F495018
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1605 | 439 | 3210 | 273 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10005609|Ga0157370_1000560911 |
| Length | 305 |
| Sequence | MRGLQAPVSKRDLSRSVGFDCRFTYIASMTQYISVAADDRVEAKNGIIKLHGPEGLAGMRRAGRLAAEILDSLAPHVVPGVSTQQLDDIVYKMTLDAGGLPATLGYRGYPKSCCISINHVVCHGIPSEQRVLKSGDIVNIDVTPILDCWHGDTSRMYLVGDVPLKARKLVDVTYECLMLGLEQAKPGNHLGDIANAIQRHAESNRYSVVRDFCGHGVGRVFHDSPEVIHAGKPGTGPELKPGMIFTVEPMINIGRADVKVLEDGWTAVTRDRSLSAQFEHSIGITQTGCEIFTKSPAGLDRPPYA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 10 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 13 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 14 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 15 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 16 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 19 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 20 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 24 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 25 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 26 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 27 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 85 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 91 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 92 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 100 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 101 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 102 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 105 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 140 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 141 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 142 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 143 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 220 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 225 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 226 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 228 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 229 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 230 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 231 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 232 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 233 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 234 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 235 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 236 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 237 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 238 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 239 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 240 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 241 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 243 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 244 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 245 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 246 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 247 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 248 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 249 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 250 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 251 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 252 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 253 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 255 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 256 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 257 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 258 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 259 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 260 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 262 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 264 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 265 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 266 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 267 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 268 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 269 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 270 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 271 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 272 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 273 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 274 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 275 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 276 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 277 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 278 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 279 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 280 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 281 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 282 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 283 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 284 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 285 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 286 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 287 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 288 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 289 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 290 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 291 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 292 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 293 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 294 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 295 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 296 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 297 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 298 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 299 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 300 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 301 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 302 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 303 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 304 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 305 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 306 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 327 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 328 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 329 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 330 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 331 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 334 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 335 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 336 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 337 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 338 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 339 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 340 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 341 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 342 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 343 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 344 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 345 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 346 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 347 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 349 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 370 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 371 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 372 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 373 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 374 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 375 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 376 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 377 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 378 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 379 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 380 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 381 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 382 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 383 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 384 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 385 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 390 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 391 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 392 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 393 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 394 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 395 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 399 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 400 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 401 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 402 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 407 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 408 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 409 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 410 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 411 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 412 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 413 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 414 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 415 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 416 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 417 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 418 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 419 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 420 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 421 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 422 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 425 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 426 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 427 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 428 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 429 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 430 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 431 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 432 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 433 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 434 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 435 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 436 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 437 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 438 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 439 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.19 |
| Metatranscriptomes | 0.87 |
| Isolates | 0.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.68 |
| Nodule | 0.12 |
| Rhizoplane | 4.55 |
| Rhizosphere | 88.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157370_10005609 | 3300013104 | Bacteria | 14050 |
| 2 | LJQas_1004738 | 3300000549 | Bacteria | 1758 |
| 3 | JGI24736J21556_1001107 | 3300001904 | Bacteria | 4939 |
| 4 | JGI24741J21665_1012174 | 3300001915 | Bacteria | 1485 |
| 5 | JGI24752J21851_1007184 | 3300001976 | Bacteria | 1452 |
| 6 | JGI24740J21852_10011276 | 3300001979 | Bacteria | 3407 |
| 7 | JGI24740J21852_10050555 | 3300001979 | Bacteria | 1195 |
| 8 | JGI24739J22299_10001179 | 3300001989 | Bacteria | 9782 |
| 9 | JGI24737J22298_10000046 | 3300001990 | Bacteria | 34636 |
| 10 | JGI24737J22298_10000144 | 3300001990 | Bacteria | 22021 |
| 11 | JGI24737J22298_10012849 | 3300001990 | Bacteria | 2730 |
| 12 | JGI24737J22298_10050156 | 3300001990 | Bacteria | 1269 |
| 13 | JGI24743J22301_10018929 | 3300001991 | Bacteria | 1305 |
| 14 | JGI24735J21928_10008760 | 3300002067 | Bacteria | 3264 |
| 15 | JGI24735J21928_10023798 | 3300002067 | Bacteria | 1857 |
| 16 | JGI24735J21928_10041445 | 3300002067 | Bacteria | 1342 |
| 17 | JGI24735J21928_10049491 | 3300002067 | Bacteria | 1214 |
| 18 | JGI24738J21930_10010536 | 3300002075 | Bacteria | 2055 |
| 19 | JGI24744J21845_10000547 | 3300002077 | Bacteria | 6755 |
| 20 | JGI24751J29686_10028440 | 3300002459 | Bacteria | 1161 |
| 21 | JGI25150J39212_1000701 | 3300002774 | Bacteria | 12140 |
| 22 | JGI25151J46595_10027072 | 3300003187 | Bacteria | 2305 |
| 23 | JGI25406J46586_10009729 | 3300003203 | Bacteria | 4297 |
| 24 | JGI25153J46596_10000196 | 3300003215 | Bacteria | 57182 |
| 25 | rootL2_10012690 | 3300003322 | Bacteria | 4228 |
| 26 | rootH1_10079078 | 3300003323 | Bacteria | 3304 |
| 27 | Ga0055536_1018345 | 3300003781 | Bacteria | 2246 |
| 28 | Ga0055540_1000907 | 3300003792 | Bacteria | 19487 |
| 29 | Ga0055531_10000021 | 3300003794 | Bacteria | 167213 |
| 30 | Ga0058863_11714062 | 3300004799 | Bacteria | 1026 |
| 31 | Ga0058861_11993753 | 3300004800 | Bacteria | 1053 |
| 32 | Ga0058862_12098551 | 3300004803 | Bacteria | 1029 |
| 33 | Ga0065712_10117326 | 3300005290 | Bacteria | 1722 |
| 34 | Ga0065712_10177284 | 3300005290 | Bacteria | 1211 |
| 35 | Ga0065707_10000499 | 3300005295 | Bacteria | 40457 |
| 36 | Ga0065707_10082284 | 3300005295 | Bacteria | 17401 |
| 37 | Ga0065707_10097429 | 3300005295 | Bacteria | 3174 |
| 38 | Ga0070658_10000001 | 3300005327 | Bacteria | 856789 |
| 39 | Ga0070658_10001597 | 3300005327 | Bacteria | 19154 |
| 40 | Ga0070658_10004859 | 3300005327 | Bacteria | 10944 |
| 41 | Ga0070658_10050747 | 3300005327 | Bacteria | 3363 |
| 42 | Ga0070658_10083539 | 3300005327 | Bacteria | 2625 |
| 43 | Ga0070658_10106638 | 3300005327 | Bacteria | 2318 |
| 44 | Ga0070658_10107235 | 3300005327 | Bacteria | 2311 |
| 45 | Ga0070658_10177363 | 3300005327 | Bacteria | 1792 |
| 46 | Ga0070658_10294338 | 3300005327 | Bacteria | 1384 |
| 47 | Ga0070658_10428873 | 3300005327 | Bacteria | 1138 |
| 48 | Ga0070658_10553707 | 3300005327 | Bacteria | 995 |
| 49 | Ga0070676_10008390 | 3300005328 | Bacteria | 5568 |
| 50 | Ga0070676_10009125 | 3300005328 | Bacteria | 5365 |
| 51 | Ga0070676_10055026 | 3300005328 | Bacteria | 2347 |
| 52 | Ga0070676_10232010 | 3300005328 | Bacteria | 1224 |
| 53 | Ga0070683_100015692 | 3300005329 | Bacteria | 6660 |
| 54 | Ga0070683_100065681 | 3300005329 | Bacteria | 3378 |
| 55 | Ga0070683_100422038 | 3300005329 | Bacteria | 1272 |
| 56 | Ga0070690_100020627 | 3300005330 | Bacteria | 4016 |
| 57 | Ga0070690_100056501 | 3300005330 | Bacteria | 2517 |
| 58 | Ga0070690_100236747 | 3300005330 | Bacteria | 1286 |
| 59 | Ga0070670_100047328 | 3300005331 | Bacteria | 3700 |
| 60 | Ga0070670_100080022 | 3300005331 | Bacteria | 2808 |
| 61 | Ga0070670_100108075 | 3300005331 | Bacteria | 2397 |
| 62 | Ga0070670_100449324 | 3300005331 | Bacteria | 1142 |
| 63 | Ga0070670_100474796 | 3300005331 | Bacteria | 1110 |
| 64 | Ga0070677_10131526 | 3300005333 | Bacteria | 1143 |
| 65 | Ga0068869_100000248 | 3300005334 | Bacteria | 28582 |
| 66 | Ga0068869_100222574 | 3300005334 | Bacteria | 1496 |
| 67 | Ga0070666_10000381 | 3300005335 | Bacteria | 27905 |
| 68 | Ga0070666_10001831 | 3300005335 | Bacteria | 12959 |
| 69 | Ga0070666_10018453 | 3300005335 | Bacteria | 4487 |
| 70 | Ga0070666_10026728 | 3300005335 | Bacteria | 3774 |
| 71 | Ga0070666_10035612 | 3300005335 | Bacteria | 3301 |
| 72 | Ga0070666_10040320 | 3300005335 | Bacteria | 3116 |
| 73 | Ga0070666_10317357 | 3300005335 | Bacteria | 1111 |
| 74 | Ga0070680_100000081 | 3300005336 | Bacteria | 52556 |
| 75 | Ga0070680_100004762 | 3300005336 | Bacteria | 10214 |
| 76 | Ga0070680_100015293 | 3300005336 | Bacteria | 6013 |
| 77 | Ga0070680_100015773 | 3300005336 | Bacteria | 5931 |
| 78 | Ga0070680_100051207 | 3300005336 | Bacteria | 3369 |
| 79 | Ga0070680_100057907 | 3300005336 | Bacteria | 3169 |
| 80 | Ga0070680_100064511 | 3300005336 | Bacteria | 3002 |
| 81 | Ga0070680_100080069 | 3300005336 | Bacteria | 2694 |
| 82 | Ga0070680_100157302 | 3300005336 | Bacteria | 1909 |
| 83 | Ga0070680_100231629 | 3300005336 | Bacteria | 1560 |
| 84 | Ga0070682_100017648 | 3300005337 | Bacteria | 4162 |
| 85 | Ga0070682_100050955 | 3300005337 | Bacteria | 2586 |
| 86 | Ga0070682_100091351 | 3300005337 | Bacteria | 1993 |
| 87 | Ga0070682_100464551 | 3300005337 | Bacteria | 972 |
| 88 | Ga0068868_100000638 | 3300005338 | Bacteria | 23609 |
| 89 | Ga0068868_100002486 | 3300005338 | Bacteria | 12791 |
| 90 | Ga0068868_100012819 | 3300005338 | Bacteria | 6133 |
| 91 | Ga0068868_100016220 | 3300005338 | Bacteria | 5527 |
| 92 | Ga0068868_100048439 | 3300005338 | Bacteria | 3333 |
| 93 | Ga0068868_100061996 | 3300005338 | Bacteria | 2963 |
| 94 | Ga0068868_100140909 | 3300005338 | Bacteria | 1979 |
| 95 | Ga0070660_100000039 | 3300005339 | Bacteria | 76157 |
| 96 | Ga0070660_100000596 | 3300005339 | Bacteria | 24197 |
| 97 | Ga0070660_100006325 | 3300005339 | Bacteria | 8203 |
| 98 | Ga0070660_100006837 | 3300005339 | Bacteria | 7912 |
| 99 | Ga0070660_100010785 | 3300005339 | Bacteria | 6469 |
| 100 | Ga0070660_100015799 | 3300005339 | Bacteria | 5461 |
| 101 | Ga0070660_100046290 | 3300005339 | Bacteria | 3334 |
| 102 | Ga0070660_100051072 | 3300005339 | Bacteria | 3183 |
| 103 | Ga0070660_100053647 | 3300005339 | Bacteria | 3110 |
| 104 | Ga0070660_100070079 | 3300005339 | Bacteria | 2735 |
| 105 | Ga0070660_100073099 | 3300005339 | Bacteria | 2681 |
| 106 | Ga0070660_100101765 | 3300005339 | Bacteria | 2277 |
| 107 | Ga0070660_100106413 | 3300005339 | Bacteria | 2228 |
| 108 | Ga0070660_100155798 | 3300005339 | Bacteria | 1838 |
| 109 | Ga0070660_100210874 | 3300005339 | Bacteria | 1577 |
| 110 | Ga0070689_100148501 | 3300005340 | Bacteria | 1889 |
| 111 | Ga0070689_100258406 | 3300005340 | Bacteria | 1439 |
| 112 | Ga0070691_10009897 | 3300005341 | Bacteria | 4343 |
| 113 | Ga0070691_10041532 | 3300005341 | Bacteria | 2174 |
| 114 | Ga0070661_100000009 | 3300005344 | Bacteria | 181351 |
| 115 | Ga0070661_100008809 | 3300005344 | Bacteria | 6983 |
| 116 | Ga0070661_100008823 | 3300005344 | Bacteria | 6976 |
| 117 | Ga0070661_100019749 | 3300005344 | Bacteria | 4802 |
| 118 | Ga0070661_100035443 | 3300005344 | Bacteria | 3623 |
| 119 | Ga0070661_100056510 | 3300005344 | Bacteria | 2876 |
| 120 | Ga0070661_100059054 | 3300005344 | Bacteria | 2811 |
| 121 | Ga0070661_100092995 | 3300005344 | Bacteria | 2235 |
| 122 | Ga0070661_100129737 | 3300005344 | Bacteria | 1893 |
| 123 | Ga0070661_100218562 | 3300005344 | Bacteria | 1461 |
| 124 | Ga0070661_100240686 | 3300005344 | Bacteria | 1393 |
| 125 | Ga0070692_10005876 | 3300005345 | Bacteria | 5280 |
| 126 | Ga0070668_100000048 | 3300005347 | Bacteria | 75276 |
| 127 | Ga0070668_100043246 | 3300005347 | Bacteria | 3455 |
| 128 | Ga0070669_100003550 | 3300005353 | Bacteria | 11253 |
| 129 | Ga0070669_100021133 | 3300005353 | Bacteria | 4651 |
| 130 | Ga0070669_100077138 | 3300005353 | Bacteria | 2475 |
| 131 | Ga0070669_100227785 | 3300005353 | Bacteria | 1476 |
| 132 | Ga0070675_100000913 | 3300005354 | Bacteria | 20987 |
| 133 | Ga0070675_100072925 | 3300005354 | Bacteria | 2850 |
| 134 | Ga0070675_100142616 | 3300005354 | Bacteria | 2049 |
| 135 | Ga0070675_100230945 | 3300005354 | Bacteria | 1614 |
| 136 | Ga0070675_100348052 | 3300005354 | Bacteria | 1314 |
| 137 | Ga0070671_100000492 | 3300005355 | Bacteria | 27614 |
| 138 | Ga0070671_100000860 | 3300005355 | Bacteria | 22151 |
| 139 | Ga0070671_100001033 | 3300005355 | Bacteria | 20484 |
| 140 | Ga0070671_100005525 | 3300005355 | Bacteria | 10069 |
| 141 | Ga0070671_100011713 | 3300005355 | Bacteria | 7053 |
| 142 | Ga0070671_100022902 | 3300005355 | Bacteria | 5105 |
| 143 | Ga0070671_100033981 | 3300005355 | Bacteria | 4220 |
| 144 | Ga0070671_100056215 | 3300005355 | Bacteria | 3274 |
| 145 | Ga0070671_100127994 | 3300005355 | Bacteria | 2138 |
| 146 | Ga0070671_100183497 | 3300005355 | Bacteria | 1772 |
| 147 | Ga0070674_100014377 | 3300005356 | Bacteria | 4922 |
| 148 | Ga0070674_100026131 | 3300005356 | Bacteria | 3809 |
| 149 | Ga0070674_100072023 | 3300005356 | Bacteria | 2446 |
| 150 | Ga0070674_100251989 | 3300005356 | Bacteria | 1387 |
| 151 | Ga0070673_100002642 | 3300005364 | Bacteria | 10962 |
| 152 | Ga0070673_100054862 | 3300005364 | Bacteria | 3137 |
| 153 | Ga0070673_100090163 | 3300005364 | Bacteria | 2504 |
| 154 | Ga0070673_100115071 | 3300005364 | Bacteria | 2236 |
| 155 | Ga0070673_100222719 | 3300005364 | Bacteria | 1633 |
| 156 | Ga0070673_100236991 | 3300005364 | Bacteria | 1585 |
| 157 | Ga0070673_100329494 | 3300005364 | Bacteria | 1350 |
| 158 | Ga0070673_100375767 | 3300005364 | Bacteria | 1266 |
| 159 | Ga0070659_100001925 | 3300005366 | Bacteria | 14830 |
| 160 | Ga0070659_100003113 | 3300005366 | Bacteria | 11801 |
| 161 | Ga0070659_100016142 | 3300005366 | Bacteria | 5603 |
| 162 | Ga0070659_100019299 | 3300005366 | Bacteria | 5163 |
| 163 | Ga0070659_100019630 | 3300005366 | Bacteria | 5126 |
| 164 | Ga0070659_100019664 | 3300005366 | Bacteria | 5122 |
| 165 | Ga0070659_100034417 | 3300005366 | Bacteria | 3941 |
| 166 | Ga0070659_100069013 | 3300005366 | Bacteria | 2805 |
| 167 | Ga0070659_100081050 | 3300005366 | Bacteria | 2592 |
| 168 | Ga0070659_100366209 | 3300005366 | Bacteria | 1212 |
| 169 | Ga0070667_100000363 | 3300005367 | Bacteria | 49379 |
| 170 | Ga0070667_100000915 | 3300005367 | Bacteria | 27247 |
| 171 | Ga0070667_100001034 | 3300005367 | Bacteria | 25405 |
| 172 | Ga0070667_100001800 | 3300005367 | Bacteria | 19079 |
| 173 | Ga0070667_100002455 | 3300005367 | Bacteria | 16189 |
| 174 | Ga0070667_100003445 | 3300005367 | Bacteria | 13477 |
| 175 | Ga0070667_100017753 | 3300005367 | Bacteria | 5897 |
| 176 | Ga0070667_100084129 | 3300005367 | Bacteria | 2727 |
| 177 | Ga0070667_100096210 | 3300005367 | Bacteria | 2553 |
| 178 | Ga0070667_100110842 | 3300005367 | Bacteria | 2379 |
| 179 | Ga0070667_100115081 | 3300005367 | Bacteria | 2335 |
| 180 | Ga0070667_100141190 | 3300005367 | Bacteria | 2109 |
| 181 | Ga0070709_10006352 | 3300005434 | Bacteria | 6435 |
| 182 | Ga0070709_10025490 | 3300005434 | Bacteria | 3495 |
| 183 | Ga0070709_10114766 | 3300005434 | Bacteria | 1816 |
| 184 | Ga0070709_10119281 | 3300005434 | Bacteria | 1785 |
| 185 | Ga0070709_10139194 | 3300005434 | Bacteria | 1666 |
| 186 | Ga0070714_100013482 | 3300005435 | Bacteria | 6551 |
| 187 | Ga0070714_100077928 | 3300005435 | Bacteria | 2880 |
| 188 | Ga0070714_100118597 | 3300005435 | Bacteria | 2351 |
| 189 | Ga0070714_100428699 | 3300005435 | Bacteria | 1254 |
| 190 | Ga0070713_100002739 | 3300005436 | Bacteria | 11513 |
| 191 | Ga0070713_100031229 | 3300005436 | Bacteria | 4241 |
| 192 | Ga0070713_100067606 | 3300005436 | Bacteria | 3009 |
| 193 | Ga0070713_100318538 | 3300005436 | Bacteria | 1436 |
| 194 | Ga0070710_10260518 | 3300005437 | Bacteria | 1118 |
| 195 | Ga0070711_100058122 | 3300005439 | Bacteria | 2680 |
| 196 | Ga0070694_100183080 | 3300005444 | Bacteria | 1551 |
| 197 | Ga0070663_100001101 | 3300005455 | Bacteria | 14847 |
| 198 | Ga0070663_100022927 | 3300005455 | Bacteria | 4179 |
| 199 | Ga0070663_100024555 | 3300005455 | Bacteria | 4059 |
| 200 | Ga0070663_100040471 | 3300005455 | Bacteria | 3263 |
| 201 | Ga0070663_100114931 | 3300005455 | Bacteria | 2027 |
| 202 | Ga0070663_100120055 | 3300005455 | Bacteria | 1985 |
| 203 | Ga0070678_100028164 | 3300005456 | Bacteria | 3827 |
| 204 | Ga0070678_100291796 | 3300005456 | Bacteria | 1383 |
| 205 | Ga0070662_100000077 | 3300005457 | Bacteria | 53803 |
| 206 | Ga0070662_100004226 | 3300005457 | Bacteria | 9052 |
| 207 | Ga0070662_100017342 | 3300005457 | Bacteria | 4854 |
| 208 | Ga0070662_100034607 | 3300005457 | Bacteria | 3563 |
| 209 | Ga0070662_100116204 | 3300005457 | Bacteria | 2044 |
| 210 | Ga0070662_100244923 | 3300005457 | Bacteria | 1439 |
| 211 | Ga0070662_100246120 | 3300005457 | Bacteria | 1435 |
| 212 | Ga0070662_100542109 | 3300005457 | Bacteria | 974 |
| 213 | Ga0070681_10002023 | 3300005458 | Bacteria | 18354 |
| 214 | Ga0070681_10003522 | 3300005458 | Bacteria | 14664 |
| 215 | Ga0070681_10021321 | 3300005458 | Bacteria | 6495 |
| 216 | Ga0070681_10022034 | 3300005458 | Bacteria | 6393 |
| 217 | Ga0070681_10055363 | 3300005458 | Bacteria | 3949 |
| 218 | Ga0070681_10063064 | 3300005458 | Bacteria | 3679 |
| 219 | Ga0070681_10079117 | 3300005458 | Bacteria | 3244 |
| 220 | Ga0070681_10079732 | 3300005458 | Bacteria | 3230 |
| 221 | Ga0070681_10093902 | 3300005458 | Bacteria | 2949 |
| 222 | Ga0070681_10248312 | 3300005458 | Bacteria | 1692 |
| 223 | Ga0068867_100012318 | 3300005459 | Bacteria | 6049 |
| 224 | Ga0068867_100018339 | 3300005459 | Bacteria | 4974 |
| 225 | Ga0068867_100095721 | 3300005459 | Bacteria | 2259 |
| 226 | Ga0070699_100014057 | 3300005518 | Bacteria | 6887 |
| 227 | Ga0070679_100000031 | 3300005530 | Bacteria | 107526 |
| 228 | Ga0070679_100006962 | 3300005530 | Bacteria | 10552 |
| 229 | Ga0070679_100054990 | 3300005530 | Bacteria | 3964 |
| 230 | Ga0070679_100070381 | 3300005530 | Bacteria | 3490 |
| 231 | Ga0070679_100092141 | 3300005530 | Bacteria | 3018 |
| 232 | Ga0070679_100093706 | 3300005530 | Bacteria | 2990 |
| 233 | Ga0070679_100096575 | 3300005530 | Bacteria | 2943 |
| 234 | Ga0070679_100126321 | 3300005530 | Bacteria | 2540 |
| 235 | Ga0070679_100216875 | 3300005530 | Bacteria | 1876 |
| 236 | Ga0070684_100043998 | 3300005535 | Bacteria | 3859 |
| 237 | Ga0070684_100056140 | 3300005535 | Bacteria | 3435 |
| 238 | Ga0070684_100114544 | 3300005535 | Bacteria | 2420 |
| 239 | Ga0070684_100115069 | 3300005535 | Bacteria | 2415 |
| 240 | Ga0070684_100478126 | 3300005535 | Bacteria | 1153 |
| 241 | Ga0068853_100006336 | 3300005539 | Bacteria | 9391 |
| 242 | Ga0068853_100008076 | 3300005539 | Bacteria | 8442 |
| 243 | Ga0068853_100029886 | 3300005539 | Bacteria | 4597 |
| 244 | Ga0068853_100036478 | 3300005539 | Bacteria | 4182 |
| 245 | Ga0068853_100066571 | 3300005539 | Bacteria | 3129 |
| 246 | Ga0068853_100090534 | 3300005539 | Bacteria | 2689 |
| 247 | Ga0068853_100208194 | 3300005539 | Bacteria | 1782 |
| 248 | Ga0068853_100279599 | 3300005539 | Bacteria | 1538 |
| 249 | Ga0068853_100899773 | 3300005539 | Bacteria | 850 |
| 250 | Ga0070672_100003257 | 3300005543 | Bacteria | 10508 |
| 251 | Ga0070672_100003621 | 3300005543 | Bacteria | 10023 |
| 252 | Ga0070672_100022583 | 3300005543 | Bacteria | 4624 |
| 253 | Ga0070672_100403882 | 3300005543 | Bacteria | 1171 |
| 254 | Ga0070686_100099037 | 3300005544 | Bacteria | 1966 |
| 255 | Ga0070695_100136216 | 3300005545 | Bacteria | 1698 |
| 256 | Ga0070696_100018654 | 3300005546 | Bacteria | 4692 |
| 257 | Ga0070693_100061023 | 3300005547 | Bacteria | 2191 |
| 258 | Ga0070665_100001581 | 3300005548 | Bacteria | 26245 |
| 259 | Ga0070665_100003133 | 3300005548 | Bacteria | 17806 |
| 260 | Ga0070665_100007755 | 3300005548 | Bacteria | 10897 |
| 261 | Ga0070665_100008963 | 3300005548 | Bacteria | 10136 |
| 262 | Ga0070665_100009801 | 3300005548 | Bacteria | 9686 |
| 263 | Ga0070665_100011210 | 3300005548 | Bacteria | 9064 |
| 264 | Ga0070665_100058842 | 3300005548 | Bacteria | 3852 |
| 265 | Ga0070665_100134878 | 3300005548 | Bacteria | 2471 |
| 266 | Ga0070665_100198317 | 3300005548 | Bacteria | 2008 |
| 267 | Ga0070665_100533529 | 3300005548 | Bacteria | 1185 |
| 268 | Ga0070704_100065882 | 3300005549 | Bacteria | 2610 |
| 269 | Ga0068855_100000135 | 3300005563 | Bacteria | 94502 |
| 270 | Ga0068855_100000789 | 3300005563 | Bacteria | 39145 |
| 271 | Ga0068855_100001165 | 3300005563 | Bacteria | 32593 |
| 272 | Ga0068855_100009575 | 3300005563 | Bacteria | 11690 |
| 273 | Ga0068855_100016755 | 3300005563 | Bacteria | 8814 |
| 274 | Ga0068855_100019907 | 3300005563 | Bacteria | 8059 |
| 275 | Ga0068855_100025830 | 3300005563 | Bacteria | 7023 |
| 276 | Ga0068855_100041991 | 3300005563 | Bacteria | 5419 |
| 277 | Ga0070664_100003529 | 3300005564 | Bacteria | 12625 |
| 278 | Ga0070664_100008493 | 3300005564 | Bacteria | 8304 |
| 279 | Ga0070664_100041322 | 3300005564 | Bacteria | 3891 |
| 280 | Ga0070664_100047682 | 3300005564 | Bacteria | 3620 |
| 281 | Ga0070664_100048561 | 3300005564 | Bacteria | 3586 |
| 282 | Ga0070664_100059290 | 3300005564 | Bacteria | 3256 |
| 283 | Ga0070664_100076492 | 3300005564 | Bacteria | 2876 |
| 284 | Ga0070664_100098888 | 3300005564 | Bacteria | 2535 |
| 285 | Ga0070664_100101155 | 3300005564 | Bacteria | 2506 |
| 286 | Ga0070664_100106890 | 3300005564 | Bacteria | 2439 |
| 287 | Ga0068857_100000555 | 3300005577 | Bacteria | 27265 |
| 288 | Ga0068857_100002899 | 3300005577 | Bacteria | 14123 |
| 289 | Ga0068857_100016286 | 3300005577 | Bacteria | 6513 |
| 290 | Ga0068857_100040921 | 3300005577 | Bacteria | 4108 |
| 291 | Ga0068857_100140765 | 3300005577 | Bacteria | 2180 |
| 292 | Ga0068857_100155652 | 3300005577 | Bacteria | 2072 |
| 293 | Ga0068857_100331672 | 3300005577 | Bacteria | 1406 |
| 294 | Ga0068854_100001637 | 3300005578 | Bacteria | 13623 |
| 295 | Ga0068854_100002406 | 3300005578 | Bacteria | 11546 |
| 296 | Ga0068854_100009733 | 3300005578 | Bacteria | 6213 |
| 297 | Ga0068854_100023622 | 3300005578 | Bacteria | 4201 |
| 298 | Ga0068854_100050636 | 3300005578 | Bacteria | 2973 |
| 299 | Ga0068854_100063809 | 3300005578 | Bacteria | 2675 |
| 300 | Ga0068854_100085704 | 3300005578 | Bacteria | 2333 |
| 301 | Ga0068854_100113560 | 3300005578 | Bacteria | 2046 |
| 302 | Ga0068856_100040544 | 3300005614 | Bacteria | 4574 |
| 303 | Ga0068856_100045466 | 3300005614 | Bacteria | 4323 |
| 304 | Ga0068856_100059987 | 3300005614 | Bacteria | 3758 |
| 305 | Ga0068856_100077188 | 3300005614 | Bacteria | 3300 |
| 306 | Ga0068856_100090898 | 3300005614 | Bacteria | 3037 |
| 307 | Ga0068856_100099313 | 3300005614 | Bacteria | 2902 |
| 308 | Ga0068856_100274254 | 3300005614 | Bacteria | 1703 |
| 309 | Ga0068856_100317759 | 3300005614 | Bacteria | 1575 |
| 310 | Ga0068856_100432976 | 3300005614 | Bacteria | 1335 |
| 311 | Ga0068856_100535736 | 3300005614 | Bacteria | 1192 |
| 312 | Ga0068852_100000585 | 3300005616 | Bacteria | 24010 |
| 313 | Ga0068852_100002847 | 3300005616 | Bacteria | 11997 |
| 314 | Ga0068852_100003152 | 3300005616 | Bacteria | 11500 |
| 315 | Ga0068852_100004872 | 3300005616 | Bacteria | 9532 |
| 316 | Ga0068852_100022981 | 3300005616 | Bacteria | 5010 |
| 317 | Ga0068852_100029135 | 3300005616 | Bacteria | 4530 |
| 318 | Ga0068852_100030523 | 3300005616 | Bacteria | 4438 |
| 319 | Ga0068852_100062026 | 3300005616 | Bacteria | 3250 |
| 320 | Ga0068852_100099856 | 3300005616 | Bacteria | 2617 |
| 321 | Ga0068852_100159516 | 3300005616 | Bacteria | 2105 |
| 322 | Ga0068852_100351348 | 3300005616 | Bacteria | 1440 |
| 323 | Ga0068859_100000843 | 3300005617 | Bacteria | 31176 |
| 324 | Ga0068859_100002246 | 3300005617 | Bacteria | 19594 |
| 325 | Ga0068859_100010758 | 3300005617 | Bacteria | 9211 |
| 326 | Ga0068859_100027052 | 3300005617 | Bacteria | 5753 |
| 327 | Ga0068859_100035841 | 3300005617 | Bacteria | 4979 |
| 328 | Ga0068859_100045999 | 3300005617 | Bacteria | 4384 |
| 329 | Ga0068864_100001488 | 3300005618 | Bacteria | 19304 |
| 330 | Ga0068864_100002545 | 3300005618 | Bacteria | 15051 |
| 331 | Ga0068864_100009367 | 3300005618 | Bacteria | 8079 |
| 332 | Ga0068864_100011444 | 3300005618 | Bacteria | 7329 |
| 333 | Ga0068864_100035565 | 3300005618 | Bacteria | 4240 |
| 334 | Ga0068864_100274950 | 3300005618 | Bacteria | 1570 |
| 335 | Ga0068864_100320388 | 3300005618 | Bacteria | 1456 |
| 336 | Ga0068866_10018377 | 3300005718 | Bacteria | 3161 |
| 337 | Ga0068866_10045342 | 3300005718 | Bacteria | 2205 |
| 338 | Ga0068861_100254167 | 3300005719 | Bacteria | 1501 |
| 339 | Ga0068861_100353555 | 3300005719 | Bacteria | 1290 |
| 340 | Ga0068851_10105631 | 3300005834 | Bacteria | 1499 |
| 341 | Ga0068870_10108305 | 3300005840 | Bacteria | 1582 |
| 342 | Ga0068863_100002392 | 3300005841 | Bacteria | 18652 |
| 343 | Ga0068863_100002503 | 3300005841 | Bacteria | 18268 |
| 344 | Ga0068863_100010147 | 3300005841 | Bacteria | 9160 |
| 345 | Ga0068863_100011390 | 3300005841 | Bacteria | 8607 |
| 346 | Ga0068863_100014403 | 3300005841 | Bacteria | 7616 |
| 347 | Ga0068863_100041540 | 3300005841 | Bacteria | 4373 |
| 348 | Ga0068863_100056578 | 3300005841 | Bacteria | 3713 |
| 349 | Ga0068863_100060914 | 3300005841 | Bacteria | 3569 |
| 350 | Ga0068863_100100722 | 3300005841 | Bacteria | 2746 |
| 351 | Ga0068863_100106435 | 3300005841 | Bacteria | 2669 |
| 352 | Ga0068863_100295134 | 3300005841 | Bacteria | 1572 |
| 353 | Ga0068858_100000570 | 3300005842 | Bacteria | 38553 |
| 354 | Ga0068858_100001408 | 3300005842 | Bacteria | 24701 |
| 355 | Ga0068858_100002531 | 3300005842 | Bacteria | 18418 |
| 356 | Ga0068858_100005297 | 3300005842 | Bacteria | 12648 |
| 357 | Ga0068858_100007205 | 3300005842 | Bacteria | 10783 |
| 358 | Ga0068858_100009318 | 3300005842 | Bacteria | 9374 |
| 359 | Ga0068858_100047601 | 3300005842 | Bacteria | 3974 |
| 360 | Ga0068858_100137802 | 3300005842 | Bacteria | 2290 |
| 361 | Ga0068860_100005362 | 3300005843 | Bacteria | 13014 |
| 362 | Ga0068860_100005556 | 3300005843 | Bacteria | 12752 |
| 363 | Ga0068860_100007956 | 3300005843 | Bacteria | 10575 |
| 364 | Ga0068860_100009212 | 3300005843 | Bacteria | 9813 |
| 365 | Ga0068860_100010634 | 3300005843 | Bacteria | 9087 |
| 366 | Ga0068860_100070773 | 3300005843 | Bacteria | 3316 |
| 367 | Ga0068860_100183540 | 3300005843 | Bacteria | 2022 |
| 368 | Ga0068860_100211413 | 3300005843 | Bacteria | 1882 |
| 369 | Ga0068860_100280774 | 3300005843 | Bacteria | 1627 |
| 370 | Ga0068862_100012763 | 3300005844 | Bacteria | 6952 |
| 371 | Ga0068862_100020145 | 3300005844 | Bacteria | 5571 |
| 372 | Ga0068862_100030579 | 3300005844 | Bacteria | 4539 |
| 373 | Ga0068862_100050029 | 3300005844 | Bacteria | 3570 |
| 374 | Ga0068862_100074078 | 3300005844 | Bacteria | 2943 |
| 375 | Ga0068862_100237120 | 3300005844 | Bacteria | 1657 |
| 376 | Ga0068862_100303677 | 3300005844 | Bacteria | 1469 |
| 377 | Ga0068862_100724067 | 3300005844 | Bacteria | 966 |
| 378 | Ga0081455_10012753 | 3300005937 | Bacteria | 8358 |
| 379 | Ga0081539_10000004 | 3300005985 | Bacteria | 555600 |
| 380 | Ga0081539_10032795 | 3300005985 | Bacteria | 3174 |
| 381 | Ga0070717_10010469 | 3300006028 | Bacteria | 7005 |
| 382 | Ga0070715_10000333 | 3300006163 | Bacteria | 11737 |
| 383 | Ga0070716_100049583 | 3300006173 | Bacteria | 2379 |
| 384 | Ga0070712_100002678 | 3300006175 | Bacteria | 10991 |
| 385 | Ga0070712_100061466 | 3300006175 | Bacteria | 2654 |
| 386 | Ga0097621_100070361 | 3300006237 | Bacteria | 2889 |
| 387 | Ga0097621_100086556 | 3300006237 | Bacteria | 2616 |
| 388 | Ga0097621_100168213 | 3300006237 | Bacteria | 1888 |
| 389 | Ga0075370_10003471 | 3300006353 | Bacteria | 7511 |
| 390 | Ga0068871_100008181 | 3300006358 | Bacteria | 7512 |
| 391 | Ga0068871_100085791 | 3300006358 | Bacteria | 2615 |
| 392 | Ga0068871_100295792 | 3300006358 | Bacteria | 1420 |
| 393 | Ga0075428_100026953 | 3300006844 | Bacteria | 6365 |
| 394 | Ga0075430_100015171 | 3300006846 | Bacteria | 6559 |
| 395 | Ga0075431_100292314 | 3300006847 | Bacteria | 1648 |
| 396 | Ga0075429_100337994 | 3300006880 | Bacteria | 1318 |
| 397 | Ga0068865_100003326 | 3300006881 | Bacteria | 9632 |
| 398 | Ga0068865_100005880 | 3300006881 | Bacteria | 7464 |
| 399 | Ga0068865_100028409 | 3300006881 | Bacteria | 3702 |
| 400 | Ga0068865_100058849 | 3300006881 | Bacteria | 2686 |
| 401 | Ga0068865_100191203 | 3300006881 | Bacteria | 1583 |
| 402 | Ga0068865_100308215 | 3300006881 | Bacteria | 1269 |
| 403 | Ga0075436_100292776 | 3300006914 | Bacteria | 1166 |
| 404 | Ga0097620_100000843 | 3300006931 | Bacteria | 31176 |
| 405 | Ga0097620_100002246 | 3300006931 | Bacteria | 19594 |
| 406 | Ga0097620_100010758 | 3300006931 | Bacteria | 9211 |
| 407 | Ga0097620_100027052 | 3300006931 | Bacteria | 5753 |
| 408 | Ga0097620_100035839 | 3300006931 | Bacteria | 4979 |
| 409 | Ga0097620_100045999 | 3300006931 | Bacteria | 4384 |
| 410 | Ga0105251_10017252 | 3300009011 | Bacteria | 3876 |
| 411 | Ga0105251_10093187 | 3300009011 | Bacteria | 1382 |
| 412 | Ga0105240_10004389 | 3300009093 | Bacteria | 21534 |
| 413 | Ga0105240_10007571 | 3300009093 | Bacteria | 15734 |
| 414 | Ga0105240_10010627 | 3300009093 | Bacteria | 12932 |
| 415 | Ga0105240_10011630 | 3300009093 | Bacteria | 12242 |
| 416 | Ga0105240_10030693 | 3300009093 | Bacteria | 6981 |
| 417 | Ga0105240_10041145 | 3300009093 | Bacteria | 5902 |
| 418 | Ga0105240_10094481 | 3300009093 | Bacteria | 3647 |
| 419 | Ga0105240_10164573 | 3300009093 | Bacteria | 2632 |
| 420 | Ga0105240_10205832 | 3300009093 | Bacteria | 2303 |
| 421 | Ga0105240_10305369 | 3300009093 | Bacteria | 1819 |
| 422 | Ga0105240_10620106 | 3300009093 | Bacteria | 1189 |
| 423 | Ga0111539_10024945 | 3300009094 | Bacteria | 7329 |
| 424 | Ga0111539_10405206 | 3300009094 | Bacteria | 1588 |
| 425 | Ga0105245_10000240 | 3300009098 | Bacteria | 52165 |
| 426 | Ga0105245_10001159 | 3300009098 | Bacteria | 23843 |
| 427 | Ga0105245_10084045 | 3300009098 | Bacteria | 2915 |
| 428 | Ga0105245_10138345 | 3300009098 | Bacteria | 2291 |
| 429 | Ga0105245_10272335 | 3300009098 | Bacteria | 1652 |
| 430 | Ga0105247_10000212 | 3300009101 | Bacteria | 56393 |
| 431 | Ga0105247_10005134 | 3300009101 | Bacteria | 8289 |
| 432 | Ga0105247_10030833 | 3300009101 | Bacteria | 3252 |
| 433 | Ga0105247_10089192 | 3300009101 | Bacteria | 1955 |
| 434 | Ga0105247_10111271 | 3300009101 | Bacteria | 1763 |
| 435 | Ga0105243_10015375 | 3300009148 | Bacteria | 5788 |
| 436 | Ga0105243_10147537 | 3300009148 | Bacteria | 2014 |
| 437 | Ga0105243_10228121 | 3300009148 | Bacteria | 1650 |
| 438 | Ga0105241_10008322 | 3300009174 | Bacteria | 7636 |
| 439 | Ga0105241_10217923 | 3300009174 | Bacteria | 1602 |
| 440 | Ga0105242_10004796 | 3300009176 | Bacteria | 10464 |
| 441 | Ga0105242_10041050 | 3300009176 | Bacteria | 3730 |
| 442 | Ga0105242_10185446 | 3300009176 | Bacteria | 1838 |
| 443 | Ga0105248_10000673 | 3300009177 | Bacteria | 38736 |
| 444 | Ga0105248_10002105 | 3300009177 | Bacteria | 22055 |
| 445 | Ga0105248_10002346 | 3300009177 | Bacteria | 21004 |
| 446 | Ga0105248_10003667 | 3300009177 | Bacteria | 17023 |
| 447 | Ga0105248_10019138 | 3300009177 | Bacteria | 7574 |
| 448 | Ga0105248_10019438 | 3300009177 | Bacteria | 7517 |
| 449 | Ga0105248_10024349 | 3300009177 | Bacteria | 6732 |
| 450 | Ga0105248_10031964 | 3300009177 | Bacteria | 5881 |
| 451 | Ga0105248_10098505 | 3300009177 | Bacteria | 3294 |
| 452 | Ga0105248_10099756 | 3300009177 | Bacteria | 3272 |
| 453 | Ga0105248_10127653 | 3300009177 | Bacteria | 2869 |
| 454 | Ga0105248_10158553 | 3300009177 | Bacteria | 2553 |
| 455 | Ga0105248_10163473 | 3300009177 | Bacteria | 2510 |
| 456 | Ga0105248_10378153 | 3300009177 | Bacteria | 1594 |
| 457 | Ga0105237_10007858 | 3300009545 | Bacteria | 11627 |
| 458 | Ga0105237_10008093 | 3300009545 | Bacteria | 11424 |
| 459 | Ga0105237_10071865 | 3300009545 | Bacteria | 3454 |
| 460 | Ga0105237_10083461 | 3300009545 | Bacteria | 3186 |
| 461 | Ga0105237_10376471 | 3300009545 | Bacteria | 1424 |
| 462 | Ga0105238_10012026 | 3300009551 | Bacteria | 8719 |
| 463 | Ga0105238_10017564 | 3300009551 | Bacteria | 7275 |
| 464 | Ga0105238_10053323 | 3300009551 | Bacteria | 4064 |
| 465 | Ga0105238_10097943 | 3300009551 | Bacteria | 2918 |
| 466 | Ga0105238_10189751 | 3300009551 | Bacteria | 2031 |
| 467 | Ga0105238_10319021 | 3300009551 | Bacteria | 1539 |
| 468 | Ga0105238_10328257 | 3300009551 | Bacteria | 1516 |
| 469 | Ga0105238_10530489 | 3300009551 | Bacteria | 1180 |
| 470 | Ga0105249_10000523 | 3300009553 | Bacteria | 35379 |
| 471 | Ga0105249_10008358 | 3300009553 | Bacteria | 9016 |
| 472 | Ga0105249_10019924 | 3300009553 | Bacteria | 5989 |
| 473 | Ga0105249_10312784 | 3300009553 | Bacteria | 1580 |
| 474 | Ga0105249_10323927 | 3300009553 | Bacteria | 1553 |
| 475 | Ga0105239_10019470 | 3300010375 | Bacteria | 7493 |
| 476 | Ga0105239_10041008 | 3300010375 | Bacteria | 5073 |
| 477 | Ga0105239_10061514 | 3300010375 | Bacteria | 4121 |
| 478 | Ga0105239_10150182 | 3300010375 | Bacteria | 2600 |
| 479 | Ga0105239_10218556 | 3300010375 | Bacteria | 2137 |
| 480 | Ga0105239_10850817 | 3300010375 | Bacteria | 1046 |
| 481 | Ga0105246_10019993 | 3300011119 | Bacteria | 4291 |
| 482 | Ga0105246_10237891 | 3300011119 | Bacteria | 1438 |
| 483 | Ga0157373_10007346 | 3300013100 | Bacteria | 8201 |
| 484 | Ga0157373_10007738 | 3300013100 | Bacteria | 7988 |
| 485 | Ga0157373_10016856 | 3300013100 | Bacteria | 5327 |
| 486 | Ga0157373_10023265 | 3300013100 | Bacteria | 4493 |
| 487 | Ga0157373_10056665 | 3300013100 | Bacteria | 2782 |
| 488 | Ga0157373_10078186 | 3300013100 | Bacteria | 2333 |
| 489 | Ga0157373_10109174 | 3300013100 | Bacteria | 1945 |
| 490 | Ga0157373_10121335 | 3300013100 | Bacteria | 1837 |
| 491 | Ga0157373_10134864 | 3300013100 | Bacteria | 1736 |
| 492 | Ga0157371_10001435 | 3300013102 | Bacteria | 24751 |
| 493 | Ga0157371_10003052 | 3300013102 | Bacteria | 15543 |
| 494 | Ga0157371_10003899 | 3300013102 | Bacteria | 13286 |
| 495 | Ga0157371_10023919 | 3300013102 | Bacteria | 4464 |
| 496 | Ga0157371_10053508 | 3300013102 | Bacteria | 2866 |
| 497 | Ga0157371_10098960 | 3300013102 | Bacteria | 2068 |
| 498 | Ga0157371_10142618 | 3300013102 | Bacteria | 1706 |
| 499 | Ga0157371_10157594 | 3300013102 | Bacteria | 1621 |
| 500 | Ga0157371_10199726 | 3300013102 | Bacteria | 1433 |
| 501 | Ga0157371_10285173 | 3300013102 | Bacteria | 1193 |
| 502 | Ga0157370_10012562 | 3300013104 | Bacteria | 8779 |
| 503 | Ga0157370_10035399 | 3300013104 | Bacteria | 4853 |
| 504 | Ga0157370_10035936 | 3300013104 | Bacteria | 4811 |
| 505 | Ga0157370_10083008 | 3300013104 | Bacteria | 3013 |
| 506 | Ga0157370_10132585 | 3300013104 | Bacteria | 2324 |
| 507 | Ga0157370_10246868 | 3300013104 | Bacteria | 1651 |
| 508 | Ga0157369_10001579 | 3300013105 | Bacteria | 27879 |
| 509 | Ga0157369_10004172 | 3300013105 | Bacteria | 17121 |
| 510 | Ga0157369_10006524 | 3300013105 | Bacteria | 13518 |
| 511 | Ga0157369_10008300 | 3300013105 | Bacteria | 11906 |
| 512 | Ga0157369_10025769 | 3300013105 | Bacteria | 6523 |
| 513 | Ga0157369_10029001 | 3300013105 | Bacteria | 6119 |
| 514 | Ga0157369_10062380 | 3300013105 | Bacteria | 4017 |
| 515 | Ga0157369_10200913 | 3300013105 | Bacteria | 2092 |
| 516 | Ga0157369_10341158 | 3300013105 | Bacteria | 1556 |
| 517 | Ga0157369_10344203 | 3300013105 | Bacteria | 1549 |
| 518 | Ga0157369_10438797 | 3300013105 | Bacteria | 1353 |
| 519 | Ga0157369_10472533 | 3300013105 | Bacteria | 1298 |
| 520 | Ga0157369_10529259 | 3300013105 | Bacteria | 1219 |
| 521 | Ga0157374_10000882 | 3300013296 | Bacteria | 26194 |
| 522 | Ga0157374_10002261 | 3300013296 | Bacteria | 16219 |
| 523 | Ga0157374_10009049 | 3300013296 | Bacteria | 8532 |
| 524 | Ga0157374_10090064 | 3300013296 | Bacteria | 2924 |
| 525 | Ga0157374_10109979 | 3300013296 | Bacteria | 2650 |
| 526 | Ga0157374_10231593 | 3300013296 | Bacteria | 1815 |
| 527 | Ga0157378_10000625 | 3300013297 | Bacteria | 33285 |
| 528 | Ga0157378_10003623 | 3300013297 | Bacteria | 13668 |
| 529 | Ga0157378_10020195 | 3300013297 | Bacteria | 5859 |
| 530 | Ga0163162_10002440 | 3300013306 | Bacteria | 17525 |
| 531 | Ga0163162_10085584 | 3300013306 | Bacteria | 3230 |
| 532 | Ga0163162_10097768 | 3300013306 | Bacteria | 3024 |
| 533 | Ga0163162_10257091 | 3300013306 | Bacteria | 1878 |
| 534 | Ga0157372_10004346 | 3300013307 | Bacteria | 15135 |
| 535 | Ga0157372_10024533 | 3300013307 | Bacteria | 6553 |
| 536 | Ga0157372_10034601 | 3300013307 | Bacteria | 5555 |
| 537 | Ga0157372_10040762 | 3300013307 | Bacteria | 5131 |
| 538 | Ga0157372_10062828 | 3300013307 | Bacteria | 4162 |
| 539 | Ga0157372_10382227 | 3300013307 | Bacteria | 1640 |
| 540 | Ga0157372_10414170 | 3300013307 | Bacteria | 1570 |
| 541 | Ga0157372_10700861 | 3300013307 | Bacteria | 1178 |
| 542 | Ga0157375_10038790 | 3300013308 | Bacteria | 4577 |
| 543 | Ga0157375_10063978 | 3300013308 | Bacteria | 3662 |
| 544 | Ga0157375_10136739 | 3300013308 | Bacteria | 2575 |
| 545 | Ga0157375_10435314 | 3300013308 | Bacteria | 1477 |
| 546 | Ga0163163_10002408 | 3300014325 | Bacteria | 15819 |
| 547 | Ga0163163_10004034 | 3300014325 | Bacteria | 12528 |
| 548 | Ga0163163_10022952 | 3300014325 | Bacteria | 5917 |
| 549 | Ga0163163_10038472 | 3300014325 | Bacteria | 4663 |
| 550 | Ga0163163_10562117 | 3300014325 | Bacteria | 1203 |
| 551 | Ga0157380_10001526 | 3300014326 | Bacteria | 15211 |
| 552 | Ga0157380_10002231 | 3300014326 | Bacteria | 13033 |
| 553 | Ga0157380_10062065 | 3300014326 | Bacteria | 2993 |
| 554 | Ga0157380_10127797 | 3300014326 | Bacteria | 2163 |
| 555 | Ga0157380_10270229 | 3300014326 | Bacteria | 1549 |
| 556 | Ga0157380_10291720 | 3300014326 | Bacteria | 1498 |
| 557 | Ga0182008_10173956 | 3300014497 | Bacteria | 1088 |
| 558 | Ga0157377_10049358 | 3300014745 | Bacteria | 2365 |
| 559 | Ga0157377_10070643 | 3300014745 | Bacteria | 2017 |
| 560 | Ga0157379_10001277 | 3300014968 | Bacteria | 20464 |
| 561 | Ga0157379_10003741 | 3300014968 | Bacteria | 12937 |
| 562 | Ga0157379_10010195 | 3300014968 | Bacteria | 8189 |
| 563 | Ga0157379_10046470 | 3300014968 | Bacteria | 3872 |
| 564 | Ga0157379_10105763 | 3300014968 | Bacteria | 2526 |
| 565 | Ga0157379_10169928 | 3300014968 | Bacteria | 1968 |
| 566 | Ga0157376_10006910 | 3300014969 | Bacteria | 8041 |
| 567 | Ga0157376_10103869 | 3300014969 | Bacteria | 2489 |
| 568 | Ga0157376_10245106 | 3300014969 | Bacteria | 1671 |
| 569 | Ga0157376_10748131 | 3300014969 | Bacteria | 986 |
| 570 | Ga0206356_10519558 | 3300020070 | Bacteria | 2348 |
| 571 | Ga0206349_1981439 | 3300020075 | Bacteria | 1130 |
| 572 | Ga0206350_11177039 | 3300020080 | Bacteria | 970 |
| 573 | Ga0206354_10918587 | 3300020081 | Bacteria | 1065 |
| 574 | Ga0206353_11473440 | 3300020082 | Bacteria | 1076 |
| 575 | Ga0206353_12012814 | 3300020082 | Bacteria | 13237 |
| 576 | Ga0206353_12019217 | 3300020082 | Bacteria | 1934 |
| 577 | Ga0213873_10000012 | 3300021358 | Bacteria | 210531 |
| 578 | Ga0213874_10002669 | 3300021377 | Bacteria | 3870 |
| 579 | Ga0213876_10000021 | 3300021384 | Bacteria | 260105 |
| 580 | Ga0213876_10020022 | 3300021384 | Bacteria | 3534 |
| 581 | Ga0213876_10073919 | 3300021384 | Bacteria | 1800 |
| 582 | Ga0213875_10006414 | 3300021388 | Bacteria | 6180 |
| 583 | Ga0224712_10039436 | 3300022467 | Bacteria | 1771 |
| 584 | Ga0224712_10064149 | 3300022467 | Bacteria | 1473 |
| 585 | Ga0224712_10151519 | 3300022467 | Bacteria | 1028 |
| 586 | Ga0207425_1000146 | 3300025245 | Bacteria | 60712 |
| 587 | Ga0209129_1000912 | 3300025258 | Bacteria | 18080 |
| 588 | Ga0209676_1041693 | 3300025292 | Bacteria | 1280 |
| 589 | Ga0209025_1000431 | 3300025294 | Bacteria | 82934 |
| 590 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 591 | Ga0209050_1000005 | 3300025298 | Bacteria | 1557793 |
| 592 | Ga0209050_1005562 | 3300025298 | Bacteria | 7845 |
| 593 | Ga0209051_1000212 | 3300025303 | Bacteria | 100189 |
| 594 | Ga0209051_1003223 | 3300025303 | Bacteria | 10876 |
| 595 | Ga0209257_1000032 | 3300025304 | Bacteria | 680354 |
| 596 | Ga0209257_1000753 | 3300025304 | Bacteria | 48917 |
| 597 | Ga0209257_1000925 | 3300025304 | Bacteria | 40806 |
| 598 | Ga0209257_1017966 | 3300025304 | Bacteria | 2750 |
| 599 | Ga0207697_10001286 | 3300025315 | Bacteria | 13774 |
| 600 | Ga0207656_10159501 | 3300025321 | Bacteria | 1073 |
| 601 | Ga0207696_1008898 | 3300025711 | Bacteria | 3787 |
| 602 | Ga0207682_10039097 | 3300025893 | Bacteria | 1927 |
| 603 | Ga0207692_10203076 | 3300025898 | Bacteria | 1166 |
| 604 | Ga0207642_10011765 | 3300025899 | Bacteria | 3135 |
| 605 | Ga0207710_10000254 | 3300025900 | Bacteria | 44382 |
| 606 | Ga0207710_10013274 | 3300025900 | Bacteria | 3470 |
| 607 | Ga0207710_10036857 | 3300025900 | Bacteria | 2158 |
| 608 | Ga0207710_10046773 | 3300025900 | Bacteria | 1932 |
| 609 | Ga0207688_10021021 | 3300025901 | Bacteria | 3564 |
| 610 | Ga0207680_10000492 | 3300025903 | Bacteria | 18747 |
| 611 | Ga0207680_10016620 | 3300025903 | Bacteria | 3868 |
| 612 | Ga0207680_10227591 | 3300025903 | Bacteria | 1281 |
| 613 | Ga0207680_10419231 | 3300025903 | Bacteria | 948 |
| 614 | Ga0207647_10000193 | 3300025904 | Bacteria | 49635 |
| 615 | Ga0207647_10001994 | 3300025904 | Bacteria | 15616 |
| 616 | Ga0207647_10026542 | 3300025904 | Bacteria | 3788 |
| 617 | Ga0207647_10040434 | 3300025904 | Bacteria | 2936 |
| 618 | Ga0207685_10002698 | 3300025905 | Bacteria | 4129 |
| 619 | Ga0207699_10012746 | 3300025906 | Bacteria | 4281 |
| 620 | Ga0207699_10033651 | 3300025906 | Bacteria | 2899 |
| 621 | Ga0207699_10085258 | 3300025906 | Bacteria | 1969 |
| 622 | Ga0207645_10006989 | 3300025907 | Bacteria | 8035 |
| 623 | Ga0207645_10013084 | 3300025907 | Bacteria | 5605 |
| 624 | Ga0207645_10015452 | 3300025907 | Bacteria | 5069 |
| 625 | Ga0207645_10028032 | 3300025907 | Bacteria | 3636 |
| 626 | Ga0207645_10032729 | 3300025907 | Bacteria | 3342 |
| 627 | Ga0207645_10036097 | 3300025907 | Bacteria | 3174 |
| 628 | Ga0207645_10113522 | 3300025907 | Bacteria | 1755 |
| 629 | Ga0207645_10154660 | 3300025907 | Bacteria | 1498 |
| 630 | Ga0207645_10183823 | 3300025907 | Bacteria | 1372 |
| 631 | Ga0207643_10127142 | 3300025908 | Bacteria | 1514 |
| 632 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 633 | Ga0207705_10000003 | 3300025909 | Bacteria | 709270 |
| 634 | Ga0207705_10000050 | 3300025909 | Bacteria | 170078 |
| 635 | Ga0207705_10002221 | 3300025909 | Bacteria | 14985 |
| 636 | Ga0207705_10014667 | 3300025909 | Bacteria | 5638 |
| 637 | Ga0207705_10022419 | 3300025909 | Bacteria | 4502 |
| 638 | Ga0207705_10025445 | 3300025909 | Bacteria | 4225 |
| 639 | Ga0207705_10037294 | 3300025909 | Bacteria | 3478 |
| 640 | Ga0207705_10038884 | 3300025909 | Bacteria | 3408 |
| 641 | Ga0207705_10050981 | 3300025909 | Bacteria | 2979 |
| 642 | Ga0207705_10077699 | 3300025909 | Bacteria | 2415 |
| 643 | Ga0207705_10086332 | 3300025909 | Bacteria | 2293 |
| 644 | Ga0207705_10089206 | 3300025909 | Bacteria | 2256 |
| 645 | Ga0207705_10154441 | 3300025909 | Bacteria | 1721 |
| 646 | Ga0207705_10170351 | 3300025909 | Bacteria | 1639 |
| 647 | Ga0207705_10175201 | 3300025909 | Bacteria | 1616 |
| 648 | Ga0207705_10226788 | 3300025909 | Bacteria | 1420 |
| 649 | Ga0207654_10081542 | 3300025911 | Bacteria | 1948 |
| 650 | Ga0207654_10091565 | 3300025911 | Bacteria | 1855 |
| 651 | Ga0207654_10222999 | 3300025911 | Bacteria | 1251 |
| 652 | Ga0207707_10004072 | 3300025912 | Bacteria | 12941 |
| 653 | Ga0207707_10006250 | 3300025912 | Bacteria | 10400 |
| 654 | Ga0207707_10008989 | 3300025912 | Bacteria | 8677 |
| 655 | Ga0207707_10010843 | 3300025912 | Bacteria | 7920 |
| 656 | Ga0207707_10035205 | 3300025912 | Bacteria | 4379 |
| 657 | Ga0207707_10060555 | 3300025912 | Bacteria | 3293 |
| 658 | Ga0207695_10005303 | 3300025913 | Bacteria | 17175 |
| 659 | Ga0207695_10005548 | 3300025913 | Bacteria | 16679 |
| 660 | Ga0207695_10009383 | 3300025913 | Bacteria | 12102 |
| 661 | Ga0207695_10014202 | 3300025913 | Bacteria | 9448 |
| 662 | Ga0207695_10017612 | 3300025913 | Bacteria | 8303 |
| 663 | Ga0207695_10024691 | 3300025913 | Bacteria | 6752 |
| 664 | Ga0207695_10029814 | 3300025913 | Bacteria | 6019 |
| 665 | Ga0207695_10031334 | 3300025913 | Bacteria | 5834 |
| 666 | Ga0207695_10039007 | 3300025913 | Bacteria | 5108 |
| 667 | Ga0207695_10059200 | 3300025913 | Bacteria | 3973 |
| 668 | Ga0207695_10066576 | 3300025913 | Bacteria | 3699 |
| 669 | Ga0207695_10079345 | 3300025913 | Bacteria | 3327 |
| 670 | Ga0207695_10085135 | 3300025913 | Bacteria | 3190 |
| 671 | Ga0207695_10097645 | 3300025913 | Bacteria | 2938 |
| 672 | Ga0207695_10654044 | 3300025913 | Bacteria | 932 |
| 673 | Ga0207671_10005586 | 3300025914 | Bacteria | 11550 |
| 674 | Ga0207671_10013981 | 3300025914 | Bacteria | 6368 |
| 675 | Ga0207671_10018037 | 3300025914 | Bacteria | 5427 |
| 676 | Ga0207671_10086024 | 3300025914 | Bacteria | 2363 |
| 677 | Ga0207671_10106160 | 3300025914 | Bacteria | 2132 |
| 678 | Ga0207693_10000462 | 3300025915 | Bacteria | 37190 |
| 679 | Ga0207693_10031567 | 3300025915 | Bacteria | 4186 |
| 680 | Ga0207693_10147756 | 3300025915 | Bacteria | 1848 |
| 681 | Ga0207663_10007125 | 3300025916 | Bacteria | 5778 |
| 682 | Ga0207663_10090318 | 3300025916 | Bacteria | 2031 |
| 683 | Ga0207663_10157284 | 3300025916 | Bacteria | 1600 |
| 684 | Ga0207660_10000186 | 3300025917 | Bacteria | 39363 |
| 685 | Ga0207660_10004190 | 3300025917 | Bacteria | 9382 |
| 686 | Ga0207660_10008150 | 3300025917 | Bacteria | 6778 |
| 687 | Ga0207660_10030111 | 3300025917 | Bacteria | 3729 |
| 688 | Ga0207660_10042085 | 3300025917 | Bacteria | 3205 |
| 689 | Ga0207660_10047185 | 3300025917 | Bacteria | 3043 |
| 690 | Ga0207660_10052362 | 3300025917 | Bacteria | 2906 |
| 691 | Ga0207660_10070663 | 3300025917 | Bacteria | 2538 |
| 692 | Ga0207660_10183425 | 3300025917 | Bacteria | 1626 |
| 693 | Ga0207662_10145770 | 3300025918 | Bacteria | 1503 |
| 694 | Ga0207657_10000121 | 3300025919 | Bacteria | 78211 |
| 695 | Ga0207657_10001248 | 3300025919 | Bacteria | 27180 |
| 696 | Ga0207657_10003049 | 3300025919 | Bacteria | 17918 |
| 697 | Ga0207657_10005568 | 3300025919 | Bacteria | 13152 |
| 698 | Ga0207657_10005714 | 3300025919 | Bacteria | 12980 |
| 699 | Ga0207657_10008500 | 3300025919 | Bacteria | 10413 |
| 700 | Ga0207657_10011471 | 3300025919 | Bacteria | 8797 |
| 701 | Ga0207657_10012677 | 3300025919 | Bacteria | 8308 |
| 702 | Ga0207657_10021169 | 3300025919 | Bacteria | 6126 |
| 703 | Ga0207657_10049190 | 3300025919 | Bacteria | 3676 |
| 704 | Ga0207657_10050297 | 3300025919 | Bacteria | 3627 |
| 705 | Ga0207657_10079533 | 3300025919 | Bacteria | 2758 |
| 706 | Ga0207657_10090824 | 3300025919 | Bacteria | 2548 |
| 707 | Ga0207657_10093945 | 3300025919 | Bacteria | 2498 |
| 708 | Ga0207649_10000190 | 3300025920 | Bacteria | 50479 |
| 709 | Ga0207649_10001220 | 3300025920 | Bacteria | 15471 |
| 710 | Ga0207649_10008345 | 3300025920 | Bacteria | 5644 |
| 711 | Ga0207649_10057649 | 3300025920 | Bacteria | 2429 |
| 712 | Ga0207649_10287111 | 3300025920 | Bacteria | 1198 |
| 713 | Ga0207652_10000003 | 3300025921 | Bacteria | 502441 |
| 714 | Ga0207652_10001982 | 3300025921 | Bacteria | 17714 |
| 715 | Ga0207652_10017644 | 3300025921 | Bacteria | 5842 |
| 716 | Ga0207652_10072927 | 3300025921 | Bacteria | 2986 |
| 717 | Ga0207652_10127656 | 3300025921 | Bacteria | 2266 |
| 718 | Ga0207652_10129200 | 3300025921 | Bacteria | 2253 |
| 719 | Ga0207652_10162062 | 3300025921 | Bacteria | 2005 |
| 720 | Ga0207652_10219188 | 3300025921 | Bacteria | 1714 |
| 721 | Ga0207652_10236421 | 3300025921 | Bacteria | 1647 |
| 722 | Ga0207652_10597913 | 3300025921 | Bacteria | 989 |
| 723 | Ga0207681_10004853 | 3300025923 | Bacteria | 8262 |
| 724 | Ga0207681_10041120 | 3300025923 | Bacteria | 3080 |
| 725 | Ga0207681_10075308 | 3300025923 | Bacteria | 2367 |
| 726 | Ga0207681_10207143 | 3300025923 | Bacteria | 1509 |
| 727 | Ga0207694_10000667 | 3300025924 | Bacteria | 30806 |
| 728 | Ga0207694_10007119 | 3300025924 | Bacteria | 8500 |
| 729 | Ga0207694_10067018 | 3300025924 | Bacteria | 2802 |
| 730 | Ga0207694_10101162 | 3300025924 | Bacteria | 2284 |
| 731 | Ga0207694_10153334 | 3300025924 | Bacteria | 1857 |
| 732 | Ga0207694_10164129 | 3300025924 | Bacteria | 1795 |
| 733 | Ga0207694_10203768 | 3300025924 | Bacteria | 1610 |
| 734 | Ga0207694_10277535 | 3300025924 | Bacteria | 1376 |
| 735 | Ga0207694_10337081 | 3300025924 | Bacteria | 1247 |
| 736 | Ga0207650_10009214 | 3300025925 | Bacteria | 6746 |
| 737 | Ga0207650_10019746 | 3300025925 | Bacteria | 4739 |
| 738 | Ga0207650_10034633 | 3300025925 | Bacteria | 3663 |
| 739 | Ga0207650_10069191 | 3300025925 | Bacteria | 2652 |
| 740 | Ga0207650_10107015 | 3300025925 | Bacteria | 2160 |
| 741 | Ga0207650_10175655 | 3300025925 | Bacteria | 1705 |
| 742 | Ga0207650_10491802 | 3300025925 | Bacteria | 1024 |
| 743 | Ga0207659_10092065 | 3300025926 | Bacteria | 2266 |
| 744 | Ga0207659_10281127 | 3300025926 | Bacteria | 1361 |
| 745 | Ga0207687_10006042 | 3300025927 | Bacteria | 8010 |
| 746 | Ga0207687_10032648 | 3300025927 | Bacteria | 3527 |
| 747 | Ga0207687_10150257 | 3300025927 | Bacteria | 1776 |
| 748 | Ga0207700_10005097 | 3300025928 | Bacteria | 7808 |
| 749 | Ga0207700_10034763 | 3300025928 | Bacteria | 3622 |
| 750 | Ga0207700_10072261 | 3300025928 | Bacteria | 2659 |
| 751 | Ga0207700_10076030 | 3300025928 | Bacteria | 2604 |
| 752 | Ga0207664_10007710 | 3300025929 | Bacteria | 7471 |
| 753 | Ga0207664_10063990 | 3300025929 | Bacteria | 2940 |
| 754 | Ga0207664_10283922 | 3300025929 | Bacteria | 1453 |
| 755 | Ga0207644_10000181 | 3300025931 | Bacteria | 45051 |
| 756 | Ga0207644_10001877 | 3300025931 | Bacteria | 13683 |
| 757 | Ga0207644_10007510 | 3300025931 | Bacteria | 7108 |
| 758 | Ga0207644_10015423 | 3300025931 | Bacteria | 5128 |
| 759 | Ga0207644_10076628 | 3300025931 | Bacteria | 2460 |
| 760 | Ga0207644_10079575 | 3300025931 | Bacteria | 2418 |
| 761 | Ga0207644_10136374 | 3300025931 | Bacteria | 1885 |
| 762 | Ga0207644_10193996 | 3300025931 | Bacteria | 1598 |
| 763 | Ga0207644_10420002 | 3300025931 | Bacteria | 1095 |
| 764 | Ga0207690_10000922 | 3300025932 | Bacteria | 18771 |
| 765 | Ga0207690_10012495 | 3300025932 | Bacteria | 5080 |
| 766 | Ga0207690_10030611 | 3300025932 | Bacteria | 3435 |
| 767 | Ga0207690_10031182 | 3300025932 | Bacteria | 3409 |
| 768 | Ga0207690_10068871 | 3300025932 | Bacteria | 2433 |
| 769 | Ga0207690_10124238 | 3300025932 | Bacteria | 1879 |
| 770 | Ga0207690_10126432 | 3300025932 | Bacteria | 1865 |
| 771 | Ga0207690_10229540 | 3300025932 | Bacteria | 1424 |
| 772 | Ga0207706_10000320 | 3300025933 | Bacteria | 52005 |
| 773 | Ga0207706_10002152 | 3300025933 | Bacteria | 19256 |
| 774 | Ga0207706_10005703 | 3300025933 | Bacteria | 11601 |
| 775 | Ga0207706_10006809 | 3300025933 | Bacteria | 10568 |
| 776 | Ga0207706_10016150 | 3300025933 | Bacteria | 6744 |
| 777 | Ga0207706_10033282 | 3300025933 | Bacteria | 4589 |
| 778 | Ga0207706_10469011 | 3300025933 | Bacteria | 1088 |
| 779 | Ga0207706_10492574 | 3300025933 | Bacteria | 1058 |
| 780 | Ga0207686_10032876 | 3300025934 | Bacteria | 3091 |
| 781 | Ga0207709_10072557 | 3300025935 | Bacteria | 2190 |
| 782 | Ga0207670_10253487 | 3300025936 | Bacteria | 1361 |
| 783 | Ga0207669_10005254 | 3300025937 | Bacteria | 5789 |
| 784 | Ga0207669_10017120 | 3300025937 | Bacteria | 3708 |
| 785 | Ga0207669_10017596 | 3300025937 | Bacteria | 3672 |
| 786 | Ga0207669_10040698 | 3300025937 | Bacteria | 2698 |
| 787 | Ga0207669_10044761 | 3300025937 | Bacteria | 2603 |
| 788 | Ga0207704_10009452 | 3300025938 | Bacteria | 4705 |
| 789 | Ga0207704_10023727 | 3300025938 | Bacteria | 3311 |
| 790 | Ga0207704_10568257 | 3300025938 | Bacteria | 924 |
| 791 | Ga0207665_10003728 | 3300025939 | Bacteria | 10183 |
| 792 | Ga0207665_10088617 | 3300025939 | Bacteria | 2141 |
| 793 | Ga0207691_10000085 | 3300025940 | Bacteria | 79681 |
| 794 | Ga0207691_10005557 | 3300025940 | Bacteria | 12179 |
| 795 | Ga0207691_10014238 | 3300025940 | Bacteria | 7588 |
| 796 | Ga0207691_10028769 | 3300025940 | Bacteria | 5201 |
| 797 | Ga0207691_10042288 | 3300025940 | Bacteria | 4201 |
| 798 | Ga0207691_10055496 | 3300025940 | Bacteria | 3610 |
| 799 | Ga0207711_10000044 | 3300025941 | Bacteria | 157113 |
| 800 | Ga0207711_10001646 | 3300025941 | Bacteria | 20609 |
| 801 | Ga0207711_10003531 | 3300025941 | Bacteria | 13537 |
| 802 | Ga0207711_10013510 | 3300025941 | Bacteria | 6779 |
| 803 | Ga0207711_10016809 | 3300025941 | Bacteria | 6076 |
| 804 | Ga0207711_10018189 | 3300025941 | Bacteria | 5842 |
| 805 | Ga0207711_10067752 | 3300025941 | Bacteria | 3090 |
| 806 | Ga0207711_10126210 | 3300025941 | Bacteria | 2289 |
| 807 | Ga0207711_10204104 | 3300025941 | Bacteria | 1804 |
| 808 | Ga0207689_10000016 | 3300025942 | Bacteria | 118140 |
| 809 | Ga0207689_10206683 | 3300025942 | Bacteria | 1622 |
| 810 | Ga0207661_10241640 | 3300025944 | Bacteria | 1602 |
| 811 | Ga0207661_10271472 | 3300025944 | Bacteria | 1513 |
| 812 | Ga0207661_10292219 | 3300025944 | Bacteria | 1459 |
| 813 | Ga0207661_10632087 | 3300025944 | Bacteria | 983 |
| 814 | Ga0207679_10007667 | 3300025945 | Bacteria | 6857 |
| 815 | Ga0207679_10010617 | 3300025945 | Bacteria | 5934 |
| 816 | Ga0207679_10036640 | 3300025945 | Bacteria | 3480 |
| 817 | Ga0207679_10043131 | 3300025945 | Bacteria | 3246 |
| 818 | Ga0207679_10046835 | 3300025945 | Bacteria | 3137 |
| 819 | Ga0207679_10055968 | 3300025945 | Bacteria | 2910 |
| 820 | Ga0207679_10068889 | 3300025945 | Bacteria | 2660 |
| 821 | Ga0207679_10069531 | 3300025945 | Bacteria | 2650 |
| 822 | Ga0207679_10123116 | 3300025945 | Bacteria | 2068 |
| 823 | Ga0207679_10346695 | 3300025945 | Bacteria | 1293 |
| 824 | Ga0207679_10399253 | 3300025945 | Bacteria | 1209 |
| 825 | Ga0207667_10000859 | 3300025949 | Bacteria | 39082 |
| 826 | Ga0207667_10001013 | 3300025949 | Bacteria | 35783 |
| 827 | Ga0207667_10002514 | 3300025949 | Bacteria | 22864 |
| 828 | Ga0207667_10009692 | 3300025949 | Bacteria | 11328 |
| 829 | Ga0207667_10019156 | 3300025949 | Bacteria | 7653 |
| 830 | Ga0207667_10031313 | 3300025949 | Bacteria | 5742 |
| 831 | Ga0207667_10047606 | 3300025949 | Bacteria | 4538 |
| 832 | Ga0207667_10059750 | 3300025949 | Bacteria | 3991 |
| 833 | Ga0207667_10061643 | 3300025949 | Bacteria | 3923 |
| 834 | Ga0207667_10067595 | 3300025949 | Bacteria | 3722 |
| 835 | Ga0207667_10204972 | 3300025949 | Bacteria | 2022 |
| 836 | Ga0207651_10008254 | 3300025960 | Bacteria | 5613 |
| 837 | Ga0207651_10011713 | 3300025960 | Bacteria | 4921 |
| 838 | Ga0207651_10022903 | 3300025960 | Bacteria | 3831 |
| 839 | Ga0207651_10033107 | 3300025960 | Bacteria | 3329 |
| 840 | Ga0207651_10098449 | 3300025960 | Bacteria | 2163 |
| 841 | Ga0207651_10108710 | 3300025960 | Bacteria | 2076 |
| 842 | Ga0207651_10128440 | 3300025960 | Bacteria | 1936 |
| 843 | Ga0207651_10129071 | 3300025960 | Bacteria | 1932 |
| 844 | Ga0207651_10131109 | 3300025960 | Bacteria | 1919 |
| 845 | Ga0207712_10000437 | 3300025961 | Bacteria | 35483 |
| 846 | Ga0207712_10019374 | 3300025961 | Bacteria | 4442 |
| 847 | Ga0207712_10026842 | 3300025961 | Bacteria | 3841 |
| 848 | Ga0207712_10087146 | 3300025961 | Bacteria | 2289 |
| 849 | Ga0207712_10134122 | 3300025961 | Bacteria | 1891 |
| 850 | Ga0207668_10009261 | 3300025972 | Bacteria | 5893 |
| 851 | Ga0207668_10254800 | 3300025972 | Bacteria | 1427 |
| 852 | Ga0207640_10000851 | 3300025981 | Bacteria | 17314 |
| 853 | Ga0207640_10007010 | 3300025981 | Bacteria | 6204 |
| 854 | Ga0207640_10015163 | 3300025981 | Bacteria | 4455 |
| 855 | Ga0207640_10059129 | 3300025981 | Bacteria | 2528 |
| 856 | Ga0207640_10064025 | 3300025981 | Bacteria | 2446 |
| 857 | Ga0207640_10085744 | 3300025981 | Bacteria | 2166 |
| 858 | Ga0207640_10093371 | 3300025981 | Bacteria | 2090 |
| 859 | Ga0207640_10162338 | 3300025981 | Bacteria | 1655 |
| 860 | Ga0207658_10000936 | 3300025986 | Bacteria | 24076 |
| 861 | Ga0207658_10002942 | 3300025986 | Bacteria | 12198 |
| 862 | Ga0207658_10005057 | 3300025986 | Bacteria | 9074 |
| 863 | Ga0207658_10006132 | 3300025986 | Bacteria | 8205 |
| 864 | Ga0207658_10011779 | 3300025986 | Bacteria | 5957 |
| 865 | Ga0207658_10085660 | 3300025986 | Bacteria | 2427 |
| 866 | Ga0207658_10091455 | 3300025986 | Bacteria | 2361 |
| 867 | Ga0207658_10379621 | 3300025986 | Bacteria | 1237 |
| 868 | Ga0207677_10003694 | 3300026023 | Bacteria | 8118 |
| 869 | Ga0207677_10026050 | 3300026023 | Bacteria | 3661 |
| 870 | Ga0207677_10094729 | 3300026023 | Bacteria | 2180 |
| 871 | Ga0207677_10469250 | 3300026023 | Bacteria | 1082 |
| 872 | Ga0207703_10000183 | 3300026035 | Bacteria | 73109 |
| 873 | Ga0207703_10001302 | 3300026035 | Bacteria | 23082 |
| 874 | Ga0207703_10003806 | 3300026035 | Bacteria | 12534 |
| 875 | Ga0207703_10005275 | 3300026035 | Bacteria | 10418 |
| 876 | Ga0207703_10007702 | 3300026035 | Bacteria | 8527 |
| 877 | Ga0207703_10009541 | 3300026035 | Bacteria | 7617 |
| 878 | Ga0207703_10214932 | 3300026035 | Bacteria | 1716 |
| 879 | Ga0207703_10313617 | 3300026035 | Bacteria | 1434 |
| 880 | Ga0207703_10321811 | 3300026035 | Bacteria | 1416 |
| 881 | Ga0207703_10357478 | 3300026035 | Bacteria | 1346 |
| 882 | Ga0207639_10000181 | 3300026041 | Bacteria | 49444 |
| 883 | Ga0207639_10007288 | 3300026041 | Bacteria | 7534 |
| 884 | Ga0207639_10034006 | 3300026041 | Bacteria | 3765 |
| 885 | Ga0207639_10072027 | 3300026041 | Bacteria | 2705 |
| 886 | Ga0207639_10314472 | 3300026041 | Bacteria | 1388 |
| 887 | Ga0207639_10326436 | 3300026041 | Bacteria | 1364 |
| 888 | Ga0207639_10615379 | 3300026041 | Bacteria | 1002 |
| 889 | Ga0207678_10001321 | 3300026067 | Bacteria | 22898 |
| 890 | Ga0207678_10002048 | 3300026067 | Bacteria | 18285 |
| 891 | Ga0207678_10003177 | 3300026067 | Bacteria | 14856 |
| 892 | Ga0207678_10006824 | 3300026067 | Bacteria | 10123 |
| 893 | Ga0207678_10009022 | 3300026067 | Bacteria | 8779 |
| 894 | Ga0207678_10011197 | 3300026067 | Bacteria | 7877 |
| 895 | Ga0207678_10013529 | 3300026067 | Bacteria | 7165 |
| 896 | Ga0207678_10019862 | 3300026067 | Bacteria | 5905 |
| 897 | Ga0207678_10030836 | 3300026067 | Bacteria | 4682 |
| 898 | Ga0207678_10088130 | 3300026067 | Bacteria | 2653 |
| 899 | Ga0207702_10021703 | 3300026078 | Bacteria | 5316 |
| 900 | Ga0207702_10049667 | 3300026078 | Bacteria | 3540 |
| 901 | Ga0207702_10054024 | 3300026078 | Bacteria | 3402 |
| 902 | Ga0207702_10113075 | 3300026078 | Bacteria | 2417 |
| 903 | Ga0207702_10267956 | 3300026078 | Bacteria | 1610 |
| 904 | Ga0207702_10548173 | 3300026078 | Bacteria | 1131 |
| 905 | Ga0207641_10001338 | 3300026088 | Bacteria | 24391 |
| 906 | Ga0207641_10001458 | 3300026088 | Bacteria | 23179 |
| 907 | Ga0207641_10002484 | 3300026088 | Bacteria | 17013 |
| 908 | Ga0207641_10008289 | 3300026088 | Bacteria | 8587 |
| 909 | Ga0207641_10016012 | 3300026088 | Bacteria | 6139 |
| 910 | Ga0207641_10056936 | 3300026088 | Bacteria | 3324 |
| 911 | Ga0207641_10060015 | 3300026088 | Bacteria | 3241 |
| 912 | Ga0207641_10079359 | 3300026088 | Bacteria | 2845 |
| 913 | Ga0207641_10087245 | 3300026088 | Bacteria | 2722 |
| 914 | Ga0207641_10389998 | 3300026088 | Bacteria | 1335 |
| 915 | Ga0207648_10003603 | 3300026089 | Bacteria | 16196 |
| 916 | Ga0207648_10007718 | 3300026089 | Bacteria | 10518 |
| 917 | Ga0207648_10016176 | 3300026089 | Bacteria | 6827 |
| 918 | Ga0207648_10044684 | 3300026089 | Bacteria | 3887 |
| 919 | Ga0207648_10113725 | 3300026089 | Bacteria | 2377 |
| 920 | Ga0207648_10165891 | 3300026089 | Bacteria | 1952 |
| 921 | Ga0207676_10005209 | 3300026095 | Bacteria | 9201 |
| 922 | Ga0207676_10049201 | 3300026095 | Bacteria | 3277 |
| 923 | Ga0207676_10110374 | 3300026095 | Bacteria | 2300 |
| 924 | Ga0207676_10128368 | 3300026095 | Bacteria | 2151 |
| 925 | Ga0207676_10203987 | 3300026095 | Bacteria | 1749 |
| 926 | Ga0207674_10000114 | 3300026116 | Bacteria | 93676 |
| 927 | Ga0207674_10001036 | 3300026116 | Bacteria | 36260 |
| 928 | Ga0207674_10001151 | 3300026116 | Bacteria | 34261 |
| 929 | Ga0207674_10006687 | 3300026116 | Bacteria | 13544 |
| 930 | Ga0207674_10014936 | 3300026116 | Bacteria | 8556 |
| 931 | Ga0207674_10018868 | 3300026116 | Bacteria | 7481 |
| 932 | Ga0207674_10144034 | 3300026116 | Bacteria | 2342 |
| 933 | Ga0207674_10193615 | 3300026116 | Bacteria | 1983 |
| 934 | Ga0207674_10381259 | 3300026116 | Bacteria | 1363 |
| 935 | Ga0207675_100190179 | 3300026118 | Bacteria | 1969 |
| 936 | Ga0207675_100205088 | 3300026118 | Bacteria | 1894 |
| 937 | Ga0207675_100242861 | 3300026118 | Bacteria | 1741 |
| 938 | Ga0207675_100306334 | 3300026118 | Bacteria | 1548 |
| 939 | Ga0207683_10007850 | 3300026121 | Bacteria | 9131 |
| 940 | Ga0207683_10007992 | 3300026121 | Bacteria | 9046 |
| 941 | Ga0207683_10197588 | 3300026121 | Bacteria | 1827 |
| 942 | Ga0207698_10000796 | 3300026142 | Bacteria | 18339 |
| 943 | Ga0207698_10000887 | 3300026142 | Bacteria | 17369 |
| 944 | Ga0207698_10002867 | 3300026142 | Bacteria | 10309 |
| 945 | Ga0207698_10003119 | 3300026142 | Bacteria | 9933 |
| 946 | Ga0207698_10003206 | 3300026142 | Bacteria | 9824 |
| 947 | Ga0207698_10006634 | 3300026142 | Bacteria | 7238 |
| 948 | Ga0207698_10010230 | 3300026142 | Bacteria | 6015 |
| 949 | Ga0207698_10061767 | 3300026142 | Bacteria | 2922 |
| 950 | Ga0207698_10194133 | 3300026142 | Bacteria | 1812 |
| 951 | Ga0207698_10274367 | 3300026142 | Bacteria | 1556 |
| 952 | Ga0207698_10317675 | 3300026142 | Bacteria | 1457 |
| 953 | Ga0207698_10332579 | 3300026142 | Bacteria | 1427 |
| 954 | Ga0207698_10363565 | 3300026142 | Bacteria | 1371 |
| 955 | Ga0207698_10509720 | 3300026142 | Bacteria | 1172 |
| 956 | Ga0209982_1012035 | 3300027552 | Bacteria | 1296 |
| 957 | Ga0209974_10001961 | 3300027876 | Bacteria | 7514 |
| 958 | Ga0207428_10033260 | 3300027907 | Bacteria | 4236 |
| 959 | Ga0268266_10000834 | 3300028379 | Bacteria | 40263 |
| 960 | Ga0268266_10007466 | 3300028379 | Bacteria | 9860 |
| 961 | Ga0268266_10010282 | 3300028379 | Bacteria | 8191 |
| 962 | Ga0268266_10013691 | 3300028379 | Bacteria | 6985 |
| 963 | Ga0268266_10079389 | 3300028379 | Bacteria | 2857 |
| 964 | Ga0268266_10080781 | 3300028379 | Bacteria | 2833 |
| 965 | Ga0268266_10092782 | 3300028379 | Bacteria | 2649 |
| 966 | Ga0268266_10098990 | 3300028379 | Bacteria | 2566 |
| 967 | Ga0268266_10214787 | 3300028379 | Bacteria | 1765 |
| 968 | Ga0268266_10250475 | 3300028379 | Bacteria | 1638 |
| 969 | Ga0268266_10433352 | 3300028379 | Bacteria | 1247 |
| 970 | Ga0268265_10002414 | 3300028380 | Bacteria | 14116 |
| 971 | Ga0268265_10007856 | 3300028380 | Bacteria | 7197 |
| 972 | Ga0268265_10009708 | 3300028380 | Bacteria | 6497 |
| 973 | Ga0268265_10010713 | 3300028380 | Bacteria | 6190 |
| 974 | Ga0268265_10071818 | 3300028380 | Bacteria | 2697 |
| 975 | Ga0268265_10146124 | 3300028380 | Bacteria | 1987 |
| 976 | Ga0268264_10000057 | 3300028381 | Bacteria | 309824 |
| 977 | Ga0268264_10001982 | 3300028381 | Bacteria | 18419 |
| 978 | Ga0268264_10006236 | 3300028381 | Bacteria | 10060 |
| 979 | Ga0268264_10009364 | 3300028381 | Bacteria | 8106 |
| 980 | Ga0268264_10110522 | 3300028381 | Bacteria | 2406 |
| 981 | Ga0268264_10120880 | 3300028381 | Bacteria | 2308 |
| 982 | Ga0268264_10236227 | 3300028381 | Bacteria | 1691 |
| 983 | Ga0268264_10272591 | 3300028381 | Bacteria | 1581 |
| 984 | Ga0265334_10076257 | 3300028573 | Bacteria | 1242 |
| 985 | Ga0307515_10068006 | 3300028794 | Bacteria | 4903 |
| 986 | Ga0307515_10098372 | 3300028794 | Bacteria | 3564 |
| 987 | Ga0307511_10001123 | 3300030521 | Bacteria | 28507 |
| 988 | Ga0265762_1019634 | 3300030760 | Bacteria | 1239 |
| 989 | Ga0265340_10008897 | 3300031247 | Bacteria | 5411 |
| 990 | Ga0265340_10028939 | 3300031247 | Bacteria | 2784 |
| 991 | Ga0307513_10054594 | 3300031456 | Bacteria | 4282 |
| 992 | Ga0307513_10085117 | 3300031456 | Bacteria | 3245 |
| 993 | Ga0307509_10000013 | 3300031507 | Bacteria | 283027 |
| 994 | Ga0307408_100020656 | 3300031548 | Bacteria | 4447 |
| 995 | Ga0307408_100030450 | 3300031548 | Bacteria | 3748 |
| 996 | Ga0307408_100100370 | 3300031548 | Bacteria | 2204 |
| 997 | Ga0307408_100123141 | 3300031548 | Bacteria | 2012 |
| 998 | Ga0307408_100249374 | 3300031548 | Bacteria | 1463 |
| 999 | Ga0307508_10198678 | 3300031616 | Bacteria | 1606 |
| 1000 | Ga0316576_10261048 | 3300031727 | Bacteria | 1299 |
| 1001 | Ga0316578_10003227 | 3300031728 | Bacteria | 7400 |
| 1002 | Ga0307516_10086048 | 3300031730 | Bacteria | 2980 |
| 1003 | Ga0307405_10022992 | 3300031731 | Bacteria | 3534 |
| 1004 | Ga0307405_10034261 | 3300031731 | Bacteria | 3020 |
| 1005 | Ga0307405_10079712 | 3300031731 | Bacteria | 2135 |
| 1006 | Ga0307405_10128402 | 3300031731 | Bacteria | 1747 |
| 1007 | Ga0316577_10020096 | 3300031733 | Bacteria | 3700 |
| 1008 | Ga0307413_10000739 | 3300031824 | Bacteria | 11290 |
| 1009 | Ga0307413_10001898 | 3300031824 | Bacteria | 8267 |
| 1010 | Ga0307413_10002115 | 3300031824 | Bacteria | 7964 |
| 1011 | Ga0307413_10010806 | 3300031824 | Bacteria | 4451 |
| 1012 | Ga0307413_10022007 | 3300031824 | Bacteria | 3426 |
| 1013 | Ga0307413_10046641 | 3300031824 | Bacteria | 2578 |
| 1014 | Ga0307413_10290569 | 3300031824 | Bacteria | 1234 |
| 1015 | Ga0307413_10365662 | 3300031824 | Bacteria | 1118 |
| 1016 | Ga0307410_10000171 | 3300031852 | Bacteria | 23683 |
| 1017 | Ga0307410_10002848 | 3300031852 | Bacteria | 8505 |
| 1018 | Ga0307410_10004835 | 3300031852 | Bacteria | 7038 |
| 1019 | Ga0307410_10009406 | 3300031852 | Bacteria | 5481 |
| 1020 | Ga0307410_10012882 | 3300031852 | Bacteria | 4855 |
| 1021 | Ga0307410_10016770 | 3300031852 | Bacteria | 4379 |
| 1022 | Ga0307410_10018471 | 3300031852 | Bacteria | 4214 |
| 1023 | Ga0307410_10021886 | 3300031852 | Bacteria | 3941 |
| 1024 | Ga0307410_10023442 | 3300031852 | Bacteria | 3836 |
| 1025 | Ga0307410_10027779 | 3300031852 | Bacteria | 3579 |
| 1026 | Ga0307410_10074094 | 3300031852 | Bacteria | 2369 |
| 1027 | Ga0307410_10113753 | 3300031852 | Bacteria | 1962 |
| 1028 | Ga0307410_10198571 | 3300031852 | Bacteria | 1530 |
| 1029 | Ga0307410_10214472 | 3300031852 | Bacteria | 1477 |
| 1030 | Ga0307406_10001149 | 3300031901 | Bacteria | 14799 |
| 1031 | Ga0307406_10003488 | 3300031901 | Bacteria | 8558 |
| 1032 | Ga0307406_10027008 | 3300031901 | Bacteria | 3453 |
| 1033 | Ga0307406_10039950 | 3300031901 | Bacteria | 2914 |
| 1034 | Ga0307406_10091701 | 3300031901 | Bacteria | 2047 |
| 1035 | Ga0307406_10107328 | 3300031901 | Bacteria | 1914 |
| 1036 | Ga0307406_10109031 | 3300031901 | Bacteria | 1902 |
| 1037 | Ga0307406_10150396 | 3300031901 | Bacteria | 1660 |
| 1038 | Ga0307406_10196705 | 3300031901 | Bacteria | 1480 |
| 1039 | Ga0307406_10237779 | 3300031901 | Bacteria | 1364 |
| 1040 | Ga0307406_10569416 | 3300031901 | Bacteria | 929 |
| 1041 | Ga0307407_10001542 | 3300031903 | Bacteria | 8455 |
| 1042 | Ga0307407_10001946 | 3300031903 | Bacteria | 7826 |
| 1043 | Ga0307407_10002595 | 3300031903 | Bacteria | 7131 |
| 1044 | Ga0307407_10007483 | 3300031903 | Bacteria | 4948 |
| 1045 | Ga0307407_10015178 | 3300031903 | Bacteria | 3797 |
| 1046 | Ga0307407_10026119 | 3300031903 | Bacteria | 3088 |
| 1047 | Ga0307407_10080559 | 3300031903 | Bacteria | 1968 |
| 1048 | Ga0307407_10340773 | 3300031903 | Bacteria | 1058 |
| 1049 | Ga0307407_10344137 | 3300031903 | Bacteria | 1054 |
| 1050 | Ga0307412_10007148 | 3300031911 | Bacteria | 6337 |
| 1051 | Ga0307412_10011156 | 3300031911 | Bacteria | 5197 |
| 1052 | Ga0307412_10011193 | 3300031911 | Bacteria | 5191 |
| 1053 | Ga0307412_10040563 | 3300031911 | Bacteria | 3012 |
| 1054 | Ga0307412_10098314 | 3300031911 | Bacteria | 2064 |
| 1055 | Ga0307412_10139287 | 3300031911 | Bacteria | 1774 |
| 1056 | Ga0307412_10173253 | 3300031911 | Bacteria | 1615 |
| 1057 | Ga0307412_10332824 | 3300031911 | Bacteria | 1212 |
| 1058 | Ga0307412_10476910 | 3300031911 | Bacteria | 1034 |
| 1059 | Ga0307412_10488346 | 3300031911 | Bacteria | 1023 |
| 1060 | Ga0307409_100001095 | 3300031995 | Bacteria | 12802 |
| 1061 | Ga0307409_100004656 | 3300031995 | Bacteria | 7752 |
| 1062 | Ga0307409_100008214 | 3300031995 | Bacteria | 6315 |
| 1063 | Ga0307409_100009931 | 3300031995 | Bacteria | 5879 |
| 1064 | Ga0307409_100022413 | 3300031995 | Bacteria | 4355 |
| 1065 | Ga0307409_100042410 | 3300031995 | Bacteria | 3407 |
| 1066 | Ga0307409_100049332 | 3300031995 | Bacteria | 3209 |
| 1067 | Ga0307409_100075465 | 3300031995 | Bacteria | 2699 |
| 1068 | Ga0307409_100075567 | 3300031995 | Bacteria | 2698 |
| 1069 | Ga0307409_100081411 | 3300031995 | Bacteria | 2617 |
| 1070 | Ga0307409_100105977 | 3300031995 | Bacteria | 2345 |
| 1071 | Ga0307409_100143466 | 3300031995 | Bacteria | 2061 |
| 1072 | Ga0307409_100193406 | 3300031995 | Bacteria | 1813 |
| 1073 | Ga0307409_100252790 | 3300031995 | Bacteria | 1612 |
| 1074 | Ga0307416_100002009 | 3300032002 | Bacteria | 11429 |
| 1075 | Ga0307416_100004801 | 3300032002 | Bacteria | 8213 |
| 1076 | Ga0307416_100006767 | 3300032002 | Bacteria | 7206 |
| 1077 | Ga0307416_100027504 | 3300032002 | Bacteria | 4213 |
| 1078 | Ga0307416_100049275 | 3300032002 | Bacteria | 3348 |
| 1079 | Ga0307416_100066877 | 3300032002 | Bacteria | 2961 |
| 1080 | Ga0307416_100120266 | 3300032002 | Bacteria | 2338 |
| 1081 | Ga0307416_100220359 | 3300032002 | Bacteria | 1819 |
| 1082 | Ga0307416_100253714 | 3300032002 | Bacteria | 1714 |
| 1083 | Ga0307416_100441309 | 3300032002 | Bacteria | 1352 |
| 1084 | Ga0307416_100754314 | 3300032002 | Bacteria | 1066 |
| 1085 | Ga0307414_10016999 | 3300032004 | Bacteria | 4441 |
| 1086 | Ga0307414_10022664 | 3300032004 | Bacteria | 3967 |
| 1087 | Ga0307414_10049644 | 3300032004 | Bacteria | 2902 |
| 1088 | Ga0307414_10057325 | 3300032004 | Bacteria | 2738 |
| 1089 | Ga0307414_10058986 | 3300032004 | Bacteria | 2707 |
| 1090 | Ga0307414_10064078 | 3300032004 | Bacteria | 2615 |
| 1091 | Ga0307414_10065439 | 3300032004 | Bacteria | 2593 |
| 1092 | Ga0307414_10071176 | 3300032004 | Bacteria | 2507 |
| 1093 | Ga0307414_10074410 | 3300032004 | Bacteria | 2461 |
| 1094 | Ga0307414_10080822 | 3300032004 | Bacteria | 2378 |
| 1095 | Ga0307414_10082256 | 3300032004 | Bacteria | 2360 |
| 1096 | Ga0307414_10102582 | 3300032004 | Bacteria | 2156 |
| 1097 | Ga0307414_10128179 | 3300032004 | Bacteria | 1965 |
| 1098 | Ga0307414_10128387 | 3300032004 | Bacteria | 1963 |
| 1099 | Ga0307414_10132324 | 3300032004 | Bacteria | 1938 |
| 1100 | Ga0307411_10000997 | 3300032005 | Bacteria | 10907 |
| 1101 | Ga0307411_10001612 | 3300032005 | Bacteria | 9392 |
| 1102 | Ga0307411_10001951 | 3300032005 | Bacteria | 8837 |
| 1103 | Ga0307411_10007559 | 3300032005 | Bacteria | 5550 |
| 1104 | Ga0307411_10008119 | 3300032005 | Bacteria | 5412 |
| 1105 | Ga0307411_10011823 | 3300032005 | Bacteria | 4732 |
| 1106 | Ga0307411_10017680 | 3300032005 | Bacteria | 4071 |
| 1107 | Ga0307411_10050205 | 3300032005 | Bacteria | 2715 |
| 1108 | Ga0307411_10054530 | 3300032005 | Bacteria | 2625 |
| 1109 | Ga0307411_10057500 | 3300032005 | Bacteria | 2570 |
| 1110 | Ga0307411_10060348 | 3300032005 | Bacteria | 2518 |
| 1111 | Ga0307411_10064323 | 3300032005 | Bacteria | 2455 |
| 1112 | Ga0307411_10079612 | 3300032005 | Bacteria | 2250 |
| 1113 | Ga0307411_10080096 | 3300032005 | Bacteria | 2244 |
| 1114 | Ga0307411_10089268 | 3300032005 | Bacteria | 2146 |
| 1115 | Ga0307411_10152872 | 3300032005 | Bacteria | 1717 |
| 1116 | Ga0307411_10156608 | 3300032005 | Bacteria | 1700 |
| 1117 | Ga0307411_10203181 | 3300032005 | Bacteria | 1523 |
| 1118 | Ga0307411_10217963 | 3300032005 | Bacteria | 1478 |
| 1119 | Ga0307411_10344298 | 3300032005 | Bacteria | 1212 |
| 1120 | Ga0307411_10399819 | 3300032005 | Bacteria | 1135 |
| 1121 | Ga0307415_100005998 | 3300032126 | Bacteria | 6512 |
| 1122 | Ga0307415_100011428 | 3300032126 | Bacteria | 5081 |
| 1123 | Ga0307415_100011638 | 3300032126 | Bacteria | 5046 |
| 1124 | Ga0307415_100035538 | 3300032126 | Bacteria | 3255 |
| 1125 | Ga0307415_100061923 | 3300032126 | Bacteria | 2593 |
| 1126 | Ga0307415_100093123 | 3300032126 | Bacteria | 2187 |
| 1127 | Ga0307415_100097719 | 3300032126 | Bacteria | 2144 |
| 1128 | Ga0307415_100159647 | 3300032126 | Bacteria | 1746 |
| 1129 | Ga0307415_100230721 | 3300032126 | Bacteria | 1490 |
| 1130 | Ga0307415_100351179 | 3300032126 | Bacteria | 1241 |
| 1131 | Ga0307415_100513058 | 3300032126 | Bacteria | 1050 |
| 1132 | Ga0307510_10000014 | 3300033180 | Bacteria | 271607 |
| 1133 | Ga0307510_10009003 | 3300033180 | Bacteria | 11888 |
| 1134 | Ga0373959_0029053 | 3300034820 | Bacteria | 1107 |
| 1135 | Ga0373936_0000241 | 3300035113 | Bacteria | 18098 |
| 1136 | Ga0373939_0000094 | 3300035114 | Bacteria | 27768 |
| 1137 | Ga0373957_0137901 | 3300035120 | Bacteria | 996 |
| 1138 | Ga0373957_0184698 | 3300035120 | Bacteria | 865 |
| 1139 | Ga0373943_0005992 | 3300035170 | Bacteria | 5455 |
| 1140 | Ga0373943_0164833 | 3300035170 | Bacteria | 1209 |
| 1141 | Ga0373961_0066743 | 3300035241 | Bacteria | 1104 |
| 1142 | Ga0373962_0012366 | 3300035242 | Bacteria | 2150 |
| 1143 | Ga0316574_0037011 | 3300035398 | Bacteria | 2990 |
| 1144 | Ga0373931_0007647 | 3300035691 | Bacteria | 5095 |
| 1145 | Ga0373931_0033030 | 3300035691 | Bacteria | 2680 |
| 1146 | Ga0373935_0081666 | 3300035692 | Bacteria | 2102 |
| 1147 | Ga0373927_0009097 | 3300035695 | Bacteria | 6666 |
| 1148 | Ga0373927_0040428 | 3300035695 | Bacteria | 3025 |
| 1149 | Ga0373933_0044992 | 3300035724 | Bacteria | 2616 |
| 1150 | Ga0373937_0011845 | 3300036401 | Bacteria | 7659 |
| 1151 | Ga0373937_0016107 | 3300036401 | Bacteria | 6632 |
| 1152 | Ga0373937_0400537 | 3300036401 | Bacteria | 1302 |
| 1153 | Ga0316584_0079129 | 3300036712 | Bacteria | 2462 |
| 1154 | Ga0373925_0440835 | 3300037068 | Bacteria | 1066 |
| 1155 | Ga0395899_0000334 | 3300037312 | Bacteria | 59344 |
| 1156 | Ga0395899_0002441 | 3300037312 | Bacteria | 15108 |
| 1157 | Ga0395899_0002612 | 3300037312 | Bacteria | 14528 |
| 1158 | Ga0395899_0002671 | 3300037312 | Bacteria | 14376 |
| 1159 | Ga0395899_0002940 | 3300037312 | Bacteria | 13659 |
| 1160 | Ga0395899_0010568 | 3300037312 | Bacteria | 7073 |
| 1161 | Ga0395899_0015016 | 3300037312 | Bacteria | 5905 |
| 1162 | Ga0395899_0022102 | 3300037312 | Bacteria | 4823 |
| 1163 | Ga0395899_0023172 | 3300037312 | Bacteria | 4705 |
| 1164 | Ga0395899_0029558 | 3300037312 | Bacteria | 4122 |
| 1165 | Ga0395899_0034202 | 3300037312 | Bacteria | 3815 |
| 1166 | Ga0395899_0036935 | 3300037312 | Bacteria | 3663 |
| 1167 | Ga0395899_0103198 | 3300037312 | Bacteria | 2057 |
| 1168 | Ga0395899_0120893 | 3300037312 | Bacteria | 1876 |
| 1169 | Ga0395899_0145804 | 3300037312 | Bacteria | 1681 |
| 1170 | Ga0395899_0203517 | 3300037312 | Bacteria | 1379 |
| 1171 | Ga0395899_0205323 | 3300037312 | Bacteria | 1371 |
| 1172 | Ga0395899_0205340 | 3300037312 | Bacteria | 1371 |
| 1173 | Ga0395900_0000084 | 3300037418 | Bacteria | 172593 |
| 1174 | Ga0395900_0002289 | 3300037418 | Bacteria | 21271 |
| 1175 | Ga0395900_0002759 | 3300037418 | Bacteria | 19188 |
| 1176 | Ga0395900_0011437 | 3300037418 | Bacteria | 9085 |
| 1177 | Ga0395900_0015453 | 3300037418 | Bacteria | 7782 |
| 1178 | Ga0395900_0024121 | 3300037418 | Bacteria | 6226 |
| 1179 | Ga0395900_0032811 | 3300037418 | Bacteria | 5341 |
| 1180 | Ga0395900_0041524 | 3300037418 | Bacteria | 4742 |
| 1181 | Ga0395900_0048166 | 3300037418 | Bacteria | 4390 |
| 1182 | Ga0395900_0053389 | 3300037418 | Bacteria | 4159 |
| 1183 | Ga0395900_0056181 | 3300037418 | Bacteria | 4052 |
| 1184 | Ga0395900_0105776 | 3300037418 | Bacteria | 2891 |
| 1185 | Ga0395900_0120563 | 3300037418 | Bacteria | 2691 |
| 1186 | Ga0395900_0149447 | 3300037418 | Bacteria | 2387 |
| 1187 | Ga0395900_0202719 | 3300037418 | Bacteria | 2006 |
| 1188 | Ga0395900_0239781 | 3300037418 | Bacteria | 1820 |
| 1189 | Ga0395900_0290894 | 3300037418 | Bacteria | 1622 |
| 1190 | Ga0395900_0344262 | 3300037418 | Bacteria | 1465 |
| 1191 | Ga0395900_0354423 | 3300037418 | Bacteria | 1440 |
| 1192 | Ga0395900_0462939 | 3300037418 | Bacteria | 1222 |
| 1193 | Ga0395900_0551139 | 3300037418 | Bacteria | 1097 |
| 1194 | Ga0395900_0584499 | 3300037418 | Bacteria | 1058 |
| 1195 | Ga0395900_0635176 | 3300037418 | Bacteria | 1005 |
| 1196 | Ga0395898_0000021 | 3300037466 | Bacteria | 393971 |
| 1197 | Ga0395898_0002115 | 3300037466 | Bacteria | 24534 |
| 1198 | Ga0395898_0006097 | 3300037466 | Bacteria | 12931 |
| 1199 | Ga0395898_0014592 | 3300037466 | Bacteria | 8067 |
| 1200 | Ga0395898_0018292 | 3300037466 | Bacteria | 7145 |
| 1201 | Ga0395898_0025894 | 3300037466 | Bacteria | 5906 |
| 1202 | Ga0395898_0030307 | 3300037466 | Bacteria | 5415 |
| 1203 | Ga0395898_0053534 | 3300037466 | Bacteria | 3942 |
| 1204 | Ga0395898_0058017 | 3300037466 | Bacteria | 3770 |
| 1205 | Ga0395898_0067055 | 3300037466 | Bacteria | 3476 |
| 1206 | Ga0395898_0072080 | 3300037466 | Bacteria | 3337 |
| 1207 | Ga0395898_0076730 | 3300037466 | Bacteria | 3226 |
| 1208 | Ga0395898_0202801 | 3300037466 | Bacteria | 1893 |
| 1209 | Ga0395898_0383496 | 3300037466 | Bacteria | 1340 |
| 1210 | Ga0395898_0616775 | 3300037466 | Bacteria | 1027 |
| 1211 | Ga0395898_0703572 | 3300037466 | Bacteria | 952 |
| 1212 | Ga0395898_0867950 | 3300037466 | Bacteria | 841 |
| 1213 | Ga0395905_0000006 | 3300037471 | Bacteria | 549428 |
| 1214 | Ga0395905_0000191 | 3300037471 | Bacteria | 97191 |
| 1215 | Ga0395905_0000372 | 3300037471 | Bacteria | 63933 |
| 1216 | Ga0395905_0001643 | 3300037471 | Bacteria | 26485 |
| 1217 | Ga0395905_0003116 | 3300037471 | Bacteria | 17889 |
| 1218 | Ga0395905_0003972 | 3300037471 | Bacteria | 15557 |
| 1219 | Ga0395905_0005548 | 3300037471 | Bacteria | 12864 |
| 1220 | Ga0395905_0006958 | 3300037471 | Bacteria | 11303 |
| 1221 | Ga0395905_0007174 | 3300037471 | Bacteria | 11130 |
| 1222 | Ga0395905_0007663 | 3300037471 | Bacteria | 10715 |
| 1223 | Ga0395905_0009025 | 3300037471 | Bacteria | 9782 |
| 1224 | Ga0395905_0009210 | 3300037471 | Bacteria | 9667 |
| 1225 | Ga0395905_0015666 | 3300037471 | Bacteria | 7203 |
| 1226 | Ga0395905_0028190 | 3300037471 | Bacteria | 5293 |
| 1227 | Ga0395905_0047025 | 3300037471 | Bacteria | 4045 |
| 1228 | Ga0395905_0060448 | 3300037471 | Bacteria | 3543 |
| 1229 | Ga0395905_0068122 | 3300037471 | Bacteria | 3334 |
| 1230 | Ga0395905_0095817 | 3300037471 | Bacteria | 2786 |
| 1231 | Ga0395905_0099676 | 3300037471 | Bacteria | 2728 |
| 1232 | Ga0395905_0109931 | 3300037471 | Bacteria | 2588 |
| 1233 | Ga0395905_0134983 | 3300037471 | Bacteria | 2321 |
| 1234 | Ga0395905_0152826 | 3300037471 | Bacteria | 2171 |
| 1235 | Ga0395905_0219699 | 3300037471 | Bacteria | 1778 |
| 1236 | Ga0395905_0221727 | 3300037471 | Bacteria | 1770 |
| 1237 | Ga0395905_0222740 | 3300037471 | Bacteria | 1765 |
| 1238 | Ga0395905_0268916 | 3300037471 | Bacteria | 1590 |
| 1239 | Ga0395905_0290052 | 3300037471 | Bacteria | 1523 |
| 1240 | Ga0395905_0369760 | 3300037471 | Bacteria | 1327 |
| 1241 | Ga0395905_0414683 | 3300037471 | Bacteria | 1242 |
| 1242 | Ga0395905_0456551 | 3300037471 | Bacteria | 1176 |
| 1243 | Ga0395905_0526669 | 3300037471 | Bacteria | 1082 |
| 1244 | Ga0436364_1182596 | 3300037853 | Bacteria | 26080 |
| 1245 | Ga0395901_0001258 | 3300038443 | Bacteria | 26908 |
| 1246 | Ga0395901_0001740 | 3300038443 | Bacteria | 22491 |
| 1247 | Ga0395901_0004352 | 3300038443 | Bacteria | 14287 |
| 1248 | Ga0395901_0004669 | 3300038443 | Bacteria | 13811 |
| 1249 | Ga0395901_0012257 | 3300038443 | Bacteria | 8701 |
| 1250 | Ga0395901_0018587 | 3300038443 | Bacteria | 7098 |
| 1251 | Ga0395901_0048742 | 3300038443 | Bacteria | 4399 |
| 1252 | Ga0395901_0052514 | 3300038443 | Bacteria | 4236 |
| 1253 | Ga0395901_0093886 | 3300038443 | Bacteria | 3142 |
| 1254 | Ga0395901_0142105 | 3300038443 | Bacteria | 2522 |
| 1255 | Ga0395901_0177328 | 3300038443 | Bacteria | 2235 |
| 1256 | Ga0395901_0184793 | 3300038443 | Bacteria | 2186 |
| 1257 | Ga0395901_0195571 | 3300038443 | Bacteria | 2121 |
| 1258 | Ga0395901_0208692 | 3300038443 | Bacteria | 2045 |
| 1259 | Ga0395901_0217593 | 3300038443 | Bacteria | 1997 |
| 1260 | Ga0395901_0269392 | 3300038443 | Bacteria | 1772 |
| 1261 | Ga0395901_0377658 | 3300038443 | Bacteria | 1459 |
| 1262 | Ga0395901_0433438 | 3300038443 | Bacteria | 1346 |
| 1263 | Ga0395901_0517240 | 3300038443 | Bacteria | 1213 |
| 1264 | Ga0237819_00570 | 3300038705 | Bacteria | 12398 |
| 1265 | Ga0436365_0184456 | 3300039437 | Bacteria | 3207 |
| 1266 | Ga0436365_0774506 | 3300039437 | Bacteria | 12388 |
| 1267 | Ga0436365_0998972 | 3300039437 | Bacteria | 5629 |
| 1268 | Ga0436365_1009784 | 3300039437 | Bacteria | 2896 |
| 1269 | Ga0436365_1119595 | 3300039437 | Bacteria | 3071 |
| 1270 | Ga0436360_1163113 | 3300039438 | Bacteria | 8239 |
| 1271 | Ga0436363_0550894 | 3300039450 | Bacteria | 1400 |
| 1272 | Ga0436363_0893184 | 3300039450 | Bacteria | 6655 |
| 1273 | Ga0436363_1642796 | 3300039450 | Bacteria | 14852 |
| 1274 | Ga0436362_0126459 | 3300039453 | Bacteria | 236400 |
| 1275 | Ga0436362_0195334 | 3300039453 | Bacteria | 2520 |
| 1276 | Ga0439461_0018756 | 3300041410 | Bacteria | 1357 |
| 1277 | Ga0451853_1650316 | 3300041512 | Bacteria | 1072 |
| 1278 | Ga0439443_000059 | 3300042003 | Bacteria | 6223 |
| 1279 | Ga0439432_013232 | 3300042006 | Bacteria | 2809 |
| 1280 | Ga0439449_0021135 | 3300042007 | Bacteria | 2437 |
| 1281 | Ga0439449_0075806 | 3300042007 | Bacteria | 1240 |
| 1282 | Ga0439455_0074891 | 3300042012 | Bacteria | 914 |
| 1283 | Ga0439456_000086 | 3300042013 | Bacteria | 32013 |
| 1284 | Ga0450890_000770 | 3300042127 | Bacteria | 4625 |
| 1285 | Ga0450892_000388 | 3300042130 | Bacteria | 5184 |
| 1286 | Ga0450900_013602 | 3300042136 | Bacteria | 1077 |
| 1287 | Ga0450905_000289 | 3300042142 | Bacteria | 5985 |
| 1288 | Ga0450889_000091 | 3300042144 | Bacteria | 8434 |
| 1289 | Ga0450889_000640 | 3300042144 | Bacteria | 3867 |
| 1290 | Ga0439458_0001847 | 3300042157 | Bacteria | 5265 |
| 1291 | Ga0439459_0006633 | 3300042438 | Bacteria | 1934 |
| 1292 | Ga0450893_0006315 | 3300042532 | Bacteria | 1916 |
| 1293 | Ga0451577_0597389 | 3300042876 | Bacteria | 1002 |
| 1294 | Ga0466969_0000561 | 3300044656 | Bacteria | 20372 |
| 1295 | Ga0466969_0005115 | 3300044656 | Bacteria | 6973 |
| 1296 | Ga0466969_0053865 | 3300044656 | Bacteria | 1972 |
| 1297 | Ga0466972_0064982 | 3300044658 | Bacteria | 1745 |
| 1298 | Ga0466972_0177931 | 3300044658 | Bacteria | 998 |
| 1299 | Ga0466965_0039691 | 3300044683 | Bacteria | 2315 |
| 1300 | Ga0466966_0001104 | 3300044684 | Bacteria | 17300 |
| 1301 | Ga0466966_0023711 | 3300044684 | Bacteria | 4015 |
| 1302 | Ga0466966_0064836 | 3300044684 | Bacteria | 2299 |
| 1303 | Ga0466966_0427027 | 3300044684 | Bacteria | 796 |
| 1304 | Ga0466961_0000806 | 3300044693 | Bacteria | 19537 |
| 1305 | Ga0466961_0020251 | 3300044693 | Bacteria | 4280 |
| 1306 | Ga0466961_0032193 | 3300044693 | Bacteria | 3368 |
| 1307 | Ga0466961_0060425 | 3300044693 | Bacteria | 2410 |
| 1308 | Ga0466961_0081205 | 3300044693 | Bacteria | 2052 |
| 1309 | Ga0466963_0008859 | 3300044694 | Bacteria | 6038 |
| 1310 | Ga0466963_0010369 | 3300044694 | Bacteria | 5639 |
| 1311 | Ga0466963_0056161 | 3300044694 | Bacteria | 2619 |
| 1312 | Ga0466963_0115748 | 3300044694 | Bacteria | 1842 |
| 1313 | Ga0466963_0193183 | 3300044694 | Bacteria | 1422 |
| 1314 | Ga0466964_0004970 | 3300044706 | Bacteria | 4915 |
| 1315 | Ga0466964_0049721 | 3300044706 | Bacteria | 1717 |
| 1316 | Ga0466964_0082767 | 3300044706 | Bacteria | 1381 |
| 1317 | Ga0466964_0142905 | 3300044706 | Bacteria | 1102 |
| 1318 | Ga0466971_0019546 | 3300044719 | Bacteria | 3009 |
| 1319 | Ga0466971_0023960 | 3300044719 | Bacteria | 2721 |
| 1320 | Ga0466971_0032061 | 3300044719 | Bacteria | 2354 |
| 1321 | Ga0466968_0225032 | 3300044735 | Bacteria | 885 |
| 1322 | Ga0466970_0000141 | 3300044765 | Bacteria | 33348 |
| 1323 | Ga0466970_0083823 | 3300044765 | Bacteria | 1725 |
| 1324 | Ga0466970_0096904 | 3300044765 | Bacteria | 1604 |
| 1325 | Ga0466957_0001445 | 3300044842 | Bacteria | 12423 |
| 1326 | Ga0466957_0004083 | 3300044842 | Bacteria | 8086 |
| 1327 | Ga0466957_0012108 | 3300044842 | Bacteria | 4989 |
| 1328 | Ga0466957_0050742 | 3300044842 | Bacteria | 2525 |
| 1329 | Ga0466957_0114841 | 3300044842 | Bacteria | 1711 |
| 1330 | Ga0466960_0017595 | 3300044901 | Bacteria | 3119 |
| 1331 | Ga0466959_0006624 | 3300045049 | Bacteria | 8043 |
| 1332 | Ga0466959_0007471 | 3300045049 | Bacteria | 7671 |
| 1333 | Ga0466959_0026026 | 3300045049 | Bacteria | 4338 |
| 1334 | Ga0466959_0046437 | 3300045049 | Bacteria | 3195 |
| 1335 | Ga0466959_0114087 | 3300045049 | Bacteria | 1926 |
| 1336 | Ga0466959_0236757 | 3300045049 | Bacteria | 1262 |
| 1337 | Ga0466959_0322926 | 3300045049 | Bacteria | 1055 |
| 1338 | Ga0451576_0298183 | 3300045051 | Bacteria | 1685 |
| 1339 | Ga0451576_0316976 | 3300045051 | Bacteria | 1632 |
| 1340 | Ga0466958_0000112 | 3300045836 | Bacteria | 26021 |
| 1341 | Ga0466958_0015179 | 3300045836 | Bacteria | 4409 |
| 1342 | Ga0466958_0028848 | 3300045836 | Bacteria | 3293 |
| 1343 | Ga0466958_0041070 | 3300045836 | Bacteria | 2781 |
| 1344 | Ga0466958_0062214 | 3300045836 | Bacteria | 2275 |
| 1345 | Ga0466967_0054646 | 3300045976 | Bacteria | 3516 |
| 1346 | Ga0466967_0079223 | 3300045976 | Bacteria | 2961 |
| 1347 | Ga0466967_0082683 | 3300045976 | Bacteria | 2902 |
| 1348 | Ga0466967_0086801 | 3300045976 | Bacteria | 2835 |
| 1349 | Ga0466967_0109675 | 3300045976 | Bacteria | 2534 |
| 1350 | Ga0466967_0170652 | 3300045976 | Bacteria | 2046 |
| 1351 | Ga0466967_0210302 | 3300045976 | Bacteria | 1845 |
| 1352 | Ga0466967_0217642 | 3300045976 | Bacteria | 1814 |
| 1353 | Ga0466967_0251882 | 3300045976 | Bacteria | 1687 |
| 1354 | Ga0466967_0326818 | 3300045976 | Bacteria | 1480 |
| 1355 | Ga0466967_0342293 | 3300045976 | Bacteria | 1446 |
| 1356 | Ga0495603_0076531 | 3300046455 | Bacteria | 1964 |
| 1357 | Ga0495590_0001289 | 3300046457 | Bacteria | 10915 |
| 1358 | Ga0495638_0000714 | 3300046460 | Bacteria | 35808 |
| 1359 | Ga0495638_0013012 | 3300046460 | Bacteria | 5682 |
| 1360 | Ga0495638_0071193 | 3300046460 | Bacteria | 2127 |
| 1361 | Ga0495580_0002152 | 3300046472 | Bacteria | 17309 |
| 1362 | Ga0495616_0001437 | 3300046513 | Bacteria | 16573 |
| 1363 | Ga0495643_0147815 | 3300046522 | Bacteria | 1166 |
| 1364 | Ga0495648_0041969 | 3300046524 | Bacteria | 2883 |
| 1365 | Ga0495663_0010721 | 3300046525 | Bacteria | 2550 |
| 1366 | Ga0495663_0037608 | 3300046525 | Bacteria | 1460 |
| 1367 | Ga0495598_0009154 | 3300046537 | Bacteria | 2331 |
| 1368 | Ga0495598_0009515 | 3300046537 | Bacteria | 2300 |
| 1369 | Ga0495621_0000828 | 3300046539 | Bacteria | 7840 |
| 1370 | Ga0495621_0001056 | 3300046539 | Bacteria | 7053 |
| 1371 | Ga0495621_0023643 | 3300046539 | Bacteria | 2045 |
| 1372 | Ga0495633_0019671 | 3300046558 | Bacteria | 3411 |
| 1373 | Ga0495625_0003242 | 3300046660 | Bacteria | 16463 |
| 1374 | Ga0495625_0056158 | 3300046660 | Bacteria | 2804 |
| 1375 | Ga0495625_0121124 | 3300046660 | Bacteria | 1780 |
| 1376 | Ga0495623_0049158 | 3300046679 | Bacteria | 2673 |
| 1377 | Ga0495669_0001546 | 3300046684 | Bacteria | 9460 |
| 1378 | Ga0495669_0006368 | 3300046684 | Bacteria | 4932 |
| 1379 | Ga0495669_0008299 | 3300046684 | Bacteria | 4362 |
| 1380 | Ga0495669_0020004 | 3300046684 | Bacteria | 2892 |
| 1381 | Ga0495669_0031978 | 3300046684 | Bacteria | 2311 |
| 1382 | Ga0495669_0052234 | 3300046684 | Bacteria | 1835 |
| 1383 | Ga0495669_0118758 | 3300046684 | Bacteria | 1238 |
| 1384 | Ga0495670_0002211 | 3300046691 | Bacteria | 9613 |
| 1385 | Ga0495670_0028894 | 3300046691 | Bacteria | 2750 |
| 1386 | Ga0495670_0096201 | 3300046691 | Bacteria | 1520 |
| 1387 | Ga0495649_0001764 | 3300046694 | Bacteria | 15947 |
| 1388 | Ga0495680_0271034 | 3300047322 | Bacteria | 1198 |
| 1389 | Ga0495677_0051924 | 3300047445 | Bacteria | 1510 |
| 1390 | Ga0495677_0087975 | 3300047445 | Bacteria | 1169 |
| 1391 | Ga0496100_0012082 | 3300048903 | Bacteria | 4939 |
| 1392 | Ga0496100_0023756 | 3300048903 | Bacteria | 3730 |
| 1393 | Ga0496100_0034133 | 3300048903 | Bacteria | 3190 |
| 1394 | Ga0496100_0294497 | 3300048903 | Bacteria | 1213 |
| 1395 | Ga0496101_0003206 | 3300048904 | Bacteria | 10145 |
| 1396 | Ga0496101_0006265 | 3300048904 | Bacteria | 7656 |
| 1397 | Ga0496101_0010717 | 3300048904 | Bacteria | 6060 |
| 1398 | Ga0496101_0311987 | 3300048904 | Bacteria | 1233 |
| 1399 | Ga0496101_0538732 | 3300048904 | Bacteria | 923 |
| 1400 | Ga0496102_0021186 | 3300048905 | Bacteria | 5748 |
| 1401 | Ga0496102_0055285 | 3300048905 | Bacteria | 3620 |
| 1402 | Ga0496102_0089784 | 3300048905 | Bacteria | 2843 |
| 1403 | Ga0496102_0115519 | 3300048905 | Bacteria | 2504 |
| 1404 | Ga0496103_0044380 | 3300048906 | Bacteria | 2739 |
| 1405 | Ga0496103_0189132 | 3300048906 | Bacteria | 1324 |
| 1406 | Ga0496103_0335265 | 3300048906 | Bacteria | 973 |
| 1407 | Ga0496105_0014011 | 3300048908 | Bacteria | 6378 |
| 1408 | Ga0496105_0440672 | 3300048908 | Bacteria | 1029 |
| 1409 | Ga0496106_0010145 | 3300048909 | Bacteria | 6960 |
| 1410 | Ga0496106_0040445 | 3300048909 | Bacteria | 3492 |
| 1411 | Ga0496106_0040837 | 3300048909 | Bacteria | 3476 |
| 1412 | Ga0496106_0147975 | 3300048909 | Bacteria | 1851 |
| 1413 | Ga0496106_0193664 | 3300048909 | Bacteria | 1617 |
| 1414 | Ga0496107_0001288 | 3300048910 | Bacteria | 15332 |
| 1415 | Ga0496107_0013115 | 3300048910 | Bacteria | 5790 |
| 1416 | Ga0496107_0028262 | 3300048910 | Bacteria | 3984 |
| 1417 | Ga0496107_0068823 | 3300048910 | Bacteria | 2569 |
| 1418 | Ga0496107_0102333 | 3300048910 | Bacteria | 2100 |
| 1419 | Ga0496107_0122857 | 3300048910 | Bacteria | 1913 |
| 1420 | Ga0496107_0133507 | 3300048910 | Bacteria | 1833 |
| 1421 | Ga0496107_0337987 | 3300048910 | Bacteria | 1120 |
| 1422 | Ga0496108_0000372 | 3300048911 | Bacteria | 37378 |
| 1423 | Ga0496108_0009427 | 3300048911 | Bacteria | 7905 |
| 1424 | Ga0496108_0020262 | 3300048911 | Bacteria | 5465 |
| 1425 | Ga0496108_0055426 | 3300048911 | Bacteria | 3328 |
| 1426 | Ga0496108_0078996 | 3300048911 | Bacteria | 2785 |
| 1427 | Ga0496109_0001137 | 3300048912 | Bacteria | 22110 |
| 1428 | Ga0496109_0001325 | 3300048912 | Bacteria | 20432 |
| 1429 | Ga0496109_0057599 | 3300048912 | Bacteria | 3547 |
| 1430 | Ga0496109_0061301 | 3300048912 | Bacteria | 3439 |
| 1431 | Ga0496109_0103348 | 3300048912 | Bacteria | 2644 |
| 1432 | Ga0496109_0234385 | 3300048912 | Bacteria | 1727 |
| 1433 | Ga0496110_0009927 | 3300048913 | Bacteria | 7719 |
| 1434 | Ga0496110_0016678 | 3300048913 | Bacteria | 6135 |
| 1435 | Ga0496110_0023560 | 3300048913 | Bacteria | 5238 |
| 1436 | Ga0496110_0031418 | 3300048913 | Bacteria | 4582 |
| 1437 | Ga0496110_0128958 | 3300048913 | Bacteria | 2283 |
| 1438 | Ga0496110_0517101 | 3300048913 | Bacteria | 1086 |
| 1439 | Ga0496111_0002146 | 3300048914 | Bacteria | 11800 |
| 1440 | Ga0496111_0009171 | 3300048914 | Bacteria | 6587 |
| 1441 | Ga0496111_0021784 | 3300048914 | Bacteria | 4477 |
| 1442 | Ga0496111_0034718 | 3300048914 | Bacteria | 3602 |
| 1443 | Ga0496111_0085202 | 3300048914 | Bacteria | 2310 |
| 1444 | Ga0496111_0149004 | 3300048914 | Bacteria | 1735 |
| 1445 | Ga0496111_0265164 | 3300048914 | Bacteria | 1274 |
| 1446 | Ga0496111_0353202 | 3300048914 | Bacteria | 1088 |
| 1447 | Ga0496112_0007892 | 3300048915 | Bacteria | 9484 |
| 1448 | Ga0496112_0012135 | 3300048915 | Bacteria | 7906 |
| 1449 | Ga0496112_0025396 | 3300048915 | Bacteria | 5688 |
| 1450 | Ga0496112_0049413 | 3300048915 | Bacteria | 4123 |
| 1451 | Ga0496112_0062421 | 3300048915 | Bacteria | 3675 |
| 1452 | Ga0496112_0142590 | 3300048915 | Bacteria | 2365 |
| 1453 | Ga0496112_0156129 | 3300048915 | Bacteria | 2249 |
| 1454 | Ga0496113_0072071 | 3300048916 | Bacteria | 2628 |
| 1455 | Ga0496113_0167037 | 3300048916 | Bacteria | 1741 |
| 1456 | Ga0496114_0000023 | 3300048917 | Bacteria | 219092 |
| 1457 | Ga0496114_0009720 | 3300048917 | Bacteria | 7641 |
| 1458 | Ga0496114_0025285 | 3300048917 | Bacteria | 4852 |
| 1459 | Ga0496114_0091099 | 3300048917 | Bacteria | 2589 |
| 1460 | Ga0496115_0004751 | 3300048918 | Bacteria | 9858 |
| 1461 | Ga0496115_0006554 | 3300048918 | Bacteria | 8533 |
| 1462 | Ga0496115_0028270 | 3300048918 | Bacteria | 4394 |
| 1463 | Ga0496115_0411564 | 3300048918 | Bacteria | 1096 |
| 1464 | Ga0496117_0000156 | 3300048920 | Bacteria | 145285 |
| 1465 | Ga0496118_0000005 | 3300048921 | Bacteria | 697350 |
| 1466 | Ga0496119_0001995 | 3300048922 | Bacteria | 23145 |
| 1467 | Ga0496119_0027338 | 3300048922 | Bacteria | 3924 |
| 1468 | Ga0496119_0096703 | 3300048922 | Bacteria | 1665 |
| 1469 | Ga0496120_0000173 | 3300048923 | Bacteria | 109909 |
| 1470 | Ga0496120_0013758 | 3300048923 | Bacteria | 5429 |
| 1471 | Ga0496120_0043030 | 3300048923 | Bacteria | 2634 |
| 1472 | Ga0496121_0000371 | 3300048924 | Bacteria | 92354 |
| 1473 | Ga0496121_0000441 | 3300048924 | Bacteria | 82090 |
| 1474 | Ga0496121_0002693 | 3300048924 | Bacteria | 26575 |
| 1475 | Ga0496121_0004828 | 3300048924 | Bacteria | 17746 |
| 1476 | Ga0496121_0045899 | 3300048924 | Bacteria | 3747 |
| 1477 | Ga0496124_0019875 | 3300048927 | Bacteria | 6230 |
| 1478 | Ga0496124_0158874 | 3300048927 | Bacteria | 1764 |
| 1479 | Ga0496125_0001476 | 3300048928 | Bacteria | 33987 |
| 1480 | Ga0496125_0003558 | 3300048928 | Bacteria | 18766 |
| 1481 | Ga0496125_0075785 | 3300048928 | Bacteria | 2601 |
| 1482 | Ga0496125_0264987 | 3300048928 | Bacteria | 1074 |
| 1483 | Ga0496126_0003036 | 3300048929 | Bacteria | 21761 |
| 1484 | Ga0496126_0014156 | 3300048929 | Bacteria | 8072 |
| 1485 | Ga0496126_0018733 | 3300048929 | Bacteria | 6849 |
| 1486 | Ga0496126_0405328 | 3300048929 | Bacteria | 1105 |
| 1487 | Ga0496126_0490316 | 3300048929 | Bacteria | 983 |
| 1488 | Ga0495678_037576 | 3300049459 | Bacteria | 1966 |
| 1489 | Ga0501298_033164 | 3300049521 | Bacteria | 1022 |
| 1490 | Ga0501032_0000083 | 3300049569 | Bacteria | 82166 |
| 1491 | Ga0501032_0002358 | 3300049569 | Bacteria | 14796 |
| 1492 | Ga0501033_0016156 | 3300049570 | Bacteria | 5652 |
| 1493 | Ga0501033_0147790 | 3300049570 | Bacteria | 1697 |
| 1494 | Ga0501034_0000001 | 3300049571 | Bacteria | 2184493 |
| 1495 | Ga0501034_0028292 | 3300049571 | Bacteria | 5702 |
| 1496 | Ga0501034_0809472 | 3300049571 | Bacteria | 829 |
| 1497 | Ga0501036_0008712 | 3300049572 | Bacteria | 8321 |
| 1498 | Ga0501037_0000785 | 3300049573 | Bacteria | 23911 |
| 1499 | Ga0501038_0000644 | 3300049574 | Bacteria | 31017 |
| 1500 | Ga0501038_0001615 | 3300049574 | Bacteria | 20948 |
| 1501 | Ga0501039_0000033 | 3300049575 | Bacteria | 128868 |
| 1502 | Ga0501039_0001268 | 3300049575 | Bacteria | 18468 |
| 1503 | Ga0501042_0366238 | 3300049578 | Bacteria | 1043 |
| 1504 | Ga0501043_0002273 | 3300049579 | Bacteria | 16341 |
| 1505 | Ga0501046_0002264 | 3300049580 | Bacteria | 18161 |
| 1506 | Ga0501047_0039919 | 3300049581 | Bacteria | 4539 |
| 1507 | Ga0501047_0363352 | 3300049581 | Bacteria | 1283 |
| 1508 | Ga0501048_0008512 | 3300049582 | Bacteria | 7755 |
| 1509 | Ga0501067_0001478 | 3300049583 | Bacteria | 12775 |
| 1510 | Ga0501068_0211139 | 3300049584 | Bacteria | 1232 |
| 1511 | Ga0501069_0000429 | 3300049585 | Bacteria | 19098 |
| 1512 | Ga0501070_0006112 | 3300049586 | Bacteria | 10263 |
| 1513 | Ga0501071_0387250 | 3300049587 | Bacteria | 1067 |
| 1514 | Ga0501071_0517305 | 3300049587 | Bacteria | 916 |
| 1515 | Ga0501073_0060098 | 3300049589 | Bacteria | 2652 |
| 1516 | Ga0501074_0006905 | 3300049590 | Bacteria | 8196 |
| 1517 | Ga0501075_0245951 | 3300049591 | Bacteria | 1363 |
| 1518 | Ga0501202_008106 | 3300049652 | Bacteria | 1909 |
| 1519 | Ga0501216_017267 | 3300049660 | Bacteria | 1233 |
| 1520 | Ga0501216_020765 | 3300049660 | Bacteria | 1150 |
| 1521 | Ga0501217_006360 | 3300049661 | Bacteria | 2508 |
| 1522 | Ga0501222_001194 | 3300049662 | Bacteria | 3666 |
| 1523 | Ga0501224_007120 | 3300049664 | Bacteria | 1627 |
| 1524 | Ga0501233_008812 | 3300049668 | Bacteria | 1954 |
| 1525 | Ga0501235_003638 | 3300049669 | Bacteria | 3332 |
| 1526 | Ga0501235_023488 | 3300049669 | Bacteria | 1375 |
| 1527 | Ga0501236_009768 | 3300049670 | Bacteria | 1244 |
| 1528 | Ga0501249_001844 | 3300049679 | Bacteria | 4316 |
| 1529 | Ga0501250_002363 | 3300049680 | Bacteria | 1703 |
| 1530 | Ga0501253_004534 | 3300049683 | Bacteria | 1760 |
| 1531 | Ga0501253_048118 | 3300049683 | Bacteria | 884 |
| 1532 | Ga0501257_021294 | 3300049686 | Bacteria | 1528 |
| 1533 | Ga0501221_001116 | 3300049704 | Bacteria | 4416 |
| 1534 | Ga0501221_002374 | 3300049704 | Bacteria | 3118 |
| 1535 | Ga0501221_005121 | 3300049704 | Bacteria | 2186 |
| 1536 | Ga0501225_0029196 | 3300049705 | Bacteria | 1515 |
| 1537 | Ga0501229_002174 | 3300049706 | Bacteria | 2303 |
| 1538 | Ga0501245_004736 | 3300049708 | Bacteria | 1873 |
| 1539 | Ga0501079_0050464 | 3300049741 | Bacteria | 3212 |
| 1540 | Ga0501080_0004541 | 3300049742 | Bacteria | 12373 |
| 1541 | Ga0501081_0172310 | 3300049743 | Bacteria | 1563 |
| 1542 | Ga0501083_0002945 | 3300049744 | Bacteria | 11794 |
| 1543 | Ga0501083_0029619 | 3300049744 | Bacteria | 3763 |
| 1544 | Ga0501083_0248205 | 3300049744 | Bacteria | 1159 |
| 1545 | Ga0501262_008854 | 3300049759 | Bacteria | 1236 |
| 1546 | Ga0501263_001889 | 3300049760 | Bacteria | 2062 |
| 1547 | Ga0501267_008154 | 3300049764 | Bacteria | 1030 |
| 1548 | Ga0501268_001501 | 3300049765 | Bacteria | 2925 |
| 1549 | Ga0501270_002379 | 3300049767 | Bacteria | 1921 |
| 1550 | Ga0501272_005506 | 3300049769 | Bacteria | 1334 |
| 1551 | Ga0501035_0001739 | 3300049822 | Bacteria | 21999 |
| 1552 | Ga0501044_0004784 | 3300049823 | Bacteria | 15146 |
| 1553 | Ga0501044_0064458 | 3300049823 | Bacteria | 3741 |
| 1554 | Ga0501044_0214603 | 3300049823 | Bacteria | 1877 |
| 1555 | Ga0501045_0135362 | 3300049824 | Bacteria | 1832 |
| 1556 | Ga0501212_012838 | 3300049851 | Bacteria | 1224 |
| 1557 | nmdc:mga03683_58163_c1 | 3300050489 | Bacteria | 1628 |
| 1558 | nmdc:mga00v17_55457_c1 | 3300050491 | Bacteria | 2420 |
| 1559 | nmdc:mga07m45_22427_c1 | 3300050496 | Bacteria | 3447 |
| 1560 | nmdc:mga07m45_27400_c1 | 3300050496 | Bacteria | 3138 |
| 1561 | nmdc:mga09592_197218_c1 | 3300050508 | Bacteria | 1743 |
| 1562 | nmdc:mga0qj67_39866_c1 | 3300050509 | Bacteria | 3690 |
| 1563 | nmdc:mga08y16_160509_c1 | 3300050511 | Bacteria | 2336 |
| 1564 | nmdc:mga08y16_494019_c1 | 3300050511 | Bacteria | 1244 |
| 1565 | nmdc:mga08x19_132574_c1 | 3300050514 | Bacteria | 1677 |
| 1566 | Ga0500643_000366 | 3300053087 | Bacteria | 35720 |
| 1567 | Ga0500644_0004471 | 3300053088 | Bacteria | 3500 |
| 1568 | Ga0500646_0017655 | 3300053090 | Bacteria | 1873 |
| 1569 | Ga0500583_0060020 | 3300053092 | Bacteria | 1792 |
| 1570 | Ga0500557_000019 | 3300053105 | Bacteria | 93216 |
| 1571 | Ga0500591_006428 | 3300053115 | Bacteria | 5345 |
| 1572 | Ga0500592_000162 | 3300053116 | Bacteria | 13444 |
| 1573 | Ga0500597_002257 | 3300053120 | Bacteria | 5294 |
| 1574 | Ga0500658_0000291 | 3300053134 | Bacteria | 22597 |
| 1575 | Ga0500568_0000140 | 3300053139 | Bacteria | 65109 |
| 1576 | Ga0500573_0000363 | 3300053140 | Bacteria | 19265 |
| 1577 | Ga0500616_0006277 | 3300053153 | Bacteria | 7819 |
| 1578 | Ga0500622_0061870 | 3300053156 | Bacteria | 1907 |
| 1579 | Ga0500624_000077 | 3300053157 | Bacteria | 54433 |
| 1580 | Ga0500637_0000931 | 3300053178 | Bacteria | 11843 |
| 1581 | Ga0500637_0043799 | 3300053178 | Bacteria | 2535 |
| 1582 | Ga0500637_0049083 | 3300053178 | Bacteria | 2401 |
| 1583 | Ga0500637_0128958 | 3300053178 | Bacteria | 1467 |
| 1584 | Ga0500611_000980 | 3300053727 | Bacteria | 3003 |
| 1585 | Ga0501084_0009704 | 3300054114 | Bacteria | 7961 |
| 1586 | Ga0501082_0186147 | 3300060353 | Bacteria | 1807 |
| 1587 | Ga0501082_0198675 | 3300060353 | Bacteria | 1744 |
| 1588 | Ga0466962_0000589 | 3300061719 | Bacteria | 16003 |
| 1589 | Ga0466962_0010534 | 3300061719 | Bacteria | 4448 |
| 1590 | Ga0466962_0025028 | 3300061719 | Bacteria | 2865 |
| 1591 | 2513593995 | 2513237087 | Bacteria | 5817514 |
| 1592 | 2514590293 | 2513237351 | Bacteria | 6968952 |
| 1593 | 2643746064 | 2643221544 | Bacteria | 5886209 |
| 1594 | 2643937021 | 2643221585 | Bacteria | 5812563 |
| 1595 | 2644218007 | 2643221639 | Bacteria | 6649903 |
| 1596 | 2644258253 | 2643221646 | Bacteria | 6433402 |
| 1597 | 2644318186 | 2643221656 | Bacteria | 5809961 |
| 1598 | 2739057144 | 2738541337 | Bacteria | 6183410 |
| 1599 | 2852654024 | 2852653556 | Bacteria | 4050083 |
| 1600 | 2896429963 | 2896429255 | Bacteria | 2557483 |
| 1601 | 2912967717 | 2912963787 | Bacteria | 5646108 |
| 1602 | 2939655827 | 2939651529 | Bacteria | 5895393 |
| 1603 | 2996341144 | 2996336353 | Bacteria | 5511628 |
| 1604 | 8055878932 | 8055878733 | Bacteria | 5907058 |
| 1605 | 8057101270 | 8057101203 | Bacteria | 5034064 |
| 1606 | Ga0157370_10005609 | |||
| 1607 | LJQas_1004738 | |||
| 1608 | JGI24736J21556_1001107 | |||
| 1609 | JGI24741J21665_1012174 | |||
| 1610 | JGI24752J21851_1007184 | |||
| 1611 | JGI24740J21852_10011276 | |||
| 1612 | JGI24740J21852_10050555 | |||
| 1613 | JGI24739J22299_10001179 | |||
| 1614 | JGI24737J22298_10000046 | |||
| 1615 | JGI24737J22298_10000144 | |||
| 1616 | JGI24737J22298_10012849 | |||
| 1617 | JGI24737J22298_10050156 | |||
| 1618 | JGI24743J22301_10018929 | |||
| 1619 | JGI24735J21928_10008760 | |||
| 1620 | JGI24735J21928_10023798 | |||
| 1621 | JGI24735J21928_10041445 | |||
| 1622 | JGI24735J21928_10049491 | |||
| 1623 | JGI24738J21930_10010536 | |||
| 1624 | JGI24744J21845_10000547 | |||
| 1625 | JGI24751J29686_10028440 | |||
| 1626 | JGI25150J39212_1000701 | |||
| 1627 | JGI25151J46595_10027072 | |||
| 1628 | JGI25406J46586_10009729 | |||
| 1629 | JGI25153J46596_10000196 | |||
| 1630 | rootL2_10012690 | |||
| 1631 | rootH1_10079078 | |||
| 1632 | Ga0055536_1018345 | |||
| 1633 | Ga0055540_1000907 | |||
| 1634 | Ga0055531_10000021 | |||
| 1635 | Ga0058863_11714062 | |||
| 1636 | Ga0058861_11993753 | |||
| 1637 | Ga0058862_12098551 | |||
| 1638 | Ga0065712_10117326 | |||
| 1639 | Ga0065712_10177284 | |||
| 1640 | Ga0065707_10000499 | |||
| 1641 | Ga0065707_10082284 | |||
| 1642 | Ga0065707_10097429 | |||
| 1643 | Ga0070658_10000001 | |||
| 1644 | Ga0070658_10001597 | |||
| 1645 | Ga0070658_10004859 | |||
| 1646 | Ga0070658_10050747 | |||
| 1647 | Ga0070658_10083539 | |||
| 1648 | Ga0070658_10106638 | |||
| 1649 | Ga0070658_10107235 | |||
| 1650 | Ga0070658_10177363 | |||
| 1651 | Ga0070658_10294338 | |||
| 1652 | Ga0070658_10428873 | |||
| 1653 | Ga0070658_10553707 | |||
| 1654 | Ga0070676_10008390 | |||
| 1655 | Ga0070676_10009125 | |||
| 1656 | Ga0070676_10055026 | |||
| 1657 | Ga0070676_10232010 | |||
| 1658 | Ga0070683_100015692 | |||
| 1659 | Ga0070683_100065681 | |||
| 1660 | Ga0070683_100422038 | |||
| 1661 | Ga0070690_100020627 | |||
| 1662 | Ga0070690_100056501 | |||
| 1663 | Ga0070690_100236747 | |||
| 1664 | Ga0070670_100047328 | |||
| 1665 | Ga0070670_100080022 | |||
| 1666 | Ga0070670_100108075 | |||
| 1667 | Ga0070670_100449324 | |||
| 1668 | Ga0070670_100474796 | |||
| 1669 | Ga0070677_10131526 | |||
| 1670 | Ga0068869_100000248 | |||
| 1671 | Ga0068869_100222574 | |||
| 1672 | Ga0070666_10000381 | |||
| 1673 | Ga0070666_10001831 | |||
| 1674 | Ga0070666_10018453 | |||
| 1675 | Ga0070666_10026728 | |||
| 1676 | Ga0070666_10035612 | |||
| 1677 | Ga0070666_10040320 | |||
| 1678 | Ga0070666_10317357 | |||
| 1679 | Ga0070680_100000081 | |||
| 1680 | Ga0070680_100004762 | |||
| 1681 | Ga0070680_100015293 | |||
| 1682 | Ga0070680_100015773 | |||
| 1683 | Ga0070680_100051207 | |||
| 1684 | Ga0070680_100057907 | |||
| 1685 | Ga0070680_100064511 | |||
| 1686 | Ga0070680_100080069 | |||
| 1687 | Ga0070680_100157302 | |||
| 1688 | Ga0070680_100231629 | |||
| 1689 | Ga0070682_100017648 | |||
| 1690 | Ga0070682_100050955 | |||
| 1691 | Ga0070682_100091351 | |||
| 1692 | Ga0070682_100464551 | |||
| 1693 | Ga0068868_100000638 | |||
| 1694 | Ga0068868_100002486 | |||
| 1695 | Ga0068868_100012819 | |||
| 1696 | Ga0068868_100016220 | |||
| 1697 | Ga0068868_100048439 | |||
| 1698 | Ga0068868_100061996 | |||
| 1699 | Ga0068868_100140909 | |||
| 1700 | Ga0070660_100000039 | |||
| 1701 | Ga0070660_100000596 | |||
| 1702 | Ga0070660_100006325 | |||
| 1703 | Ga0070660_100006837 | |||
| 1704 | Ga0070660_100010785 | |||
| 1705 | Ga0070660_100015799 | |||
| 1706 | Ga0070660_100046290 | |||
| 1707 | Ga0070660_100051072 | |||
| 1708 | Ga0070660_100053647 | |||
| 1709 | Ga0070660_100070079 | |||
| 1710 | Ga0070660_100073099 | |||
| 1711 | Ga0070660_100101765 | |||
| 1712 | Ga0070660_100106413 | |||
| 1713 | Ga0070660_100155798 | |||
| 1714 | Ga0070660_100210874 | |||
| 1715 | Ga0070689_100148501 | |||
| 1716 | Ga0070689_100258406 | |||
| 1717 | Ga0070691_10009897 | |||
| 1718 | Ga0070691_10041532 | |||
| 1719 | Ga0070661_100000009 | |||
| 1720 | Ga0070661_100008809 | |||
| 1721 | Ga0070661_100008823 | |||
| 1722 | Ga0070661_100019749 | |||
| 1723 | Ga0070661_100035443 | |||
| 1724 | Ga0070661_100056510 | |||
| 1725 | Ga0070661_100059054 | |||
| 1726 | Ga0070661_100092995 | |||
| 1727 | Ga0070661_100129737 | |||
| 1728 | Ga0070661_100218562 | |||
| 1729 | Ga0070661_100240686 | |||
| 1730 | Ga0070692_10005876 | |||
| 1731 | Ga0070668_100000048 | |||
| 1732 | Ga0070668_100043246 | |||
| 1733 | Ga0070669_100003550 | |||
| 1734 | Ga0070669_100021133 | |||
| 1735 | Ga0070669_100077138 | |||
| 1736 | Ga0070669_100227785 | |||
| 1737 | Ga0070675_100000913 | |||
| 1738 | Ga0070675_100072925 | |||
| 1739 | Ga0070675_100142616 | |||
| 1740 | Ga0070675_100230945 | |||
| 1741 | Ga0070675_100348052 | |||
| 1742 | Ga0070671_100000492 | |||
| 1743 | Ga0070671_100000860 | |||
| 1744 | Ga0070671_100001033 | |||
| 1745 | Ga0070671_100005525 | |||
| 1746 | Ga0070671_100011713 | |||
| 1747 | Ga0070671_100022902 | |||
| 1748 | Ga0070671_100033981 | |||
| 1749 | Ga0070671_100056215 | |||
| 1750 | Ga0070671_100127994 | |||
| 1751 | Ga0070671_100183497 | |||
| 1752 | Ga0070674_100014377 | |||
| 1753 | Ga0070674_100026131 | |||
| 1754 | Ga0070674_100072023 | |||
| 1755 | Ga0070674_100251989 | |||
| 1756 | Ga0070673_100002642 | |||
| 1757 | Ga0070673_100054862 | |||
| 1758 | Ga0070673_100090163 | |||
| 1759 | Ga0070673_100115071 | |||
| 1760 | Ga0070673_100222719 | |||
| 1761 | Ga0070673_100236991 | |||
| 1762 | Ga0070673_100329494 | |||
| 1763 | Ga0070673_100375767 | |||
| 1764 | Ga0070659_100001925 | |||
| 1765 | Ga0070659_100003113 | |||
| 1766 | Ga0070659_100016142 | |||
| 1767 | Ga0070659_100019299 | |||
| 1768 | Ga0070659_100019630 | |||
| 1769 | Ga0070659_100019664 | |||
| 1770 | Ga0070659_100034417 | |||
| 1771 | Ga0070659_100069013 | |||
| 1772 | Ga0070659_100081050 | |||
| 1773 | Ga0070659_100366209 | |||
| 1774 | Ga0070667_100000363 | |||
| 1775 | Ga0070667_100000915 | |||
| 1776 | Ga0070667_100001034 | |||
| 1777 | Ga0070667_100001800 | |||
| 1778 | Ga0070667_100002455 | |||
| 1779 | Ga0070667_100003445 | |||
| 1780 | Ga0070667_100017753 | |||
| 1781 | Ga0070667_100084129 | |||
| 1782 | Ga0070667_100096210 | |||
| 1783 | Ga0070667_100110842 | |||
| 1784 | Ga0070667_100115081 | |||
| 1785 | Ga0070667_100141190 | |||
| 1786 | Ga0070709_10006352 | |||
| 1787 | Ga0070709_10025490 | |||
| 1788 | Ga0070709_10114766 | |||
| 1789 | Ga0070709_10119281 | |||
| 1790 | Ga0070709_10139194 | |||
| 1791 | Ga0070714_100013482 | |||
| 1792 | Ga0070714_100077928 | |||
| 1793 | Ga0070714_100118597 | |||
| 1794 | Ga0070714_100428699 | |||
| 1795 | Ga0070713_100002739 | |||
| 1796 | Ga0070713_100031229 | |||
| 1797 | Ga0070713_100067606 | |||
| 1798 | Ga0070713_100318538 | |||
| 1799 | Ga0070710_10260518 | |||
| 1800 | Ga0070711_100058122 | |||
| 1801 | Ga0070694_100183080 | |||
| 1802 | Ga0070663_100001101 | |||
| 1803 | Ga0070663_100022927 | |||
| 1804 | Ga0070663_100024555 | |||
| 1805 | Ga0070663_100040471 | |||
| 1806 | Ga0070663_100114931 | |||
| 1807 | Ga0070663_100120055 | |||
| 1808 | Ga0070678_100028164 | |||
| 1809 | Ga0070678_100291796 | |||
| 1810 | Ga0070662_100000077 | |||
| 1811 | Ga0070662_100004226 | |||
| 1812 | Ga0070662_100017342 | |||
| 1813 | Ga0070662_100034607 | |||
| 1814 | Ga0070662_100116204 | |||
| 1815 | Ga0070662_100244923 | |||
| 1816 | Ga0070662_100246120 | |||
| 1817 | Ga0070662_100542109 | |||
| 1818 | Ga0070681_10002023 | |||
| 1819 | Ga0070681_10003522 | |||
| 1820 | Ga0070681_10021321 | |||
| 1821 | Ga0070681_10022034 | |||
| 1822 | Ga0070681_10055363 | |||
| 1823 | Ga0070681_10063064 | |||
| 1824 | Ga0070681_10079117 | |||
| 1825 | Ga0070681_10079732 | |||
| 1826 | Ga0070681_10093902 | |||
| 1827 | Ga0070681_10248312 | |||
| 1828 | Ga0068867_100012318 | |||
| 1829 | Ga0068867_100018339 | |||
| 1830 | Ga0068867_100095721 | |||
| 1831 | Ga0070699_100014057 | |||
| 1832 | Ga0070679_100000031 | |||
| 1833 | Ga0070679_100006962 | |||
| 1834 | Ga0070679_100054990 | |||
| 1835 | Ga0070679_100070381 | |||
| 1836 | Ga0070679_100092141 | |||
| 1837 | Ga0070679_100093706 | |||
| 1838 | Ga0070679_100096575 | |||
| 1839 | Ga0070679_100126321 | |||
| 1840 | Ga0070679_100216875 | |||
| 1841 | Ga0070684_100043998 | |||
| 1842 | Ga0070684_100056140 | |||
| 1843 | Ga0070684_100114544 | |||
| 1844 | Ga0070684_100115069 | |||
| 1845 | Ga0070684_100478126 | |||
| 1846 | Ga0068853_100006336 | |||
| 1847 | Ga0068853_100008076 | |||
| 1848 | Ga0068853_100029886 | |||
| 1849 | Ga0068853_100036478 | |||
| 1850 | Ga0068853_100066571 | |||
| 1851 | Ga0068853_100090534 | |||
| 1852 | Ga0068853_100208194 | |||
| 1853 | Ga0068853_100279599 | |||
| 1854 | Ga0068853_100899773 | |||
| 1855 | Ga0070672_100003257 | |||
| 1856 | Ga0070672_100003621 | |||
| 1857 | Ga0070672_100022583 | |||
| 1858 | Ga0070672_100403882 | |||
| 1859 | Ga0070686_100099037 | |||
| 1860 | Ga0070695_100136216 | |||
| 1861 | Ga0070696_100018654 | |||
| 1862 | Ga0070693_100061023 | |||
| 1863 | Ga0070665_100001581 | |||
| 1864 | Ga0070665_100003133 | |||
| 1865 | Ga0070665_100007755 | |||
| 1866 | Ga0070665_100008963 | |||
| 1867 | Ga0070665_100009801 | |||
| 1868 | Ga0070665_100011210 | |||
| 1869 | Ga0070665_100058842 | |||
| 1870 | Ga0070665_100134878 | |||
| 1871 | Ga0070665_100198317 | |||
| 1872 | Ga0070665_100533529 | |||
| 1873 | Ga0070704_100065882 | |||
| 1874 | Ga0068855_100000135 | |||
| 1875 | Ga0068855_100000789 | |||
| 1876 | Ga0068855_100001165 | |||
| 1877 | Ga0068855_100009575 | |||
| 1878 | Ga0068855_100016755 | |||
| 1879 | Ga0068855_100019907 | |||
| 1880 | Ga0068855_100025830 | |||
| 1881 | Ga0068855_100041991 | |||
| 1882 | Ga0070664_100003529 | |||
| 1883 | Ga0070664_100008493 | |||
| 1884 | Ga0070664_100041322 | |||
| 1885 | Ga0070664_100047682 | |||
| 1886 | Ga0070664_100048561 | |||
| 1887 | Ga0070664_100059290 | |||
| 1888 | Ga0070664_100076492 | |||
| 1889 | Ga0070664_100098888 | |||
| 1890 | Ga0070664_100101155 | |||
| 1891 | Ga0070664_100106890 | |||
| 1892 | Ga0068857_100000555 | |||
| 1893 | Ga0068857_100002899 | |||
| 1894 | Ga0068857_100016286 | |||
| 1895 | Ga0068857_100040921 | |||
| 1896 | Ga0068857_100140765 | |||
| 1897 | Ga0068857_100155652 | |||
| 1898 | Ga0068857_100331672 | |||
| 1899 | Ga0068854_100001637 | |||
| 1900 | Ga0068854_100002406 | |||
| 1901 | Ga0068854_100009733 | |||
| 1902 | Ga0068854_100023622 | |||
| 1903 | Ga0068854_100050636 | |||
| 1904 | Ga0068854_100063809 | |||
| 1905 | Ga0068854_100085704 | |||
| 1906 | Ga0068854_100113560 | |||
| 1907 | Ga0068856_100040544 | |||
| 1908 | Ga0068856_100045466 | |||
| 1909 | Ga0068856_100059987 | |||
| 1910 | Ga0068856_100077188 | |||
| 1911 | Ga0068856_100090898 | |||
| 1912 | Ga0068856_100099313 | |||
| 1913 | Ga0068856_100274254 | |||
| 1914 | Ga0068856_100317759 | |||
| 1915 | Ga0068856_100432976 | |||
| 1916 | Ga0068856_100535736 | |||
| 1917 | Ga0068852_100000585 | |||
| 1918 | Ga0068852_100002847 | |||
| 1919 | Ga0068852_100003152 | |||
| 1920 | Ga0068852_100004872 | |||
| 1921 | Ga0068852_100022981 | |||
| 1922 | Ga0068852_100029135 | |||
| 1923 | Ga0068852_100030523 | |||
| 1924 | Ga0068852_100062026 | |||
| 1925 | Ga0068852_100099856 | |||
| 1926 | Ga0068852_100159516 | |||
| 1927 | Ga0068852_100351348 | |||
| 1928 | Ga0068859_100000843 | |||
| 1929 | Ga0068859_100002246 | |||
| 1930 | Ga0068859_100010758 | |||
| 1931 | Ga0068859_100027052 | |||
| 1932 | Ga0068859_100035841 | |||
| 1933 | Ga0068859_100045999 | |||
| 1934 | Ga0068864_100001488 | |||
| 1935 | Ga0068864_100002545 | |||
| 1936 | Ga0068864_100009367 | |||
| 1937 | Ga0068864_100011444 | |||
| 1938 | Ga0068864_100035565 | |||
| 1939 | Ga0068864_100274950 | |||
| 1940 | Ga0068864_100320388 | |||
| 1941 | Ga0068866_10018377 | |||
| 1942 | Ga0068866_10045342 | |||
| 1943 | Ga0068861_100254167 | |||
| 1944 | Ga0068861_100353555 | |||
| 1945 | Ga0068851_10105631 | |||
| 1946 | Ga0068870_10108305 | |||
| 1947 | Ga0068863_100002392 | |||
| 1948 | Ga0068863_100002503 | |||
| 1949 | Ga0068863_100010147 | |||
| 1950 | Ga0068863_100011390 | |||
| 1951 | Ga0068863_100014403 | |||
| 1952 | Ga0068863_100041540 | |||
| 1953 | Ga0068863_100056578 | |||
| 1954 | Ga0068863_100060914 | |||
| 1955 | Ga0068863_100100722 | |||
| 1956 | Ga0068863_100106435 | |||
| 1957 | Ga0068863_100295134 | |||
| 1958 | Ga0068858_100000570 | |||
| 1959 | Ga0068858_100001408 | |||
| 1960 | Ga0068858_100002531 | |||
| 1961 | Ga0068858_100005297 | |||
| 1962 | Ga0068858_100007205 | |||
| 1963 | Ga0068858_100009318 | |||
| 1964 | Ga0068858_100047601 | |||
| 1965 | Ga0068858_100137802 | |||
| 1966 | Ga0068860_100005362 | |||
| 1967 | Ga0068860_100005556 | |||
| 1968 | Ga0068860_100007956 | |||
| 1969 | Ga0068860_100009212 | |||
| 1970 | Ga0068860_100010634 | |||
| 1971 | Ga0068860_100070773 | |||
| 1972 | Ga0068860_100183540 | |||
| 1973 | Ga0068860_100211413 | |||
| 1974 | Ga0068860_100280774 | |||
| 1975 | Ga0068862_100012763 | |||
| 1976 | Ga0068862_100020145 | |||
| 1977 | Ga0068862_100030579 | |||
| 1978 | Ga0068862_100050029 | |||
| 1979 | Ga0068862_100074078 | |||
| 1980 | Ga0068862_100237120 | |||
| 1981 | Ga0068862_100303677 | |||
| 1982 | Ga0068862_100724067 | |||
| 1983 | Ga0081455_10012753 | |||
| 1984 | Ga0081539_10000004 | |||
| 1985 | Ga0081539_10032795 | |||
| 1986 | Ga0070717_10010469 | |||
| 1987 | Ga0070715_10000333 | |||
| 1988 | Ga0070716_100049583 | |||
| 1989 | Ga0070712_100002678 | |||
| 1990 | Ga0070712_100061466 | |||
| 1991 | Ga0097621_100070361 | |||
| 1992 | Ga0097621_100086556 | |||
| 1993 | Ga0097621_100168213 | |||
| 1994 | Ga0075370_10003471 | |||
| 1995 | Ga0068871_100008181 | |||
| 1996 | Ga0068871_100085791 | |||
| 1997 | Ga0068871_100295792 | |||
| 1998 | Ga0075428_100026953 | |||
| 1999 | Ga0075430_100015171 | |||
| 2000 | Ga0075431_100292314 | |||
| 2001 | Ga0075429_100337994 | |||
| 2002 | Ga0068865_100003326 | |||
| 2003 | Ga0068865_100005880 | |||
| 2004 | Ga0068865_100028409 | |||
| 2005 | Ga0068865_100058849 | |||
| 2006 | Ga0068865_100191203 | |||
| 2007 | Ga0068865_100308215 | |||
| 2008 | Ga0075436_100292776 | |||
| 2009 | Ga0097620_100000843 | |||
| 2010 | Ga0097620_100002246 | |||
| 2011 | Ga0097620_100010758 | |||
| 2012 | Ga0097620_100027052 | |||
| 2013 | Ga0097620_100035839 | |||
| 2014 | Ga0097620_100045999 | |||
| 2015 | Ga0105251_10017252 | |||
| 2016 | Ga0105251_10093187 | |||
| 2017 | Ga0105240_10004389 | |||
| 2018 | Ga0105240_10007571 | |||
| 2019 | Ga0105240_10010627 | |||
| 2020 | Ga0105240_10011630 | |||
| 2021 | Ga0105240_10030693 | |||
| 2022 | Ga0105240_10041145 | |||
| 2023 | Ga0105240_10094481 | |||
| 2024 | Ga0105240_10164573 | |||
| 2025 | Ga0105240_10205832 | |||
| 2026 | Ga0105240_10305369 | |||
| 2027 | Ga0105240_10620106 | |||
| 2028 | Ga0111539_10024945 | |||
| 2029 | Ga0111539_10405206 | |||
| 2030 | Ga0105245_10000240 | |||
| 2031 | Ga0105245_10001159 | |||
| 2032 | Ga0105245_10084045 | |||
| 2033 | Ga0105245_10138345 | |||
| 2034 | Ga0105245_10272335 | |||
| 2035 | Ga0105247_10000212 | |||
| 2036 | Ga0105247_10005134 | |||
| 2037 | Ga0105247_10030833 | |||
| 2038 | Ga0105247_10089192 | |||
| 2039 | Ga0105247_10111271 | |||
| 2040 | Ga0105243_10015375 | |||
| 2041 | Ga0105243_10147537 | |||
| 2042 | Ga0105243_10228121 | |||
| 2043 | Ga0105241_10008322 | |||
| 2044 | Ga0105241_10217923 | |||
| 2045 | Ga0105242_10004796 | |||
| 2046 | Ga0105242_10041050 | |||
| 2047 | Ga0105242_10185446 | |||
| 2048 | Ga0105248_10000673 | |||
| 2049 | Ga0105248_10002105 | |||
| 2050 | Ga0105248_10002346 | |||
| 2051 | Ga0105248_10003667 | |||
| 2052 | Ga0105248_10019138 | |||
| 2053 | Ga0105248_10019438 | |||
| 2054 | Ga0105248_10024349 | |||
| 2055 | Ga0105248_10031964 | |||
| 2056 | Ga0105248_10098505 | |||
| 2057 | Ga0105248_10099756 | |||
| 2058 | Ga0105248_10127653 | |||
| 2059 | Ga0105248_10158553 | |||
| 2060 | Ga0105248_10163473 | |||
| 2061 | Ga0105248_10378153 | |||
| 2062 | Ga0105237_10007858 | |||
| 2063 | Ga0105237_10008093 | |||
| 2064 | Ga0105237_10071865 | |||
| 2065 | Ga0105237_10083461 | |||
| 2066 | Ga0105237_10376471 | |||
| 2067 | Ga0105238_10012026 | |||
| 2068 | Ga0105238_10017564 | |||
| 2069 | Ga0105238_10053323 | |||
| 2070 | Ga0105238_10097943 | |||
| 2071 | Ga0105238_10189751 | |||
| 2072 | Ga0105238_10319021 | |||
| 2073 | Ga0105238_10328257 | |||
| 2074 | Ga0105238_10530489 | |||
| 2075 | Ga0105249_10000523 | |||
| 2076 | Ga0105249_10008358 | |||
| 2077 | Ga0105249_10019924 | |||
| 2078 | Ga0105249_10312784 | |||
| 2079 | Ga0105249_10323927 | |||
| 2080 | Ga0105239_10019470 | |||
| 2081 | Ga0105239_10041008 | |||
| 2082 | Ga0105239_10061514 | |||
| 2083 | Ga0105239_10150182 | |||
| 2084 | Ga0105239_10218556 | |||
| 2085 | Ga0105239_10850817 | |||
| 2086 | Ga0105246_10019993 | |||
| 2087 | Ga0105246_10237891 | |||
| 2088 | Ga0157373_10007346 | |||
| 2089 | Ga0157373_10007738 | |||
| 2090 | Ga0157373_10016856 | |||
| 2091 | Ga0157373_10023265 | |||
| 2092 | Ga0157373_10056665 | |||
| 2093 | Ga0157373_10078186 | |||
| 2094 | Ga0157373_10109174 | |||
| 2095 | Ga0157373_10121335 | |||
| 2096 | Ga0157373_10134864 | |||
| 2097 | Ga0157371_10001435 | |||
| 2098 | Ga0157371_10003052 | |||
| 2099 | Ga0157371_10003899 | |||
| 2100 | Ga0157371_10023919 | |||
| 2101 | Ga0157371_10053508 | |||
| 2102 | Ga0157371_10098960 | |||
| 2103 | Ga0157371_10142618 | |||
| 2104 | Ga0157371_10157594 | |||
| 2105 | Ga0157371_10199726 | |||
| 2106 | Ga0157371_10285173 | |||
| 2107 | Ga0157370_10012562 | |||
| 2108 | Ga0157370_10035399 | |||
| 2109 | Ga0157370_10035936 | |||
| 2110 | Ga0157370_10083008 | |||
| 2111 | Ga0157370_10132585 | |||
| 2112 | Ga0157370_10246868 | |||
| 2113 | Ga0157369_10001579 | |||
| 2114 | Ga0157369_10004172 | |||
| 2115 | Ga0157369_10006524 | |||
| 2116 | Ga0157369_10008300 | |||
| 2117 | Ga0157369_10025769 | |||
| 2118 | Ga0157369_10029001 | |||
| 2119 | Ga0157369_10062380 | |||
| 2120 | Ga0157369_10200913 | |||
| 2121 | Ga0157369_10341158 | |||
| 2122 | Ga0157369_10344203 | |||
| 2123 | Ga0157369_10438797 | |||
| 2124 | Ga0157369_10472533 | |||
| 2125 | Ga0157369_10529259 | |||
| 2126 | Ga0157374_10000882 | |||
| 2127 | Ga0157374_10002261 | |||
| 2128 | Ga0157374_10009049 | |||
| 2129 | Ga0157374_10090064 | |||
| 2130 | Ga0157374_10109979 | |||
| 2131 | Ga0157374_10231593 | |||
| 2132 | Ga0157378_10000625 | |||
| 2133 | Ga0157378_10003623 | |||
| 2134 | Ga0157378_10020195 | |||
| 2135 | Ga0163162_10002440 | |||
| 2136 | Ga0163162_10085584 | |||
| 2137 | Ga0163162_10097768 | |||
| 2138 | Ga0163162_10257091 | |||
| 2139 | Ga0157372_10004346 | |||
| 2140 | Ga0157372_10024533 | |||
| 2141 | Ga0157372_10034601 | |||
| 2142 | Ga0157372_10040762 | |||
| 2143 | Ga0157372_10062828 | |||
| 2144 | Ga0157372_10382227 | |||
| 2145 | Ga0157372_10414170 | |||
| 2146 | Ga0157372_10700861 | |||
| 2147 | Ga0157375_10038790 | |||
| 2148 | Ga0157375_10063978 | |||
| 2149 | Ga0157375_10136739 | |||
| 2150 | Ga0157375_10435314 | |||
| 2151 | Ga0163163_10002408 | |||
| 2152 | Ga0163163_10004034 | |||
| 2153 | Ga0163163_10022952 | |||
| 2154 | Ga0163163_10038472 | |||
| 2155 | Ga0163163_10562117 | |||
| 2156 | Ga0157380_10001526 | |||
| 2157 | Ga0157380_10002231 | |||
| 2158 | Ga0157380_10062065 | |||
| 2159 | Ga0157380_10127797 | |||
| 2160 | Ga0157380_10270229 | |||
| 2161 | Ga0157380_10291720 | |||
| 2162 | Ga0182008_10173956 | |||
| 2163 | Ga0157377_10049358 | |||
| 2164 | Ga0157377_10070643 | |||
| 2165 | Ga0157379_10001277 | |||
| 2166 | Ga0157379_10003741 | |||
| 2167 | Ga0157379_10010195 | |||
| 2168 | Ga0157379_10046470 | |||
| 2169 | Ga0157379_10105763 | |||
| 2170 | Ga0157379_10169928 | |||
| 2171 | Ga0157376_10006910 | |||
| 2172 | Ga0157376_10103869 | |||
| 2173 | Ga0157376_10245106 | |||
| 2174 | Ga0157376_10748131 | |||
| 2175 | Ga0206356_10519558 | |||
| 2176 | Ga0206349_1981439 | |||
| 2177 | Ga0206350_11177039 | |||
| 2178 | Ga0206354_10918587 | |||
| 2179 | Ga0206353_11473440 | |||
| 2180 | Ga0206353_12012814 | |||
| 2181 | Ga0206353_12019217 | |||
| 2182 | Ga0213873_10000012 | |||
| 2183 | Ga0213874_10002669 | |||
| 2184 | Ga0213876_10000021 | |||
| 2185 | Ga0213876_10020022 | |||
| 2186 | Ga0213876_10073919 | |||
| 2187 | Ga0213875_10006414 | |||
| 2188 | Ga0224712_10039436 | |||
| 2189 | Ga0224712_10064149 | |||
| 2190 | Ga0224712_10151519 | |||
| 2191 | Ga0207425_1000146 | |||
| 2192 | Ga0209129_1000912 | |||
| 2193 | Ga0209676_1041693 | |||
| 2194 | Ga0209025_1000431 | |||
| 2195 | Ga0209758_1000002 | |||
| 2196 | Ga0209050_1000005 | |||
| 2197 | Ga0209050_1005562 | |||
| 2198 | Ga0209051_1000212 | |||
| 2199 | Ga0209051_1003223 | |||
| 2200 | Ga0209257_1000032 | |||
| 2201 | Ga0209257_1000753 | |||
| 2202 | Ga0209257_1000925 | |||
| 2203 | Ga0209257_1017966 | |||
| 2204 | Ga0207697_10001286 | |||
| 2205 | Ga0207656_10159501 | |||
| 2206 | Ga0207696_1008898 | |||
| 2207 | Ga0207682_10039097 | |||
| 2208 | Ga0207692_10203076 | |||
| 2209 | Ga0207642_10011765 | |||
| 2210 | Ga0207710_10000254 | |||
| 2211 | Ga0207710_10013274 | |||
| 2212 | Ga0207710_10036857 | |||
| 2213 | Ga0207710_10046773 | |||
| 2214 | Ga0207688_10021021 | |||
| 2215 | Ga0207680_10000492 | |||
| 2216 | Ga0207680_10016620 | |||
| 2217 | Ga0207680_10227591 | |||
| 2218 | Ga0207680_10419231 | |||
| 2219 | Ga0207647_10000193 | |||
| 2220 | Ga0207647_10001994 | |||
| 2221 | Ga0207647_10026542 | |||
| 2222 | Ga0207647_10040434 | |||
| 2223 | Ga0207685_10002698 | |||
| 2224 | Ga0207699_10012746 | |||
| 2225 | Ga0207699_10033651 | |||
| 2226 | Ga0207699_10085258 | |||
| 2227 | Ga0207645_10006989 | |||
| 2228 | Ga0207645_10013084 | |||
| 2229 | Ga0207645_10015452 | |||
| 2230 | Ga0207645_10028032 | |||
| 2231 | Ga0207645_10032729 | |||
| 2232 | Ga0207645_10036097 | |||
| 2233 | Ga0207645_10113522 | |||
| 2234 | Ga0207645_10154660 | |||
| 2235 | Ga0207645_10183823 | |||
| 2236 | Ga0207643_10127142 | |||
| 2237 | Ga0207705_10000002 | |||
| 2238 | Ga0207705_10000003 | |||
| 2239 | Ga0207705_10000050 | |||
| 2240 | Ga0207705_10002221 | |||
| 2241 | Ga0207705_10014667 | |||
| 2242 | Ga0207705_10022419 | |||
| 2243 | Ga0207705_10025445 | |||
| 2244 | Ga0207705_10037294 | |||
| 2245 | Ga0207705_10038884 | |||
| 2246 | Ga0207705_10050981 | |||
| 2247 | Ga0207705_10077699 | |||
| 2248 | Ga0207705_10086332 | |||
| 2249 | Ga0207705_10089206 | |||
| 2250 | Ga0207705_10154441 | |||
| 2251 | Ga0207705_10170351 | |||
| 2252 | Ga0207705_10175201 | |||
| 2253 | Ga0207705_10226788 | |||
| 2254 | Ga0207654_10081542 | |||
| 2255 | Ga0207654_10091565 | |||
| 2256 | Ga0207654_10222999 | |||
| 2257 | Ga0207707_10004072 | |||
| 2258 | Ga0207707_10006250 | |||
| 2259 | Ga0207707_10008989 | |||
| 2260 | Ga0207707_10010843 | |||
| 2261 | Ga0207707_10035205 | |||
| 2262 | Ga0207707_10060555 | |||
| 2263 | Ga0207695_10005303 | |||
| 2264 | Ga0207695_10005548 | |||
| 2265 | Ga0207695_10009383 | |||
| 2266 | Ga0207695_10014202 | |||
| 2267 | Ga0207695_10017612 | |||
| 2268 | Ga0207695_10024691 | |||
| 2269 | Ga0207695_10029814 | |||
| 2270 | Ga0207695_10031334 | |||
| 2271 | Ga0207695_10039007 | |||
| 2272 | Ga0207695_10059200 | |||
| 2273 | Ga0207695_10066576 | |||
| 2274 | Ga0207695_10079345 | |||
| 2275 | Ga0207695_10085135 | |||
| 2276 | Ga0207695_10097645 | |||
| 2277 | Ga0207695_10654044 | |||
| 2278 | Ga0207671_10005586 | |||
| 2279 | Ga0207671_10013981 | |||
| 2280 | Ga0207671_10018037 | |||
| 2281 | Ga0207671_10086024 | |||
| 2282 | Ga0207671_10106160 | |||
| 2283 | Ga0207693_10000462 | |||
| 2284 | Ga0207693_10031567 | |||
| 2285 | Ga0207693_10147756 | |||
| 2286 | Ga0207663_10007125 | |||
| 2287 | Ga0207663_10090318 | |||
| 2288 | Ga0207663_10157284 | |||
| 2289 | Ga0207660_10000186 | |||
| 2290 | Ga0207660_10004190 | |||
| 2291 | Ga0207660_10008150 | |||
| 2292 | Ga0207660_10030111 | |||
| 2293 | Ga0207660_10042085 | |||
| 2294 | Ga0207660_10047185 | |||
| 2295 | Ga0207660_10052362 | |||
| 2296 | Ga0207660_10070663 | |||
| 2297 | Ga0207660_10183425 | |||
| 2298 | Ga0207662_10145770 | |||
| 2299 | Ga0207657_10000121 | |||
| 2300 | Ga0207657_10001248 | |||
| 2301 | Ga0207657_10003049 | |||
| 2302 | Ga0207657_10005568 | |||
| 2303 | Ga0207657_10005714 | |||
| 2304 | Ga0207657_10008500 | |||
| 2305 | Ga0207657_10011471 | |||
| 2306 | Ga0207657_10012677 | |||
| 2307 | Ga0207657_10021169 | |||
| 2308 | Ga0207657_10049190 | |||
| 2309 | Ga0207657_10050297 | |||
| 2310 | Ga0207657_10079533 | |||
| 2311 | Ga0207657_10090824 | |||
| 2312 | Ga0207657_10093945 | |||
| 2313 | Ga0207649_10000190 | |||
| 2314 | Ga0207649_10001220 | |||
| 2315 | Ga0207649_10008345 | |||
| 2316 | Ga0207649_10057649 | |||
| 2317 | Ga0207649_10287111 | |||
| 2318 | Ga0207652_10000003 | |||
| 2319 | Ga0207652_10001982 | |||
| 2320 | Ga0207652_10017644 | |||
| 2321 | Ga0207652_10072927 | |||
| 2322 | Ga0207652_10127656 | |||
| 2323 | Ga0207652_10129200 | |||
| 2324 | Ga0207652_10162062 | |||
| 2325 | Ga0207652_10219188 | |||
| 2326 | Ga0207652_10236421 | |||
| 2327 | Ga0207652_10597913 | |||
| 2328 | Ga0207681_10004853 | |||
| 2329 | Ga0207681_10041120 | |||
| 2330 | Ga0207681_10075308 | |||
| 2331 | Ga0207681_10207143 | |||
| 2332 | Ga0207694_10000667 | |||
| 2333 | Ga0207694_10007119 | |||
| 2334 | Ga0207694_10067018 | |||
| 2335 | Ga0207694_10101162 | |||
| 2336 | Ga0207694_10153334 | |||
| 2337 | Ga0207694_10164129 | |||
| 2338 | Ga0207694_10203768 | |||
| 2339 | Ga0207694_10277535 | |||
| 2340 | Ga0207694_10337081 | |||
| 2341 | Ga0207650_10009214 | |||
| 2342 | Ga0207650_10019746 | |||
| 2343 | Ga0207650_10034633 | |||
| 2344 | Ga0207650_10069191 | |||
| 2345 | Ga0207650_10107015 | |||
| 2346 | Ga0207650_10175655 | |||
| 2347 | Ga0207650_10491802 | |||
| 2348 | Ga0207659_10092065 | |||
| 2349 | Ga0207659_10281127 | |||
| 2350 | Ga0207687_10006042 | |||
| 2351 | Ga0207687_10032648 | |||
| 2352 | Ga0207687_10150257 | |||
| 2353 | Ga0207700_10005097 | |||
| 2354 | Ga0207700_10034763 | |||
| 2355 | Ga0207700_10072261 | |||
| 2356 | Ga0207700_10076030 | |||
| 2357 | Ga0207664_10007710 | |||
| 2358 | Ga0207664_10063990 | |||
| 2359 | Ga0207664_10283922 | |||
| 2360 | Ga0207644_10000181 | |||
| 2361 | Ga0207644_10001877 | |||
| 2362 | Ga0207644_10007510 | |||
| 2363 | Ga0207644_10015423 | |||
| 2364 | Ga0207644_10076628 | |||
| 2365 | Ga0207644_10079575 | |||
| 2366 | Ga0207644_10136374 | |||
| 2367 | Ga0207644_10193996 | |||
| 2368 | Ga0207644_10420002 | |||
| 2369 | Ga0207690_10000922 | |||
| 2370 | Ga0207690_10012495 | |||
| 2371 | Ga0207690_10030611 | |||
| 2372 | Ga0207690_10031182 | |||
| 2373 | Ga0207690_10068871 | |||
| 2374 | Ga0207690_10124238 | |||
| 2375 | Ga0207690_10126432 | |||
| 2376 | Ga0207690_10229540 | |||
| 2377 | Ga0207706_10000320 | |||
| 2378 | Ga0207706_10002152 | |||
| 2379 | Ga0207706_10005703 | |||
| 2380 | Ga0207706_10006809 | |||
| 2381 | Ga0207706_10016150 | |||
| 2382 | Ga0207706_10033282 | |||
| 2383 | Ga0207706_10469011 | |||
| 2384 | Ga0207706_10492574 | |||
| 2385 | Ga0207686_10032876 | |||
| 2386 | Ga0207709_10072557 | |||
| 2387 | Ga0207670_10253487 | |||
| 2388 | Ga0207669_10005254 | |||
| 2389 | Ga0207669_10017120 | |||
| 2390 | Ga0207669_10017596 | |||
| 2391 | Ga0207669_10040698 | |||
| 2392 | Ga0207669_10044761 | |||
| 2393 | Ga0207704_10009452 | |||
| 2394 | Ga0207704_10023727 | |||
| 2395 | Ga0207704_10568257 | |||
| 2396 | Ga0207665_10003728 | |||
| 2397 | Ga0207665_10088617 | |||
| 2398 | Ga0207691_10000085 | |||
| 2399 | Ga0207691_10005557 | |||
| 2400 | Ga0207691_10014238 | |||
| 2401 | Ga0207691_10028769 | |||
| 2402 | Ga0207691_10042288 | |||
| 2403 | Ga0207691_10055496 | |||
| 2404 | Ga0207711_10000044 | |||
| 2405 | Ga0207711_10001646 | |||
| 2406 | Ga0207711_10003531 | |||
| 2407 | Ga0207711_10013510 | |||
| 2408 | Ga0207711_10016809 | |||
| 2409 | Ga0207711_10018189 | |||
| 2410 | Ga0207711_10067752 | |||
| 2411 | Ga0207711_10126210 | |||
| 2412 | Ga0207711_10204104 | |||
| 2413 | Ga0207689_10000016 | |||
| 2414 | Ga0207689_10206683 | |||
| 2415 | Ga0207661_10241640 | |||
| 2416 | Ga0207661_10271472 | |||
| 2417 | Ga0207661_10292219 | |||
| 2418 | Ga0207661_10632087 | |||
| 2419 | Ga0207679_10007667 | |||
| 2420 | Ga0207679_10010617 | |||
| 2421 | Ga0207679_10036640 | |||
| 2422 | Ga0207679_10043131 | |||
| 2423 | Ga0207679_10046835 | |||
| 2424 | Ga0207679_10055968 | |||
| 2425 | Ga0207679_10068889 | |||
| 2426 | Ga0207679_10069531 | |||
| 2427 | Ga0207679_10123116 | |||
| 2428 | Ga0207679_10346695 | |||
| 2429 | Ga0207679_10399253 | |||
| 2430 | Ga0207667_10000859 | |||
| 2431 | Ga0207667_10001013 | |||
| 2432 | Ga0207667_10002514 | |||
| 2433 | Ga0207667_10009692 | |||
| 2434 | Ga0207667_10019156 | |||
| 2435 | Ga0207667_10031313 | |||
| 2436 | Ga0207667_10047606 | |||
| 2437 | Ga0207667_10059750 | |||
| 2438 | Ga0207667_10061643 | |||
| 2439 | Ga0207667_10067595 | |||
| 2440 | Ga0207667_10204972 | |||
| 2441 | Ga0207651_10008254 | |||
| 2442 | Ga0207651_10011713 | |||
| 2443 | Ga0207651_10022903 | |||
| 2444 | Ga0207651_10033107 | |||
| 2445 | Ga0207651_10098449 | |||
| 2446 | Ga0207651_10108710 | |||
| 2447 | Ga0207651_10128440 | |||
| 2448 | Ga0207651_10129071 | |||
| 2449 | Ga0207651_10131109 | |||
| 2450 | Ga0207712_10000437 | |||
| 2451 | Ga0207712_10019374 | |||
| 2452 | Ga0207712_10026842 | |||
| 2453 | Ga0207712_10087146 | |||
| 2454 | Ga0207712_10134122 | |||
| 2455 | Ga0207668_10009261 | |||
| 2456 | Ga0207668_10254800 | |||
| 2457 | Ga0207640_10000851 | |||
| 2458 | Ga0207640_10007010 | |||
| 2459 | Ga0207640_10015163 | |||
| 2460 | Ga0207640_10059129 | |||
| 2461 | Ga0207640_10064025 | |||
| 2462 | Ga0207640_10085744 | |||
| 2463 | Ga0207640_10093371 | |||
| 2464 | Ga0207640_10162338 | |||
| 2465 | Ga0207658_10000936 | |||
| 2466 | Ga0207658_10002942 | |||
| 2467 | Ga0207658_10005057 | |||
| 2468 | Ga0207658_10006132 | |||
| 2469 | Ga0207658_10011779 | |||
| 2470 | Ga0207658_10085660 | |||
| 2471 | Ga0207658_10091455 | |||
| 2472 | Ga0207658_10379621 | |||
| 2473 | Ga0207677_10003694 | |||
| 2474 | Ga0207677_10026050 | |||
| 2475 | Ga0207677_10094729 | |||
| 2476 | Ga0207677_10469250 | |||
| 2477 | Ga0207703_10000183 | |||
| 2478 | Ga0207703_10001302 | |||
| 2479 | Ga0207703_10003806 | |||
| 2480 | Ga0207703_10005275 | |||
| 2481 | Ga0207703_10007702 | |||
| 2482 | Ga0207703_10009541 | |||
| 2483 | Ga0207703_10214932 | |||
| 2484 | Ga0207703_10313617 | |||
| 2485 | Ga0207703_10321811 | |||
| 2486 | Ga0207703_10357478 | |||
| 2487 | Ga0207639_10000181 | |||
| 2488 | Ga0207639_10007288 | |||
| 2489 | Ga0207639_10034006 | |||
| 2490 | Ga0207639_10072027 | |||
| 2491 | Ga0207639_10314472 | |||
| 2492 | Ga0207639_10326436 | |||
| 2493 | Ga0207639_10615379 | |||
| 2494 | Ga0207678_10001321 | |||
| 2495 | Ga0207678_10002048 | |||
| 2496 | Ga0207678_10003177 | |||
| 2497 | Ga0207678_10006824 | |||
| 2498 | Ga0207678_10009022 | |||
| 2499 | Ga0207678_10011197 | |||
| 2500 | Ga0207678_10013529 | |||
| 2501 | Ga0207678_10019862 | |||
| 2502 | Ga0207678_10030836 | |||
| 2503 | Ga0207678_10088130 | |||
| 2504 | Ga0207702_10021703 | |||
| 2505 | Ga0207702_10049667 | |||
| 2506 | Ga0207702_10054024 | |||
| 2507 | Ga0207702_10113075 | |||
| 2508 | Ga0207702_10267956 | |||
| 2509 | Ga0207702_10548173 | |||
| 2510 | Ga0207641_10001338 | |||
| 2511 | Ga0207641_10001458 | |||
| 2512 | Ga0207641_10002484 | |||
| 2513 | Ga0207641_10008289 | |||
| 2514 | Ga0207641_10016012 | |||
| 2515 | Ga0207641_10056936 | |||
| 2516 | Ga0207641_10060015 | |||
| 2517 | Ga0207641_10079359 | |||
| 2518 | Ga0207641_10087245 | |||
| 2519 | Ga0207641_10389998 | |||
| 2520 | Ga0207648_10003603 | |||
| 2521 | Ga0207648_10007718 | |||
| 2522 | Ga0207648_10016176 | |||
| 2523 | Ga0207648_10044684 | |||
| 2524 | Ga0207648_10113725 | |||
| 2525 | Ga0207648_10165891 | |||
| 2526 | Ga0207676_10005209 | |||
| 2527 | Ga0207676_10049201 | |||
| 2528 | Ga0207676_10110374 | |||
| 2529 | Ga0207676_10128368 | |||
| 2530 | Ga0207676_10203987 | |||
| 2531 | Ga0207674_10000114 | |||
| 2532 | Ga0207674_10001036 | |||
| 2533 | Ga0207674_10001151 | |||
| 2534 | Ga0207674_10006687 | |||
| 2535 | Ga0207674_10014936 | |||
| 2536 | Ga0207674_10018868 | |||
| 2537 | Ga0207674_10144034 | |||
| 2538 | Ga0207674_10193615 | |||
| 2539 | Ga0207674_10381259 | |||
| 2540 | Ga0207675_100190179 | |||
| 2541 | Ga0207675_100205088 | |||
| 2542 | Ga0207675_100242861 | |||
| 2543 | Ga0207675_100306334 | |||
| 2544 | Ga0207683_10007850 | |||
| 2545 | Ga0207683_10007992 | |||
| 2546 | Ga0207683_10197588 | |||
| 2547 | Ga0207698_10000796 | |||
| 2548 | Ga0207698_10000887 | |||
| 2549 | Ga0207698_10002867 | |||
| 2550 | Ga0207698_10003119 | |||
| 2551 | Ga0207698_10003206 | |||
| 2552 | Ga0207698_10006634 | |||
| 2553 | Ga0207698_10010230 | |||
| 2554 | Ga0207698_10061767 | |||
| 2555 | Ga0207698_10194133 | |||
| 2556 | Ga0207698_10274367 | |||
| 2557 | Ga0207698_10317675 | |||
| 2558 | Ga0207698_10332579 | |||
| 2559 | Ga0207698_10363565 | |||
| 2560 | Ga0207698_10509720 | |||
| 2561 | Ga0209982_1012035 | |||
| 2562 | Ga0209974_10001961 | |||
| 2563 | Ga0207428_10033260 | |||
| 2564 | Ga0268266_10000834 | |||
| 2565 | Ga0268266_10007466 | |||
| 2566 | Ga0268266_10010282 | |||
| 2567 | Ga0268266_10013691 | |||
| 2568 | Ga0268266_10079389 | |||
| 2569 | Ga0268266_10080781 | |||
| 2570 | Ga0268266_10092782 | |||
| 2571 | Ga0268266_10098990 | |||
| 2572 | Ga0268266_10214787 | |||
| 2573 | Ga0268266_10250475 | |||
| 2574 | Ga0268266_10433352 | |||
| 2575 | Ga0268265_10002414 | |||
| 2576 | Ga0268265_10007856 | |||
| 2577 | Ga0268265_10009708 | |||
| 2578 | Ga0268265_10010713 | |||
| 2579 | Ga0268265_10071818 | |||
| 2580 | Ga0268265_10146124 | |||
| 2581 | Ga0268264_10000057 | |||
| 2582 | Ga0268264_10001982 | |||
| 2583 | Ga0268264_10006236 | |||
| 2584 | Ga0268264_10009364 | |||
| 2585 | Ga0268264_10110522 | |||
| 2586 | Ga0268264_10120880 | |||
| 2587 | Ga0268264_10236227 | |||
| 2588 | Ga0268264_10272591 | |||
| 2589 | Ga0265334_10076257 | |||
| 2590 | Ga0307515_10068006 | |||
| 2591 | Ga0307515_10098372 | |||
| 2592 | Ga0307511_10001123 | |||
| 2593 | Ga0265762_1019634 | |||
| 2594 | Ga0265340_10008897 | |||
| 2595 | Ga0265340_10028939 | |||
| 2596 | Ga0307513_10054594 | |||
| 2597 | Ga0307513_10085117 | |||
| 2598 | Ga0307509_10000013 | |||
| 2599 | Ga0307408_100020656 | |||
| 2600 | Ga0307408_100030450 | |||
| 2601 | Ga0307408_100100370 | |||
| 2602 | Ga0307408_100123141 | |||
| 2603 | Ga0307408_100249374 | |||
| 2604 | Ga0307508_10198678 | |||
| 2605 | Ga0316576_10261048 | |||
| 2606 | Ga0316578_10003227 | |||
| 2607 | Ga0307516_10086048 | |||
| 2608 | Ga0307405_10022992 | |||
| 2609 | Ga0307405_10034261 | |||
| 2610 | Ga0307405_10079712 | |||
| 2611 | Ga0307405_10128402 | |||
| 2612 | Ga0316577_10020096 | |||
| 2613 | Ga0307413_10000739 | |||
| 2614 | Ga0307413_10001898 | |||
| 2615 | Ga0307413_10002115 | |||
| 2616 | Ga0307413_10010806 | |||
| 2617 | Ga0307413_10022007 | |||
| 2618 | Ga0307413_10046641 | |||
| 2619 | Ga0307413_10290569 | |||
| 2620 | Ga0307413_10365662 | |||
| 2621 | Ga0307410_10000171 | |||
| 2622 | Ga0307410_10002848 | |||
| 2623 | Ga0307410_10004835 | |||
| 2624 | Ga0307410_10009406 | |||
| 2625 | Ga0307410_10012882 | |||
| 2626 | Ga0307410_10016770 | |||
| 2627 | Ga0307410_10018471 | |||
| 2628 | Ga0307410_10021886 | |||
| 2629 | Ga0307410_10023442 | |||
| 2630 | Ga0307410_10027779 | |||
| 2631 | Ga0307410_10074094 | |||
| 2632 | Ga0307410_10113753 | |||
| 2633 | Ga0307410_10198571 | |||
| 2634 | Ga0307410_10214472 | |||
| 2635 | Ga0307406_10001149 | |||
| 2636 | Ga0307406_10003488 | |||
| 2637 | Ga0307406_10027008 | |||
| 2638 | Ga0307406_10039950 | |||
| 2639 | Ga0307406_10091701 | |||
| 2640 | Ga0307406_10107328 | |||
| 2641 | Ga0307406_10109031 | |||
| 2642 | Ga0307406_10150396 | |||
| 2643 | Ga0307406_10196705 | |||
| 2644 | Ga0307406_10237779 | |||
| 2645 | Ga0307406_10569416 | |||
| 2646 | Ga0307407_10001542 | |||
| 2647 | Ga0307407_10001946 | |||
| 2648 | Ga0307407_10002595 | |||
| 2649 | Ga0307407_10007483 | |||
| 2650 | Ga0307407_10015178 | |||
| 2651 | Ga0307407_10026119 | |||
| 2652 | Ga0307407_10080559 | |||
| 2653 | Ga0307407_10340773 | |||
| 2654 | Ga0307407_10344137 | |||
| 2655 | Ga0307412_10007148 | |||
| 2656 | Ga0307412_10011156 | |||
| 2657 | Ga0307412_10011193 | |||
| 2658 | Ga0307412_10040563 | |||
| 2659 | Ga0307412_10098314 | |||
| 2660 | Ga0307412_10139287 | |||
| 2661 | Ga0307412_10173253 | |||
| 2662 | Ga0307412_10332824 | |||
| 2663 | Ga0307412_10476910 | |||
| 2664 | Ga0307412_10488346 | |||
| 2665 | Ga0307409_100001095 | |||
| 2666 | Ga0307409_100004656 | |||
| 2667 | Ga0307409_100008214 | |||
| 2668 | Ga0307409_100009931 | |||
| 2669 | Ga0307409_100022413 | |||
| 2670 | Ga0307409_100042410 | |||
| 2671 | Ga0307409_100049332 | |||
| 2672 | Ga0307409_100075465 | |||
| 2673 | Ga0307409_100075567 | |||
| 2674 | Ga0307409_100081411 | |||
| 2675 | Ga0307409_100105977 | |||
| 2676 | Ga0307409_100143466 | |||
| 2677 | Ga0307409_100193406 | |||
| 2678 | Ga0307409_100252790 | |||
| 2679 | Ga0307416_100002009 | |||
| 2680 | Ga0307416_100004801 | |||
| 2681 | Ga0307416_100006767 | |||
| 2682 | Ga0307416_100027504 | |||
| 2683 | Ga0307416_100049275 | |||
| 2684 | Ga0307416_100066877 | |||
| 2685 | Ga0307416_100120266 | |||
| 2686 | Ga0307416_100220359 | |||
| 2687 | Ga0307416_100253714 | |||
| 2688 | Ga0307416_100441309 | |||
| 2689 | Ga0307416_100754314 | |||
| 2690 | Ga0307414_10016999 | |||
| 2691 | Ga0307414_10022664 | |||
| 2692 | Ga0307414_10049644 | |||
| 2693 | Ga0307414_10057325 | |||
| 2694 | Ga0307414_10058986 | |||
| 2695 | Ga0307414_10064078 | |||
| 2696 | Ga0307414_10065439 | |||
| 2697 | Ga0307414_10071176 | |||
| 2698 | Ga0307414_10074410 | |||
| 2699 | Ga0307414_10080822 | |||
| 2700 | Ga0307414_10082256 | |||
| 2701 | Ga0307414_10102582 | |||
| 2702 | Ga0307414_10128179 | |||
| 2703 | Ga0307414_10128387 | |||
| 2704 | Ga0307414_10132324 | |||
| 2705 | Ga0307411_10000997 | |||
| 2706 | Ga0307411_10001612 | |||
| 2707 | Ga0307411_10001951 | |||
| 2708 | Ga0307411_10007559 | |||
| 2709 | Ga0307411_10008119 | |||
| 2710 | Ga0307411_10011823 | |||
| 2711 | Ga0307411_10017680 | |||
| 2712 | Ga0307411_10050205 | |||
| 2713 | Ga0307411_10054530 | |||
| 2714 | Ga0307411_10057500 | |||
| 2715 | Ga0307411_10060348 | |||
| 2716 | Ga0307411_10064323 | |||
| 2717 | Ga0307411_10079612 | |||
| 2718 | Ga0307411_10080096 | |||
| 2719 | Ga0307411_10089268 | |||
| 2720 | Ga0307411_10152872 | |||
| 2721 | Ga0307411_10156608 | |||
| 2722 | Ga0307411_10203181 | |||
| 2723 | Ga0307411_10217963 | |||
| 2724 | Ga0307411_10344298 | |||
| 2725 | Ga0307411_10399819 | |||
| 2726 | Ga0307415_100005998 | |||
| 2727 | Ga0307415_100011428 | |||
| 2728 | Ga0307415_100011638 | |||
| 2729 | Ga0307415_100035538 | |||
| 2730 | Ga0307415_100061923 | |||
| 2731 | Ga0307415_100093123 | |||
| 2732 | Ga0307415_100097719 | |||
| 2733 | Ga0307415_100159647 | |||
| 2734 | Ga0307415_100230721 | |||
| 2735 | Ga0307415_100351179 | |||
| 2736 | Ga0307415_100513058 | |||
| 2737 | Ga0307510_10000014 | |||
| 2738 | Ga0307510_10009003 | |||
| 2739 | Ga0373959_0029053 | |||
| 2740 | Ga0373936_0000241 | |||
| 2741 | Ga0373939_0000094 | |||
| 2742 | Ga0373957_0137901 | |||
| 2743 | Ga0373957_0184698 | |||
| 2744 | Ga0373943_0005992 | |||
| 2745 | Ga0373943_0164833 | |||
| 2746 | Ga0373961_0066743 | |||
| 2747 | Ga0373962_0012366 | |||
| 2748 | Ga0316574_0037011 | |||
| 2749 | Ga0373931_0007647 | |||
| 2750 | Ga0373931_0033030 | |||
| 2751 | Ga0373935_0081666 | |||
| 2752 | Ga0373927_0009097 | |||
| 2753 | Ga0373927_0040428 | |||
| 2754 | Ga0373933_0044992 | |||
| 2755 | Ga0373937_0011845 | |||
| 2756 | Ga0373937_0016107 | |||
| 2757 | Ga0373937_0400537 | |||
| 2758 | Ga0316584_0079129 | |||
| 2759 | Ga0373925_0440835 | |||
| 2760 | Ga0395899_0000334 | |||
| 2761 | Ga0395899_0002441 | |||
| 2762 | Ga0395899_0002612 | |||
| 2763 | Ga0395899_0002671 | |||
| 2764 | Ga0395899_0002940 | |||
| 2765 | Ga0395899_0010568 | |||
| 2766 | Ga0395899_0015016 | |||
| 2767 | Ga0395899_0022102 | |||
| 2768 | Ga0395899_0023172 | |||
| 2769 | Ga0395899_0029558 | |||
| 2770 | Ga0395899_0034202 | |||
| 2771 | Ga0395899_0036935 | |||
| 2772 | Ga0395899_0103198 | |||
| 2773 | Ga0395899_0120893 | |||
| 2774 | Ga0395899_0145804 | |||
| 2775 | Ga0395899_0203517 | |||
| 2776 | Ga0395899_0205323 | |||
| 2777 | Ga0395899_0205340 | |||
| 2778 | Ga0395900_0000084 | |||
| 2779 | Ga0395900_0002289 | |||
| 2780 | Ga0395900_0002759 | |||
| 2781 | Ga0395900_0011437 | |||
| 2782 | Ga0395900_0015453 | |||
| 2783 | Ga0395900_0024121 | |||
| 2784 | Ga0395900_0032811 | |||
| 2785 | Ga0395900_0041524 | |||
| 2786 | Ga0395900_0048166 | |||
| 2787 | Ga0395900_0053389 | |||
| 2788 | Ga0395900_0056181 | |||
| 2789 | Ga0395900_0105776 | |||
| 2790 | Ga0395900_0120563 | |||
| 2791 | Ga0395900_0149447 | |||
| 2792 | Ga0395900_0202719 | |||
| 2793 | Ga0395900_0239781 | |||
| 2794 | Ga0395900_0290894 | |||
| 2795 | Ga0395900_0344262 | |||
| 2796 | Ga0395900_0354423 | |||
| 2797 | Ga0395900_0462939 | |||
| 2798 | Ga0395900_0551139 | |||
| 2799 | Ga0395900_0584499 | |||
| 2800 | Ga0395900_0635176 | |||
| 2801 | Ga0395898_0000021 | |||
| 2802 | Ga0395898_0002115 | |||
| 2803 | Ga0395898_0006097 | |||
| 2804 | Ga0395898_0014592 | |||
| 2805 | Ga0395898_0018292 | |||
| 2806 | Ga0395898_0025894 | |||
| 2807 | Ga0395898_0030307 | |||
| 2808 | Ga0395898_0053534 | |||
| 2809 | Ga0395898_0058017 | |||
| 2810 | Ga0395898_0067055 | |||
| 2811 | Ga0395898_0072080 | |||
| 2812 | Ga0395898_0076730 | |||
| 2813 | Ga0395898_0202801 | |||
| 2814 | Ga0395898_0383496 | |||
| 2815 | Ga0395898_0616775 | |||
| 2816 | Ga0395898_0703572 | |||
| 2817 | Ga0395898_0867950 | |||
| 2818 | Ga0395905_0000006 | |||
| 2819 | Ga0395905_0000191 | |||
| 2820 | Ga0395905_0000372 | |||
| 2821 | Ga0395905_0001643 | |||
| 2822 | Ga0395905_0003116 | |||
| 2823 | Ga0395905_0003972 | |||
| 2824 | Ga0395905_0005548 | |||
| 2825 | Ga0395905_0006958 | |||
| 2826 | Ga0395905_0007174 | |||
| 2827 | Ga0395905_0007663 | |||
| 2828 | Ga0395905_0009025 | |||
| 2829 | Ga0395905_0009210 | |||
| 2830 | Ga0395905_0015666 | |||
| 2831 | Ga0395905_0028190 | |||
| 2832 | Ga0395905_0047025 | |||
| 2833 | Ga0395905_0060448 | |||
| 2834 | Ga0395905_0068122 | |||
| 2835 | Ga0395905_0095817 | |||
| 2836 | Ga0395905_0099676 | |||
| 2837 | Ga0395905_0109931 | |||
| 2838 | Ga0395905_0134983 | |||
| 2839 | Ga0395905_0152826 | |||
| 2840 | Ga0395905_0219699 | |||
| 2841 | Ga0395905_0221727 | |||
| 2842 | Ga0395905_0222740 | |||
| 2843 | Ga0395905_0268916 | |||
| 2844 | Ga0395905_0290052 | |||
| 2845 | Ga0395905_0369760 | |||
| 2846 | Ga0395905_0414683 | |||
| 2847 | Ga0395905_0456551 | |||
| 2848 | Ga0395905_0526669 | |||
| 2849 | Ga0436364_1182596 | |||
| 2850 | Ga0395901_0001258 | |||
| 2851 | Ga0395901_0001740 | |||
| 2852 | Ga0395901_0004352 | |||
| 2853 | Ga0395901_0004669 | |||
| 2854 | Ga0395901_0012257 | |||
| 2855 | Ga0395901_0018587 | |||
| 2856 | Ga0395901_0048742 | |||
| 2857 | Ga0395901_0052514 | |||
| 2858 | Ga0395901_0093886 | |||
| 2859 | Ga0395901_0142105 | |||
| 2860 | Ga0395901_0177328 | |||
| 2861 | Ga0395901_0184793 | |||
| 2862 | Ga0395901_0195571 | |||
| 2863 | Ga0395901_0208692 | |||
| 2864 | Ga0395901_0217593 | |||
| 2865 | Ga0395901_0269392 | |||
| 2866 | Ga0395901_0377658 | |||
| 2867 | Ga0395901_0433438 | |||
| 2868 | Ga0395901_0517240 | |||
| 2869 | Ga0237819_00570 | |||
| 2870 | Ga0436365_0184456 | |||
| 2871 | Ga0436365_0774506 | |||
| 2872 | Ga0436365_0998972 | |||
| 2873 | Ga0436365_1009784 | |||
| 2874 | Ga0436365_1119595 | |||
| 2875 | Ga0436360_1163113 | |||
| 2876 | Ga0436363_0550894 | |||
| 2877 | Ga0436363_0893184 | |||
| 2878 | Ga0436363_1642796 | |||
| 2879 | Ga0436362_0126459 | |||
| 2880 | Ga0436362_0195334 | |||
| 2881 | Ga0439461_0018756 | |||
| 2882 | Ga0451853_1650316 | |||
| 2883 | Ga0439443_000059 | |||
| 2884 | Ga0439432_013232 | |||
| 2885 | Ga0439449_0021135 | |||
| 2886 | Ga0439449_0075806 | |||
| 2887 | Ga0439455_0074891 | |||
| 2888 | Ga0439456_000086 | |||
| 2889 | Ga0450890_000770 | |||
| 2890 | Ga0450892_000388 | |||
| 2891 | Ga0450900_013602 | |||
| 2892 | Ga0450905_000289 | |||
| 2893 | Ga0450889_000091 | |||
| 2894 | Ga0450889_000640 | |||
| 2895 | Ga0439458_0001847 | |||
| 2896 | Ga0439459_0006633 | |||
| 2897 | Ga0450893_0006315 | |||
| 2898 | Ga0451577_0597389 | |||
| 2899 | Ga0466969_0000561 | |||
| 2900 | Ga0466969_0005115 | |||
| 2901 | Ga0466969_0053865 | |||
| 2902 | Ga0466972_0064982 | |||
| 2903 | Ga0466972_0177931 | |||
| 2904 | Ga0466965_0039691 | |||
| 2905 | Ga0466966_0001104 | |||
| 2906 | Ga0466966_0023711 | |||
| 2907 | Ga0466966_0064836 | |||
| 2908 | Ga0466966_0427027 | |||
| 2909 | Ga0466961_0000806 | |||
| 2910 | Ga0466961_0020251 | |||
| 2911 | Ga0466961_0032193 | |||
| 2912 | Ga0466961_0060425 | |||
| 2913 | Ga0466961_0081205 | |||
| 2914 | Ga0466963_0008859 | |||
| 2915 | Ga0466963_0010369 | |||
| 2916 | Ga0466963_0056161 | |||
| 2917 | Ga0466963_0115748 | |||
| 2918 | Ga0466963_0193183 | |||
| 2919 | Ga0466964_0004970 | |||
| 2920 | Ga0466964_0049721 | |||
| 2921 | Ga0466964_0082767 | |||
| 2922 | Ga0466964_0142905 | |||
| 2923 | Ga0466971_0019546 | |||
| 2924 | Ga0466971_0023960 | |||
| 2925 | Ga0466971_0032061 | |||
| 2926 | Ga0466968_0225032 | |||
| 2927 | Ga0466970_0000141 | |||
| 2928 | Ga0466970_0083823 | |||
| 2929 | Ga0466970_0096904 | |||
| 2930 | Ga0466957_0001445 | |||
| 2931 | Ga0466957_0004083 | |||
| 2932 | Ga0466957_0012108 | |||
| 2933 | Ga0466957_0050742 | |||
| 2934 | Ga0466957_0114841 | |||
| 2935 | Ga0466960_0017595 | |||
| 2936 | Ga0466959_0006624 | |||
| 2937 | Ga0466959_0007471 | |||
| 2938 | Ga0466959_0026026 | |||
| 2939 | Ga0466959_0046437 | |||
| 2940 | Ga0466959_0114087 | |||
| 2941 | Ga0466959_0236757 | |||
| 2942 | Ga0466959_0322926 | |||
| 2943 | Ga0451576_0298183 | |||
| 2944 | Ga0451576_0316976 | |||
| 2945 | Ga0466958_0000112 | |||
| 2946 | Ga0466958_0015179 | |||
| 2947 | Ga0466958_0028848 | |||
| 2948 | Ga0466958_0041070 | |||
| 2949 | Ga0466958_0062214 | |||
| 2950 | Ga0466967_0054646 | |||
| 2951 | Ga0466967_0079223 | |||
| 2952 | Ga0466967_0082683 | |||
| 2953 | Ga0466967_0086801 | |||
| 2954 | Ga0466967_0109675 | |||
| 2955 | Ga0466967_0170652 | |||
| 2956 | Ga0466967_0210302 | |||
| 2957 | Ga0466967_0217642 | |||
| 2958 | Ga0466967_0251882 | |||
| 2959 | Ga0466967_0326818 | |||
| 2960 | Ga0466967_0342293 | |||
| 2961 | Ga0495603_0076531 | |||
| 2962 | Ga0495590_0001289 | |||
| 2963 | Ga0495638_0000714 | |||
| 2964 | Ga0495638_0013012 | |||
| 2965 | Ga0495638_0071193 | |||
| 2966 | Ga0495580_0002152 | |||
| 2967 | Ga0495616_0001437 | |||
| 2968 | Ga0495643_0147815 | |||
| 2969 | Ga0495648_0041969 | |||
| 2970 | Ga0495663_0010721 | |||
| 2971 | Ga0495663_0037608 | |||
| 2972 | Ga0495598_0009154 | |||
| 2973 | Ga0495598_0009515 | |||
| 2974 | Ga0495621_0000828 | |||
| 2975 | Ga0495621_0001056 | |||
| 2976 | Ga0495621_0023643 | |||
| 2977 | Ga0495633_0019671 | |||
| 2978 | Ga0495625_0003242 | |||
| 2979 | Ga0495625_0056158 | |||
| 2980 | Ga0495625_0121124 | |||
| 2981 | Ga0495623_0049158 | |||
| 2982 | Ga0495669_0001546 | |||
| 2983 | Ga0495669_0006368 | |||
| 2984 | Ga0495669_0008299 | |||
| 2985 | Ga0495669_0020004 | |||
| 2986 | Ga0495669_0031978 | |||
| 2987 | Ga0495669_0052234 | |||
| 2988 | Ga0495669_0118758 | |||
| 2989 | Ga0495670_0002211 | |||
| 2990 | Ga0495670_0028894 | |||
| 2991 | Ga0495670_0096201 | |||
| 2992 | Ga0495649_0001764 | |||
| 2993 | Ga0495680_0271034 | |||
| 2994 | Ga0495677_0051924 | |||
| 2995 | Ga0495677_0087975 | |||
| 2996 | Ga0496100_0012082 | |||
| 2997 | Ga0496100_0023756 | |||
| 2998 | Ga0496100_0034133 | |||
| 2999 | Ga0496100_0294497 | |||
| 3000 | Ga0496101_0003206 | |||
| 3001 | Ga0496101_0006265 | |||
| 3002 | Ga0496101_0010717 | |||
| 3003 | Ga0496101_0311987 | |||
| 3004 | Ga0496101_0538732 | |||
| 3005 | Ga0496102_0021186 | |||
| 3006 | Ga0496102_0055285 | |||
| 3007 | Ga0496102_0089784 | |||
| 3008 | Ga0496102_0115519 | |||
| 3009 | Ga0496103_0044380 | |||
| 3010 | Ga0496103_0189132 | |||
| 3011 | Ga0496103_0335265 | |||
| 3012 | Ga0496105_0014011 | |||
| 3013 | Ga0496105_0440672 | |||
| 3014 | Ga0496106_0010145 | |||
| 3015 | Ga0496106_0040445 | |||
| 3016 | Ga0496106_0040837 | |||
| 3017 | Ga0496106_0147975 | |||
| 3018 | Ga0496106_0193664 | |||
| 3019 | Ga0496107_0001288 | |||
| 3020 | Ga0496107_0013115 | |||
| 3021 | Ga0496107_0028262 | |||
| 3022 | Ga0496107_0068823 | |||
| 3023 | Ga0496107_0102333 | |||
| 3024 | Ga0496107_0122857 | |||
| 3025 | Ga0496107_0133507 | |||
| 3026 | Ga0496107_0337987 | |||
| 3027 | Ga0496108_0000372 | |||
| 3028 | Ga0496108_0009427 | |||
| 3029 | Ga0496108_0020262 | |||
| 3030 | Ga0496108_0055426 | |||
| 3031 | Ga0496108_0078996 | |||
| 3032 | Ga0496109_0001137 | |||
| 3033 | Ga0496109_0001325 | |||
| 3034 | Ga0496109_0057599 | |||
| 3035 | Ga0496109_0061301 | |||
| 3036 | Ga0496109_0103348 | |||
| 3037 | Ga0496109_0234385 | |||
| 3038 | Ga0496110_0009927 | |||
| 3039 | Ga0496110_0016678 | |||
| 3040 | Ga0496110_0023560 | |||
| 3041 | Ga0496110_0031418 | |||
| 3042 | Ga0496110_0128958 | |||
| 3043 | Ga0496110_0517101 | |||
| 3044 | Ga0496111_0002146 | |||
| 3045 | Ga0496111_0009171 | |||
| 3046 | Ga0496111_0021784 | |||
| 3047 | Ga0496111_0034718 | |||
| 3048 | Ga0496111_0085202 | |||
| 3049 | Ga0496111_0149004 | |||
| 3050 | Ga0496111_0265164 | |||
| 3051 | Ga0496111_0353202 | |||
| 3052 | Ga0496112_0007892 | |||
| 3053 | Ga0496112_0012135 | |||
| 3054 | Ga0496112_0025396 | |||
| 3055 | Ga0496112_0049413 | |||
| 3056 | Ga0496112_0062421 | |||
| 3057 | Ga0496112_0142590 | |||
| 3058 | Ga0496112_0156129 | |||
| 3059 | Ga0496113_0072071 | |||
| 3060 | Ga0496113_0167037 | |||
| 3061 | Ga0496114_0000023 | |||
| 3062 | Ga0496114_0009720 | |||
| 3063 | Ga0496114_0025285 | |||
| 3064 | Ga0496114_0091099 | |||
| 3065 | Ga0496115_0004751 | |||
| 3066 | Ga0496115_0006554 | |||
| 3067 | Ga0496115_0028270 | |||
| 3068 | Ga0496115_0411564 | |||
| 3069 | Ga0496117_0000156 | |||
| 3070 | Ga0496118_0000005 | |||
| 3071 | Ga0496119_0001995 | |||
| 3072 | Ga0496119_0027338 | |||
| 3073 | Ga0496119_0096703 | |||
| 3074 | Ga0496120_0000173 | |||
| 3075 | Ga0496120_0013758 | |||
| 3076 | Ga0496120_0043030 | |||
| 3077 | Ga0496121_0000371 | |||
| 3078 | Ga0496121_0000441 | |||
| 3079 | Ga0496121_0002693 | |||
| 3080 | Ga0496121_0004828 | |||
| 3081 | Ga0496121_0045899 | |||
| 3082 | Ga0496124_0019875 | |||
| 3083 | Ga0496124_0158874 | |||
| 3084 | Ga0496125_0001476 | |||
| 3085 | Ga0496125_0003558 | |||
| 3086 | Ga0496125_0075785 | |||
| 3087 | Ga0496125_0264987 | |||
| 3088 | Ga0496126_0003036 | |||
| 3089 | Ga0496126_0014156 | |||
| 3090 | Ga0496126_0018733 | |||
| 3091 | Ga0496126_0405328 | |||
| 3092 | Ga0496126_0490316 | |||
| 3093 | Ga0495678_037576 | |||
| 3094 | Ga0501298_033164 | |||
| 3095 | Ga0501032_0000083 | |||
| 3096 | Ga0501032_0002358 | |||
| 3097 | Ga0501033_0016156 | |||
| 3098 | Ga0501033_0147790 | |||
| 3099 | Ga0501034_0000001 | |||
| 3100 | Ga0501034_0028292 | |||
| 3101 | Ga0501034_0809472 | |||
| 3102 | Ga0501036_0008712 | |||
| 3103 | Ga0501037_0000785 | |||
| 3104 | Ga0501038_0000644 | |||
| 3105 | Ga0501038_0001615 | |||
| 3106 | Ga0501039_0000033 | |||
| 3107 | Ga0501039_0001268 | |||
| 3108 | Ga0501042_0366238 | |||
| 3109 | Ga0501043_0002273 | |||
| 3110 | Ga0501046_0002264 | |||
| 3111 | Ga0501047_0039919 | |||
| 3112 | Ga0501047_0363352 | |||
| 3113 | Ga0501048_0008512 | |||
| 3114 | Ga0501067_0001478 | |||
| 3115 | Ga0501068_0211139 | |||
| 3116 | Ga0501069_0000429 | |||
| 3117 | Ga0501070_0006112 | |||
| 3118 | Ga0501071_0387250 | |||
| 3119 | Ga0501071_0517305 | |||
| 3120 | Ga0501073_0060098 | |||
| 3121 | Ga0501074_0006905 | |||
| 3122 | Ga0501075_0245951 | |||
| 3123 | Ga0501202_008106 | |||
| 3124 | Ga0501216_017267 | |||
| 3125 | Ga0501216_020765 | |||
| 3126 | Ga0501217_006360 | |||
| 3127 | Ga0501222_001194 | |||
| 3128 | Ga0501224_007120 | |||
| 3129 | Ga0501233_008812 | |||
| 3130 | Ga0501235_003638 | |||
| 3131 | Ga0501235_023488 | |||
| 3132 | Ga0501236_009768 | |||
| 3133 | Ga0501249_001844 | |||
| 3134 | Ga0501250_002363 | |||
| 3135 | Ga0501253_004534 | |||
| 3136 | Ga0501253_048118 | |||
| 3137 | Ga0501257_021294 | |||
| 3138 | Ga0501221_001116 | |||
| 3139 | Ga0501221_002374 | |||
| 3140 | Ga0501221_005121 | |||
| 3141 | Ga0501225_0029196 | |||
| 3142 | Ga0501229_002174 | |||
| 3143 | Ga0501245_004736 | |||
| 3144 | Ga0501079_0050464 | |||
| 3145 | Ga0501080_0004541 | |||
| 3146 | Ga0501081_0172310 | |||
| 3147 | Ga0501083_0002945 | |||
| 3148 | Ga0501083_0029619 | |||
| 3149 | Ga0501083_0248205 | |||
| 3150 | Ga0501262_008854 | |||
| 3151 | Ga0501263_001889 | |||
| 3152 | Ga0501267_008154 | |||
| 3153 | Ga0501268_001501 | |||
| 3154 | Ga0501270_002379 | |||
| 3155 | Ga0501272_005506 | |||
| 3156 | Ga0501035_0001739 | |||
| 3157 | Ga0501044_0004784 | |||
| 3158 | Ga0501044_0064458 | |||
| 3159 | Ga0501044_0214603 | |||
| 3160 | Ga0501045_0135362 | |||
| 3161 | Ga0501212_012838 | |||
| 3162 | nmdc:mga03683_58163_c1 | |||
| 3163 | nmdc:mga00v17_55457_c1 | |||
| 3164 | nmdc:mga07m45_22427_c1 | |||
| 3165 | nmdc:mga07m45_27400_c1 | |||
| 3166 | nmdc:mga09592_197218_c1 | |||
| 3167 | nmdc:mga0qj67_39866_c1 | |||
| 3168 | nmdc:mga08y16_160509_c1 | |||
| 3169 | nmdc:mga08y16_494019_c1 | |||
| 3170 | nmdc:mga08x19_132574_c1 | |||
| 3171 | Ga0500643_000366 | |||
| 3172 | Ga0500644_0004471 | |||
| 3173 | Ga0500646_0017655 | |||
| 3174 | Ga0500583_0060020 | |||
| 3175 | Ga0500557_000019 | |||
| 3176 | Ga0500591_006428 | |||
| 3177 | Ga0500592_000162 | |||
| 3178 | Ga0500597_002257 | |||
| 3179 | Ga0500658_0000291 | |||
| 3180 | Ga0500568_0000140 | |||
| 3181 | Ga0500573_0000363 | |||
| 3182 | Ga0500616_0006277 | |||
| 3183 | Ga0500622_0061870 | |||
| 3184 | Ga0500624_000077 | |||
| 3185 | Ga0500637_0000931 | |||
| 3186 | Ga0500637_0043799 | |||
| 3187 | Ga0500637_0049083 | |||
| 3188 | Ga0500637_0128958 | |||
| 3189 | Ga0500611_000980 | |||
| 3190 | Ga0501084_0009704 | |||
| 3191 | Ga0501082_0186147 | |||
| 3192 | Ga0501082_0198675 | |||
| 3193 | Ga0466962_0000589 | |||
| 3194 | Ga0466962_0010534 | |||
| 3195 | Ga0466962_0025028 | |||
| 3196 | 2513593995 | |||
| 3197 | 2514590293 | |||
| 3198 | 2643746064 | |||
| 3199 | 2643937021 | |||
| 3200 | 2644218007 | |||
| 3201 | 2644258253 | |||
| 3202 | 2644318186 | |||
| 3203 | 2739057144 | |||
| 3204 | 2852654024 | |||
| 3205 | 2896429963 | |||
| 3206 | 2912967717 | |||
| 3207 | 2939655827 | |||
| 3208 | 2996341144 | |||
| 3209 | 8055878932 | |||
| 3210 | 8057101270 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3mr1-assembly2.cif.gz_B | crystal structure of methionine aminopeptidase from rickettsia prowazekii | 0.9959 | 18 | 262 |
| 4juq-assembly1.cif.gz_A | pseudomonas aeruginosa metap t2n mutant, in mn form | 0.995 | 18 | 266 |
| 3tb5-assembly2.cif.gz_B | crystal structure of the enterococcus faecalis methionine aminopeptidase apo form | 0.9868 | 18 | 262 |
| 1o0x-assembly1.cif.gz_A | crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution | 0.9834 | 18 | 262 |
| 2b3k-assembly1.cif.gz_A | crystal structure of human methionine aminopeptidase type i in the holo form | 0.9825 | 18 | 265 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6Z3V9_1_121_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9893 | 30 | 140 | 3.90.230.10 |
| 1o0xA00 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9834 | 18 | 262 | 3.90.230.10 |
| af_P9WK19_6_284_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9819 | 20 | 262 | 3.90.230.10 |
| 4fukB01 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9796 | 25 | 267 | 3.90.230.10 |
| 4iecA01 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9788 | 20 | 262 | 3.90.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B0TU55-F1-model_v4 | Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) | 0.9996 | 30 | 269 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-A0A258LEB9-F1-model_v4 | Methionine aminopeptidase (EC 3.4.11.18) | 0.9989 | 71 | 274 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-A0A7Z1N8M5-F1-model_v4 | Methionine aminopeptidase (EC 3.4.11.18) | 0.9989 | 49 | 204 |
GO:0005829
GO:0006508 GO:0046872 GO:0070006 |
| AF-A0A6P0I4I0-F1-model_v4 | Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) | 0.9987 | 30 | 262 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-A0A1Z4VBK9-F1-model_v4 | deleted | 0.9981 | 18 | 262 |
|