
652 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
653 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
654 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
655 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
656 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
657 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
658 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
659 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
660 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
661 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
662 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
663 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
664 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
665 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
666 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
667 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
668 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
669 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
670 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
671 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
672 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
673 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
674 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
675 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
676 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
677 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
678 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
679 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
680 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
681 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
682 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
683 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
684 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
685 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
686 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
687 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
688 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
689 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
690 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
691 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
692 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
693 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
694 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
695 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
696 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
697 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
698 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
699 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
700 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
701 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
702 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
703 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
704 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
705 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
706 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
707 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
708 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
709 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
710 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
711 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
712 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
713 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
714 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
715 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
716 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
717 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
718 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
719 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
720 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
721 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
722 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
723 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
724 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
725 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
726 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
727 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
728 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
729 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
730 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
731 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
732 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
733 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
734 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
735 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
736 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
737 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
738 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
739 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
740 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
741 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
742 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
743 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
744 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
745 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
746 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
747 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
748 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
749 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
750 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
751 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
752 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
753 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
754 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
755 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
756 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
757 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
758 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
759 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
760 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
761 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
762 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
763 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
764 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
765 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
766 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
767 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
768 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
769 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
770 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
771 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
772 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
773 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
774 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
775 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
776 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
777 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
778 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
779 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
780 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
781 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
782 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
783 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
784 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
785 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
786 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
787 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
788 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
789 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
790 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
791 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
792 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
793 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
794 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
795 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
796 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
797 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
798 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
799 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
800 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
801 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
802 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
803 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
804 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
805 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
806 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
807 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
808 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
809 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
810 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
811 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
812 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
813 2933599457 Rhizobium phaseoli M3 Isolate Nodule
814 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
815 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
816 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
817 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
818 2936381700 Rhizobium chutanense C16 Isolate Unclassified
819 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
820 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
821 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
822 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
823 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
824 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
825 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
826 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
827 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
828 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
829 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
830 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
831 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
832 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
833 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
834 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
835 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
836 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
837 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
838 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
839 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
840 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
841 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
842 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
843 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
844 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
845 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
846 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
847 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
848 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
849 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
850 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
851 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
852 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
853 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
854 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
855 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
856 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
857 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
858 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
859 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
860 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
861 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
862 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
863 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
864 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
865 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
866 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
867 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
868 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
869 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
870 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
871 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
872 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
873 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
874 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
875 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
876 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
877 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
878 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
879 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
880 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
881 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
882 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
883 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
884 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
885 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
886 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
887 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
888 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
889 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
890 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
891 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
892 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
893 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
894 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
895 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
896 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
897 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
898 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
899 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
900 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
901 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
902 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
903 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
904 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
905 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
906 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
907 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
908 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
909 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
910 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
911 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
912 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
913 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
914 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
915 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
916 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
917 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
918 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
919 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
920 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
921 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
922 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
923 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
924 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
925 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
926 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
927 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
928 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
929 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
930 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
931 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
932 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
933 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
934 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
935 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
936 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
937 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
938 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
939 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
940 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
941 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
942 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
943 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
944 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
945 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
946 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
947 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
948 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
949 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
950 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
951 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
952 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
953 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
954 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
955 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
956 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
957 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
958 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
959 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
960 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
961 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
962 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
963 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
964 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
965 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
966 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
967 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
968 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
969 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
970 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
971 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
972 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
973 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
974 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
975 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
976 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
977 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
978 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
979 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
980 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
981 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
982 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
983 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
984 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
985 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
986 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
987 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
988 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
989 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
990 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
991 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
992 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
993 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
994 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
995 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
996 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
997 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
998 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
999 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
1000 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
1001 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
1002 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
1003 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
1004 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
1005 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
1006 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
1007 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
1008 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
1009 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
1010 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
1011 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
1012 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
1013 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
1014 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
1015 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
1016 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
1017 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
1018 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
1019 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
1020 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
1021 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
1022 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
1023 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
1024 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
1025 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
1026 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
1027 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
1028 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
1029 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
1030 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
1031 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
1032 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
1033 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
1034 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
1035 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
1036 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
1037 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
1038 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
1039 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
1040 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
1041 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
1042 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
1043 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
1044 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
1045 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
1046 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
1047 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
1048 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
1049 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
1050 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
1051 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
1052 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
1053 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
1054 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
1055 2996887358 Rhizobium sp. R711 Isolate Nodule
1056 2996893221 Rhizobium sp. R635 Isolate Nodule
1057 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
1058 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
1059 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
1060 3004167301 Mesorhizobium loti 582 Isolate Unclassified
1061 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
1062 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
1063 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
1064 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
1065 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
1066 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
1067 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
1068 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
1069 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
1070 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
1071 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
1072 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
1073 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
1074 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
1075 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
1076 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
1077 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1078 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1079 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1080 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1081 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1082 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1083 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1084 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1085 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1086 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1087 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1088 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1089 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1090 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1091 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1092 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1093 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1094 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1095 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1096 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1097 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1098 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1099 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1100 8005258706 Rhizobium sp. R693 Isolate Nodule
1101 8005275841 Rhizobium sp. N4311 Isolate Nodule
1102 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1103 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1104 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1105 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1106 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1107 8005321885 Rhizobium sp. R72 Isolate Nodule
1108 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1109 8005382845 Rhizobium sp. R634 Isolate Nodule
1110 8005395548 Rhizobium sp. R339 Isolate Nodule
1111 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1112 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1113 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1114 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1115 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1116 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1117 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1118 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1119 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1120 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1121 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1122 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1123 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1124 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1125 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1126 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1127 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1128 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1129 8018176218 Rhizobium sp. N122 Isolate Nodule
1130 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1131 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1132 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1133 8024501048 Rhizobium sp. H4 Isolate Nodule
1134 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1135 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1136 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1137 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1138 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1139 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1140 8056382006 Rhizobium croatiense 13T Isolate Nodule
1141 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1142 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1143 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 47.85
Metatranscriptomes 0.06
Isolates 52.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.77
Nodule 41.18
Rhizoplane 1.62
Rhizosphere 25.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10039093 3300003323 Bacteria 3732
2 JGI24740J21852_10006164 3300001979 Bacteria 5001
3 JGI24735J21928_10055750 3300002067 Bacteria 1138
4 JGI25155J39150_1000018 3300002704 Bacteria 157606
5 JGI25156J39149_1000055 3300002705 Bacteria 87733
6 JGI25162J39368_1000601 3300002737 Bacteria 25918
7 JGI25162J39368_1000903 3300002737 Bacteria 19226
8 JGI25154J39366_1000069 3300002738 Bacteria 96438
9 JGI25157J39369_1000076 3300002741 Bacteria 87678
10 JGI25157J39369_1001842 3300002741 Bacteria 6641
11 JGI25152J39213_1000169 3300002773 Bacteria 44325
12 JGI25152J39213_1000820 3300002773 Bacteria 15512
13 JGI25152J39213_1005058 3300002773 Bacteria 3968
14 JGI25152J39213_1008918 3300002773 Bacteria 2434
15 JGI25150J39212_1000018 3300002774 Bacteria 146535
16 JGI25159J45721_1000022 3300002987 Bacteria 119463
17 JGI25159J45721_1006609 3300002987 Bacteria 3446
18 JGI25151J46595_10000034 3300003187 Bacteria 192271
19 JGI25151J46595_10000879 3300003187 Bacteria 23723
20 JGI25151J46595_10004148 3300003187 Bacteria 7742
21 JGI25151J46595_10021299 3300003187 Bacteria 2715
22 JGI25165J46597_1000052 3300003214 Bacteria 236064
23 JGI25165J46597_1000974 3300003214 Bacteria 19236
24 JGI25165J46597_1001602 3300003214 Bacteria 10851
25 JGI25153J46596_10002149 3300003215 Bacteria 11526
26 JGI25153J46596_10005551 3300003215 Bacteria 6594
27 JGI25153J46596_10008231 3300003215 Bacteria 5011
28 rootH2_10246162 3300003320 Bacteria 1201
29 rootL2_10121384 3300003322 Bacteria 2007
30 rootL2_10149035 3300003322 Bacteria 3339
31 JGI25160J50197_1000051 3300003354 Bacteria 132923
32 JGI25160J50197_1000056 3300003354 Bacteria 119463
33 JGI25160J50197_1001318 3300003354 Bacteria 12528
34 JGI25160J50197_1015541 3300003354 Bacteria 2493
35 JGI25161J50226_1000011 3300003374 Bacteria 210140
36 JGI25161J50226_1000451 3300003374 Bacteria 19047
37 JGI25161J50226_1008186 3300003374 Bacteria 1637
38 Ga0006562J51391_1007063 3300003578 Bacteria 5235
39 Ga0055542_1000284 3300003762 Bacteria 56677
40 Ga0055526_1000992 3300003771 Bacteria 20826
41 Ga0055526_1001114 3300003771 Bacteria 19551
42 Ga0055526_1008790 3300003771 Bacteria 4974
43 Ga0055526_1010174 3300003771 Bacteria 4409
44 Ga0055524_1000962 3300003775 Bacteria 18149
45 Ga0055524_1001562 3300003775 Bacteria 12886
46 Ga0055524_1018402 3300003775 Bacteria 2427
47 Ga0055524_1033601 3300003775 Bacteria 1433
48 Ga0055536_1006175 3300003781 Bacteria 5660
49 Ga0055528_1000452 3300003790 Bacteria 32857
50 Ga0055528_1001012 3300003790 Bacteria 18669
51 Ga0055528_1007110 3300003790 Bacteria 4997
52 Ga0055528_1032358 3300003790 Bacteria 1337
53 Ga0055530_10035600 3300003791 Bacteria 1261
54 Ga0055540_1000597 3300003792 Bacteria 26126
55 Ga0055540_1002326 3300003792 Bacteria 10178
56 Ga0055540_1006982 3300003792 Bacteria 4360
57 Ga0055540_1034698 3300003792 Bacteria 1133
58 Ga0055531_10001167 3300003794 Bacteria 20222
59 Ga0055531_10009790 3300003794 Bacteria 4859
60 Ga0055531_10038238 3300003794 Bacteria 1443
61 Ga0058692_1001407 3300003856 Bacteria 8879
62 Ga0055543_1000041 3300004625 Bacteria 118501
63 Ga0055543_1000383 3300004625 Bacteria 28950
64 Ga0055543_1003469 3300004625 Bacteria 4636
65 Ga0065165_1000155 3300005262 Bacteria 119501
66 Ga0065165_1000303 3300005262 Bacteria 82513
67 Ga0065165_1003259 3300005262 Bacteria 11726
68 Ga0065165_1006555 3300005262 Bacteria 6064
69 Ga0065704_10111010 3300005289 Bacteria 1967
70 Ga0065715_10475619 3300005293 Bacteria 802
71 Ga0070658_10696390 3300005327 Bacteria 882
72 Ga0070670_100666642 3300005331 Bacteria 934
73 Ga0070666_10007959 3300005335 Bacteria 6554
74 Ga0070682_100528440 3300005337 Bacteria 919
75 Ga0070689_100578095 3300005340 Bacteria 971
76 Ga0070668_100175173 3300005347 Bacteria 1748
77 Ga0070688_100415242 3300005365 Bacteria 999
78 Ga0070667_100080147 3300005367 Bacteria 2792
79 Ga0070667_100686171 3300005367 Bacteria 947
80 Ga0070663_100025431 3300005455 Bacteria 3997
81 Ga0070665_100005296 3300005548 Bacteria 13322
82 Ga0070665_100025587 3300005548 Bacteria 5945
83 Ga0070665_100110656 3300005548 Bacteria 2749
84 Ga0070665_100129832 3300005548 Bacteria 2522
85 Ga0070665_100209258 3300005548 Bacteria 1951
86 Ga0070665_100302093 3300005548 Bacteria 1603
87 Ga0070665_100383989 3300005548 Bacteria 1412
88 Ga0068855_100160444 3300005563 Bacteria 2553
89 Ga0068857_100099313 3300005577 Bacteria 2611
90 Ga0068854_100152338 3300005578 Bacteria 1784
91 Ga0081539_10000690 3300005985 Bacteria 67656
92 Ga0075365_10001383 3300006038 Bacteria 10915
93 Ga0075365_10006283 3300006038 Bacteria 6519
94 Ga0075365_10021999 3300006038 Bacteria 3987
95 Ga0075365_10056247 3300006038 Bacteria 2614
96 Ga0075365_10110386 3300006038 Bacteria 1890
97 Ga0075365_10111458 3300006038 Bacteria 1880
98 Ga0075365_10171604 3300006038 Bacteria 1514
99 Ga0075368_10038661 3300006042 Bacteria 1868
100 Ga0075368_10095444 3300006042 Bacteria 1218
101 Ga0075363_100059964 3300006048 Bacteria 2047
102 Ga0075364_10000055 3300006051 Bacteria 41950
103 Ga0075364_10007112 3300006051 Bacteria 6617
104 Ga0075364_10135744 3300006051 Bacteria 1652
105 Ga0075364_10201122 3300006051 Bacteria 1350
106 Ga0075362_10029246 3300006177 Bacteria 2373
107 Ga0075362_10053779 3300006177 Bacteria 1808
108 Ga0075362_10219997 3300006177 Bacteria 928
109 Ga0075367_10000616 3300006178 Bacteria 13639
110 Ga0075367_10018532 3300006178 Bacteria 3843
111 Ga0075367_10040834 3300006178 Bacteria 2710
112 Ga0075367_10187419 3300006178 Bacteria 1290
113 Ga0075367_10430036 3300006178 Bacteria 836
114 Ga0075369_10027546 3300006186 Bacteria 2376
115 Ga0075369_10093631 3300006186 Bacteria 1342
116 Ga0075369_10238633 3300006186 Bacteria 843
117 Ga0075366_10147346 3300006195 Bacteria 1425
118 Ga0075370_10002288 3300006353 Bacteria 8836
119 Ga0075370_10030861 3300006353 Bacteria 2991
120 Ga0075370_10123948 3300006353 Bacteria 1505
121 Ga0075370_10161993 3300006353 Bacteria 1313
122 Ga0075370_10189824 3300006353 Bacteria 1210
123 Ga0079104_1000310 3300006946 Bacteria 61815
124 Ga0099826_10000813 3300006948 Bacteria 16761
125 Ga0105251_10004120 3300009011 Bacteria 10148
126 Ga0105240_10000142 3300009093 Bacteria 146932
127 Ga0105240_10086359 3300009093 Bacteria 3842
128 Ga0105247_10469224 3300009101 Bacteria 911
129 Ga0105243_10803631 3300009148 Bacteria 927
130 Ga0105241_10427610 3300009174 Bacteria 1167
131 Ga0105241_10888833 3300009174 Bacteria 827
132 Ga0105248_10042433 3300009177 Bacteria 5101
133 Ga0105248_10648799 3300009177 Bacteria 1191
134 Ga0105237_10026327 3300009545 Bacteria 5944
135 Ga0105237_10045097 3300009545 Bacteria 4438
136 Ga0105238_10005000 3300009551 Bacteria 13106
137 Ga0105238_10348810 3300009551 Bacteria 1469
138 Ga0105249_10878300 3300009553 Bacteria 963
139 Ga0123341_1000071 3300009765 Bacteria 43545
140 Ga0123341_1030290 3300009765 Bacteria 4086
141 Ga0123342_1017422 3300009766 Bacteria 5975
142 Ga0123342_1020734 3300009766 Bacteria 4744
143 Ga0105239_10189932 3300010375 Bacteria 2299
144 Ga0105246_10120726 3300011119 Bacteria 1942
145 Ga0157373_10132181 3300013100 Bacteria 1755
146 Ga0157373_10186282 3300013100 Bacteria 1462
147 Ga0157371_10000071 3300013102 Bacteria 164088
148 Ga0157371_10018404 3300013102 Bacteria 5166
149 Ga0157370_10000079 3300013104 Bacteria 107305
150 Ga0157370_10002835 3300013104 Bacteria 20731
151 Ga0157370_10013167 3300013104 Bacteria 8530
152 Ga0157369_10212209 3300013105 Bacteria 2029
153 Ga0157369_10223746 3300013105 Bacteria 1969
154 Ga0157369_10258496 3300013105 Bacteria 1816
155 Ga0157369_10413286 3300013105 Bacteria 1399
156 Ga0171463_1004 3300013249 Bacteria 437207
157 Ga0163162_10741260 3300013306 Bacteria 1102
158 Ga0157375_11368723 3300013308 Bacteria 833
159 Ga0157380_10336256 3300014326 Bacteria 1406
160 Ga0182008_10048871 3300014497 Bacteria 2100
161 Ga0182008_10082679 3300014497 Bacteria 1581
162 Ga0182007_10025218 3300015262 Bacteria 2072
163 Ga0182007_10030312 3300015262 Bacteria 1849
164 Ga0182005_1005736 3300015265 Bacteria 3852
165 Ga0183363_1217 3300015690 Bacteria 11179
166 Ga0214544_1000079 3300021320 Bacteria 121742
167 Ga0214542_1000064 3300021321 Bacteria 127681
168 Ga0214542_1025627 3300021321 Bacteria 3035
169 Ga0214543_1000015 3300021327 Bacteria 305679
170 Ga0214543_1000063 3300021327 Bacteria 127694
171 Ga0228711_1000030 3300022739 Bacteria 94546
172 Ga0228710_1000002 3300022740 Bacteria 287279
173 Ga0209435_100031 3300025206 Bacteria 164115
174 Ga0209436_100428 3300025208 Bacteria 18888
175 Ga0209672_109682 3300025228 Bacteria 1344
176 Ga0209563_102041 3300025230 Bacteria 4798
177 Ga0209437_100179 3300025233 Bacteria 134210
178 Ga0209437_100181 3300025233 Bacteria 132953
179 Ga0207425_1000035 3300025245 Bacteria 225942
180 Ga0207425_1036699 3300025245 Bacteria 949
181 Ga0207425_1043494 3300025245 Bacteria 846
182 Ga0209646_1000102 3300025246 Bacteria 164115
183 Ga0209646_1007221 3300025246 Bacteria 1824
184 Ga0209646_1011090 3300025246 Bacteria 1399
185 Ga0209026_1000096 3300025250 Bacteria 164115
186 Ga0209026_1000141 3300025250 Bacteria 114545
187 Ga0209677_100353 3300025253 Bacteria 28643
188 Ga0209148_1000111 3300025254 Bacteria 198095
189 Ga0209148_1011158 3300025254 Bacteria 1678
190 Ga0209759_1000090 3300025256 Bacteria 164115
191 Ga0209759_1000354 3300025256 Bacteria 59742
192 Ga0209759_1016766 3300025256 Bacteria 1835
193 Ga0209129_1000029 3300025258 Bacteria 401149
194 Ga0209129_1000050 3300025258 Bacteria 267408
195 Ga0209129_1000289 3300025258 Bacteria 48018
196 Ga0209129_1000826 3300025258 Bacteria 19503
197 Ga0209129_1011574 3300025258 Bacteria 2095
198 Ga0209233_1000118 3300025261 Bacteria 236172
199 Ga0209233_1000185 3300025261 Bacteria 133788
200 Ga0209233_1000212 3300025261 Bacteria 110364
201 Ga0209233_1000263 3300025261 Bacteria 79293
202 Ga0209233_1012079 3300025261 Bacteria 2518
203 Ga0209565_1031235 3300025263 Bacteria 1035
204 Ga0209455_1000206 3300025272 Bacteria 84430
205 Ga0209673_1000033 3300025273 Bacteria 335369
206 Ga0209673_1000050 3300025273 Bacteria 285287
207 Ga0209673_1000370 3300025273 Bacteria 81047
208 Ga0209673_1001329 3300025273 Bacteria 24789
209 Ga0209673_1003533 3300025273 Bacteria 9145
210 Ga0209673_1036722 3300025273 Bacteria 1449
211 Ga0209130_1000058 3300025284 Bacteria 210250
212 Ga0209130_1000133 3300025284 Bacteria 119561
213 Ga0209130_1014136 3300025284 Bacteria 2015
214 Ga0209675_1016811 3300025291 Bacteria 2114
215 Ga0209676_1004127 3300025292 Bacteria 8274
216 Ga0209676_1026346 3300025292 Bacteria 1848
217 Ga0209025_1000042 3300025294 Bacteria 370577
218 Ga0209025_1000132 3300025294 Bacteria 197432
219 Ga0209025_1000536 3300025294 Bacteria 71932
220 Ga0209025_1000815 3300025294 Bacteria 50019
221 Ga0209025_1001644 3300025294 Bacteria 27573
222 Ga0209025_1011082 3300025294 Bacteria 6006
223 Ga0209025_1016811 3300025294 Bacteria 4279
224 Ga0209025_1034273 3300025294 Bacteria 2322
225 Ga0209564_1000193 3300025295 Bacteria 141731
226 Ga0209564_1000227 3300025295 Bacteria 125497
227 Ga0209564_1001108 3300025295 Bacteria 31835
228 Ga0209564_1004168 3300025295 Bacteria 9034
229 Ga0209564_1007892 3300025295 Bacteria 5383
230 Ga0209564_1016233 3300025295 Bacteria 2978
231 Ga0209564_1025168 3300025295 Bacteria 2012
232 Ga0209758_1000299 3300025297 Bacteria 97367
233 Ga0209758_1000406 3300025297 Bacteria 73962
234 Ga0209758_1001221 3300025297 Bacteria 32261
235 Ga0209758_1006685 3300025297 Bacteria 8143
236 Ga0209758_1020820 3300025297 Bacteria 3083
237 Ga0209256_1000286 3300025299 Bacteria 88880
238 Ga0209256_1000459 3300025299 Bacteria 61577
239 Ga0209256_1000737 3300025299 Bacteria 43040
240 Ga0209256_1001479 3300025299 Bacteria 24043
241 Ga0209256_1001610 3300025299 Bacteria 22074
242 Ga0209256_1001820 3300025299 Bacteria 19999
243 Ga0209256_1008143 3300025299 Bacteria 4933
244 Ga0209256_1014511 3300025299 Bacteria 2829
245 Ga0209256_1037176 3300025299 Bacteria 1271
246 Ga0207426_1000131 3300025302 Bacteria 210250
247 Ga0207426_1000214 3300025302 Bacteria 137296
248 Ga0207426_1000248 3300025302 Bacteria 119561
249 Ga0207426_1000682 3300025302 Bacteria 40955
250 Ga0209051_1000118 3300025303 Bacteria 149426
251 Ga0209051_1000547 3300025303 Bacteria 45743
252 Ga0209051_1001039 3300025303 Bacteria 26259
253 Ga0209051_1023907 3300025303 Bacteria 2529
254 Ga0209051_1030652 3300025303 Bacteria 2083
255 Ga0209051_1056965 3300025303 Bacteria 1255
256 Ga0209257_1002918 3300025304 Bacteria 15767
257 Ga0209257_1006107 3300025304 Bacteria 7995
258 Ga0209257_1051080 3300025304 Bacteria 1167
259 Ga0207680_10066970 3300025903 Bacteria 2210
260 Ga0207647_10118235 3300025904 Bacteria 1564
261 Ga0207645_10132397 3300025907 Bacteria 1623
262 Ga0207654_10094850 3300025911 Bacteria 1827
263 Ga0207695_10000234 3300025913 Bacteria 146987
264 Ga0207695_10274317 3300025913 Bacteria 1581
265 Ga0207671_10000234 3300025914 Bacteria 83448
266 Ga0207657_10130056 3300025919 Bacteria 2064
267 Ga0207681_10099276 3300025923 Bacteria 2096
268 Ga0207694_10234957 3300025924 Bacteria 1497
269 Ga0207650_10003285 3300025925 Bacteria 11136
270 Ga0207644_10020105 3300025931 Bacteria 4536
271 Ga0207709_10159172 3300025935 Bacteria 1573
272 Ga0207669_10132781 3300025937 Bacteria 1714
273 Ga0207711_10019978 3300025941 Bacteria 5583
274 Ga0207667_10703057 3300025949 Bacteria 1013
275 Ga0207668_10015020 3300025972 Bacteria 4805
276 Ga0207640_10049059 3300025981 Bacteria 2732
277 Ga0207658_10123552 3300025986 Bacteria 2068
278 Ga0207639_10095427 3300026041 Bacteria 2390
279 Ga0207639_10381644 3300026041 Bacteria 1266
280 Ga0207639_10460372 3300026041 Bacteria 1156
281 Ga0207678_10531181 3300026067 Bacteria 1027
282 Ga0207678_10621836 3300026067 Bacteria 948
283 Ga0207702_10585056 3300026078 Bacteria 1094
284 Ga0207683_10163901 3300026121 Bacteria 2011
285 Ga0209281_1000028 3300027111 Bacteria 440027
286 Ga0209281_1000030 3300027111 Bacteria 425931
287 Ga0209281_1000144 3300027111 Bacteria 172471
288 Ga0209371_1012675 3300027312 Bacteria 2420
289 Ga0209282_1000004 3300027666 Bacteria 425931
290 Ga0209282_1000695 3300027666 Bacteria 16757
291 Ga0209813_10017298 3300027866 Bacteria 1978
292 Ga0268266_10007709 3300028379 Bacteria 9663
293 Ga0268266_10017844 3300028379 Bacteria 6048
294 Ga0268266_10019818 3300028379 Bacteria 5732
295 Ga0268266_10054454 3300028379 Bacteria 3437
296 Ga0268266_10129394 3300028379 Bacteria 2256
297 Ga0268266_10302756 3300028379 Bacteria 1492
298 Ga0268266_10337298 3300028379 Bacteria 1414
299 Ga0307515_10001049 3300028794 Bacteria 63286
300 Ga0307515_10001099 3300028794 Bacteria 61933
301 Ga0307515_10012908 3300028794 Bacteria 15667
302 Ga0307515_10052107 3300028794 Bacteria 6080
303 Ga0316182_1048672 3300030745 Bacteria 2881
304 Ga0307513_10000998 3300031456 Bacteria 40880
305 Ga0307513_10019403 3300031456 Bacteria 8094
306 Ga0307408_100080546 3300031548 Bacteria 2433
307 Ga0307408_100277207 3300031548 Bacteria 1395
308 Ga0307405_10072649 3300031731 Bacteria 2218
309 Ga0307405_10197209 3300031731 Bacteria 1459
310 Ga0307405_10500537 3300031731 Bacteria 974
311 Ga0307406_10081707 3300031901 Bacteria 2150
312 Ga0307412_10000412 3300031911 Bacteria 26116
313 Ga0307412_10033693 3300031911 Bacteria 3258
314 Ga0307412_10206314 3300031911 Bacteria 1496
315 Ga0315914_1000001 3300031967 Bacteria 416633
316 Ga0307416_100072501 3300032002 Bacteria 2867
317 Ga0307416_100265449 3300032002 Bacteria 1681
318 Ga0307414_10157341 3300032004 Bacteria 1801
319 Ga0315913_1000022 3300033430 Bacteria 94546
320 Ga0315915_1000002 3300033464 Bacteria 425854
321 Ga0373935_0377101 3300035692 Bacteria 1015
322 Ga0373927_0000068 3300035695 Bacteria 75823
323 Ga0316582_0202578 3300036647 Bacteria 1354
324 Ga0373925_0019526 3300037068 Bacteria 4930
325 Ga0395899_0000114 3300037312 Bacteria 134621
326 Ga0395900_0000154 3300037418 Bacteria 113757
327 Ga0395900_0064530 3300037418 Bacteria 3763
328 Ga0395900_0275724 3300037418 Bacteria 1675
329 Ga0395898_0000308 3300037466 Bacteria 113757
330 Ga0395898_0214144 3300037466 Bacteria 1838
331 Ga0395905_0000153 3300037471 Bacteria 113757
332 Ga0395905_0016023 3300037471 Bacteria 7124
333 Ga0395905_0020321 3300037471 Bacteria 6290
334 Ga0395905_0421592 3300037471 Bacteria 1231
335 Ga0395901_0000107 3300038443 Bacteria 113757
336 Ga0395901_0098886 3300038443 Bacteria 3059
337 Ga0395901_0760491 3300038443 Bacteria 961
338 Ga0400488_54739 3300038741 Bacteria 1028
339 Ga0439436_0035316 3300041404 Bacteria 1444
340 Ga0439436_0053881 3300041404 Bacteria 1132
341 Ga0439465_0003516 3300041413 Bacteria 5106
342 Ga0439465_0022383 3300041413 Bacteria 1985
343 Ga0451787_819215 3300041441 Bacteria 1676
344 Ga0451791_1888911 3300041451 Bacteria 2118
345 Ga0451798_0844921 3300041458 Bacteria 2108
346 Ga0451833_1015424 3300041491 Bacteria 1844
347 Ga0451835_0212654 3300041492 Bacteria 1916
348 Ga0451837_0362518 3300041494 Bacteria 845
349 Ga0451841_0560456 3300041498 Bacteria 911
350 Ga0451845_0256199 3300041501 Bacteria 1221
351 Ga0451847_0425469 3300041503 Bacteria 1213
352 Ga0451843_0016801 3300041509 Bacteria 3598
353 Ga0451855_0116657 3300041511 Bacteria 4353
354 Ga0451855_0490172 3300041511 Bacteria 950
355 Ga0451853_0090539 3300041512 Bacteria 1016
356 Ga0451853_0525065 3300041512 Bacteria 1768
357 Ga0439431_0023820 3300041997 Bacteria 1485
358 Ga0439432_048589 3300042006 Bacteria 1328
359 Ga0439432_063955 3300042006 Bacteria 1130
360 Ga0439449_0009510 3300042007 Bacteria 3683
361 Ga0439449_0015237 3300042007 Bacteria 2889
362 Ga0439449_0024194 3300042007 Bacteria 2271
363 Ga0439449_0051614 3300042007 Bacteria 1521
364 Ga0450910_030309 3300042147 Bacteria 848
365 Ga0450918_002726 3300042531 Bacteria 3315
366 Ga0466972_0043393 3300044658 Bacteria 2184
367 Ga0466972_0092422 3300044658 Bacteria 1434
368 Ga0466965_0135054 3300044683 Bacteria 1281
369 Ga0466970_0001843 3300044765 Bacteria 10241
370 Ga0466958_0033437 3300045836 Bacteria 3063
371 Ga0466967_0243209 3300045976 Bacteria 1717
372 Ga0495629_0024636 3300046459 Bacteria 4283
373 Ga0495638_0000110 3300046460 Bacteria 131410
374 Ga0495638_0008972 3300046460 Bacteria 7051
375 Ga0495638_0016891 3300046460 Bacteria 4880
376 Ga0495638_0016930 3300046460 Bacteria 4873
377 Ga0495638_0179534 3300046460 Bacteria 1209
378 Ga0495650_0058652 3300046471 Bacteria 1553
379 Ga0495605_0020885 3300046474 Bacteria 3475
380 Ga0495605_0021385 3300046474 Bacteria 3426
381 Ga0495662_0002722 3300046476 Bacteria 8931
382 Ga0495585_0020896 3300046492 Bacteria 3761
383 Ga0495585_0047785 3300046492 Bacteria 2382
384 Ga0495607_0033151 3300046501 Bacteria 3144
385 Ga0495583_0009155 3300046506 Bacteria 5951
386 Ga0495583_0030481 3300046506 Bacteria 2626
387 Ga0495583_0033014 3300046506 Bacteria 2493
388 Ga0495606_0001343 3300046507 Bacteria 33471
389 Ga0495606_0018735 3300046507 Bacteria 5179
390 Ga0495606_0034694 3300046507 Bacteria 3460
391 Ga0495606_0053608 3300046507 Bacteria 2616
392 Ga0495606_0057744 3300046507 Bacteria 2498
393 Ga0495610_0000363 3300046512 Bacteria 47378
394 Ga0495610_0032530 3300046512 Bacteria 2707
395 Ga0495610_0124802 3300046512 Bacteria 1124
396 Ga0495616_0013577 3300046513 Bacteria 4589
397 Ga0495620_0018362 3300046515 Bacteria 3464
398 Ga0495620_0021545 3300046515 Bacteria 3128
399 Ga0495631_0009763 3300046518 Bacteria 4780
400 Ga0495632_0010305 3300046519 Bacteria 5548
401 Ga0495632_0012878 3300046519 Bacteria 4798
402 Ga0495632_0032201 3300046519 Bacteria 2704
403 Ga0495632_0112093 3300046519 Bacteria 1280
404 Ga0495643_0012962 3300046522 Bacteria 5009
405 Ga0495643_0040443 3300046522 Bacteria 2547
406 Ga0495643_0041854 3300046522 Bacteria 2497
407 Ga0495643_0053035 3300046522 Bacteria 2175
408 Ga0495643_0198895 3300046522 Bacteria 963
409 Ga0495654_0000143 3300046530 Bacteria 74495
410 Ga0495654_0052791 3300046530 Bacteria 1978
411 Ga0495597_0014903 3300046542 Bacteria 3694
412 Ga0495622_0108952 3300046557 Bacteria 1268
413 Ga0495633_0012534 3300046558 Bacteria 4503
414 Ga0495633_0023680 3300046558 Bacteria 3040
415 Ga0495633_0026014 3300046558 Bacteria 2875
416 Ga0495633_0030588 3300046558 Bacteria 2614
417 Ga0495656_0161881 3300046615 Bacteria 1088
418 Ga0495668_0006494 3300046616 Bacteria 7650
419 Ga0495668_0044298 3300046616 Bacteria 2473
420 Ga0495668_0155501 3300046616 Bacteria 1252
421 Ga0495611_0015286 3300046648 Bacteria 3281
422 Ga0495625_0009878 3300046660 Bacteria 7937
423 Ga0495625_0037190 3300046660 Bacteria 3573
424 Ga0495625_0037793 3300046660 Bacteria 3537
425 Ga0495625_0047572 3300046660 Bacteria 3092
426 Ga0495625_0069448 3300046660 Bacteria 2475
427 Ga0495625_0136089 3300046660 Bacteria 1661
428 Ga0495625_0136351 3300046660 Bacteria 1659
429 Ga0495588_0060114 3300046674 Bacteria 1967
430 Ga0495588_0076226 3300046674 Bacteria 1748
431 Ga0495670_0031756 3300046691 Bacteria 2625
432 Ga0495670_0119678 3300046691 Bacteria 1367
433 Ga0495671_0096320 3300046692 Bacteria 1448
434 Ga0495671_0106058 3300046692 Bacteria 1372
435 Ga0495649_0024968 3300046694 Bacteria 3330
436 Ga0495649_0036833 3300046694 Bacteria 2687
437 Ga0495660_0024851 3300046810 Bacteria 3408
438 Ga0495660_0076639 3300046810 Bacteria 1761
439 Ga0495660_0101599 3300046810 Bacteria 1479
440 Ga0495604_0071336 3300047317 Bacteria 2627
441 Ga0495672_0021992 3300047320 Bacteria 4153
442 Ga0495676_0125714 3300047321 Bacteria 1859
443 Ga0495683_0035335 3300047323 Bacteria 2540
444 Ga0495687_036976 3300047443 Bacteria 2179
445 Ga0495679_054560 3300047446 Bacteria 1190
446 Ga0495685_051700 3300047447 Bacteria 1393
447 Ga0495681_0132688 3300047470 Bacteria 1059
448 Ga0495686_0001162 3300047472 Bacteria 30927
449 Ga0495686_0002138 3300047472 Bacteria 19314
450 Ga0495686_0019477 3300047472 Bacteria 4533
451 Ga0495686_0022887 3300047472 Bacteria 4128
452 Ga0495686_0093720 3300047472 Bacteria 1821
453 Ga0495686_0102322 3300047472 Bacteria 1726
454 Ga0495626_0087833 3300048091 Bacteria 1371
455 Ga0496101_0099713 3300048904 Bacteria 2172
456 Ga0496102_0006022 3300048905 Bacteria 10327
457 Ga0496103_0005771 3300048906 Bacteria 7389
458 Ga0496103_0228393 3300048906 Bacteria 1197
459 Ga0496104_0047950 3300048907 Bacteria 4027
460 Ga0496106_0001205 3300048909 Bacteria 19322
461 Ga0496106_0128107 3300048909 Bacteria 1989
462 Ga0496108_0699378 3300048911 Bacteria 879
463 Ga0496112_0416004 3300048915 Bacteria 1283
464 Ga0496112_0444826 3300048915 Bacteria 1234
465 Ga0496114_0352528 3300048917 Bacteria 1302
466 Ga0496114_0503764 3300048917 Bacteria 1071
467 Ga0496116_0000057 3300048919 Bacteria 281652
468 Ga0496116_0002951 3300048919 Bacteria 17324
469 Ga0496116_0010500 3300048919 Bacteria 7750
470 Ga0496116_0026331 3300048919 Bacteria 4257
471 Ga0496116_0028786 3300048919 Bacteria 4017
472 Ga0496116_0043951 3300048919 Bacteria 3039
473 Ga0496116_0073273 3300048919 Bacteria 2160
474 Ga0496116_0169318 3300048919 Bacteria 1186
475 Ga0496117_0000031 3300048920 Bacteria 381048
476 Ga0496117_0006996 3300048920 Bacteria 11181
477 Ga0496117_0010245 3300048920 Bacteria 8588
478 Ga0496117_0011322 3300048920 Bacteria 7995
479 Ga0496117_0013741 3300048920 Bacteria 7033
480 Ga0496117_0044367 3300048920 Bacteria 3221
481 Ga0496117_0077892 3300048920 Bacteria 2191
482 Ga0496117_0098692 3300048920 Bacteria 1856
483 Ga0496118_0000208 3300048921 Bacteria 102645
484 Ga0496118_0004885 3300048921 Bacteria 15595
485 Ga0496118_0008237 3300048921 Bacteria 10813
486 Ga0496118_0008792 3300048921 Bacteria 10353
487 Ga0496118_0035642 3300048921 Bacteria 4036
488 Ga0496118_0349701 3300048921 Bacteria 788
489 Ga0496119_0018993 3300048922 Bacteria 5086
490 Ga0496119_0028959 3300048922 Bacteria 3767
491 Ga0496119_0040159 3300048922 Bacteria 2997
492 Ga0496119_0103260 3300048922 Bacteria 1597
493 Ga0496119_0112910 3300048922 Bacteria 1505
494 Ga0496120_0000387 3300048923 Bacteria 71224
495 Ga0496120_0008689 3300048923 Bacteria 7320
496 Ga0496120_0008826 3300048923 Bacteria 7237
497 Ga0496120_0021630 3300048923 Bacteria 4061
498 Ga0496120_0052276 3300048923 Bacteria 2328
499 Ga0496120_0078475 3300048923 Bacteria 1795
500 Ga0496120_0132906 3300048923 Bacteria 1272
501 Ga0496121_0000034 3300048924 Bacteria 377095
502 Ga0496121_0000660 3300048924 Bacteria 64425
503 Ga0496121_0003956 3300048924 Bacteria 20474
504 Ga0496121_0006665 3300048924 Bacteria 14205
505 Ga0496121_0013662 3300048924 Bacteria 8704
506 Ga0496121_0031118 3300048924 Bacteria 4884
507 Ga0496121_0038317 3300048924 Bacteria 4248
508 Ga0496121_0045593 3300048924 Bacteria 3765
509 Ga0496121_0127676 3300048924 Bacteria 1909
510 Ga0496121_0164826 3300048924 Bacteria 1616
511 Ga0496121_0335130 3300048924 Bacteria 1013
512 Ga0496121_0339532 3300048924 Bacteria 1004
513 Ga0496121_0345534 3300048924 Bacteria 993
514 Ga0496121_0478273 3300048924 Bacteria 796
515 Ga0496122_0000023 3300048925 Bacteria 381035
516 Ga0496122_0000082 3300048925 Bacteria 209159
517 Ga0496122_0000308 3300048925 Bacteria 107960
518 Ga0496122_0007901 3300048925 Bacteria 11666
519 Ga0496122_0009867 3300048925 Bacteria 9953
520 Ga0496122_0015251 3300048925 Bacteria 7354
521 Ga0496122_0019377 3300048925 Bacteria 6218
522 Ga0496122_0118399 3300048925 Bacteria 1716
523 Ga0496122_0196200 3300048925 Bacteria 1185
524 Ga0496123_0000027 3300048926 Bacteria 306773
525 Ga0496123_0000066 3300048926 Bacteria 210327
526 Ga0496123_0000067 3300048926 Bacteria 209159
527 Ga0496123_0004280 3300048926 Bacteria 15189
528 Ga0496123_0020402 3300048926 Bacteria 5185
529 Ga0496123_0033226 3300048926 Bacteria 3715
530 Ga0496123_0048158 3300048926 Bacteria 2870
531 Ga0496123_0069144 3300048926 Bacteria 2219
532 Ga0496123_0093217 3300048926 Bacteria 1779
533 Ga0496123_0162797 3300048926 Bacteria 1187
534 Ga0496123_0310560 3300048926 Bacteria 748
535 Ga0496124_0000294 3300048927 Bacteria 93153
536 Ga0496124_0006387 3300048927 Bacteria 12849
537 Ga0496124_0013477 3300048927 Bacteria 7979
538 Ga0496124_0015682 3300048927 Bacteria 7248
539 Ga0496124_0017122 3300048927 Bacteria 6850
540 Ga0496124_0018926 3300048927 Bacteria 6429
541 Ga0496124_0019169 3300048927 Bacteria 6381
542 Ga0496124_0044025 3300048927 Bacteria 3833
543 Ga0496124_0082800 3300048927 Bacteria 2633
544 Ga0496124_0091711 3300048927 Bacteria 2475
545 Ga0496124_0092571 3300048927 Bacteria 2462
546 Ga0496124_0108102 3300048927 Bacteria 2243
547 Ga0496124_0309665 3300048927 Bacteria 1136
548 Ga0496124_0346893 3300048927 Bacteria 1052
549 Ga0496124_0385443 3300048927 Bacteria 978
550 Ga0496125_0000030 3300048928 Bacteria 375023
551 Ga0496125_0000288 3300048928 Bacteria 99681
552 Ga0496125_0004702 3300048928 Bacteria 15559
553 Ga0496125_0028379 3300048928 Bacteria 5056
554 Ga0496125_0068570 3300048928 Bacteria 2789
555 Ga0496125_0165584 3300048928 Bacteria 1494
556 Ga0496125_0178587 3300048928 Bacteria 1417
557 Ga0496125_0319155 3300048928 Bacteria 943
558 Ga0496125_0391062 3300048928 Bacteria 816
559 Ga0496126_0000115 3300048929 Bacteria 188546
560 Ga0496126_0000258 3300048929 Bacteria 113843
561 Ga0496126_0027664 3300048929 Bacteria 5413
562 Ga0496126_0080370 3300048929 Bacteria 2885
563 Ga0496126_0096937 3300048929 Bacteria 2585
564 Ga0496126_0137879 3300048929 Bacteria 2102
565 Ga0496126_0142866 3300048929 Bacteria 2058
566 Ga0496126_0358229 3300048929 Bacteria 1192
567 Ga0495678_006828 3300049459 Bacteria 6004
568 Ga0495678_021033 3300049459 Bacteria 2879
569 Ga0495678_030619 3300049459 Bacteria 2250
570 Ga0501031_0000009 3300049568 Bacteria 155116
571 Ga0501031_0010153 3300049568 Bacteria 6136
572 Ga0501031_0038930 3300049568 Bacteria 3101
573 Ga0501031_0288856 3300049568 Bacteria 1063
574 Ga0501032_0000001 3300049569 Bacteria 422097
575 Ga0501032_0000017 3300049569 Bacteria 158303
576 Ga0501032_0001183 3300049569 Bacteria 20900
577 Ga0501032_0003697 3300049569 Bacteria 11614
578 Ga0501032_0102231 3300049569 Bacteria 1899
579 Ga0501033_0000029 3300049570 Bacteria 158294
580 Ga0501033_0000185 3300049570 Bacteria 59836
581 Ga0501033_0000898 3300049570 Bacteria 27225
582 Ga0501033_0003664 3300049570 Bacteria 12527
583 Ga0501033_0006596 3300049570 Bacteria 9079
584 Ga0501033_0012136 3300049570 Bacteria 6577
585 Ga0501033_0069200 3300049570 Bacteria 2595
586 Ga0501033_0132242 3300049570 Bacteria 1807
587 Ga0501033_0146882 3300049570 Bacteria 1702
588 Ga0501033_0276425 3300049570 Bacteria 1186
589 Ga0501034_0000102 3300049571 Bacteria 158302
590 Ga0501034_0002200 3300049571 Bacteria 24125
591 Ga0501034_0006872 3300049571 Bacteria 12166
592 Ga0501034_0008936 3300049571 Bacteria 10532
593 Ga0501034_0026220 3300049571 Bacteria 5936
594 Ga0501034_0034891 3300049571 Bacteria 5101
595 Ga0501034_0145734 3300049571 Bacteria 2345
596 Ga0501034_0182645 3300049571 Bacteria 2062
597 Ga0501034_0194548 3300049571 Bacteria 1989
598 Ga0501034_0248890 3300049571 Bacteria 1722
599 Ga0501034_0677738 3300049571 Bacteria 931
600 Ga0501036_0000011 3300049572 Bacteria 158302
601 Ga0501036_0000804 3300049572 Bacteria 23330
602 Ga0501036_0017357 3300049572 Bacteria 6017
603 Ga0501036_0030932 3300049572 Bacteria 4523
604 Ga0501036_0539806 3300049572 Bacteria 969
605 Ga0501036_0548337 3300049572 Bacteria 961
606 Ga0501037_0000015 3300049573 Bacteria 161311
607 Ga0501037_0000089 3300049573 Bacteria 85102
608 Ga0501037_0000091 3300049573 Bacteria 84811
609 Ga0501037_0013773 3300049573 Bacteria 5959
610 Ga0501037_0079949 3300049573 Bacteria 2373
611 Ga0501037_0107380 3300049573 Bacteria 2011
612 Ga0501037_0107976 3300049573 Bacteria 2005
613 Ga0501038_0000016 3300049574 Bacteria 159150
614 Ga0501038_0000402 3300049574 Bacteria 37516
615 Ga0501038_0006176 3300049574 Bacteria 11081
616 Ga0501038_0086822 3300049574 Bacteria 2628
617 Ga0501038_0374949 3300049574 Bacteria 1105
618 Ga0501039_0000022 3300049575 Bacteria 160858
619 Ga0501039_0000023 3300049575 Bacteria 158026
620 Ga0501040_0013506 3300049576 Bacteria 5368
621 Ga0501040_0016214 3300049576 Bacteria 4927
622 Ga0501040_0153292 3300049576 Bacteria 1626
623 Ga0501042_0025138 3300049578 Bacteria 4182
624 Ga0501043_0000007 3300049579 Bacteria 224595
625 Ga0501043_0000093 3300049579 Bacteria 80521
626 Ga0501043_0000372 3300049579 Bacteria 40661
627 Ga0501043_0022793 3300049579 Bacteria 4910
628 Ga0501043_0041763 3300049579 Bacteria 3603
629 Ga0501043_0053247 3300049579 Bacteria 3178
630 Ga0501043_0145689 3300049579 Bacteria 1854
631 Ga0501043_0264565 3300049579 Bacteria 1322
632 Ga0501046_0007948 3300049580 Bacteria 9278
633 Ga0501047_0001190 3300049581 Bacteria 25762
634 Ga0501047_0013036 3300049581 Bacteria 7873
635 Ga0501047_0027682 3300049581 Bacteria 5461
636 Ga0501047_0039664 3300049581 Bacteria 4554
637 Ga0501047_0050281 3300049581 Bacteria 4025
638 Ga0501047_0064245 3300049581 Bacteria 3540
639 Ga0501047_0097755 3300049581 Bacteria 2814
640 Ga0501048_0042023 3300049582 Bacteria 3274
641 Ga0501048_0072183 3300049582 Bacteria 2437
642 Ga0501068_0006701 3300049584 Bacteria 6362
643 Ga0501068_0286303 3300049584 Bacteria 1054
644 Ga0501069_0000001 3300049585 Bacteria 289100
645 Ga0501069_0030648 3300049585 Bacteria 2954
646 Ga0501070_0000071 3300049586 Bacteria 86669
647 Ga0501070_0007877 3300049586 Bacteria 9028
648 Ga0501070_0012914 3300049586 Bacteria 7039
649 Ga0501070_0053927 3300049586 Bacteria 3334
650 Ga0501070_0091303 3300049586 Bacteria 2520
651 Ga0501070_0135113 3300049586 Bacteria 2036
652 Ga0501070_0152064 3300049586 Bacteria 1909
653 Ga0501071_0004661 3300049587 Bacteria 8711
654 Ga0501071_0019085 3300049587 Bacteria 4757
655 Ga0501072_0084890 3300049588 Bacteria 2511
656 Ga0501073_0173391 3300049589 Bacteria 1493
657 Ga0501073_0185693 3300049589 Bacteria 1439
658 Ga0501074_0000003 3300049590 Bacteria 116101
659 Ga0501074_0015071 3300049590 Bacteria 5625
660 Ga0501074_0050264 3300049590 Bacteria 3010
661 Ga0501074_0142038 3300049590 Bacteria 1717
662 Ga0501076_0212233 3300049592 Bacteria 1582
663 Ga0501080_0000090 3300049742 Bacteria 61585
664 Ga0501080_0001328 3300049742 Bacteria 20617
665 Ga0501080_0020052 3300049742 Bacteria 6187
666 Ga0501080_0039144 3300049742 Bacteria 4425
667 Ga0501080_0049490 3300049742 Bacteria 3912
668 Ga0501083_0000012 3300049744 Bacteria 178668
669 Ga0501241_009887 3300049758 Bacteria 1734
670 Ga0501035_0000037 3300049822 Bacteria 160921
671 Ga0501035_0000038 3300049822 Bacteria 158818
672 Ga0501035_0000336 3300049822 Bacteria 54776
673 Ga0501035_0002574 3300049822 Bacteria 17734
674 Ga0501035_0003081 3300049822 Bacteria 16003
675 Ga0501035_0008280 3300049822 Bacteria 9688
676 Ga0501035_0031602 3300049822 Bacteria 4821
677 Ga0501035_0059338 3300049822 Bacteria 3407
678 Ga0501035_0074962 3300049822 Bacteria 2992
679 Ga0501035_0159278 3300049822 Bacteria 1955
680 Ga0501035_0305116 3300049822 Bacteria 1340
681 Ga0501035_0651104 3300049822 Bacteria 854
682 Ga0501044_0000018 3300049823 Bacteria 225885
683 Ga0501044_0000046 3300049823 Bacteria 146812
684 Ga0501044_0002609 3300049823 Bacteria 20471
685 Ga0501044_0005144 3300049823 Bacteria 14583
686 Ga0501044_0010831 3300049823 Bacteria 9892
687 Ga0501044_0011495 3300049823 Bacteria 9590
688 Ga0501044_0043443 3300049823 Bacteria 4668
689 Ga0501044_0051335 3300049823 Bacteria 4252
690 Ga0501044_0101172 3300049823 Bacteria 2900
691 Ga0501044_0151471 3300049823 Bacteria 2301
692 Ga0501044_0261054 3300049823 Bacteria 1670
693 Ga0501045_0002171 3300049824 Bacteria 13300
694 Ga0501045_0558517 3300049824 Bacteria 849
695 nmdc:mga03683_26719_c1 3300050489 Bacteria 2279
696 nmdc:mga03683_37420_c1 3300050489 Bacteria 1978
697 nmdc:mga03n38_171028_c1 3300050490 Bacteria 1107
698 nmdc:mga03n38_197274_c1 3300050490 Bacteria 1040
699 nmdc:mga03n38_83897_c1 3300050490 Bacteria 1503
700 nmdc:mga03n38_9398_c1 3300050490 Bacteria 3557
701 nmdc:mga00v17_15_c1 3300050491 Bacteria 126234
702 nmdc:mga00v17_175324_c1 3300050491 Bacteria 1383
703 nmdc:mga00v17_22162_c1 3300050491 Bacteria 3662
704 nmdc:mga00v17_431_c1 3300050491 Bacteria 23635
705 nmdc:mga0yw44_169052_c1 3300050492 Bacteria 1435
706 nmdc:mga0yw44_215571_c1 3300050492 Bacteria 1271
707 nmdc:mga0yw44_247036_c1 3300050492 Bacteria 1187
708 nmdc:mga0yw44_458516_c1 3300050492 Bacteria 864
709 nmdc:mga0yw44_46542_c1 3300050492 Bacteria 2606
710 nmdc:mga0k408_11620_c1 3300050493 Bacteria 4799
711 nmdc:mga0k408_162758_c1 3300050493 Bacteria 1330
712 nmdc:mga0k408_295303_c1 3300050493 Bacteria 967
713 nmdc:mga06z11_156743_c1 3300050494 Bacteria 1299
714 nmdc:mga06z11_237413_c1 3300050494 Bacteria 1070
715 nmdc:mga06z11_389791_c1 3300050494 Bacteria 838
716 nmdc:mga04h51_32633_c1 3300050495 Bacteria 1652
717 nmdc:mga04h51_5669_c1 3300050495 Bacteria 3192
718 nmdc:mga07m45_185864_c1 3300050496 Bacteria 1208
719 nmdc:mga07m45_3170_c1 3300050496 Bacteria 7892
720 nmdc:mga07m45_55189_c1 3300050496 Bacteria 2246
721 nmdc:mga07m45_68111_c1 3300050496 Bacteria 2023
722 nmdc:mga0sz30_27365_c2 3300050516 Bacteria 1944
723 nmdc:mga0sz30_68463_c1 3300050516 Bacteria 1525
724 nmdc:mga0sz30_735_c1 3300050516 Bacteria 11987
725 Ga0495601_0031472 3300053077 Bacteria 3298
726 Ga0500610_0014511 3300053079 Bacteria 3699
727 Ga0500578_0136371 3300053086 Bacteria 1536
728 Ga0500578_0293247 3300053086 Bacteria 966
729 Ga0500644_0134415 3300053088 Bacteria 977
730 Ga0500651_0064159 3300053093 Bacteria 2291
731 Ga0500556_0164003 3300053104 Bacteria 877
732 Ga0500557_000347 3300053105 Bacteria 6035
733 Ga0500560_151037 3300053107 Bacteria 771
734 Ga0500569_002088 3300053109 Bacteria 3892
735 Ga0500594_0008013 3300053118 Bacteria 2401
736 Ga0500594_0119746 3300053118 Bacteria 826
737 Ga0500595_110058 3300053119 Bacteria 784
738 Ga0500608_007493 3300053122 Bacteria 4522
739 Ga0500618_000701 3300053125 Bacteria 19679
740 Ga0500618_007665 3300053125 Bacteria 3062
741 Ga0500618_008921 3300053125 Bacteria 2764
742 Ga0500618_037997 3300053125 Bacteria 1111
743 Ga0500655_000659 3300053133 Bacteria 6845
744 Ga0500658_0001061 3300053134 Bacteria 11260
745 Ga0500559_0025355 3300053136 Bacteria 2523
746 Ga0500561_0000223 3300053137 Bacteria 10314
747 Ga0500568_0000010 3300053139 Bacteria 249043
748 Ga0500568_0000247 3300053139 Bacteria 45994
749 Ga0500568_0005405 3300053139 Bacteria 6604
750 Ga0500573_0000793 3300053140 Bacteria 14234
751 Ga0500573_0020718 3300053140 Bacteria 3766
752 Ga0500604_0035239 3300053151 Bacteria 1488
753 Ga0500604_0043624 3300053151 Bacteria 1363
754 Ga0500604_0132288 3300053151 Bacteria 839
755 Ga0500616_0000448 3300053153 Bacteria 53998
756 Ga0500616_0002118 3300053153 Bacteria 17230
757 Ga0500616_0028767 3300053153 Bacteria 3060
758 Ga0500616_0061916 3300053153 Bacteria 1935
759 Ga0500616_0107217 3300053153 Bacteria 1355
760 Ga0500620_000918 3300053155 Bacteria 5128
761 Ga0500620_028184 3300053155 Bacteria 1754
762 Ga0500622_0000169 3300053156 Bacteria 70224
763 Ga0500622_0000441 3300053156 Bacteria 39445
764 Ga0500624_000633 3300053157 Bacteria 9342
765 Ga0500633_0011581 3300053160 Bacteria 2404
766 Ga0500636_0151188 3300053177 Bacteria 1275
767 Ga0500611_007007 3300053727 Bacteria 1673
768 Ga0500599_013779 3300053736 Bacteria 1097
769 Ga0501082_0109221 3300060353 Bacteria 2394
770 2503198899 2503198000 Bacteria 6884444
771 2509108850 2508501122 Bacteria 6292184
772 2509117923 2508501123 Bacteria 6283661
773 2509143074 2508501127 Bacteria 7037543
774 2509371533 2509276018 Bacteria 6910194
775 2509377980 2509276019 Bacteria 6802256
776 2509389223 2509276021 Bacteria 7634384
777 2509393773 2509276022 Bacteria 6200534
778 2509444782 2509276033 Bacteria 7180565
779 2509444786 2509276033 Bacteria 7180565
780 2510135432 2510065019 Bacteria 6903379
781 2510305833 2510065057 Bacteria 6649661
782 2510318475 2510065059 Bacteria 6847884
783 2510896891 2510461076 Bacteria 8618824
784 2511135834 2510917022 Bacteria 6504556
785 2511168439 2510917026 Bacteria 7046020
786 2511185216 2510917028 Bacteria 6185411
787 2511391887 2511231027 Bacteria 5013807
788 2511498599 2511231052 Bacteria 6974333
789 2512534748 2512047086 Bacteria 6850303
790 2512933707 2512875016 Bacteria 6529530
791 2512961859 2512875024 Bacteria 7195110
792 2512973440 2512875026 Bacteria 6861065
793 2513572869 2513237084 Bacteria 7231967
794 2513580402 2513237085 Bacteria 7695351
795 2513586353 2513237086 Bacteria 7265287
796 2513597837 2513237088 Bacteria 6927906
797 2513602043 2513237089 Bacteria 6553624
798 2513613823 2513237090 Bacteria 7096802
799 2513615832 2513237091 Bacteria 6900273
800 2513634904 2513237093 Bacteria 7545552
801 2513711535 2513237103 Bacteria 7647401
802 2513865116 2513237138 Bacteria 7368160
803 2513885398 2513237140 Bacteria 7076289
804 2513904667 2513237143 Bacteria 6664116
805 2513912914 2513237144 Bacteria 7530820
806 2513929507 2513237146 Bacteria 7166346
807 2513983497 2513237156 Bacteria 6402557
808 2514001708 2513237159 Bacteria 6810126
809 2514003358 2513237160 Bacteria 6650282
810 2514023171 2513237162 Bacteria 7468464
811 2514035461 2513237164 Bacteria 7563725
812 2514421940 2513237305 Bacteria 7293571
813 2514586552 2513237351 Bacteria 6968952
814 2515114604 2515075009 Bacteria 7288508
815 2515612421 2515154107 Bacteria 6795637
816 2515634976 2515154113 Bacteria 7807172
817 2515644460 2515154114 Bacteria 7848616
818 2515660963 2515154116 Bacteria 7552979
819 2515741787 2515154134 Bacteria 7220242
820 2516205707 2516143018 Bacteria 6951533
821 2516894876 2516653046 Bacteria 6989037
822 2517038247 2516653077 Bacteria 7555578
823 2517078525 2516653085 Bacteria 7346596
824 2517097264 2517093000 Bacteria 7412387
825 2517408347 2517287029 Bacteria 6905599
826 2517571557 2517487022 Bacteria 7227575
827 2520376504 2519899620 Bacteria 6499161
828 2524450306 2524023207 Bacteria 6813453
829 2524461196 2524023209 Bacteria 6679728
830 2530647170 2529292951 Bacteria 6916614
831 2535485515 2534681786 Bacteria 3308809
832 2535519225 2534681796 Bacteria 7146037
833 2551678458 2551306084 Bacteria 8942552
834 2551685185 2551306085 Bacteria 7347181
835 2554249001 2554235003 Bacteria 5877155
836 2558867519 2558860100 Bacteria 8458965
837 2559296089 2558860242 Bacteria 5568029
838 2561468562 2558860983 Bacteria 4133860
839 2585166493 2582581283 Bacteria 6030556
840 2585201539 2582581294 Bacteria 6626667
841 2585231860 2582581299 Bacteria 6518058
842 2585257162 2582581304 Bacteria 5831370
843 2585267186 2582581306 Bacteria 6450535
844 2585272076 2582581307 Bacteria 6597605
845 2585279619 2582581308 Bacteria 7413247
846 2585327456 2582581315 Bacteria 7318924
847 2585334005 2582581316 Bacteria 7774528
848 2585388237 2582581865 Bacteria 6644329
849 2585396166 2582581866 Bacteria 6859583
850 2585399952 2582581867 Bacteria 7184437
851 2585529176 2585427526 Bacteria 7258840
852 2585535698 2585427527 Bacteria 7273426
853 2585542993 2585427528 Bacteria 6842387
854 2585551076 2585427530 Bacteria 7383882
855 2585563379 2585427531 Bacteria 6992870
856 2585821041 2585427590 Bacteria 6824633
857 2585839238 2585427593 Bacteria 7141551
858 2585845074 2585427594 Bacteria 6180594
859 2585897200 2585427608 Bacteria 6544331
860 2585909114 2585427609 Bacteria 6667127
861 2585998088 2585427633 Bacteria 6413184
862 2586002667 2585427634 Bacteria 6455027
863 2587984528 2585428125 Bacteria 6662905
864 2588519788 2588253730 Bacteria 6881675
865 2597810856 2597489875 Bacteria 7010078
866 2599335738 2599185156 Bacteria 5403036
867 2599419951 2599185170 Bacteria 7295545
868 2599722649 2599185236 Bacteria 6875203
869 2599938847 2599185301 Bacteria 6161860
870 2600193986 2599185352 Bacteria 7228948
871 2600377453 2600254933 Bacteria 4750527
872 2601610977 2600255279 Bacteria 5605316
873 2601747751 2600255308 Bacteria 5611129
874 2616297536 2615840624 Bacteria 6557588
875 2616306406 2615840626 Bacteria 7921970
876 2616551106 2615840698 Bacteria 7319877
877 2617382337 2617270742 Bacteria 6808054
878 2643771695 2643221550 Bacteria 4619371
879 2643777327 2643221551 Bacteria 3750538
880 2643795775 2643221555 Bacteria 3749717
881 2643807928 2643221557 Bacteria 7184309
882 2643814898 2643221558 Bacteria 5460675
883 2643838035 2643221564 Bacteria 4193379
884 2643854811 2643221568 Bacteria 5187270
885 2643985951 2643221595 Bacteria 6565519
886 2644002656 2643221599 Bacteria 6292121
887 2644052453 2643221607 Bacteria 6314006
888 2644068881 2643221610 Bacteria 7480339
889 2644105750 2643221618 Bacteria 7717186
890 2644133955 2643221623 Bacteria 5239945
891 2644146366 2643221626 Bacteria 8069654
892 2644154438 2643221627 Bacteria 6761570
893 2644194637 2643221634 Bacteria 6705461
894 2644201164 2643221636 Bacteria 6583769
895 2644209677 2643221637 Bacteria 5345260
896 2644240302 2643221643 Bacteria 5749658
897 2644299677 2643221653 Bacteria 4569637
898 2644310363 2643221655 Bacteria 7722067
899 2644334852 2643221659 Bacteria 7890716
900 2644378393 2643221668 Bacteria 7306521
901 2644419952 2643221675 Bacteria 7473456
902 2644453308 2643221680 Bacteria 7473610
903 2644484731 2643221686 Bacteria 6310811
904 2644492546 2643221688 Bacteria 5260751
905 2644501251 2643221689 Bacteria 6042950
906 2644521667 2643221693 Bacteria 5513853
907 2644544954 2643221698 Bacteria 7756764
908 2644615396 2643221712 Bacteria 7729434
909 2644653205 2643221718 Bacteria 5345506
910 2644657905 2643221719 Bacteria 4568197
911 2644675107 2643221723 Bacteria 7095460
912 2644688665 2643221726 Bacteria 7455827
913 2657682298 2657244999 Bacteria 5946535
914 2671116015 2667528174 Bacteria 6435400
915 2688596174 2687453392 Bacteria 6880454
916 2692319826 2690316117 Bacteria 6800650
917 2694627694 2693429783 Bacteria 7019804
918 2694636806 2693429784 Bacteria 7241525
919 2719183143 2718217882 Bacteria 6556348
920 2719387863 2718217927 Bacteria 6972593
921 2719667483 2718217997 Bacteria 6740740
922 2719733860 2718218009 Bacteria 6478651
923 2720493903 2718218199 Bacteria 6740745
924 2720615364 2718218232 Bacteria 6720332
925 2720622152 2718218233 Bacteria 6662049
926 2720633506 2718218235 Bacteria 6630699
927 2720777204 2718218269 Bacteria 6906114
928 2721149255 2718218363 Bacteria 6524337
929 2721160657 2718218365 Bacteria 6274507
930 2721166068 2718218366 Bacteria 6425255
931 2721401496 2718218423 Bacteria 6438183
932 2722842238 2721755514 Bacteria 6424414
933 2723028802 2721755556 Bacteria 6745503
934 2723562415 2721755684 Bacteria 6859907
935 2723569111 2721755685 Bacteria 6704835
936 2723573310 2721755686 Bacteria 7343952
937 2724040310 2721755809 Bacteria 6438790
938 2724046616 2721755810 Bacteria 6479005
939 2724091811 2721755819 Bacteria 6906405
940 2724106376 2721755822 Bacteria 6726041
941 2724112183 2721755823 Bacteria 6752556
942 2725945794 2724679232 Bacteria 7646494
943 2730109738 2728369352 Bacteria 6745171
944 2730166378 2728369365 Bacteria 6555560
945 2730300289 2728369397 Bacteria 6274511
946 2738801011 2738541293 Bacteria 7065685
947 2738947110 2738541317 Bacteria 5340176
948 2739037688 2738541333 Bacteria 7106503
949 2739310277 2738543024 Bacteria 5603683
950 2753360502 2751185800 Bacteria 5467370
951 2753458467 2751185821 Bacteria 6189929
952 2756673567 2756170246 Bacteria 7451806
953 2757570416 2757320392 Bacteria 3737298
954 2758642942 2758568016 Bacteria 5645291
955 2765465775 2765235802 Bacteria 5618596
956 2766064071 2765235942 Bacteria 7445910
957 2770199109 2767802442 Bacteria 5747986
958 2776269513 2775506902 Bacteria 6208009
959 2776282443 2775506904 Bacteria 5954060
960 2776915672 2775507049 Bacteria 6284736
961 2778179230 2775507266 Bacteria 7392367
962 2792582351 2791355082 Bacteria 5973319
963 2792621795 2791355091 Bacteria 6135441
964 2792628948 2791355092 Bacteria 6248105
965 2792640088 2791355094 Bacteria 7011481
966 2792747381 2791355123 Bacteria 8049106
967 2793281844 2791355253 Bacteria 5171699
968 2793295450 2791355256 Bacteria 6798008
969 2793317948 2791355259 Bacteria 7254731
970 2793324576 2791355260 Bacteria 6598818
971 2793329619 2791355261 Bacteria 6661293
972 2793332415 2791355262 Bacteria 6774204
973 2793339009 2791355263 Bacteria 6872478
974 2793346779 2791355264 Bacteria 6429314
975 2793356795 2791355265 Bacteria 6539969
976 2793359193 2791355266 Bacteria 7116587
977 2793366083 2791355267 Bacteria 7222458
978 2802717077 2802428858 Bacteria 6636079
979 2802724935 2802428859 Bacteria 6667919
980 2802729685 2802428860 Bacteria 6525526
981 2802737031 2802428861 Bacteria 6534206
982 2802743436 2802428862 Bacteria 6633353
983 2802749438 2802428863 Bacteria 6410669
984 2804753808 2802429268 Bacteria 6094027
985 2805930922 2802429605 Bacteria 6875453
986 2805936771 2802429606 Bacteria 6346811
987 2806047767 2802429633 Bacteria 7341974
988 2806055343 2802429634 Bacteria 7083200
989 2806062224 2802429635 Bacteria 7650140
990 2806070017 2802429636 Bacteria 7597525
991 2806076683 2802429637 Bacteria 7067217
992 2808988085 2808606387 Bacteria 5697198
993 2819244453 2818991272 Bacteria 4622173
994 2819561099 2818991439 Bacteria 6907412
995 2819611986 2818991448 Bacteria 6772224
996 2819638474 2818991453 Bacteria 7181617
997 2819688374 2818991461 Bacteria 7026071
998 2821129196 2821123053 Bacteria 7836056
999 2837651397 2837651117 Bacteria 3772164
1000 2838018143 2838016132 Bacteria 6577831
1001 2838023823 2838022645 Bacteria 6494267
1002 2838034133 2838029111 Bacteria 6603031
1003 2838042001 2838035591 Bacteria 7166484
1004 2838046769 2838042994 Bacteria 6046894
1005 2838050998 2838048938 Bacteria 6044578
1006 2838062764 2838061910 Bacteria 6794874
1007 2838072309 2838068647 Bacteria 6208656
1008 2838668148 2838661181 Bacteria 7385261
1009 2838674242 2838668709 Bacteria 6671819
1010 2838683695 2838680041 Bacteria 6545511
1011 2838693358 2838686498 Bacteria 7807632
1012 2838698223 2838694306 Bacteria 6853137
1013 2838706645 2838701080 Bacteria 6669771
1014 2838711338 2838707686 Bacteria 6619912
1015 2838735352 2838729681 Bacteria 7400765
1016 2838742213 2838736955 Bacteria 5760694
1017 2838748099 2838742623 Bacteria 7396178
1018 2839993416 2839993093 Bacteria 5512535
1019 2840766427 2840764183 Bacteria 6358399
1020 2841736566 2841734538 Bacteria 6784580
1021 2841846069 2841840854 Bacteria 5761912
1022 2841857424 2841851746 Bacteria 7532261
1023 2841867572 2841864319 Bacteria 6742987
1024 2842081139 2842077413 Bacteria 6508645
1025 2842116609 2842110456 Bacteria 7656360
1026 2842122084 2842118031 Bacteria 7033875
1027 2842145773 2842140634 Bacteria 5759631
1028 2842148974 2842146304 Bacteria 5957337
1029 2842162401 2842156927 Bacteria 6894975
1030 2842166898 2842163707 Bacteria 6916235
1031 2842186041 2842180545 Bacteria 6888678
1032 2842194705 2842192696 Bacteria 6147454
1033 2842201178 2842198810 Bacteria 6608673
1034 2842207596 2842205361 Bacteria 6340321
1035 2842221970 2842217011 Bacteria 7497767
1036 2842235500 2842229732 Bacteria 7475766
1037 2842241098 2842237096 Bacteria 6620661
1038 2842249217 2842243621 Bacteria 7421798
1039 2842256436 2842250916 Bacteria 6579627
1040 2842263172 2842257432 Bacteria 7401195
1041 2842269263 2842264693 Bacteria 6472963
1042 2842277826 2842271015 Bacteria 7807131
1043 2842280693 2842278818 Bacteria 6340002
1044 2842290361 2842285085 Bacteria 6011953
1045 2842294796 2842291075 Bacteria 7076806
1046 2842302640 2842298080 Bacteria 6123127
1047 2842305631 2842304105 Bacteria 7023636
1048 2842311601 2842311132 Bacteria 6616990
1049 2842323661 2842317721 Bacteria 6793725
1050 2842346883 2842341865 Bacteria 7003929
1051 2842358858 2842357229 Bacteria 6485165
1052 2842366086 2842363717 Bacteria 6844742
1053 2842375186 2842370503 Bacteria 7038661
1054 2842381194 2842377471 Bacteria 7140707
1055 2842388265 2842384541 Bacteria 7057858
1056 2842395755 2842395702 Bacteria 6780583
1057 2842408195 2842402390 Bacteria 6681310
1058 2842414957 2842409023 Bacteria 6687331
1059 2842421534 2842415677 Bacteria 6596907
1060 2842425941 2842422224 Bacteria 6239196
1061 2842433453 2842428310 Bacteria 6767288
1062 2842439492 2842434925 Bacteria 6502746
1063 2842446200 2842441272 Bacteria 6769273
1064 2842448561 2842447887 Bacteria 6754142
1065 2842467702 2842462802 Bacteria 6588055
1066 2842474334 2842469257 Bacteria 6752936
1067 2842480899 2842475841 Bacteria 6603183
1068 2842485294 2842482326 Bacteria 7212537
1069 2842491353 2842489311 Bacteria 6620893
1070 2842501912 2842495871 Bacteria 6820686
1071 2842507490 2842502639 Bacteria 6604161
1072 2842514678 2842509118 Bacteria 6850950
1073 2842527069 2842521101 Bacteria 6569494
1074 2842874039 2842871566 Bacteria 4827117
1075 2842926474 2842922631 Bacteria 5824079
1076 2844003264 2844002411 Bacteria 7168230
1077 2844010979 2844009547 Bacteria 6728125
1078 2844168166 2844163670 Bacteria 7266046
1079 2844456793 2844454524 Bacteria 7952546
1080 2847420950 2847417321 Bacteria 6913799
1081 2847673592 2847670302 Bacteria 6165597
1082 2847690106 2847686936 Bacteria 6278406
1083 2848995781 2848992105 Bacteria 6810864
1084 2850082764 2850079185 Bacteria 6848280
1085 2852387553 2852387548 Bacteria 8025568
1086 2854897779 2854896431 Bacteria 5869725
1087 2854913713 2854911287 Bacteria 5582813
1088 2854922326 2854916844 Bacteria 5725939
1089 2855827510 2855825444 Bacteria 6785811
1090 2855842885 2855839649 Bacteria 7135830
1091 2855873645 2855872281 Bacteria 6964271
1092 2856318939 2856314179 Bacteria 6477897
1093 2856324053 2856320880 Bacteria 7263508
1094 2856329456 2856328259 Bacteria 6528202
1095 2856339784 2856334872 Bacteria 7037011
1096 2856348115 2856342000 Bacteria 7176905
1097 2856350326 2856349417 Bacteria 6230045
1098 2856362368 2856356410 Bacteria 6297484
1099 2856367372 2856364286 Bacteria 6939991
1100 2857353115 2857349434 Bacteria 7926032
1101 2857374304 2857367948 Bacteria 6965560
1102 2857519773 2857516855 Bacteria 7787325
1103 2857536137 2857531043 Bacteria 6754041
1104 2858803563 2858800743 Bacteria 6603254
1105 2869168649 2869162929 Bacteria 6399702
1106 2869172637 2869169390 Bacteria 6659796
1107 2869240159 2869234852 Bacteria 6654993
1108 2869244616 2869242130 Bacteria 6609239
1109 2869254003 2869249662 Bacteria 6868783
1110 2869259051 2869256925 Bacteria 6981691
1111 2869269856 2869264136 Bacteria 6880765
1112 2869272283 2869271264 Bacteria 6908218
1113 2869283088 2869278585 Bacteria 7077053
1114 2869288513 2869285874 Bacteria 6901219
1115 2871431180 2871429161 Bacteria 6547891
1116 2871436617 2871435913 Bacteria 6880295
1117 2871450407 2871444079 Bacteria 6423508
1118 2871454082 2871451962 Bacteria 7336357
1119 2871464762 2871459585 Bacteria 6866887
1120 2871473483 2871466892 Bacteria 6923287
1121 2871478552 2871474448 Bacteria 6806570
1122 2871487490 2871481445 Bacteria 6700002
1123 2871491586 2871488783 Bacteria 6929816
1124 2871498834 2871495908 Bacteria 6935695
1125 2874107004 2874102143 Bacteria 6342645
1126 2874115773 2874109183 Bacteria 6517025
1127 2874119187 2874116593 Bacteria 6674494
1128 2874126310 2874123672 Bacteria 7238285
1129 2874131562 2874131515 Bacteria 6820270
1130 2874142747 2874139085 Bacteria 7021506
1131 2874150555 2874146452 Bacteria 7533118
1132 2874158295 2874155637 Bacteria 6724144
1133 2874163688 2874162495 Bacteria 6174670
1134 2874170549 2874168670 Bacteria 8062617
1135 2876364038 2876363079 Bacteria 6544991
1136 2876369632 2876369609 Bacteria 6807521
1137 2876386812 2876386047 Bacteria 6698674
1138 2876399073 2876392853 Bacteria 6660880
1139 2876401099 2876399893 Bacteria 6927900
1140 2876408483 2876406927 Bacteria 6191900
1141 2876416603 2876413966 Bacteria 6831344
1142 2876427243 2876420981 Bacteria 6687741
1143 2878039283 2878035449 Bacteria 6555736
1144 2878737300 2878730984 Bacteria 6380721
1145 2878741172 2878738818 Bacteria 7136951
1146 2878747784 2878745973 Bacteria 6867388
1147 2878754798 2878753008 Bacteria 6922523
1148 2878763052 2878760144 Bacteria 6823465
1149 2878770022 2878767105 Bacteria 6898628
1150 2878780005 2878774303 Bacteria 6108671
1151 2878785308 2878781027 Bacteria 6834456
1152 2878794060 2878788777 Bacteria 6567085
1153 2881148386 2881147464 Bacteria 7779814
1154 2881159452 2881155292 Bacteria 6461656
1155 2881165170 2881161766 Bacteria 7127907
1156 2881846395 2881845957 Bacteria 6611900
1157 2881857982 2881853255 Bacteria 6698367
1158 2881864265 2881861095 Bacteria 7128710
1159 2882635221 2882632389 Bacteria 8154593
1160 2882913620 2882912400 Bacteria 6801539
1161 2885307048 2885305155 Bacteria 7348390
1162 2885313952 2885312484 Bacteria 6415165
1163 2885324025 2885318864 Bacteria 6729568
1164 2885330103 2885326080 Bacteria 7134805
1165 2885339042 2885334103 Bacteria 7216818
1166 2885347076 2885342637 Bacteria 7011821
1167 2885356064 2885350715 Bacteria 6787678
1168 2888343559 2888337043 Bacteria 6629336
1169 2888344540 2888343758 Bacteria 6611049
1170 2888353388 2888350351 Bacteria 7372807
1171 2889015104 2889010040 Bacteria 6749192
1172 2889019819 2889016732 Bacteria 6700763
1173 2889795809 2889790730 Bacteria 5689708
1174 2889916355 2889914905 Bacteria 5702301
1175 2891048612 2891048133 Bacteria 4447501
1176 2891377780 2891373044 Bacteria 5202277
1177 2894653710 2894652903 Bacteria 4587256
1178 2896390074 2896384573 Bacteria 7700774
1179 2899805018 2899803654 Bacteria 5577784
1180 2899849440 2899845264 Bacteria 5672268
1181 2903453863 2903448605 Bacteria 7357801
1182 2903500331 2903492973 Bacteria 13473544
1183 2903502265 2903492973 Bacteria 13473544
1184 2903521319 2903513507 Bacteria 6344008
1185 2903525803 2903521522 Bacteria 6525694
1186 2903532651 2903528002 Bacteria 6586099
1187 2903543636 2903540706 Bacteria 7062119
1188 2904579932 2904578770 Bacteria 5302906
1189 2904665600 2904659560 Bacteria 6685615
1190 2906310957 2906308376 Bacteria 6841989
1191 2906323068 2906321335 Bacteria 6579571
1192 2906334034 2906328253 Bacteria 6585166
1193 2906359455 2906354277 Bacteria 6991324
1194 2906370156 2906363423 Bacteria 6856682
1195 2906377846 2906370794 Bacteria 6881062
1196 2906391725 2906386501 Bacteria 5977019
1197 2906395790 2906393657 Bacteria 6790866
1198 2906403243 2906401398 Bacteria 6693206
1199 2906408974 2906408224 Bacteria 6162342
1200 2906419010 2906414383 Bacteria 6580790
1201 2906430649 2906427513 Bacteria 6375796
1202 2913300297 2913295892 Bacteria 6333755
1203 2913312061 2913308742 Bacteria 5350706
1204 2915650600 2915650412 Bacteria 4288180
1205 2915981702 2915980308 Bacteria 6624279
1206 2915991909 2915986958 Bacteria 6739310
1207 2915999555 2915993759 Bacteria 7016183
1208 2916004464 2916000859 Bacteria 6865702
1209 2916013452 2916007675 Bacteria 6898660
1210 2916019876 2916014648 Bacteria 6946486
1211 2916023942 2916021584 Bacteria 6854472
1212 2916031867 2916028427 Bacteria 6748433
1213 2916040508 2916035215 Bacteria 6755766
1214 2916043441 2916041962 Bacteria 6820487
1215 2916050634 2916048683 Bacteria 6543552
1216 2916058702 2916055098 Bacteria 6758838
1217 2916066473 2916061851 Bacteria 6737736
1218 2916074344 2916068649 Bacteria 6943657
1219 2916077657 2916076590 Bacteria 6596108
1220 2919118361 2919114240 Bacteria 5700270
1221 2919120396 2919119836 Bacteria 5208557
1222 2919170447 2919166419 Bacteria 4952238
1223 2919176872 2919171160 Bacteria 6499771
1224 2919411467 2919408235 Bacteria 6149349
1225 2920760204 2920760137 Bacteria 7427611
1226 2920826069 2920822456 Bacteria 6897201
1227 2921205057 2921201388 Bacteria 6926299
1228 2921212019 2921208531 Bacteria 6745326
1229 2921240345 2921237296 Bacteria 6876710
1230 2921245620 2921244191 Bacteria 6568419
1231 2921252791 2921250672 Bacteria 6677771
1232 2921260430 2921257292 Bacteria 6808382
1233 2921267514 2921263974 Bacteria 6864552
1234 2921287321 2921282425 Bacteria 6826397
1235 2921293991 2921289301 Bacteria 7316391
1236 2921302557 2921296804 Bacteria 7176999
1237 2922135207 2922130491 Bacteria 7173936
1238 2922153559 2922151315 Bacteria 6902399
1239 2922164607 2922158528 Bacteria 6573167
1240 2922173246 2922172374 Bacteria 6167644
1241 2922181452 2922178524 Bacteria 6025201
1242 2922193264 2922185730 Bacteria 7113964
1243 2923559957 2923556063 Bacteria 6793593
1244 2924144820 2924144063 Bacteria 6883928
1245 2924157671 2924150972 Bacteria 7169444
1246 2924158771 2924158325 Bacteria 7188855
1247 2924168515 2924165586 Bacteria 7260590
1248 2924175809 2924172951 Bacteria 6749356
1249 2924183456 2924179722 Bacteria 6843264
1250 2924190203 2924186466 Bacteria 6876637
1251 2924193474 2924193448 Bacteria 6955718
1252 2924201457 2924200457 Bacteria 6757188
1253 2924207801 2924207177 Bacteria 6917007
1254 2924214879 2924214083 Bacteria 7080103
1255 2924227144 2924221636 Bacteria 7113495
1256 2924234025 2924228884 Bacteria 6633132
1257 2924716341 2924710171 Bacteria 6752351
1258 2924724509 2924718760 Bacteria 6331356
1259 2924728798 2924726620 Bacteria 6271473
1260 2924740541 2924733363 Bacteria 7574837
1261 2924746489 2924741084 Bacteria 6661321
1262 2924754405 2924748358 Bacteria 6154725
1263 2924759640 2924754689 Bacteria 6774424
1264 2924767540 2924762789 Bacteria 6561353
1265 2924778832 2924776078 Bacteria 7492003
1266 2924791018 2924784321 Bacteria 7416538
1267 2926762055 2926760298 Bacteria 5505990
1268 2928522700 2928521798 Bacteria 4960112
1269 2929142013 2929138655 Bacteria 5810547
1270 2933017803 2933016740 Bacteria 6355406
1271 2933572138 2933570622 Bacteria 7023390
1272 2933592785 2933586486 Bacteria 7667493
1273 2933597422 2933594066 Bacteria 5594265
1274 2933602839 2933599457 Bacteria 5858799
1275 2935898123 2935894831 Bacteria 6620579
1276 2935903435 2935901341 Bacteria 7341747
1277 2936370091 2936367885 Bacteria 7324495
1278 2936379267 2936375103 Bacteria 6652732
1279 2936381755 2936381700 Bacteria 7006523
1280 2936997447 2936996657 Bacteria 6298727
1281 2937004089 2937002841 Bacteria 6934057
1282 2937010374 2937009748 Bacteria 6746052
1283 2937020634 2937016420 Bacteria 6782579
1284 2937023165 2937023124 Bacteria 6815156
1285 2937031714 2937029754 Bacteria 6424026
1286 2937037781 2937036028 Bacteria 6846469
1287 2937043167 2937042894 Bacteria 6741576
1288 2937053550 2937049772 Bacteria 6757901
1289 2937059362 2937056579 Bacteria 7107896
1290 2937070510 2937063883 Bacteria 7199456
1291 2937076106 2937071275 Bacteria 6984483
1292 2937081501 2937078374 Bacteria 6610289
1293 2937090867 2937084907 Bacteria 6618516
1294 2937093357 2937091812 Bacteria 6979387
1295 2937104316 2937098957 Bacteria 7249374
1296 2937113255 2937106411 Bacteria 6947143
1297 2937114255 2937113482 Bacteria 6505872
1298 2937120253 2937119839 Bacteria 6597547
1299 2937129766 2937126314 Bacteria 6771275
1300 2937815526 2937813078 Bacteria 7783518
1301 2937823416 2937822353 Bacteria 7290551
1302 2937838851 2937836603 Bacteria 6811263
1303 2937843735 2937843397 Bacteria 5256375
1304 2937852734 2937848649 Bacteria 6983481
1305 2937862908 2937861824 Bacteria 6660327
1306 2937876038 2937868953 Bacteria 6639878
1307 2937880425 2937877337 Bacteria 7246526
1308 2937893833 2937891427 Bacteria 6357007
1309 2937976123 2937972304 Bacteria 7532020
1310 2937982231 2937980651 Bacteria 6517427
1311 2937997482 2937994558 Bacteria 7036190
1312 2938021800 2938014810 Bacteria 6700592
1313 2941501493 2941499720 Bacteria 7599444
1314 2954013918 2954011201 Bacteria 4762601
1315 2957376781 2957375807 Bacteria 6425588
1316 2957384910 2957382221 Bacteria 6737050
1317 2957395185 2957388812 Bacteria 6778072
1318 2957399720 2957395598 Bacteria 6822399
1319 2957405536 2957402308 Bacteria 6741770
1320 2957411701 2957408893 Bacteria 6558585
1321 2957417458 2957415311 Bacteria 6991633
1322 2957422377 2957422303 Bacteria 7172205
1323 2957430091 2957430029 Bacteria 7022557
1324 2957441681 2957437181 Bacteria 6568994
1325 2957447650 2957443900 Bacteria 6869977
1326 2957454666 2957450854 Bacteria 6765715
1327 2957461011 2957457609 Bacteria 6967680
1328 2957466496 2957464669 Bacteria 6568877
1329 2957475382 2957471148 Bacteria 6797643
1330 2957481440 2957478035 Bacteria 6756658
1331 2957489072 2957484790 Bacteria 6703082
1332 2957494422 2957491536 Bacteria 6695180
1333 2957505161 2957498199 Bacteria 7126688
1334 2957508279 2957505466 Bacteria 7253085
1335 2958039072 2958034702 Bacteria 6989922
1336 2958052143 2958041894 Bacteria 13082850
1337 2958054039 2958041894 Bacteria 13082850
1338 2958070977 2958064165 Bacteria 7158582
1339 2958072344 2958071322 Bacteria 6815895
1340 2958087560 2958084443 Bacteria 7312792
1341 2958102668 2958100919 Bacteria 6800575
1342 2958111097 2958108152 Bacteria 6681128
1343 2958120278 2958115193 Bacteria 6923548
1344 2958123346 2958122699 Bacteria 7280457
1345 2958132915 2958130278 Bacteria 6897202
1346 2958140143 2958137437 Bacteria 6050276
1347 2958149531 2958144490 Bacteria 6677056
1348 2958161558 2958158011 Bacteria 6058449
1349 2958167956 2958165035 Bacteria 6906348
1350 2958173816 2958172287 Bacteria 6716688
1351 2958182617 2958179912 Bacteria 6874908
1352 2960589434 2960584000 Bacteria 6864594
1353 2960592811 2960591022 Bacteria 6622873
1354 2960597886 2960597568 Bacteria 6550735
1355 2960607478 2960603979 Bacteria 6898737
1356 2960613666 2960610863 Bacteria 6691244
1357 2960619080 2960617483 Bacteria 6727748
1358 2960629073 2960624210 Bacteria 6875384
1359 2960634208 2960631154 Bacteria 6732508
1360 2960643572 2960637947 Bacteria 7296468
1361 2960650717 2960645483 Bacteria 7211087
1362 2960655913 2960652885 Bacteria 7083688
1363 2960663968 2960660292 Bacteria 7041660
1364 2960673300 2960667422 Bacteria 6763020
1365 2960674871 2960674078 Bacteria 6609048
1366 2960681736 2960680706 Bacteria 6624464
1367 2960689324 2960687367 Bacteria 6535474
1368 2960700662 2960693952 Bacteria 6749742
1369 2961080465 2961077736 Bacteria 7079850
1370 2961120943 2961114664 Bacteria 6680456
1371 2961134338 2961127735 Bacteria 7196641
1372 2961142817 2961136820 Bacteria 6775228
1373 2961166424 2961163497 Bacteria 6901077
1374 2961171989 2961170736 Bacteria 7072258
1375 2961187726 2961183825 Bacteria 6688536
1376 2963645496 2963644680 Bacteria 6530403
1377 2964608214 2964607997 Bacteria 7101408
1378 2964621658 2964615318 Bacteria 6809089
1379 2964625842 2964621998 Bacteria 6834995
1380 2964629545 2964628898 Bacteria 7083044
1381 2964639234 2964636051 Bacteria 7091832
1382 2964643597 2964643177 Bacteria 6820887
1383 2964655201 2964649959 Bacteria 6675118
1384 2964659990 2964656573 Bacteria 7100150
1385 2964669411 2964663802 Bacteria 7019362
1386 2964676855 2964670856 Bacteria 6851364
1387 2964681668 2964678106 Bacteria 6792020
1388 2964687464 2964685014 Bacteria 6839111
1389 2964695153 2964691889 Bacteria 6802758
1390 2964699171 2964698721 Bacteria 6765331
1391 2964711192 2964705432 Bacteria 7114648
1392 2964712648 2964712639 Bacteria 6695970
1393 2964719769 2964719344 Bacteria 7286602
1394 2965021243 2965018300 Bacteria 6883036
1395 2965026790 2965025482 Bacteria 6532201
1396 2965032541 2965032056 Bacteria 6887443
1397 2965047356 2965040258 Bacteria 6855979
1398 2965052135 2965047637 Bacteria 6623551
1399 2965065250 2965062239 Bacteria 7412989
1400 2965090644 2965089291 Bacteria 6866420
1401 2965104749 2965102966 Bacteria 6800987
1402 2965115034 2965110997 Bacteria 6693150
1403 2965126294 2965119406 Bacteria 6956431
1404 2967668269 2967664464 Bacteria 6948836
1405 2967675618 2967671571 Bacteria 7021409
1406 2967681259 2967678726 Bacteria 7264382
1407 2967692416 2967686174 Bacteria 6678622
1408 2967699410 2967693043 Bacteria 6804451
1409 2967704824 2967699805 Bacteria 6854538
1410 2967713014 2967706974 Bacteria 7186053
1411 2967721207 2967714385 Bacteria 7000047
1412 2967724951 2967721400 Bacteria 7073753
1413 2967731843 2967728569 Bacteria 6641507
1414 2967738474 2967735183 Bacteria 6827012
1415 2967745471 2967742019 Bacteria 6794534
1416 2967752605 2967748971 Bacteria 6733771
1417 2967757758 2967755722 Bacteria 6814706
1418 2967765785 2967762386 Bacteria 6923502
1419 2967770335 2967769361 Bacteria 6587838
1420 2967780504 2967775926 Bacteria 6738189
1421 2967997437 2967996073 Bacteria 6787468
1422 2968006439 2968003550 Bacteria 6929263
1423 2968017447 2968016561 Bacteria 7022047
1424 2968085172 2968083720 Bacteria 7351627
1425 2968093389 2968091066 Bacteria 6052692
1426 2968098181 2968097103 Bacteria 6107094
1427 2968117093 2968110612 Bacteria 6814636
1428 2968122479 2968117919 Bacteria 6536078
1429 2968129513 2968128360 Bacteria 6270294
1430 2968146624 2968138860 Bacteria 6605449
1431 2968174825 2968171901 Bacteria 6894245
1432 2970022000 2970019648 Bacteria 7072033
1433 2970028667 2970026789 Bacteria 6785236
1434 2970038972 2970033650 Bacteria 7118744
1435 2970046610 2970040964 Bacteria 6731123
1436 2970049613 2970047711 Bacteria 7088379
1437 2970058825 2970054988 Bacteria 6611507
1438 2970066749 2970061556 Bacteria 7099761
1439 2970071185 2970068827 Bacteria 7123112
1440 2970076707 2970076120 Bacteria 6697332
1441 2970086760 2970082768 Bacteria 6183754
1442 2970092732 2970088815 Bacteria 6933825
1443 2970101182 2970095765 Bacteria 6936963
1444 2970104600 2970102677 Bacteria 6812532
1445 2970113938 2970109326 Bacteria 6863976
1446 2970118385 2970116247 Bacteria 6501857
1447 2970124495 2970122695 Bacteria 6625855
1448 2970133511 2970129317 Bacteria 6806560
1449 2970140882 2970136068 Bacteria 7207982
1450 2970147346 2970143518 Bacteria 6446480
1451 2970155852 2970149975 Bacteria 6779706
1452 2970161195 2970156795 Bacteria 7168044
1453 2970170744 2970164137 Bacteria 6861252
1454 2970174077 2970170962 Bacteria 6876229
1455 2970182107 2970177841 Bacteria 6768001
1456 2970189128 2970184632 Bacteria 7054431
1457 2970197902 2970191845 Bacteria 7032787
1458 2970472493 2970469710 Bacteria 6969209
1459 2970493588 2970489779 Bacteria 6517260
1460 2970504586 2970503327 Bacteria 7099517
1461 2970511126 2970510686 Bacteria 7006402
1462 2970526261 2970524798 Bacteria 6840927
1463 2970534106 2970532167 Bacteria 6553173
1464 2970546023 2970540015 Bacteria 6977556
1465 2970550885 2970547951 Bacteria 6931819
1466 2970557907 2970554993 Bacteria 6814252
1467 2970597707 2970593180 Bacteria 7073582
1468 2970624066 2970619444 Bacteria 6986144
1469 2970629020 2970627176 Bacteria 6680862
1470 2977520219 2977516862 Bacteria 6940108
1471 2977527408 2977523885 Bacteria 6960446
1472 2977531211 2977530762 Bacteria 6951399
1473 2977544459 2977537788 Bacteria 6929320
1474 2977547481 2977544691 Bacteria 6875412
1475 2977558001 2977551784 Bacteria 7125765
1476 2977564712 2977558990 Bacteria 6863948
1477 2977571323 2977565890 Bacteria 6901543
1478 2977577257 2977572785 Bacteria 6763888
1479 2977583332 2977579622 Bacteria 6772100
1480 2977824015 2977821940 Bacteria 6906439
1481 2977833357 2977828996 Bacteria 7007971
1482 2977846709 2977843712 Bacteria 6753583
1483 2977853073 2977851361 Bacteria 6694324
1484 2977872219 2977864932 Bacteria 7534097
1485 2977876754 2977872689 Bacteria 7270173
1486 2977904704 2977898635 Bacteria 6675551
1487 2977912421 2977907340 Bacteria 6577984
1488 2977915293 2977915119 Bacteria 6829656
1489 2977924727 2977922695 Bacteria 6956781
1490 2977937973 2977935797 Bacteria 6252826
1491 2977945421 2977942078 Bacteria 7570577
1492 2977955404 2977950692 Bacteria 6893264
1493 2977963093 2977957713 Bacteria 6877875
1494 2977988960 2977986579 Bacteria 6581278
1495 2979092676 2979089926 Bacteria 5670289
1496 2979099933 2979095461 Bacteria 5669583
1497 2979748513 2979742915 Bacteria 7301278
1498 2979768015 2979764755 Bacteria 6610066
1499 2979778505 2979772303 Bacteria 6618277
1500 2979780782 2979779861 Bacteria 6219781
1501 2979795277 2979793036 Bacteria 6808957
1502 2979809224 2979808191 Bacteria 7179355
1503 2987641707 2987636660 Bacteria 8088555
1504 2987647731 2987645492 Bacteria 6117018
1505 2987653389 2987652177 Bacteria 6969023
1506 2987662432 2987659509 Bacteria 6966464
1507 2987667144 2987666974 Bacteria 6509233
1508 2987678505 2987673487 Bacteria 6884027
1509 2989355085 2989349275 Bacteria 6349068
1510 2989771770 2989771324 Bacteria 5605128
1511 2995394297 2995392953 Bacteria 4539380
1512 2996311619 2996310559 Bacteria 6357320
1513 2996341611 2996336353 Bacteria 5511628
1514 2996344877 2996341866 Bacteria 6643098
1515 2996349875 2996348954 Bacteria 7239054
1516 2996392755 2996386984 Bacteria 6978667
1517 2996890470 2996887358 Bacteria 5795980
1518 2996896197 2996893221 Bacteria 5823108
1519 3000137565 3000135777 Bacteria 6891109
1520 3002141759 3002141150 Bacteria 5254435
1521 3003931153 3003930520 Bacteria 5667563
1522 3004173493 3004167301 Bacteria 8330599
1523 3004191483 3004188549 Bacteria 6952365
1524 3004201644 3004195979 Bacteria 6776956
1525 3004209481 3004203850 Bacteria 7307914
1526 3004218518 3004211236 Bacteria 7417683
1527 3004223636 3004218560 Bacteria 7421728
1528 3004234211 3004232784 Bacteria 6662140
1529 3004247408 3004239961 Bacteria 6892290
1530 3004251189 3004248173 Bacteria 6563236
1531 3004274382 3004268573 Bacteria 7043476
1532 3004276577 3004275668 Bacteria 7114440
1533 3004296694 3004289098 Bacteria 6135450
1534 3004337058 3004334049 Bacteria 8449246
1535 3005415973 3005409236 Bacteria 7188837
1536 3005416875 3005416602 Bacteria 7064308
1537 3005449857 3005445848 Bacteria 6906074
1538 3005456148 3005452660 Bacteria 5889319
1539 637076820 637000159 Bacteria 7596297
1540 639645863 639633055 Bacteria 7751309
1541 643827538 643692032 Bacteria 6891900
1542 648737319 648276728 Bacteria 6968865
1543 649870734 649633066 Bacteria 6690028
1544 650738506 650716007 Bacteria 5573770
1545 8002286357 8002285264 Bacteria 6717907
1546 8003995466 8003992118 Bacteria 7266902
1547 8004003225 8003999396 Bacteria 7063185
1548 8004303571 8004300914 Bacteria 6132239
1549 8004315131 8004312739 Bacteria 7444653
1550 8004366012 8004361976 Bacteria 6858373
1551 8004376380 8004374579 Bacteria 6898112
1552 8004390482 8004387939 Bacteria 7049250
1553 8004395649 8004395343 Bacteria 6620908
1554 8004450756 8004445564 Bacteria 6322258
1555 8004639903 8004633249 Bacteria 6723080
1556 8004641879 8004640170 Bacteria 6723001
1557 8004701685 8004695233 Bacteria 6731676
1558 8004706567 8004703790 Bacteria 8006957
1559 8004717174 8004714634 Bacteria 6776161
1560 8004731791 8004727605 Bacteria 6643904
1561 8005249423 8005246636 Bacteria 4933972
1562 8005262657 8005258706 Bacteria 6184835
1563 8005282621 8005275841 Bacteria 6929066
1564 8005286564 8005282627 Bacteria 6675747
1565 8005291998 8005289223 Bacteria 6634003
1566 8005306137 8005301065 Bacteria 6614431
1567 8005309711 8005307578 Bacteria 7395396
1568 8005315921 8005314921 Bacteria 7072929
1569 8005324997 8005321885 Bacteria 5795980
1570 8005381379 8005376324 Bacteria 6590079
1571 8005387589 8005382845 Bacteria 6732062
1572 8005398425 8005395548 Bacteria 6806915
1573 8005431974 8005430974 Bacteria 6689030
1574 8005465299 8005460587 Bacteria 7157962
1575 8005487008 8005484373 Bacteria 6297373
1576 8005497877 8005497431 Bacteria 6477605
1577 8005546882 8005542996 Bacteria 7077758
1578 8005561364 8005556819 Bacteria 6908598
1579 8005565986 8005563573 Bacteria 7153261
1580 8005572036 8005570704 Bacteria 6957481
1581 8005623611 8005619151 Bacteria 7030230
1582 8005630828 8005626139 Bacteria 6534237
1583 8005645205 8005645114 Bacteria 6950293
1584 8005669283 8005668836 Bacteria 6953162
1585 8005687349 8005682033 Bacteria 6726518
1586 8005694166 8005688590 Bacteria 6610080
1587 8005695812 8005695170 Bacteria 6912330
1588 8018128657 8018127388 Bacteria 7351159
1589 8018150482 8018150411 Bacteria 5549903
1590 8018164899 8018163183 Bacteria 7277977
1591 8018177661 8018176218 Bacteria 6896178
1592 8023686742 8023680758 Bacteria 7729763
1593 8024484562 8024479707 Bacteria 6954785
1594 8024491025 8024486573 Bacteria 6540512
1595 8024504034 8024501048 Bacteria 6427847
1596 8046768359 8046767195 Bacteria 7547379
1597 8049296408 8049293176 Bacteria 6128433
1598 8054463897 8054460903 Bacteria 4872905
1599 8054559962 8054558443 Bacteria 5204801
1600 8055618118 8055617313 Bacteria 7548464
1601 8056380595 8056375014 Bacteria 7006639
1602 8056383345 8056382006 Bacteria 6408074
1603 8056878372 8056875544 Bacteria 4355797
1604 8057581972 8057575449 Bacteria 7367519
1605 8057879480 8057874678 Bacteria 7494653
1606 rootH1_10039093
1607 JGI24740J21852_10006164
1608 JGI24735J21928_10055750
1609 JGI25155J39150_1000018
1610 JGI25156J39149_1000055
1611 JGI25162J39368_1000601
1612 JGI25162J39368_1000903
1613 JGI25154J39366_1000069
1614 JGI25157J39369_1000076
1615 JGI25157J39369_1001842
1616 JGI25152J39213_1000169
1617 JGI25152J39213_1000820
1618 JGI25152J39213_1005058
1619 JGI25152J39213_1008918
1620 JGI25150J39212_1000018
1621 JGI25159J45721_1000022
1622 JGI25159J45721_1006609
1623 JGI25151J46595_10000034
1624 JGI25151J46595_10000879
1625 JGI25151J46595_10004148
1626 JGI25151J46595_10021299
1627 JGI25165J46597_1000052
1628 JGI25165J46597_1000974
1629 JGI25165J46597_1001602
1630 JGI25153J46596_10002149
1631 JGI25153J46596_10005551
1632 JGI25153J46596_10008231
1633 rootH2_10246162
1634 rootL2_10121384
1635 rootL2_10149035
1636 JGI25160J50197_1000051
1637 JGI25160J50197_1000056
1638 JGI25160J50197_1001318
1639 JGI25160J50197_1015541
1640 JGI25161J50226_1000011
1641 JGI25161J50226_1000451
1642 JGI25161J50226_1008186
1643 Ga0006562J51391_1007063
1644 Ga0055542_1000284
1645 Ga0055526_1000992
1646 Ga0055526_1001114
1647 Ga0055526_1008790
1648 Ga0055526_1010174
1649 Ga0055524_1000962
1650 Ga0055524_1001562
1651 Ga0055524_1018402
1652 Ga0055524_1033601
1653 Ga0055536_1006175
1654 Ga0055528_1000452
1655 Ga0055528_1001012
1656 Ga0055528_1007110
1657 Ga0055528_1032358
1658 Ga0055530_10035600
1659 Ga0055540_1000597
1660 Ga0055540_1002326
1661 Ga0055540_1006982
1662 Ga0055540_1034698
1663 Ga0055531_10001167
1664 Ga0055531_10009790
1665 Ga0055531_10038238
1666 Ga0058692_1001407
1667 Ga0055543_1000041
1668 Ga0055543_1000383
1669 Ga0055543_1003469
1670 Ga0065165_1000155
1671 Ga0065165_1000303
1672 Ga0065165_1003259
1673 Ga0065165_1006555
1674 Ga0065704_10111010
1675 Ga0065715_10475619
1676 Ga0070658_10696390
1677 Ga0070670_100666642
1678 Ga0070666_10007959
1679 Ga0070682_100528440
1680 Ga0070689_100578095
1681 Ga0070668_100175173
1682 Ga0070688_100415242
1683 Ga0070667_100080147
1684 Ga0070667_100686171
1685 Ga0070663_100025431
1686 Ga0070665_100005296
1687 Ga0070665_100025587
1688 Ga0070665_100110656
1689 Ga0070665_100129832
1690 Ga0070665_100209258
1691 Ga0070665_100302093
1692 Ga0070665_100383989
1693 Ga0068855_100160444
1694 Ga0068857_100099313
1695 Ga0068854_100152338
1696 Ga0081539_10000690
1697 Ga0075365_10001383
1698 Ga0075365_10006283
1699 Ga0075365_10021999
1700 Ga0075365_10056247
1701 Ga0075365_10110386
1702 Ga0075365_10111458
1703 Ga0075365_10171604
1704 Ga0075368_10038661
1705 Ga0075368_10095444
1706 Ga0075363_100059964
1707 Ga0075364_10000055
1708 Ga0075364_10007112
1709 Ga0075364_10135744
1710 Ga0075364_10201122
1711 Ga0075362_10029246
1712 Ga0075362_10053779
1713 Ga0075362_10219997
1714 Ga0075367_10000616
1715 Ga0075367_10018532
1716 Ga0075367_10040834
1717 Ga0075367_10187419
1718 Ga0075367_10430036
1719 Ga0075369_10027546
1720 Ga0075369_10093631
1721 Ga0075369_10238633
1722 Ga0075366_10147346
1723 Ga0075370_10002288
1724 Ga0075370_10030861
1725 Ga0075370_10123948
1726 Ga0075370_10161993
1727 Ga0075370_10189824
1728 Ga0079104_1000310
1729 Ga0099826_10000813
1730 Ga0105251_10004120
1731 Ga0105240_10000142
1732 Ga0105240_10086359
1733 Ga0105247_10469224
1734 Ga0105243_10803631
1735 Ga0105241_10427610
1736 Ga0105241_10888833
1737 Ga0105248_10042433
1738 Ga0105248_10648799
1739 Ga0105237_10026327
1740 Ga0105237_10045097
1741 Ga0105238_10005000
1742 Ga0105238_10348810
1743 Ga0105249_10878300
1744 Ga0123341_1000071
1745 Ga0123341_1030290
1746 Ga0123342_1017422
1747 Ga0123342_1020734
1748 Ga0105239_10189932
1749 Ga0105246_10120726
1750 Ga0157373_10132181
1751 Ga0157373_10186282
1752 Ga0157371_10000071
1753 Ga0157371_10018404
1754 Ga0157370_10000079
1755 Ga0157370_10002835
1756 Ga0157370_10013167
1757 Ga0157369_10212209
1758 Ga0157369_10223746
1759 Ga0157369_10258496
1760 Ga0157369_10413286
1761 Ga0171463_1004
1762 Ga0163162_10741260
1763 Ga0157375_11368723
1764 Ga0157380_10336256
1765 Ga0182008_10048871
1766 Ga0182008_10082679
1767 Ga0182007_10025218
1768 Ga0182007_10030312
1769 Ga0182005_1005736
1770 Ga0183363_1217
1771 Ga0214544_1000079
1772 Ga0214542_1000064
1773 Ga0214542_1025627
1774 Ga0214543_1000015
1775 Ga0214543_1000063
1776 Ga0228711_1000030
1777 Ga0228710_1000002
1778 Ga0209435_100031
1779 Ga0209436_100428
1780 Ga0209672_109682
1781 Ga0209563_102041
1782 Ga0209437_100179
1783 Ga0209437_100181
1784 Ga0207425_1000035
1785 Ga0207425_1036699
1786 Ga0207425_1043494
1787 Ga0209646_1000102
1788 Ga0209646_1007221
1789 Ga0209646_1011090
1790 Ga0209026_1000096
1791 Ga0209026_1000141
1792 Ga0209677_100353
1793 Ga0209148_1000111
1794 Ga0209148_1011158
1795 Ga0209759_1000090
1796 Ga0209759_1000354
1797 Ga0209759_1016766
1798 Ga0209129_1000029
1799 Ga0209129_1000050
1800 Ga0209129_1000289
1801 Ga0209129_1000826
1802 Ga0209129_1011574
1803 Ga0209233_1000118
1804 Ga0209233_1000185
1805 Ga0209233_1000212
1806 Ga0209233_1000263
1807 Ga0209233_1012079
1808 Ga0209565_1031235
1809 Ga0209455_1000206
1810 Ga0209673_1000033
1811 Ga0209673_1000050
1812 Ga0209673_1000370
1813 Ga0209673_1001329
1814 Ga0209673_1003533
1815 Ga0209673_1036722
1816 Ga0209130_1000058
1817 Ga0209130_1000133
1818 Ga0209130_1014136
1819 Ga0209675_1016811
1820 Ga0209676_1004127
1821 Ga0209676_1026346
1822 Ga0209025_1000042
1823 Ga0209025_1000132
1824 Ga0209025_1000536
1825 Ga0209025_1000815
1826 Ga0209025_1001644
1827 Ga0209025_1011082
1828 Ga0209025_1016811
1829 Ga0209025_1034273
1830 Ga0209564_1000193
1831 Ga0209564_1000227
1832 Ga0209564_1001108
1833 Ga0209564_1004168
1834 Ga0209564_1007892
1835 Ga0209564_1016233
1836 Ga0209564_1025168
1837 Ga0209758_1000299
1838 Ga0209758_1000406
1839 Ga0209758_1001221
1840 Ga0209758_1006685
1841 Ga0209758_1020820
1842 Ga0209256_1000286
1843 Ga0209256_1000459
1844 Ga0209256_1000737
1845 Ga0209256_1001479
1846 Ga0209256_1001610
1847 Ga0209256_1001820
1848 Ga0209256_1008143
1849 Ga0209256_1014511
1850 Ga0209256_1037176
1851 Ga0207426_1000131
1852 Ga0207426_1000214
1853 Ga0207426_1000248
1854 Ga0207426_1000682
1855 Ga0209051_1000118
1856 Ga0209051_1000547
1857 Ga0209051_1001039
1858 Ga0209051_1023907
1859 Ga0209051_1030652
1860 Ga0209051_1056965
1861 Ga0209257_1002918
1862 Ga0209257_1006107
1863 Ga0209257_1051080
1864 Ga0207680_10066970
1865 Ga0207647_10118235
1866 Ga0207645_10132397
1867 Ga0207654_10094850
1868 Ga0207695_10000234
1869 Ga0207695_10274317
1870 Ga0207671_10000234
1871 Ga0207657_10130056
1872 Ga0207681_10099276
1873 Ga0207694_10234957
1874 Ga0207650_10003285
1875 Ga0207644_10020105
1876 Ga0207709_10159172
1877 Ga0207669_10132781
1878 Ga0207711_10019978
1879 Ga0207667_10703057
1880 Ga0207668_10015020
1881 Ga0207640_10049059
1882 Ga0207658_10123552
1883 Ga0207639_10095427
1884 Ga0207639_10381644
1885 Ga0207639_10460372
1886 Ga0207678_10531181
1887 Ga0207678_10621836
1888 Ga0207702_10585056
1889 Ga0207683_10163901
1890 Ga0209281_1000028
1891 Ga0209281_1000030
1892 Ga0209281_1000144
1893 Ga0209371_1012675
1894 Ga0209282_1000004
1895 Ga0209282_1000695
1896 Ga0209813_10017298
1897 Ga0268266_10007709
1898 Ga0268266_10017844
1899 Ga0268266_10019818
1900 Ga0268266_10054454
1901 Ga0268266_10129394
1902 Ga0268266_10302756
1903 Ga0268266_10337298
1904 Ga0307515_10001049
1905 Ga0307515_10001099
1906 Ga0307515_10012908
1907 Ga0307515_10052107
1908 Ga0316182_1048672
1909 Ga0307513_10000998
1910 Ga0307513_10019403
1911 Ga0307408_100080546
1912 Ga0307408_100277207
1913 Ga0307405_10072649
1914 Ga0307405_10197209
1915 Ga0307405_10500537
1916 Ga0307406_10081707
1917 Ga0307412_10000412
1918 Ga0307412_10033693
1919 Ga0307412_10206314
1920 Ga0315914_1000001
1921 Ga0307416_100072501
1922 Ga0307416_100265449
1923 Ga0307414_10157341
1924 Ga0315913_1000022
1925 Ga0315915_1000002
1926 Ga0373935_0377101
1927 Ga0373927_0000068
1928 Ga0316582_0202578
1929 Ga0373925_0019526
1930 Ga0395899_0000114
1931 Ga0395900_0000154
1932 Ga0395900_0064530
1933 Ga0395900_0275724
1934 Ga0395898_0000308
1935 Ga0395898_0214144
1936 Ga0395905_0000153
1937 Ga0395905_0016023
1938 Ga0395905_0020321
1939 Ga0395905_0421592
1940 Ga0395901_0000107
1941 Ga0395901_0098886
1942 Ga0395901_0760491
1943 Ga0400488_54739
1944 Ga0439436_0035316
1945 Ga0439436_0053881
1946 Ga0439465_0003516
1947 Ga0439465_0022383
1948 Ga0451787_819215
1949 Ga0451791_1888911
1950 Ga0451798_0844921
1951 Ga0451833_1015424
1952 Ga0451835_0212654
1953 Ga0451837_0362518
1954 Ga0451841_0560456
1955 Ga0451845_0256199
1956 Ga0451847_0425469
1957 Ga0451843_0016801
1958 Ga0451855_0116657
1959 Ga0451855_0490172
1960 Ga0451853_0090539
1961 Ga0451853_0525065
1962 Ga0439431_0023820
1963 Ga0439432_048589
1964 Ga0439432_063955
1965 Ga0439449_0009510
1966 Ga0439449_0015237
1967 Ga0439449_0024194
1968 Ga0439449_0051614
1969 Ga0450910_030309
1970 Ga0450918_002726
1971 Ga0466972_0043393
1972 Ga0466972_0092422
1973 Ga0466965_0135054
1974 Ga0466970_0001843
1975 Ga0466958_0033437
1976 Ga0466967_0243209
1977 Ga0495629_0024636
1978 Ga0495638_0000110
1979 Ga0495638_0008972
1980 Ga0495638_0016891
1981 Ga0495638_0016930
1982 Ga0495638_0179534
1983 Ga0495650_0058652
1984 Ga0495605_0020885
1985 Ga0495605_0021385
1986 Ga0495662_0002722
1987 Ga0495585_0020896
1988 Ga0495585_0047785
1989 Ga0495607_0033151
1990 Ga0495583_0009155
1991 Ga0495583_0030481
1992 Ga0495583_0033014
1993 Ga0495606_0001343
1994 Ga0495606_0018735
1995 Ga0495606_0034694
1996 Ga0495606_0053608
1997 Ga0495606_0057744
1998 Ga0495610_0000363
1999 Ga0495610_0032530
2000 Ga0495610_0124802
2001 Ga0495616_0013577
2002 Ga0495620_0018362
2003 Ga0495620_0021545
2004 Ga0495631_0009763
2005 Ga0495632_0010305
2006 Ga0495632_0012878
2007 Ga0495632_0032201
2008 Ga0495632_0112093
2009 Ga0495643_0012962
2010 Ga0495643_0040443
2011 Ga0495643_0041854
2012 Ga0495643_0053035
2013 Ga0495643_0198895
2014 Ga0495654_0000143
2015 Ga0495654_0052791
2016 Ga0495597_0014903
2017 Ga0495622_0108952
2018 Ga0495633_0012534
2019 Ga0495633_0023680
2020 Ga0495633_0026014
2021 Ga0495633_0030588
2022 Ga0495656_0161881
2023 Ga0495668_0006494
2024 Ga0495668_0044298
2025 Ga0495668_0155501
2026 Ga0495611_0015286
2027 Ga0495625_0009878
2028 Ga0495625_0037190
2029 Ga0495625_0037793
2030 Ga0495625_0047572
2031 Ga0495625_0069448
2032 Ga0495625_0136089
2033 Ga0495625_0136351
2034 Ga0495588_0060114
2035 Ga0495588_0076226
2036 Ga0495670_0031756
2037 Ga0495670_0119678
2038 Ga0495671_0096320
2039 Ga0495671_0106058
2040 Ga0495649_0024968
2041 Ga0495649_0036833
2042 Ga0495660_0024851
2043 Ga0495660_0076639
2044 Ga0495660_0101599
2045 Ga0495604_0071336
2046 Ga0495672_0021992
2047 Ga0495676_0125714
2048 Ga0495683_0035335
2049 Ga0495687_036976
2050 Ga0495679_054560
2051 Ga0495685_051700
2052 Ga0495681_0132688
2053 Ga0495686_0001162
2054 Ga0495686_0002138
2055 Ga0495686_0019477
2056 Ga0495686_0022887
2057 Ga0495686_0093720
2058 Ga0495686_0102322
2059 Ga0495626_0087833
2060 Ga0496101_0099713
2061 Ga0496102_0006022
2062 Ga0496103_0005771
2063 Ga0496103_0228393
2064 Ga0496104_0047950
2065 Ga0496106_0001205
2066 Ga0496106_0128107
2067 Ga0496108_0699378
2068 Ga0496112_0416004
2069 Ga0496112_0444826
2070 Ga0496114_0352528
2071 Ga0496114_0503764
2072 Ga0496116_0000057
2073 Ga0496116_0002951
2074 Ga0496116_0010500
2075 Ga0496116_0026331
2076 Ga0496116_0028786
2077 Ga0496116_0043951
2078 Ga0496116_0073273
2079 Ga0496116_0169318
2080 Ga0496117_0000031
2081 Ga0496117_0006996
2082 Ga0496117_0010245
2083 Ga0496117_0011322
2084 Ga0496117_0013741
2085 Ga0496117_0044367
2086 Ga0496117_0077892
2087 Ga0496117_0098692
2088 Ga0496118_0000208
2089 Ga0496118_0004885
2090 Ga0496118_0008237
2091 Ga0496118_0008792
2092 Ga0496118_0035642
2093 Ga0496118_0349701
2094 Ga0496119_0018993
2095 Ga0496119_0028959
2096 Ga0496119_0040159
2097 Ga0496119_0103260
2098 Ga0496119_0112910
2099 Ga0496120_0000387
2100 Ga0496120_0008689
2101 Ga0496120_0008826
2102 Ga0496120_0021630
2103 Ga0496120_0052276
2104 Ga0496120_0078475
2105 Ga0496120_0132906
2106 Ga0496121_0000034
2107 Ga0496121_0000660
2108 Ga0496121_0003956
2109 Ga0496121_0006665
2110 Ga0496121_0013662
2111 Ga0496121_0031118
2112 Ga0496121_0038317
2113 Ga0496121_0045593
2114 Ga0496121_0127676
2115 Ga0496121_0164826
2116 Ga0496121_0335130
2117 Ga0496121_0339532
2118 Ga0496121_0345534
2119 Ga0496121_0478273
2120 Ga0496122_0000023
2121 Ga0496122_0000082
2122 Ga0496122_0000308
2123 Ga0496122_0007901
2124 Ga0496122_0009867
2125 Ga0496122_0015251
2126 Ga0496122_0019377
2127 Ga0496122_0118399
2128 Ga0496122_0196200
2129 Ga0496123_0000027
2130 Ga0496123_0000066
2131 Ga0496123_0000067
2132 Ga0496123_0004280
2133 Ga0496123_0020402
2134 Ga0496123_0033226
2135 Ga0496123_0048158
2136 Ga0496123_0069144
2137 Ga0496123_0093217
2138 Ga0496123_0162797
2139 Ga0496123_0310560
2140 Ga0496124_0000294
2141 Ga0496124_0006387
2142 Ga0496124_0013477
2143 Ga0496124_0015682
2144 Ga0496124_0017122
2145 Ga0496124_0018926
2146 Ga0496124_0019169
2147 Ga0496124_0044025
2148 Ga0496124_0082800
2149 Ga0496124_0091711
2150 Ga0496124_0092571
2151 Ga0496124_0108102
2152 Ga0496124_0309665
2153 Ga0496124_0346893
2154 Ga0496124_0385443
2155 Ga0496125_0000030
2156 Ga0496125_0000288
2157 Ga0496125_0004702
2158 Ga0496125_0028379
2159 Ga0496125_0068570
2160 Ga0496125_0165584
2161 Ga0496125_0178587
2162 Ga0496125_0319155
2163 Ga0496125_0391062
2164 Ga0496126_0000115
2165 Ga0496126_0000258
2166 Ga0496126_0027664
2167 Ga0496126_0080370
2168 Ga0496126_0096937
2169 Ga0496126_0137879
2170 Ga0496126_0142866
2171 Ga0496126_0358229
2172 Ga0495678_006828
2173 Ga0495678_021033
2174 Ga0495678_030619
2175 Ga0501031_0000009
2176 Ga0501031_0010153
2177 Ga0501031_0038930
2178 Ga0501031_0288856
2179 Ga0501032_0000001
2180 Ga0501032_0000017
2181 Ga0501032_0001183
2182 Ga0501032_0003697
2183 Ga0501032_0102231
2184 Ga0501033_0000029
2185 Ga0501033_0000185
2186 Ga0501033_0000898
2187 Ga0501033_0003664
2188 Ga0501033_0006596
2189 Ga0501033_0012136
2190 Ga0501033_0069200
2191 Ga0501033_0132242
2192 Ga0501033_0146882
2193 Ga0501033_0276425
2194 Ga0501034_0000102
2195 Ga0501034_0002200
2196 Ga0501034_0006872
2197 Ga0501034_0008936
2198 Ga0501034_0026220
2199 Ga0501034_0034891
2200 Ga0501034_0145734
2201 Ga0501034_0182645
2202 Ga0501034_0194548
2203 Ga0501034_0248890
2204 Ga0501034_0677738
2205 Ga0501036_0000011
2206 Ga0501036_0000804
2207 Ga0501036_0017357
2208 Ga0501036_0030932
2209 Ga0501036_0539806
2210 Ga0501036_0548337
2211 Ga0501037_0000015
2212 Ga0501037_0000089
2213 Ga0501037_0000091
2214 Ga0501037_0013773
2215 Ga0501037_0079949
2216 Ga0501037_0107380
2217 Ga0501037_0107976
2218 Ga0501038_0000016
2219 Ga0501038_0000402
2220 Ga0501038_0006176
2221 Ga0501038_0086822
2222 Ga0501038_0374949
2223 Ga0501039_0000022
2224 Ga0501039_0000023
2225 Ga0501040_0013506
2226 Ga0501040_0016214
2227 Ga0501040_0153292
2228 Ga0501042_0025138
2229 Ga0501043_0000007
2230 Ga0501043_0000093
2231 Ga0501043_0000372
2232 Ga0501043_0022793
2233 Ga0501043_0041763
2234 Ga0501043_0053247
2235 Ga0501043_0145689
2236 Ga0501043_0264565
2237 Ga0501046_0007948
2238 Ga0501047_0001190
2239 Ga0501047_0013036
2240 Ga0501047_0027682
2241 Ga0501047_0039664
2242 Ga0501047_0050281
2243 Ga0501047_0064245
2244 Ga0501047_0097755
2245 Ga0501048_0042023
2246 Ga0501048_0072183
2247 Ga0501068_0006701
2248 Ga0501068_0286303
2249 Ga0501069_0000001
2250 Ga0501069_0030648
2251 Ga0501070_0000071
2252 Ga0501070_0007877
2253 Ga0501070_0012914
2254 Ga0501070_0053927
2255 Ga0501070_0091303
2256 Ga0501070_0135113
2257 Ga0501070_0152064
2258 Ga0501071_0004661
2259 Ga0501071_0019085
2260 Ga0501072_0084890
2261 Ga0501073_0173391
2262 Ga0501073_0185693
2263 Ga0501074_0000003
2264 Ga0501074_0015071
2265 Ga0501074_0050264
2266 Ga0501074_0142038
2267 Ga0501076_0212233
2268 Ga0501080_0000090
2269 Ga0501080_0001328
2270 Ga0501080_0020052
2271 Ga0501080_0039144
2272 Ga0501080_0049490
2273 Ga0501083_0000012
2274 Ga0501241_009887
2275 Ga0501035_0000037
2276 Ga0501035_0000038
2277 Ga0501035_0000336
2278 Ga0501035_0002574
2279 Ga0501035_0003081
2280 Ga0501035_0008280
2281 Ga0501035_0031602
2282 Ga0501035_0059338
2283 Ga0501035_0074962
2284 Ga0501035_0159278
2285 Ga0501035_0305116
2286 Ga0501035_0651104
2287 Ga0501044_0000018
2288 Ga0501044_0000046
2289 Ga0501044_0002609
2290 Ga0501044_0005144
2291 Ga0501044_0010831
2292 Ga0501044_0011495
2293 Ga0501044_0043443
2294 Ga0501044_0051335
2295 Ga0501044_0101172
2296 Ga0501044_0151471
2297 Ga0501044_0261054
2298 Ga0501045_0002171
2299 Ga0501045_0558517
2300 nmdc:mga03683_26719_c1
2301 nmdc:mga03683_37420_c1
2302 nmdc:mga03n38_171028_c1
2303 nmdc:mga03n38_197274_c1
2304 nmdc:mga03n38_83897_c1
2305 nmdc:mga03n38_9398_c1
2306 nmdc:mga00v17_15_c1
2307 nmdc:mga00v17_175324_c1
2308 nmdc:mga00v17_22162_c1
2309 nmdc:mga00v17_431_c1
2310 nmdc:mga0yw44_169052_c1
2311 nmdc:mga0yw44_215571_c1
2312 nmdc:mga0yw44_247036_c1
2313 nmdc:mga0yw44_458516_c1
2314 nmdc:mga0yw44_46542_c1
2315 nmdc:mga0k408_11620_c1
2316 nmdc:mga0k408_162758_c1
2317 nmdc:mga0k408_295303_c1
2318 nmdc:mga06z11_156743_c1
2319 nmdc:mga06z11_237413_c1
2320 nmdc:mga06z11_389791_c1
2321 nmdc:mga04h51_32633_c1
2322 nmdc:mga04h51_5669_c1
2323 nmdc:mga07m45_185864_c1
2324 nmdc:mga07m45_3170_c1
2325 nmdc:mga07m45_55189_c1
2326 nmdc:mga07m45_68111_c1
2327 nmdc:mga0sz30_27365_c2
2328 nmdc:mga0sz30_68463_c1
2329 nmdc:mga0sz30_735_c1
2330 Ga0495601_0031472
2331 Ga0500610_0014511
2332 Ga0500578_0136371
2333 Ga0500578_0293247
2334 Ga0500644_0134415
2335 Ga0500651_0064159
2336 Ga0500556_0164003
2337 Ga0500557_000347
2338 Ga0500560_151037
2339 Ga0500569_002088
2340 Ga0500594_0008013
2341 Ga0500594_0119746
2342 Ga0500595_110058
2343 Ga0500608_007493
2344 Ga0500618_000701
2345 Ga0500618_007665
2346 Ga0500618_008921
2347 Ga0500618_037997
2348 Ga0500655_000659
2349 Ga0500658_0001061
2350 Ga0500559_0025355
2351 Ga0500561_0000223
2352 Ga0500568_0000010
2353 Ga0500568_0000247
2354 Ga0500568_0005405
2355 Ga0500573_0000793
2356 Ga0500573_0020718
2357 Ga0500604_0035239
2358 Ga0500604_0043624
2359 Ga0500604_0132288
2360 Ga0500616_0000448
2361 Ga0500616_0002118
2362 Ga0500616_0028767
2363 Ga0500616_0061916
2364 Ga0500616_0107217
2365 Ga0500620_000918
2366 Ga0500620_028184
2367 Ga0500622_0000169
2368 Ga0500622_0000441
2369 Ga0500624_000633
2370 Ga0500633_0011581
2371 Ga0500636_0151188
2372 Ga0500611_007007
2373 Ga0500599_013779
2374 Ga0501082_0109221
2375 2503198899
2376 2509108850
2377 2509117923
2378 2509143074
2379 2509371533
2380 2509377980
2381 2509389223
2382 2509393773
2383 2509444782
2384 2509444786
2385 2510135432
2386 2510305833
2387 2510318475
2388 2510896891
2389 2511135834
2390 2511168439
2391 2511185216
2392 2511391887
2393 2511498599
2394 2512534748
2395 2512933707
2396 2512961859
2397 2512973440
2398 2513572869
2399 2513580402
2400 2513586353
2401 2513597837
2402 2513602043
2403 2513613823
2404 2513615832
2405 2513634904
2406 2513711535
2407 2513865116
2408 2513885398
2409 2513904667
2410 2513912914
2411 2513929507
2412 2513983497
2413 2514001708
2414 2514003358
2415 2514023171
2416 2514035461
2417 2514421940
2418 2514586552
2419 2515114604
2420 2515612421
2421 2515634976
2422 2515644460
2423 2515660963
2424 2515741787
2425 2516205707
2426 2516894876
2427 2517038247
2428 2517078525
2429 2517097264
2430 2517408347
2431 2517571557
2432 2520376504
2433 2524450306
2434 2524461196
2435 2530647170
2436 2535485515
2437 2535519225
2438 2551678458
2439 2551685185
2440 2554249001
2441 2558867519
2442 2559296089
2443 2561468562
2444 2585166493
2445 2585201539
2446 2585231860
2447 2585257162
2448 2585267186
2449 2585272076
2450 2585279619
2451 2585327456
2452 2585334005
2453 2585388237
2454 2585396166
2455 2585399952
2456 2585529176
2457 2585535698
2458 2585542993
2459 2585551076
2460 2585563379
2461 2585821041
2462 2585839238
2463 2585845074
2464 2585897200
2465 2585909114
2466 2585998088
2467 2586002667
2468 2587984528
2469 2588519788
2470 2597810856
2471 2599335738
2472 2599419951
2473 2599722649
2474 2599938847
2475 2600193986
2476 2600377453
2477 2601610977
2478 2601747751
2479 2616297536
2480 2616306406
2481 2616551106
2482 2617382337
2483 2643771695
2484 2643777327
2485 2643795775
2486 2643807928
2487 2643814898
2488 2643838035
2489 2643854811
2490 2643985951
2491 2644002656
2492 2644052453
2493 2644068881
2494 2644105750
2495 2644133955
2496 2644146366
2497 2644154438
2498 2644194637
2499 2644201164
2500 2644209677
2501 2644240302
2502 2644299677
2503 2644310363
2504 2644334852
2505 2644378393
2506 2644419952
2507 2644453308
2508 2644484731
2509 2644492546
2510 2644501251
2511 2644521667
2512 2644544954
2513 2644615396
2514 2644653205
2515 2644657905
2516 2644675107
2517 2644688665
2518 2657682298
2519 2671116015
2520 2688596174
2521 2692319826
2522 2694627694
2523 2694636806
2524 2719183143
2525 2719387863
2526 2719667483
2527 2719733860
2528 2720493903
2529 2720615364
2530 2720622152
2531 2720633506
2532 2720777204
2533 2721149255
2534 2721160657
2535 2721166068
2536 2721401496
2537 2722842238
2538 2723028802
2539 2723562415
2540 2723569111
2541 2723573310
2542 2724040310
2543 2724046616
2544 2724091811
2545 2724106376
2546 2724112183
2547 2725945794
2548 2730109738
2549 2730166378
2550 2730300289
2551 2738801011
2552 2738947110
2553 2739037688
2554 2739310277
2555 2753360502
2556 2753458467
2557 2756673567
2558 2757570416
2559 2758642942
2560 2765465775
2561 2766064071
2562 2770199109
2563 2776269513
2564 2776282443
2565 2776915672
2566 2778179230
2567 2792582351
2568 2792621795
2569 2792628948
2570 2792640088
2571 2792747381
2572 2793281844
2573 2793295450
2574 2793317948
2575 2793324576
2576 2793329619
2577 2793332415
2578 2793339009
2579 2793346779
2580 2793356795
2581 2793359193
2582 2793366083
2583 2802717077
2584 2802724935
2585 2802729685
2586 2802737031
2587 2802743436
2588 2802749438
2589 2804753808
2590 2805930922
2591 2805936771
2592 2806047767
2593 2806055343
2594 2806062224
2595 2806070017
2596 2806076683
2597 2808988085
2598 2819244453
2599 2819561099
2600 2819611986
2601 2819638474
2602 2819688374
2603 2821129196
2604 2837651397
2605 2838018143
2606 2838023823
2607 2838034133
2608 2838042001
2609 2838046769
2610 2838050998
2611 2838062764
2612 2838072309
2613 2838668148
2614 2838674242
2615 2838683695
2616 2838693358
2617 2838698223
2618 2838706645
2619 2838711338
2620 2838735352
2621 2838742213
2622 2838748099
2623 2839993416
2624 2840766427
2625 2841736566
2626 2841846069
2627 2841857424
2628 2841867572
2629 2842081139
2630 2842116609
2631 2842122084
2632 2842145773
2633 2842148974
2634 2842162401
2635 2842166898
2636 2842186041
2637 2842194705
2638 2842201178
2639 2842207596
2640 2842221970
2641 2842235500
2642 2842241098
2643 2842249217
2644 2842256436
2645 2842263172
2646 2842269263
2647 2842277826
2648 2842280693
2649 2842290361
2650 2842294796
2651 2842302640
2652 2842305631
2653 2842311601
2654 2842323661
2655 2842346883
2656 2842358858
2657 2842366086
2658 2842375186
2659 2842381194
2660 2842388265
2661 2842395755
2662 2842408195
2663 2842414957
2664 2842421534
2665 2842425941
2666 2842433453
2667 2842439492
2668 2842446200
2669 2842448561
2670 2842467702
2671 2842474334
2672 2842480899
2673 2842485294
2674 2842491353
2675 2842501912
2676 2842507490
2677 2842514678
2678 2842527069
2679 2842874039
2680 2842926474
2681 2844003264
2682 2844010979
2683 2844168166
2684 2844456793
2685 2847420950
2686 2847673592
2687 2847690106
2688 2848995781
2689 2850082764
2690 2852387553
2691 2854897779
2692 2854913713
2693 2854922326
2694 2855827510
2695 2855842885
2696 2855873645
2697 2856318939
2698 2856324053
2699 2856329456
2700 2856339784
2701 2856348115
2702 2856350326
2703 2856362368
2704 2856367372
2705 2857353115
2706 2857374304
2707 2857519773
2708 2857536137
2709 2858803563
2710 2869168649
2711 2869172637
2712 2869240159
2713 2869244616
2714 2869254003
2715 2869259051
2716 2869269856
2717 2869272283
2718 2869283088
2719 2869288513
2720 2871431180
2721 2871436617
2722 2871450407
2723 2871454082
2724 2871464762
2725 2871473483
2726 2871478552
2727 2871487490
2728 2871491586
2729 2871498834
2730 2874107004
2731 2874115773
2732 2874119187
2733 2874126310
2734 2874131562
2735 2874142747
2736 2874150555
2737 2874158295
2738 2874163688
2739 2874170549
2740 2876364038
2741 2876369632
2742 2876386812
2743 2876399073
2744 2876401099
2745 2876408483
2746 2876416603
2747 2876427243
2748 2878039283
2749 2878737300
2750 2878741172
2751 2878747784
2752 2878754798
2753 2878763052
2754 2878770022
2755 2878780005
2756 2878785308
2757 2878794060
2758 2881148386
2759 2881159452
2760 2881165170
2761 2881846395
2762 2881857982
2763 2881864265
2764 2882635221
2765 2882913620
2766 2885307048
2767 2885313952
2768 2885324025
2769 2885330103
2770 2885339042
2771 2885347076
2772 2885356064
2773 2888343559
2774 2888344540
2775 2888353388
2776 2889015104
2777 2889019819
2778 2889795809
2779 2889916355
2780 2891048612
2781 2891377780
2782 2894653710
2783 2896390074
2784 2899805018
2785 2899849440
2786 2903453863
2787 2903500331
2788 2903502265
2789 2903521319
2790 2903525803
2791 2903532651
2792 2903543636
2793 2904579932
2794 2904665600
2795 2906310957
2796 2906323068
2797 2906334034
2798 2906359455
2799 2906370156
2800 2906377846
2801 2906391725
2802 2906395790
2803 2906403243
2804 2906408974
2805 2906419010
2806 2906430649
2807 2913300297
2808 2913312061
2809 2915650600
2810 2915981702
2811 2915991909
2812 2915999555
2813 2916004464
2814 2916013452
2815 2916019876
2816 2916023942
2817 2916031867
2818 2916040508
2819 2916043441
2820 2916050634
2821 2916058702
2822 2916066473
2823 2916074344
2824 2916077657
2825 2919118361
2826 2919120396
2827 2919170447
2828 2919176872
2829 2919411467
2830 2920760204
2831 2920826069
2832 2921205057
2833 2921212019
2834 2921240345
2835 2921245620
2836 2921252791
2837 2921260430
2838 2921267514
2839 2921287321
2840 2921293991
2841 2921302557
2842 2922135207
2843 2922153559
2844 2922164607
2845 2922173246
2846 2922181452
2847 2922193264
2848 2923559957
2849 2924144820
2850 2924157671
2851 2924158771
2852 2924168515
2853 2924175809
2854 2924183456
2855 2924190203
2856 2924193474
2857 2924201457
2858 2924207801
2859 2924214879
2860 2924227144
2861 2924234025
2862 2924716341
2863 2924724509
2864 2924728798
2865 2924740541
2866 2924746489
2867 2924754405
2868 2924759640
2869 2924767540
2870 2924778832
2871 2924791018
2872 2926762055
2873 2928522700
2874 2929142013
2875 2933017803
2876 2933572138
2877 2933592785
2878 2933597422
2879 2933602839
2880 2935898123
2881 2935903435
2882 2936370091
2883 2936379267
2884 2936381755
2885 2936997447
2886 2937004089
2887 2937010374
2888 2937020634
2889 2937023165
2890 2937031714
2891 2937037781
2892 2937043167
2893 2937053550
2894 2937059362
2895 2937070510
2896 2937076106
2897 2937081501
2898 2937090867
2899 2937093357
2900 2937104316
2901 2937113255
2902 2937114255
2903 2937120253
2904 2937129766
2905 2937815526
2906 2937823416
2907 2937838851
2908 2937843735
2909 2937852734
2910 2937862908
2911 2937876038
2912 2937880425
2913 2937893833
2914 2937976123
2915 2937982231
2916 2937997482
2917 2938021800
2918 2941501493
2919 2954013918
2920 2957376781
2921 2957384910
2922 2957395185
2923 2957399720
2924 2957405536
2925 2957411701
2926 2957417458
2927 2957422377
2928 2957430091
2929 2957441681
2930 2957447650
2931 2957454666
2932 2957461011
2933 2957466496
2934 2957475382
2935 2957481440
2936 2957489072
2937 2957494422
2938 2957505161
2939 2957508279
2940 2958039072
2941 2958052143
2942 2958054039
2943 2958070977
2944 2958072344
2945 2958087560
2946 2958102668
2947 2958111097
2948 2958120278
2949 2958123346
2950 2958132915
2951 2958140143
2952 2958149531
2953 2958161558
2954 2958167956
2955 2958173816
2956 2958182617
2957 2960589434
2958 2960592811
2959 2960597886
2960 2960607478
2961 2960613666
2962 2960619080
2963 2960629073
2964 2960634208
2965 2960643572
2966 2960650717
2967 2960655913
2968 2960663968
2969 2960673300
2970 2960674871
2971 2960681736
2972 2960689324
2973 2960700662
2974 2961080465
2975 2961120943
2976 2961134338
2977 2961142817
2978 2961166424
2979 2961171989
2980 2961187726
2981 2963645496
2982 2964608214
2983 2964621658
2984 2964625842
2985 2964629545
2986 2964639234
2987 2964643597
2988 2964655201
2989 2964659990
2990 2964669411
2991 2964676855
2992 2964681668
2993 2964687464
2994 2964695153
2995 2964699171
2996 2964711192
2997 2964712648
2998 2964719769
2999 2965021243
3000 2965026790
3001 2965032541
3002 2965047356
3003 2965052135
3004 2965065250
3005 2965090644
3006 2965104749
3007 2965115034
3008 2965126294
3009 2967668269
3010 2967675618
3011 2967681259
3012 2967692416
3013 2967699410
3014 2967704824
3015 2967713014
3016 2967721207
3017 2967724951
3018 2967731843
3019 2967738474
3020 2967745471
3021 2967752605
3022 2967757758
3023 2967765785
3024 2967770335
3025 2967780504
3026 2967997437
3027 2968006439
3028 2968017447
3029 2968085172
3030 2968093389
3031 2968098181
3032 2968117093
3033 2968122479
3034 2968129513
3035 2968146624
3036 2968174825
3037 2970022000
3038 2970028667
3039 2970038972
3040 2970046610
3041 2970049613
3042 2970058825
3043 2970066749
3044 2970071185
3045 2970076707
3046 2970086760
3047 2970092732
3048 2970101182
3049 2970104600
3050 2970113938
3051 2970118385
3052 2970124495
3053 2970133511
3054 2970140882
3055 2970147346
3056 2970155852
3057 2970161195
3058 2970170744
3059 2970174077
3060 2970182107
3061 2970189128
3062 2970197902
3063 2970472493
3064 2970493588
3065 2970504586
3066 2970511126
3067 2970526261
3068 2970534106
3069 2970546023
3070 2970550885
3071 2970557907
3072 2970597707
3073 2970624066
3074 2970629020
3075 2977520219
3076 2977527408
3077 2977531211
3078 2977544459
3079 2977547481
3080 2977558001
3081 2977564712
3082 2977571323
3083 2977577257
3084 2977583332
3085 2977824015
3086 2977833357
3087 2977846709
3088 2977853073
3089 2977872219
3090 2977876754
3091 2977904704
3092 2977912421
3093 2977915293
3094 2977924727
3095 2977937973
3096 2977945421
3097 2977955404
3098 2977963093
3099 2977988960
3100 2979092676
3101 2979099933
3102 2979748513
3103 2979768015
3104 2979778505
3105 2979780782
3106 2979795277
3107 2979809224
3108 2987641707
3109 2987647731
3110 2987653389
3111 2987662432
3112 2987667144
3113 2987678505
3114 2989355085
3115 2989771770
3116 2995394297
3117 2996311619
3118 2996341611
3119 2996344877
3120 2996349875
3121 2996392755
3122 2996890470
3123 2996896197
3124 3000137565
3125 3002141759
3126 3003931153
3127 3004173493
3128 3004191483
3129 3004201644
3130 3004209481
3131 3004218518
3132 3004223636
3133 3004234211
3134 3004247408
3135 3004251189
3136 3004274382
3137 3004276577
3138 3004296694
3139 3004337058
3140 3005415973
3141 3005416875
3142 3005449857
3143 3005456148
3144 637076820
3145 639645863
3146 643827538
3147 648737319
3148 649870734
3149 650738506
3150 8002286357
3151 8003995466
3152 8004003225
3153 8004303571
3154 8004315131
3155 8004366012
3156 8004376380
3157 8004390482
3158 8004395649
3159 8004450756
3160 8004639903
3161 8004641879
3162 8004701685
3163 8004706567
3164 8004717174
3165 8004731791
3166 8005249423
3167 8005262657
3168 8005282621
3169 8005286564
3170 8005291998
3171 8005306137
3172 8005309711
3173 8005315921
3174 8005324997
3175 8005381379
3176 8005387589
3177 8005398425
3178 8005431974
3179 8005465299
3180 8005487008
3181 8005497877
3182 8005546882
3183 8005561364
3184 8005565986
3185 8005572036
3186 8005623611
3187 8005630828
3188 8005645205
3189 8005669283
3190 8005687349
3191 8005694166
3192 8005695812
3193 8018128657
3194 8018150482
3195 8018164899
3196 8018177661
3197 8023686742
3198 8024484562
3199 8024491025
3200 8024504034
3201 8046768359
3202 8049296408
3203 8054463897
3204 8054559962
3205 8055618118
3206 8056380595
3207 8056383345
3208 8056878372
3209 8057581972
3210 8057879480

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00929

RNase_T

Exonuclease

6

161

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j53-assembly1.cif.gz_A structure of the n-terminal exonuclease domain of the epsilon subunit of e.coli dna polymerase iii at ph 8.5 0.935 3 168
2ido-assembly1.cif.gz_A structure of the e. coli pol iii epsilon-hot proofreading complex 0.9214 1 168
2ido-assembly1.cif.gz_A structure of the e. coli pol iii epsilon-hot proofreading complex 0.8957 1 168
1j53-assembly1.cif.gz_A structure of the n-terminal exonuclease domain of the epsilon subunit of e.coli dna polymerase iii at ph 8.5 0.8886 3 168
8h2f-assembly1.cif.gz_A crystal structure of dnaq domain in complex witn tmp of streptococcus thermophilus strain dgcc 7710 0.8866 2 167
ID Description Score Start End Superfamily
af_B0G161_292_467_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.944 2 167 3.30.420.10
1j54A00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9349 3 168 3.30.420.10
af_Q2FWZ6_2_173_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9132 2 167 3.30.420.10
2p1jB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.905 3 142 3.30.420.10
2p1jB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8928 3 142 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A3S1Z3G1-F1-model_v4 DNA polymerase III subunit epsilon 0.9791 1 122 GO:0003677
GO:0003887
GO:0005829
GO:0008408
GO:0045004
AF-A0A4S0J2H9-F1-model_v4 DNA polymerase III subunit epsilon 0.9774 1 101 GO:0003677
GO:0003887
GO:0005829
GO:0008408
GO:0045004
AF-A0A528EDN1-F1-model_v4 DNA polymerase III subunit epsilon 0.9729 1 85 GO:0003676
GO:0005829
GO:0008408
GO:0016779
GO:0045004
AF-A0A526YWE3-F1-model_v4 DNA polymerase III subunit epsilon 0.9722 1 90 GO:0003677
GO:0003887
GO:0005829
GO:0008408
GO:0045004
AF-A0A833G6F0-F1-model_v4 Exonuclease domain-containing protein 0.9713 1 111 GO:0003677
GO:0003887
GO:0005829
GO:0008408
GO:0016020
GO:0045004

Map