F495018

General Info

Members Datasets Scaffolds Average Seq Length
1605 439 3210 273

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10005609|Ga0157370_1000560911
Length 305
Sequence MRGLQAPVSKRDLSRSVGFDCRFTYIASMTQYISVAADDRVEAKNGIIKLHGPEGLAGMRRAGRLAAEILDSLAPHVVPGVSTQQLDDIVYKMTLDAGGLPATLGYRGYPKSCCISINHVVCHGIPSEQRVLKSGDIVNIDVTPILDCWHGDTSRMYLVGDVPLKARKLVDVTYECLMLGLEQAKPGNHLGDIANAIQRHAESNRYSVVRDFCGHGVGRVFHDSPEVIHAGKPGTGPELKPGMIFTVEPMINIGRADVKVLEDGWTAVTRDRSLSAQFEHSIGITQTGCEIFTKSPAGLDRPPYA

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
92 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
93 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
94 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
140 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
141 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
142 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
143 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
145 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
146 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
149 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
220 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
224 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
225 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
226 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
228 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
229 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
230 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
231 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
232 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
233 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
234 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
235 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
236 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
237 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
238 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
239 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
240 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
241 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
242 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
243 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
244 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
245 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
246 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
247 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
248 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
249 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
250 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
251 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
252 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
253 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
254 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
255 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
256 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
257 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
258 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
259 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
260 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
261 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
262 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
264 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
265 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
266 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
267 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
268 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
269 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
270 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
271 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
272 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
273 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
274 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
275 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
276 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
277 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
278 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
279 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
280 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
281 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
282 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
283 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
284 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
285 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
286 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
287 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
288 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
289 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
290 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
291 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
292 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
293 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
294 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
295 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
296 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
297 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
298 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
299 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
300 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
301 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
302 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
303 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
304 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
305 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
306 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
307 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
308 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
309 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
310 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
311 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
312 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
313 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
314 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
315 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
316 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
317 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
318 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
319 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
320 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
321 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
322 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
323 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
324 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
325 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
326 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
327 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
328 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
329 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
330 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
331 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
332 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
333 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
334 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
335 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
336 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
337 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
338 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
339 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
340 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
341 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
342 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
343 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
344 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
345 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
346 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
347 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
348 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
349 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
362 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
363 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
364 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
365 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
366 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
367 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
368 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
369 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
370 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
371 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
372 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
373 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
374 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
375 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
376 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
377 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
378 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
379 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
380 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
381 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
382 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
383 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
384 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
385 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
386 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
387 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
388 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
389 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
390 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
391 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
392 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
393 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
394 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
395 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
399 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
400 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
401 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
402 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
403 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
404 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
405 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
406 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
407 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
408 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
409 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
410 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
411 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
412 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
413 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
414 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
415 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
416 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
417 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
418 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
419 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
420 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
421 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
422 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
423 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
424 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
425 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
426 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
427 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
428 2643221585 Pelomonas sp. Root662 Isolate Unclassified
429 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
430 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
431 2643221656 Pelomonas sp. Root405 Isolate Unclassified
432 2738541337 Pelomonas sp. BT06 Isolate Unclassified
433 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
434 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
435 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
436 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
437 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
438 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
439 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.19
Metatranscriptomes 0.87
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.68
Nodule 0.12
Rhizoplane 4.55
Rhizosphere 88.97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10005609 3300013104 Bacteria 14050
2 LJQas_1004738 3300000549 Bacteria 1758
3 JGI24736J21556_1001107 3300001904 Bacteria 4939
4 JGI24741J21665_1012174 3300001915 Bacteria 1485
5 JGI24752J21851_1007184 3300001976 Bacteria 1452
6 JGI24740J21852_10011276 3300001979 Bacteria 3407
7 JGI24740J21852_10050555 3300001979 Bacteria 1195
8 JGI24739J22299_10001179 3300001989 Bacteria 9782
9 JGI24737J22298_10000046 3300001990 Bacteria 34636
10 JGI24737J22298_10000144 3300001990 Bacteria 22021
11 JGI24737J22298_10012849 3300001990 Bacteria 2730
12 JGI24737J22298_10050156 3300001990 Bacteria 1269
13 JGI24743J22301_10018929 3300001991 Bacteria 1305
14 JGI24735J21928_10008760 3300002067 Bacteria 3264
15 JGI24735J21928_10023798 3300002067 Bacteria 1857
16 JGI24735J21928_10041445 3300002067 Bacteria 1342
17 JGI24735J21928_10049491 3300002067 Bacteria 1214
18 JGI24738J21930_10010536 3300002075 Bacteria 2055
19 JGI24744J21845_10000547 3300002077 Bacteria 6755
20 JGI24751J29686_10028440 3300002459 Bacteria 1161
21 JGI25150J39212_1000701 3300002774 Bacteria 12140
22 JGI25151J46595_10027072 3300003187 Bacteria 2305
23 JGI25406J46586_10009729 3300003203 Bacteria 4297
24 JGI25153J46596_10000196 3300003215 Bacteria 57182
25 rootL2_10012690 3300003322 Bacteria 4228
26 rootH1_10079078 3300003323 Bacteria 3304
27 Ga0055536_1018345 3300003781 Bacteria 2246
28 Ga0055540_1000907 3300003792 Bacteria 19487
29 Ga0055531_10000021 3300003794 Bacteria 167213
30 Ga0058863_11714062 3300004799 Bacteria 1026
31 Ga0058861_11993753 3300004800 Bacteria 1053
32 Ga0058862_12098551 3300004803 Bacteria 1029
33 Ga0065712_10117326 3300005290 Bacteria 1722
34 Ga0065712_10177284 3300005290 Bacteria 1211
35 Ga0065707_10000499 3300005295 Bacteria 40457
36 Ga0065707_10082284 3300005295 Bacteria 17401
37 Ga0065707_10097429 3300005295 Bacteria 3174
38 Ga0070658_10000001 3300005327 Bacteria 856789
39 Ga0070658_10001597 3300005327 Bacteria 19154
40 Ga0070658_10004859 3300005327 Bacteria 10944
41 Ga0070658_10050747 3300005327 Bacteria 3363
42 Ga0070658_10083539 3300005327 Bacteria 2625
43 Ga0070658_10106638 3300005327 Bacteria 2318
44 Ga0070658_10107235 3300005327 Bacteria 2311
45 Ga0070658_10177363 3300005327 Bacteria 1792
46 Ga0070658_10294338 3300005327 Bacteria 1384
47 Ga0070658_10428873 3300005327 Bacteria 1138
48 Ga0070658_10553707 3300005327 Bacteria 995
49 Ga0070676_10008390 3300005328 Bacteria 5568
50 Ga0070676_10009125 3300005328 Bacteria 5365
51 Ga0070676_10055026 3300005328 Bacteria 2347
52 Ga0070676_10232010 3300005328 Bacteria 1224
53 Ga0070683_100015692 3300005329 Bacteria 6660
54 Ga0070683_100065681 3300005329 Bacteria 3378
55 Ga0070683_100422038 3300005329 Bacteria 1272
56 Ga0070690_100020627 3300005330 Bacteria 4016
57 Ga0070690_100056501 3300005330 Bacteria 2517
58 Ga0070690_100236747 3300005330 Bacteria 1286
59 Ga0070670_100047328 3300005331 Bacteria 3700
60 Ga0070670_100080022 3300005331 Bacteria 2808
61 Ga0070670_100108075 3300005331 Bacteria 2397
62 Ga0070670_100449324 3300005331 Bacteria 1142
63 Ga0070670_100474796 3300005331 Bacteria 1110
64 Ga0070677_10131526 3300005333 Bacteria 1143
65 Ga0068869_100000248 3300005334 Bacteria 28582
66 Ga0068869_100222574 3300005334 Bacteria 1496
67 Ga0070666_10000381 3300005335 Bacteria 27905
68 Ga0070666_10001831 3300005335 Bacteria 12959
69 Ga0070666_10018453 3300005335 Bacteria 4487
70 Ga0070666_10026728 3300005335 Bacteria 3774
71 Ga0070666_10035612 3300005335 Bacteria 3301
72 Ga0070666_10040320 3300005335 Bacteria 3116
73 Ga0070666_10317357 3300005335 Bacteria 1111
74 Ga0070680_100000081 3300005336 Bacteria 52556
75 Ga0070680_100004762 3300005336 Bacteria 10214
76 Ga0070680_100015293 3300005336 Bacteria 6013
77 Ga0070680_100015773 3300005336 Bacteria 5931
78 Ga0070680_100051207 3300005336 Bacteria 3369
79 Ga0070680_100057907 3300005336 Bacteria 3169
80 Ga0070680_100064511 3300005336 Bacteria 3002
81 Ga0070680_100080069 3300005336 Bacteria 2694
82 Ga0070680_100157302 3300005336 Bacteria 1909
83 Ga0070680_100231629 3300005336 Bacteria 1560
84 Ga0070682_100017648 3300005337 Bacteria 4162
85 Ga0070682_100050955 3300005337 Bacteria 2586
86 Ga0070682_100091351 3300005337 Bacteria 1993
87 Ga0070682_100464551 3300005337 Bacteria 972
88 Ga0068868_100000638 3300005338 Bacteria 23609
89 Ga0068868_100002486 3300005338 Bacteria 12791
90 Ga0068868_100012819 3300005338 Bacteria 6133
91 Ga0068868_100016220 3300005338 Bacteria 5527
92 Ga0068868_100048439 3300005338 Bacteria 3333
93 Ga0068868_100061996 3300005338 Bacteria 2963
94 Ga0068868_100140909 3300005338 Bacteria 1979
95 Ga0070660_100000039 3300005339 Bacteria 76157
96 Ga0070660_100000596 3300005339 Bacteria 24197
97 Ga0070660_100006325 3300005339 Bacteria 8203
98 Ga0070660_100006837 3300005339 Bacteria 7912
99 Ga0070660_100010785 3300005339 Bacteria 6469
100 Ga0070660_100015799 3300005339 Bacteria 5461
101 Ga0070660_100046290 3300005339 Bacteria 3334
102 Ga0070660_100051072 3300005339 Bacteria 3183
103 Ga0070660_100053647 3300005339 Bacteria 3110
104 Ga0070660_100070079 3300005339 Bacteria 2735
105 Ga0070660_100073099 3300005339 Bacteria 2681
106 Ga0070660_100101765 3300005339 Bacteria 2277
107 Ga0070660_100106413 3300005339 Bacteria 2228
108 Ga0070660_100155798 3300005339 Bacteria 1838
109 Ga0070660_100210874 3300005339 Bacteria 1577
110 Ga0070689_100148501 3300005340 Bacteria 1889
111 Ga0070689_100258406 3300005340 Bacteria 1439
112 Ga0070691_10009897 3300005341 Bacteria 4343
113 Ga0070691_10041532 3300005341 Bacteria 2174
114 Ga0070661_100000009 3300005344 Bacteria 181351
115 Ga0070661_100008809 3300005344 Bacteria 6983
116 Ga0070661_100008823 3300005344 Bacteria 6976
117 Ga0070661_100019749 3300005344 Bacteria 4802
118 Ga0070661_100035443 3300005344 Bacteria 3623
119 Ga0070661_100056510 3300005344 Bacteria 2876
120 Ga0070661_100059054 3300005344 Bacteria 2811
121 Ga0070661_100092995 3300005344 Bacteria 2235
122 Ga0070661_100129737 3300005344 Bacteria 1893
123 Ga0070661_100218562 3300005344 Bacteria 1461
124 Ga0070661_100240686 3300005344 Bacteria 1393
125 Ga0070692_10005876 3300005345 Bacteria 5280
126 Ga0070668_100000048 3300005347 Bacteria 75276
127 Ga0070668_100043246 3300005347 Bacteria 3455
128 Ga0070669_100003550 3300005353 Bacteria 11253
129 Ga0070669_100021133 3300005353 Bacteria 4651
130 Ga0070669_100077138 3300005353 Bacteria 2475
131 Ga0070669_100227785 3300005353 Bacteria 1476
132 Ga0070675_100000913 3300005354 Bacteria 20987
133 Ga0070675_100072925 3300005354 Bacteria 2850
134 Ga0070675_100142616 3300005354 Bacteria 2049
135 Ga0070675_100230945 3300005354 Bacteria 1614
136 Ga0070675_100348052 3300005354 Bacteria 1314
137 Ga0070671_100000492 3300005355 Bacteria 27614
138 Ga0070671_100000860 3300005355 Bacteria 22151
139 Ga0070671_100001033 3300005355 Bacteria 20484
140 Ga0070671_100005525 3300005355 Bacteria 10069
141 Ga0070671_100011713 3300005355 Bacteria 7053
142 Ga0070671_100022902 3300005355 Bacteria 5105
143 Ga0070671_100033981 3300005355 Bacteria 4220
144 Ga0070671_100056215 3300005355 Bacteria 3274
145 Ga0070671_100127994 3300005355 Bacteria 2138
146 Ga0070671_100183497 3300005355 Bacteria 1772
147 Ga0070674_100014377 3300005356 Bacteria 4922
148 Ga0070674_100026131 3300005356 Bacteria 3809
149 Ga0070674_100072023 3300005356 Bacteria 2446
150 Ga0070674_100251989 3300005356 Bacteria 1387
151 Ga0070673_100002642 3300005364 Bacteria 10962
152 Ga0070673_100054862 3300005364 Bacteria 3137
153 Ga0070673_100090163 3300005364 Bacteria 2504
154 Ga0070673_100115071 3300005364 Bacteria 2236
155 Ga0070673_100222719 3300005364 Bacteria 1633
156 Ga0070673_100236991 3300005364 Bacteria 1585
157 Ga0070673_100329494 3300005364 Bacteria 1350
158 Ga0070673_100375767 3300005364 Bacteria 1266
159 Ga0070659_100001925 3300005366 Bacteria 14830
160 Ga0070659_100003113 3300005366 Bacteria 11801
161 Ga0070659_100016142 3300005366 Bacteria 5603
162 Ga0070659_100019299 3300005366 Bacteria 5163
163 Ga0070659_100019630 3300005366 Bacteria 5126
164 Ga0070659_100019664 3300005366 Bacteria 5122
165 Ga0070659_100034417 3300005366 Bacteria 3941
166 Ga0070659_100069013 3300005366 Bacteria 2805
167 Ga0070659_100081050 3300005366 Bacteria 2592
168 Ga0070659_100366209 3300005366 Bacteria 1212
169 Ga0070667_100000363 3300005367 Bacteria 49379
170 Ga0070667_100000915 3300005367 Bacteria 27247
171 Ga0070667_100001034 3300005367 Bacteria 25405
172 Ga0070667_100001800 3300005367 Bacteria 19079
173 Ga0070667_100002455 3300005367 Bacteria 16189
174 Ga0070667_100003445 3300005367 Bacteria 13477
175 Ga0070667_100017753 3300005367 Bacteria 5897
176 Ga0070667_100084129 3300005367 Bacteria 2727
177 Ga0070667_100096210 3300005367 Bacteria 2553
178 Ga0070667_100110842 3300005367 Bacteria 2379
179 Ga0070667_100115081 3300005367 Bacteria 2335
180 Ga0070667_100141190 3300005367 Bacteria 2109
181 Ga0070709_10006352 3300005434 Bacteria 6435
182 Ga0070709_10025490 3300005434 Bacteria 3495
183 Ga0070709_10114766 3300005434 Bacteria 1816
184 Ga0070709_10119281 3300005434 Bacteria 1785
185 Ga0070709_10139194 3300005434 Bacteria 1666
186 Ga0070714_100013482 3300005435 Bacteria 6551
187 Ga0070714_100077928 3300005435 Bacteria 2880
188 Ga0070714_100118597 3300005435 Bacteria 2351
189 Ga0070714_100428699 3300005435 Bacteria 1254
190 Ga0070713_100002739 3300005436 Bacteria 11513
191 Ga0070713_100031229 3300005436 Bacteria 4241
192 Ga0070713_100067606 3300005436 Bacteria 3009
193 Ga0070713_100318538 3300005436 Bacteria 1436
194 Ga0070710_10260518 3300005437 Bacteria 1118
195 Ga0070711_100058122 3300005439 Bacteria 2680
196 Ga0070694_100183080 3300005444 Bacteria 1551
197 Ga0070663_100001101 3300005455 Bacteria 14847
198 Ga0070663_100022927 3300005455 Bacteria 4179
199 Ga0070663_100024555 3300005455 Bacteria 4059
200 Ga0070663_100040471 3300005455 Bacteria 3263
201 Ga0070663_100114931 3300005455 Bacteria 2027
202 Ga0070663_100120055 3300005455 Bacteria 1985
203 Ga0070678_100028164 3300005456 Bacteria 3827
204 Ga0070678_100291796 3300005456 Bacteria 1383
205 Ga0070662_100000077 3300005457 Bacteria 53803
206 Ga0070662_100004226 3300005457 Bacteria 9052
207 Ga0070662_100017342 3300005457 Bacteria 4854
208 Ga0070662_100034607 3300005457 Bacteria 3563
209 Ga0070662_100116204 3300005457 Bacteria 2044
210 Ga0070662_100244923 3300005457 Bacteria 1439
211 Ga0070662_100246120 3300005457 Bacteria 1435
212 Ga0070662_100542109 3300005457 Bacteria 974
213 Ga0070681_10002023 3300005458 Bacteria 18354
214 Ga0070681_10003522 3300005458 Bacteria 14664
215 Ga0070681_10021321 3300005458 Bacteria 6495
216 Ga0070681_10022034 3300005458 Bacteria 6393
217 Ga0070681_10055363 3300005458 Bacteria 3949
218 Ga0070681_10063064 3300005458 Bacteria 3679
219 Ga0070681_10079117 3300005458 Bacteria 3244
220 Ga0070681_10079732 3300005458 Bacteria 3230
221 Ga0070681_10093902 3300005458 Bacteria 2949
222 Ga0070681_10248312 3300005458 Bacteria 1692
223 Ga0068867_100012318 3300005459 Bacteria 6049
224 Ga0068867_100018339 3300005459 Bacteria 4974
225 Ga0068867_100095721 3300005459 Bacteria 2259
226 Ga0070699_100014057 3300005518 Bacteria 6887
227 Ga0070679_100000031 3300005530 Bacteria 107526
228 Ga0070679_100006962 3300005530 Bacteria 10552
229 Ga0070679_100054990 3300005530 Bacteria 3964
230 Ga0070679_100070381 3300005530 Bacteria 3490
231 Ga0070679_100092141 3300005530 Bacteria 3018
232 Ga0070679_100093706 3300005530 Bacteria 2990
233 Ga0070679_100096575 3300005530 Bacteria 2943
234 Ga0070679_100126321 3300005530 Bacteria 2540
235 Ga0070679_100216875 3300005530 Bacteria 1876
236 Ga0070684_100043998 3300005535 Bacteria 3859
237 Ga0070684_100056140 3300005535 Bacteria 3435
238 Ga0070684_100114544 3300005535 Bacteria 2420
239 Ga0070684_100115069 3300005535 Bacteria 2415
240 Ga0070684_100478126 3300005535 Bacteria 1153
241 Ga0068853_100006336 3300005539 Bacteria 9391
242 Ga0068853_100008076 3300005539 Bacteria 8442
243 Ga0068853_100029886 3300005539 Bacteria 4597
244 Ga0068853_100036478 3300005539 Bacteria 4182
245 Ga0068853_100066571 3300005539 Bacteria 3129
246 Ga0068853_100090534 3300005539 Bacteria 2689
247 Ga0068853_100208194 3300005539 Bacteria 1782
248 Ga0068853_100279599 3300005539 Bacteria 1538
249 Ga0068853_100899773 3300005539 Bacteria 850
250 Ga0070672_100003257 3300005543 Bacteria 10508
251 Ga0070672_100003621 3300005543 Bacteria 10023
252 Ga0070672_100022583 3300005543 Bacteria 4624
253 Ga0070672_100403882 3300005543 Bacteria 1171
254 Ga0070686_100099037 3300005544 Bacteria 1966
255 Ga0070695_100136216 3300005545 Bacteria 1698
256 Ga0070696_100018654 3300005546 Bacteria 4692
257 Ga0070693_100061023 3300005547 Bacteria 2191
258 Ga0070665_100001581 3300005548 Bacteria 26245
259 Ga0070665_100003133 3300005548 Bacteria 17806
260 Ga0070665_100007755 3300005548 Bacteria 10897
261 Ga0070665_100008963 3300005548 Bacteria 10136
262 Ga0070665_100009801 3300005548 Bacteria 9686
263 Ga0070665_100011210 3300005548 Bacteria 9064
264 Ga0070665_100058842 3300005548 Bacteria 3852
265 Ga0070665_100134878 3300005548 Bacteria 2471
266 Ga0070665_100198317 3300005548 Bacteria 2008
267 Ga0070665_100533529 3300005548 Bacteria 1185
268 Ga0070704_100065882 3300005549 Bacteria 2610
269 Ga0068855_100000135 3300005563 Bacteria 94502
270 Ga0068855_100000789 3300005563 Bacteria 39145
271 Ga0068855_100001165 3300005563 Bacteria 32593
272 Ga0068855_100009575 3300005563 Bacteria 11690
273 Ga0068855_100016755 3300005563 Bacteria 8814
274 Ga0068855_100019907 3300005563 Bacteria 8059
275 Ga0068855_100025830 3300005563 Bacteria 7023
276 Ga0068855_100041991 3300005563 Bacteria 5419
277 Ga0070664_100003529 3300005564 Bacteria 12625
278 Ga0070664_100008493 3300005564 Bacteria 8304
279 Ga0070664_100041322 3300005564 Bacteria 3891
280 Ga0070664_100047682 3300005564 Bacteria 3620
281 Ga0070664_100048561 3300005564 Bacteria 3586
282 Ga0070664_100059290 3300005564 Bacteria 3256
283 Ga0070664_100076492 3300005564 Bacteria 2876
284 Ga0070664_100098888 3300005564 Bacteria 2535
285 Ga0070664_100101155 3300005564 Bacteria 2506
286 Ga0070664_100106890 3300005564 Bacteria 2439
287 Ga0068857_100000555 3300005577 Bacteria 27265
288 Ga0068857_100002899 3300005577 Bacteria 14123
289 Ga0068857_100016286 3300005577 Bacteria 6513
290 Ga0068857_100040921 3300005577 Bacteria 4108
291 Ga0068857_100140765 3300005577 Bacteria 2180
292 Ga0068857_100155652 3300005577 Bacteria 2072
293 Ga0068857_100331672 3300005577 Bacteria 1406
294 Ga0068854_100001637 3300005578 Bacteria 13623
295 Ga0068854_100002406 3300005578 Bacteria 11546
296 Ga0068854_100009733 3300005578 Bacteria 6213
297 Ga0068854_100023622 3300005578 Bacteria 4201
298 Ga0068854_100050636 3300005578 Bacteria 2973
299 Ga0068854_100063809 3300005578 Bacteria 2675
300 Ga0068854_100085704 3300005578 Bacteria 2333
301 Ga0068854_100113560 3300005578 Bacteria 2046
302 Ga0068856_100040544 3300005614 Bacteria 4574
303 Ga0068856_100045466 3300005614 Bacteria 4323
304 Ga0068856_100059987 3300005614 Bacteria 3758
305 Ga0068856_100077188 3300005614 Bacteria 3300
306 Ga0068856_100090898 3300005614 Bacteria 3037
307 Ga0068856_100099313 3300005614 Bacteria 2902
308 Ga0068856_100274254 3300005614 Bacteria 1703
309 Ga0068856_100317759 3300005614 Bacteria 1575
310 Ga0068856_100432976 3300005614 Bacteria 1335
311 Ga0068856_100535736 3300005614 Bacteria 1192
312 Ga0068852_100000585 3300005616 Bacteria 24010
313 Ga0068852_100002847 3300005616 Bacteria 11997
314 Ga0068852_100003152 3300005616 Bacteria 11500
315 Ga0068852_100004872 3300005616 Bacteria 9532
316 Ga0068852_100022981 3300005616 Bacteria 5010
317 Ga0068852_100029135 3300005616 Bacteria 4530
318 Ga0068852_100030523 3300005616 Bacteria 4438
319 Ga0068852_100062026 3300005616 Bacteria 3250
320 Ga0068852_100099856 3300005616 Bacteria 2617
321 Ga0068852_100159516 3300005616 Bacteria 2105
322 Ga0068852_100351348 3300005616 Bacteria 1440
323 Ga0068859_100000843 3300005617 Bacteria 31176
324 Ga0068859_100002246 3300005617 Bacteria 19594
325 Ga0068859_100010758 3300005617 Bacteria 9211
326 Ga0068859_100027052 3300005617 Bacteria 5753
327 Ga0068859_100035841 3300005617 Bacteria 4979
328 Ga0068859_100045999 3300005617 Bacteria 4384
329 Ga0068864_100001488 3300005618 Bacteria 19304
330 Ga0068864_100002545 3300005618 Bacteria 15051
331 Ga0068864_100009367 3300005618 Bacteria 8079
332 Ga0068864_100011444 3300005618 Bacteria 7329
333 Ga0068864_100035565 3300005618 Bacteria 4240
334 Ga0068864_100274950 3300005618 Bacteria 1570
335 Ga0068864_100320388 3300005618 Bacteria 1456
336 Ga0068866_10018377 3300005718 Bacteria 3161
337 Ga0068866_10045342 3300005718 Bacteria 2205
338 Ga0068861_100254167 3300005719 Bacteria 1501
339 Ga0068861_100353555 3300005719 Bacteria 1290
340 Ga0068851_10105631 3300005834 Bacteria 1499
341 Ga0068870_10108305 3300005840 Bacteria 1582
342 Ga0068863_100002392 3300005841 Bacteria 18652
343 Ga0068863_100002503 3300005841 Bacteria 18268
344 Ga0068863_100010147 3300005841 Bacteria 9160
345 Ga0068863_100011390 3300005841 Bacteria 8607
346 Ga0068863_100014403 3300005841 Bacteria 7616
347 Ga0068863_100041540 3300005841 Bacteria 4373
348 Ga0068863_100056578 3300005841 Bacteria 3713
349 Ga0068863_100060914 3300005841 Bacteria 3569
350 Ga0068863_100100722 3300005841 Bacteria 2746
351 Ga0068863_100106435 3300005841 Bacteria 2669
352 Ga0068863_100295134 3300005841 Bacteria 1572
353 Ga0068858_100000570 3300005842 Bacteria 38553
354 Ga0068858_100001408 3300005842 Bacteria 24701
355 Ga0068858_100002531 3300005842 Bacteria 18418
356 Ga0068858_100005297 3300005842 Bacteria 12648
357 Ga0068858_100007205 3300005842 Bacteria 10783
358 Ga0068858_100009318 3300005842 Bacteria 9374
359 Ga0068858_100047601 3300005842 Bacteria 3974
360 Ga0068858_100137802 3300005842 Bacteria 2290
361 Ga0068860_100005362 3300005843 Bacteria 13014
362 Ga0068860_100005556 3300005843 Bacteria 12752
363 Ga0068860_100007956 3300005843 Bacteria 10575
364 Ga0068860_100009212 3300005843 Bacteria 9813
365 Ga0068860_100010634 3300005843 Bacteria 9087
366 Ga0068860_100070773 3300005843 Bacteria 3316
367 Ga0068860_100183540 3300005843 Bacteria 2022
368 Ga0068860_100211413 3300005843 Bacteria 1882
369 Ga0068860_100280774 3300005843 Bacteria 1627
370 Ga0068862_100012763 3300005844 Bacteria 6952
371 Ga0068862_100020145 3300005844 Bacteria 5571
372 Ga0068862_100030579 3300005844 Bacteria 4539
373 Ga0068862_100050029 3300005844 Bacteria 3570
374 Ga0068862_100074078 3300005844 Bacteria 2943
375 Ga0068862_100237120 3300005844 Bacteria 1657
376 Ga0068862_100303677 3300005844 Bacteria 1469
377 Ga0068862_100724067 3300005844 Bacteria 966
378 Ga0081455_10012753 3300005937 Bacteria 8358
379 Ga0081539_10000004 3300005985 Bacteria 555600
380 Ga0081539_10032795 3300005985 Bacteria 3174
381 Ga0070717_10010469 3300006028 Bacteria 7005
382 Ga0070715_10000333 3300006163 Bacteria 11737
383 Ga0070716_100049583 3300006173 Bacteria 2379
384 Ga0070712_100002678 3300006175 Bacteria 10991
385 Ga0070712_100061466 3300006175 Bacteria 2654
386 Ga0097621_100070361 3300006237 Bacteria 2889
387 Ga0097621_100086556 3300006237 Bacteria 2616
388 Ga0097621_100168213 3300006237 Bacteria 1888
389 Ga0075370_10003471 3300006353 Bacteria 7511
390 Ga0068871_100008181 3300006358 Bacteria 7512
391 Ga0068871_100085791 3300006358 Bacteria 2615
392 Ga0068871_100295792 3300006358 Bacteria 1420
393 Ga0075428_100026953 3300006844 Bacteria 6365
394 Ga0075430_100015171 3300006846 Bacteria 6559
395 Ga0075431_100292314 3300006847 Bacteria 1648
396 Ga0075429_100337994 3300006880 Bacteria 1318
397 Ga0068865_100003326 3300006881 Bacteria 9632
398 Ga0068865_100005880 3300006881 Bacteria 7464
399 Ga0068865_100028409 3300006881 Bacteria 3702
400 Ga0068865_100058849 3300006881 Bacteria 2686
401 Ga0068865_100191203 3300006881 Bacteria 1583
402 Ga0068865_100308215 3300006881 Bacteria 1269
403 Ga0075436_100292776 3300006914 Bacteria 1166
404 Ga0097620_100000843 3300006931 Bacteria 31176
405 Ga0097620_100002246 3300006931 Bacteria 19594
406 Ga0097620_100010758 3300006931 Bacteria 9211
407 Ga0097620_100027052 3300006931 Bacteria 5753
408 Ga0097620_100035839 3300006931 Bacteria 4979
409 Ga0097620_100045999 3300006931 Bacteria 4384
410 Ga0105251_10017252 3300009011 Bacteria 3876
411 Ga0105251_10093187 3300009011 Bacteria 1382
412 Ga0105240_10004389 3300009093 Bacteria 21534
413 Ga0105240_10007571 3300009093 Bacteria 15734
414 Ga0105240_10010627 3300009093 Bacteria 12932
415 Ga0105240_10011630 3300009093 Bacteria 12242
416 Ga0105240_10030693 3300009093 Bacteria 6981
417 Ga0105240_10041145 3300009093 Bacteria 5902
418 Ga0105240_10094481 3300009093 Bacteria 3647
419 Ga0105240_10164573 3300009093 Bacteria 2632
420 Ga0105240_10205832 3300009093 Bacteria 2303
421 Ga0105240_10305369 3300009093 Bacteria 1819
422 Ga0105240_10620106 3300009093 Bacteria 1189
423 Ga0111539_10024945 3300009094 Bacteria 7329
424 Ga0111539_10405206 3300009094 Bacteria 1588
425 Ga0105245_10000240 3300009098 Bacteria 52165
426 Ga0105245_10001159 3300009098 Bacteria 23843
427 Ga0105245_10084045 3300009098 Bacteria 2915
428 Ga0105245_10138345 3300009098 Bacteria 2291
429 Ga0105245_10272335 3300009098 Bacteria 1652
430 Ga0105247_10000212 3300009101 Bacteria 56393
431 Ga0105247_10005134 3300009101 Bacteria 8289
432 Ga0105247_10030833 3300009101 Bacteria 3252
433 Ga0105247_10089192 3300009101 Bacteria 1955
434 Ga0105247_10111271 3300009101 Bacteria 1763
435 Ga0105243_10015375 3300009148 Bacteria 5788
436 Ga0105243_10147537 3300009148 Bacteria 2014
437 Ga0105243_10228121 3300009148 Bacteria 1650
438 Ga0105241_10008322 3300009174 Bacteria 7636
439 Ga0105241_10217923 3300009174 Bacteria 1602
440 Ga0105242_10004796 3300009176 Bacteria 10464
441 Ga0105242_10041050 3300009176 Bacteria 3730
442 Ga0105242_10185446 3300009176 Bacteria 1838
443 Ga0105248_10000673 3300009177 Bacteria 38736
444 Ga0105248_10002105 3300009177 Bacteria 22055
445 Ga0105248_10002346 3300009177 Bacteria 21004
446 Ga0105248_10003667 3300009177 Bacteria 17023
447 Ga0105248_10019138 3300009177 Bacteria 7574
448 Ga0105248_10019438 3300009177 Bacteria 7517
449 Ga0105248_10024349 3300009177 Bacteria 6732
450 Ga0105248_10031964 3300009177 Bacteria 5881
451 Ga0105248_10098505 3300009177 Bacteria 3294
452 Ga0105248_10099756 3300009177 Bacteria 3272
453 Ga0105248_10127653 3300009177 Bacteria 2869
454 Ga0105248_10158553 3300009177 Bacteria 2553
455 Ga0105248_10163473 3300009177 Bacteria 2510
456 Ga0105248_10378153 3300009177 Bacteria 1594
457 Ga0105237_10007858 3300009545 Bacteria 11627
458 Ga0105237_10008093 3300009545 Bacteria 11424
459 Ga0105237_10071865 3300009545 Bacteria 3454
460 Ga0105237_10083461 3300009545 Bacteria 3186
461 Ga0105237_10376471 3300009545 Bacteria 1424
462 Ga0105238_10012026 3300009551 Bacteria 8719
463 Ga0105238_10017564 3300009551 Bacteria 7275
464 Ga0105238_10053323 3300009551 Bacteria 4064
465 Ga0105238_10097943 3300009551 Bacteria 2918
466 Ga0105238_10189751 3300009551 Bacteria 2031
467 Ga0105238_10319021 3300009551 Bacteria 1539
468 Ga0105238_10328257 3300009551 Bacteria 1516
469 Ga0105238_10530489 3300009551 Bacteria 1180
470 Ga0105249_10000523 3300009553 Bacteria 35379
471 Ga0105249_10008358 3300009553 Bacteria 9016
472 Ga0105249_10019924 3300009553 Bacteria 5989
473 Ga0105249_10312784 3300009553 Bacteria 1580
474 Ga0105249_10323927 3300009553 Bacteria 1553
475 Ga0105239_10019470 3300010375 Bacteria 7493
476 Ga0105239_10041008 3300010375 Bacteria 5073
477 Ga0105239_10061514 3300010375 Bacteria 4121
478 Ga0105239_10150182 3300010375 Bacteria 2600
479 Ga0105239_10218556 3300010375 Bacteria 2137
480 Ga0105239_10850817 3300010375 Bacteria 1046
481 Ga0105246_10019993 3300011119 Bacteria 4291
482 Ga0105246_10237891 3300011119 Bacteria 1438
483 Ga0157373_10007346 3300013100 Bacteria 8201
484 Ga0157373_10007738 3300013100 Bacteria 7988
485 Ga0157373_10016856 3300013100 Bacteria 5327
486 Ga0157373_10023265 3300013100 Bacteria 4493
487 Ga0157373_10056665 3300013100 Bacteria 2782
488 Ga0157373_10078186 3300013100 Bacteria 2333
489 Ga0157373_10109174 3300013100 Bacteria 1945
490 Ga0157373_10121335 3300013100 Bacteria 1837
491 Ga0157373_10134864 3300013100 Bacteria 1736
492 Ga0157371_10001435 3300013102 Bacteria 24751
493 Ga0157371_10003052 3300013102 Bacteria 15543
494 Ga0157371_10003899 3300013102 Bacteria 13286
495 Ga0157371_10023919 3300013102 Bacteria 4464
496 Ga0157371_10053508 3300013102 Bacteria 2866
497 Ga0157371_10098960 3300013102 Bacteria 2068
498 Ga0157371_10142618 3300013102 Bacteria 1706
499 Ga0157371_10157594 3300013102 Bacteria 1621
500 Ga0157371_10199726 3300013102 Bacteria 1433
501 Ga0157371_10285173 3300013102 Bacteria 1193
502 Ga0157370_10012562 3300013104 Bacteria 8779
503 Ga0157370_10035399 3300013104 Bacteria 4853
504 Ga0157370_10035936 3300013104 Bacteria 4811
505 Ga0157370_10083008 3300013104 Bacteria 3013
506 Ga0157370_10132585 3300013104 Bacteria 2324
507 Ga0157370_10246868 3300013104 Bacteria 1651
508 Ga0157369_10001579 3300013105 Bacteria 27879
509 Ga0157369_10004172 3300013105 Bacteria 17121
510 Ga0157369_10006524 3300013105 Bacteria 13518
511 Ga0157369_10008300 3300013105 Bacteria 11906
512 Ga0157369_10025769 3300013105 Bacteria 6523
513 Ga0157369_10029001 3300013105 Bacteria 6119
514 Ga0157369_10062380 3300013105 Bacteria 4017
515 Ga0157369_10200913 3300013105 Bacteria 2092
516 Ga0157369_10341158 3300013105 Bacteria 1556
517 Ga0157369_10344203 3300013105 Bacteria 1549
518 Ga0157369_10438797 3300013105 Bacteria 1353
519 Ga0157369_10472533 3300013105 Bacteria 1298
520 Ga0157369_10529259 3300013105 Bacteria 1219
521 Ga0157374_10000882 3300013296 Bacteria 26194
522 Ga0157374_10002261 3300013296 Bacteria 16219
523 Ga0157374_10009049 3300013296 Bacteria 8532
524 Ga0157374_10090064 3300013296 Bacteria 2924
525 Ga0157374_10109979 3300013296 Bacteria 2650
526 Ga0157374_10231593 3300013296 Bacteria 1815
527 Ga0157378_10000625 3300013297 Bacteria 33285
528 Ga0157378_10003623 3300013297 Bacteria 13668
529 Ga0157378_10020195 3300013297 Bacteria 5859
530 Ga0163162_10002440 3300013306 Bacteria 17525
531 Ga0163162_10085584 3300013306 Bacteria 3230
532 Ga0163162_10097768 3300013306 Bacteria 3024
533 Ga0163162_10257091 3300013306 Bacteria 1878
534 Ga0157372_10004346 3300013307 Bacteria 15135
535 Ga0157372_10024533 3300013307 Bacteria 6553
536 Ga0157372_10034601 3300013307 Bacteria 5555
537 Ga0157372_10040762 3300013307 Bacteria 5131
538 Ga0157372_10062828 3300013307 Bacteria 4162
539 Ga0157372_10382227 3300013307 Bacteria 1640
540 Ga0157372_10414170 3300013307 Bacteria 1570
541 Ga0157372_10700861 3300013307 Bacteria 1178
542 Ga0157375_10038790 3300013308 Bacteria 4577
543 Ga0157375_10063978 3300013308 Bacteria 3662
544 Ga0157375_10136739 3300013308 Bacteria 2575
545 Ga0157375_10435314 3300013308 Bacteria 1477
546 Ga0163163_10002408 3300014325 Bacteria 15819
547 Ga0163163_10004034 3300014325 Bacteria 12528
548 Ga0163163_10022952 3300014325 Bacteria 5917
549 Ga0163163_10038472 3300014325 Bacteria 4663
550 Ga0163163_10562117 3300014325 Bacteria 1203
551 Ga0157380_10001526 3300014326 Bacteria 15211
552 Ga0157380_10002231 3300014326 Bacteria 13033
553 Ga0157380_10062065 3300014326 Bacteria 2993
554 Ga0157380_10127797 3300014326 Bacteria 2163
555 Ga0157380_10270229 3300014326 Bacteria 1549
556 Ga0157380_10291720 3300014326 Bacteria 1498
557 Ga0182008_10173956 3300014497 Bacteria 1088
558 Ga0157377_10049358 3300014745 Bacteria 2365
559 Ga0157377_10070643 3300014745 Bacteria 2017
560 Ga0157379_10001277 3300014968 Bacteria 20464
561 Ga0157379_10003741 3300014968 Bacteria 12937
562 Ga0157379_10010195 3300014968 Bacteria 8189
563 Ga0157379_10046470 3300014968 Bacteria 3872
564 Ga0157379_10105763 3300014968 Bacteria 2526
565 Ga0157379_10169928 3300014968 Bacteria 1968
566 Ga0157376_10006910 3300014969 Bacteria 8041
567 Ga0157376_10103869 3300014969 Bacteria 2489
568 Ga0157376_10245106 3300014969 Bacteria 1671
569 Ga0157376_10748131 3300014969 Bacteria 986
570 Ga0206356_10519558 3300020070 Bacteria 2348
571 Ga0206349_1981439 3300020075 Bacteria 1130
572 Ga0206350_11177039 3300020080 Bacteria 970
573 Ga0206354_10918587 3300020081 Bacteria 1065
574 Ga0206353_11473440 3300020082 Bacteria 1076
575 Ga0206353_12012814 3300020082 Bacteria 13237
576 Ga0206353_12019217 3300020082 Bacteria 1934
577 Ga0213873_10000012 3300021358 Bacteria 210531
578 Ga0213874_10002669 3300021377 Bacteria 3870
579 Ga0213876_10000021 3300021384 Bacteria 260105
580 Ga0213876_10020022 3300021384 Bacteria 3534
581 Ga0213876_10073919 3300021384 Bacteria 1800
582 Ga0213875_10006414 3300021388 Bacteria 6180
583 Ga0224712_10039436 3300022467 Bacteria 1771
584 Ga0224712_10064149 3300022467 Bacteria 1473
585 Ga0224712_10151519 3300022467 Bacteria 1028
586 Ga0207425_1000146 3300025245 Bacteria 60712
587 Ga0209129_1000912 3300025258 Bacteria 18080
588 Ga0209676_1041693 3300025292 Bacteria 1280
589 Ga0209025_1000431 3300025294 Bacteria 82934
590 Ga0209758_1000002 3300025297 Bacteria 1400310
591 Ga0209050_1000005 3300025298 Bacteria 1557793
592 Ga0209050_1005562 3300025298 Bacteria 7845
593 Ga0209051_1000212 3300025303 Bacteria 100189
594 Ga0209051_1003223 3300025303 Bacteria 10876
595 Ga0209257_1000032 3300025304 Bacteria 680354
596 Ga0209257_1000753 3300025304 Bacteria 48917
597 Ga0209257_1000925 3300025304 Bacteria 40806
598 Ga0209257_1017966 3300025304 Bacteria 2750
599 Ga0207697_10001286 3300025315 Bacteria 13774
600 Ga0207656_10159501 3300025321 Bacteria 1073
601 Ga0207696_1008898 3300025711 Bacteria 3787
602 Ga0207682_10039097 3300025893 Bacteria 1927
603 Ga0207692_10203076 3300025898 Bacteria 1166
604 Ga0207642_10011765 3300025899 Bacteria 3135
605 Ga0207710_10000254 3300025900 Bacteria 44382
606 Ga0207710_10013274 3300025900 Bacteria 3470
607 Ga0207710_10036857 3300025900 Bacteria 2158
608 Ga0207710_10046773 3300025900 Bacteria 1932
609 Ga0207688_10021021 3300025901 Bacteria 3564
610 Ga0207680_10000492 3300025903 Bacteria 18747
611 Ga0207680_10016620 3300025903 Bacteria 3868
612 Ga0207680_10227591 3300025903 Bacteria 1281
613 Ga0207680_10419231 3300025903 Bacteria 948
614 Ga0207647_10000193 3300025904 Bacteria 49635
615 Ga0207647_10001994 3300025904 Bacteria 15616
616 Ga0207647_10026542 3300025904 Bacteria 3788
617 Ga0207647_10040434 3300025904 Bacteria 2936
618 Ga0207685_10002698 3300025905 Bacteria 4129
619 Ga0207699_10012746 3300025906 Bacteria 4281
620 Ga0207699_10033651 3300025906 Bacteria 2899
621 Ga0207699_10085258 3300025906 Bacteria 1969
622 Ga0207645_10006989 3300025907 Bacteria 8035
623 Ga0207645_10013084 3300025907 Bacteria 5605
624 Ga0207645_10015452 3300025907 Bacteria 5069
625 Ga0207645_10028032 3300025907 Bacteria 3636
626 Ga0207645_10032729 3300025907 Bacteria 3342
627 Ga0207645_10036097 3300025907 Bacteria 3174
628 Ga0207645_10113522 3300025907 Bacteria 1755
629 Ga0207645_10154660 3300025907 Bacteria 1498
630 Ga0207645_10183823 3300025907 Bacteria 1372
631 Ga0207643_10127142 3300025908 Bacteria 1514
632 Ga0207705_10000002 3300025909 Bacteria 2046852
633 Ga0207705_10000003 3300025909 Bacteria 709270
634 Ga0207705_10000050 3300025909 Bacteria 170078
635 Ga0207705_10002221 3300025909 Bacteria 14985
636 Ga0207705_10014667 3300025909 Bacteria 5638
637 Ga0207705_10022419 3300025909 Bacteria 4502
638 Ga0207705_10025445 3300025909 Bacteria 4225
639 Ga0207705_10037294 3300025909 Bacteria 3478
640 Ga0207705_10038884 3300025909 Bacteria 3408
641 Ga0207705_10050981 3300025909 Bacteria 2979
642 Ga0207705_10077699 3300025909 Bacteria 2415
643 Ga0207705_10086332 3300025909 Bacteria 2293
644 Ga0207705_10089206 3300025909 Bacteria 2256
645 Ga0207705_10154441 3300025909 Bacteria 1721
646 Ga0207705_10170351 3300025909 Bacteria 1639
647 Ga0207705_10175201 3300025909 Bacteria 1616
648 Ga0207705_10226788 3300025909 Bacteria 1420
649 Ga0207654_10081542 3300025911 Bacteria 1948
650 Ga0207654_10091565 3300025911 Bacteria 1855
651 Ga0207654_10222999 3300025911 Bacteria 1251
652 Ga0207707_10004072 3300025912 Bacteria 12941
653 Ga0207707_10006250 3300025912 Bacteria 10400
654 Ga0207707_10008989 3300025912 Bacteria 8677
655 Ga0207707_10010843 3300025912 Bacteria 7920
656 Ga0207707_10035205 3300025912 Bacteria 4379
657 Ga0207707_10060555 3300025912 Bacteria 3293
658 Ga0207695_10005303 3300025913 Bacteria 17175
659 Ga0207695_10005548 3300025913 Bacteria 16679
660 Ga0207695_10009383 3300025913 Bacteria 12102
661 Ga0207695_10014202 3300025913 Bacteria 9448
662 Ga0207695_10017612 3300025913 Bacteria 8303
663 Ga0207695_10024691 3300025913 Bacteria 6752
664 Ga0207695_10029814 3300025913 Bacteria 6019
665 Ga0207695_10031334 3300025913 Bacteria 5834
666 Ga0207695_10039007 3300025913 Bacteria 5108
667 Ga0207695_10059200 3300025913 Bacteria 3973
668 Ga0207695_10066576 3300025913 Bacteria 3699
669 Ga0207695_10079345 3300025913 Bacteria 3327
670 Ga0207695_10085135 3300025913 Bacteria 3190
671 Ga0207695_10097645 3300025913 Bacteria 2938
672 Ga0207695_10654044 3300025913 Bacteria 932
673 Ga0207671_10005586 3300025914 Bacteria 11550
674 Ga0207671_10013981 3300025914 Bacteria 6368
675 Ga0207671_10018037 3300025914 Bacteria 5427
676 Ga0207671_10086024 3300025914 Bacteria 2363
677 Ga0207671_10106160 3300025914 Bacteria 2132
678 Ga0207693_10000462 3300025915 Bacteria 37190
679 Ga0207693_10031567 3300025915 Bacteria 4186
680 Ga0207693_10147756 3300025915 Bacteria 1848
681 Ga0207663_10007125 3300025916 Bacteria 5778
682 Ga0207663_10090318 3300025916 Bacteria 2031
683 Ga0207663_10157284 3300025916 Bacteria 1600
684 Ga0207660_10000186 3300025917 Bacteria 39363
685 Ga0207660_10004190 3300025917 Bacteria 9382
686 Ga0207660_10008150 3300025917 Bacteria 6778
687 Ga0207660_10030111 3300025917 Bacteria 3729
688 Ga0207660_10042085 3300025917 Bacteria 3205
689 Ga0207660_10047185 3300025917 Bacteria 3043
690 Ga0207660_10052362 3300025917 Bacteria 2906
691 Ga0207660_10070663 3300025917 Bacteria 2538
692 Ga0207660_10183425 3300025917 Bacteria 1626
693 Ga0207662_10145770 3300025918 Bacteria 1503
694 Ga0207657_10000121 3300025919 Bacteria 78211
695 Ga0207657_10001248 3300025919 Bacteria 27180
696 Ga0207657_10003049 3300025919 Bacteria 17918
697 Ga0207657_10005568 3300025919 Bacteria 13152
698 Ga0207657_10005714 3300025919 Bacteria 12980
699 Ga0207657_10008500 3300025919 Bacteria 10413
700 Ga0207657_10011471 3300025919 Bacteria 8797
701 Ga0207657_10012677 3300025919 Bacteria 8308
702 Ga0207657_10021169 3300025919 Bacteria 6126
703 Ga0207657_10049190 3300025919 Bacteria 3676
704 Ga0207657_10050297 3300025919 Bacteria 3627
705 Ga0207657_10079533 3300025919 Bacteria 2758
706 Ga0207657_10090824 3300025919 Bacteria 2548
707 Ga0207657_10093945 3300025919 Bacteria 2498
708 Ga0207649_10000190 3300025920 Bacteria 50479
709 Ga0207649_10001220 3300025920 Bacteria 15471
710 Ga0207649_10008345 3300025920 Bacteria 5644
711 Ga0207649_10057649 3300025920 Bacteria 2429
712 Ga0207649_10287111 3300025920 Bacteria 1198
713 Ga0207652_10000003 3300025921 Bacteria 502441
714 Ga0207652_10001982 3300025921 Bacteria 17714
715 Ga0207652_10017644 3300025921 Bacteria 5842
716 Ga0207652_10072927 3300025921 Bacteria 2986
717 Ga0207652_10127656 3300025921 Bacteria 2266
718 Ga0207652_10129200 3300025921 Bacteria 2253
719 Ga0207652_10162062 3300025921 Bacteria 2005
720 Ga0207652_10219188 3300025921 Bacteria 1714
721 Ga0207652_10236421 3300025921 Bacteria 1647
722 Ga0207652_10597913 3300025921 Bacteria 989
723 Ga0207681_10004853 3300025923 Bacteria 8262
724 Ga0207681_10041120 3300025923 Bacteria 3080
725 Ga0207681_10075308 3300025923 Bacteria 2367
726 Ga0207681_10207143 3300025923 Bacteria 1509
727 Ga0207694_10000667 3300025924 Bacteria 30806
728 Ga0207694_10007119 3300025924 Bacteria 8500
729 Ga0207694_10067018 3300025924 Bacteria 2802
730 Ga0207694_10101162 3300025924 Bacteria 2284
731 Ga0207694_10153334 3300025924 Bacteria 1857
732 Ga0207694_10164129 3300025924 Bacteria 1795
733 Ga0207694_10203768 3300025924 Bacteria 1610
734 Ga0207694_10277535 3300025924 Bacteria 1376
735 Ga0207694_10337081 3300025924 Bacteria 1247
736 Ga0207650_10009214 3300025925 Bacteria 6746
737 Ga0207650_10019746 3300025925 Bacteria 4739
738 Ga0207650_10034633 3300025925 Bacteria 3663
739 Ga0207650_10069191 3300025925 Bacteria 2652
740 Ga0207650_10107015 3300025925 Bacteria 2160
741 Ga0207650_10175655 3300025925 Bacteria 1705
742 Ga0207650_10491802 3300025925 Bacteria 1024
743 Ga0207659_10092065 3300025926 Bacteria 2266
744 Ga0207659_10281127 3300025926 Bacteria 1361
745 Ga0207687_10006042 3300025927 Bacteria 8010
746 Ga0207687_10032648 3300025927 Bacteria 3527
747 Ga0207687_10150257 3300025927 Bacteria 1776
748 Ga0207700_10005097 3300025928 Bacteria 7808
749 Ga0207700_10034763 3300025928 Bacteria 3622
750 Ga0207700_10072261 3300025928 Bacteria 2659
751 Ga0207700_10076030 3300025928 Bacteria 2604
752 Ga0207664_10007710 3300025929 Bacteria 7471
753 Ga0207664_10063990 3300025929 Bacteria 2940
754 Ga0207664_10283922 3300025929 Bacteria 1453
755 Ga0207644_10000181 3300025931 Bacteria 45051
756 Ga0207644_10001877 3300025931 Bacteria 13683
757 Ga0207644_10007510 3300025931 Bacteria 7108
758 Ga0207644_10015423 3300025931 Bacteria 5128
759 Ga0207644_10076628 3300025931 Bacteria 2460
760 Ga0207644_10079575 3300025931 Bacteria 2418
761 Ga0207644_10136374 3300025931 Bacteria 1885
762 Ga0207644_10193996 3300025931 Bacteria 1598
763 Ga0207644_10420002 3300025931 Bacteria 1095
764 Ga0207690_10000922 3300025932 Bacteria 18771
765 Ga0207690_10012495 3300025932 Bacteria 5080
766 Ga0207690_10030611 3300025932 Bacteria 3435
767 Ga0207690_10031182 3300025932 Bacteria 3409
768 Ga0207690_10068871 3300025932 Bacteria 2433
769 Ga0207690_10124238 3300025932 Bacteria 1879
770 Ga0207690_10126432 3300025932 Bacteria 1865
771 Ga0207690_10229540 3300025932 Bacteria 1424
772 Ga0207706_10000320 3300025933 Bacteria 52005
773 Ga0207706_10002152 3300025933 Bacteria 19256
774 Ga0207706_10005703 3300025933 Bacteria 11601
775 Ga0207706_10006809 3300025933 Bacteria 10568
776 Ga0207706_10016150 3300025933 Bacteria 6744
777 Ga0207706_10033282 3300025933 Bacteria 4589
778 Ga0207706_10469011 3300025933 Bacteria 1088
779 Ga0207706_10492574 3300025933 Bacteria 1058
780 Ga0207686_10032876 3300025934 Bacteria 3091
781 Ga0207709_10072557 3300025935 Bacteria 2190
782 Ga0207670_10253487 3300025936 Bacteria 1361
783 Ga0207669_10005254 3300025937 Bacteria 5789
784 Ga0207669_10017120 3300025937 Bacteria 3708
785 Ga0207669_10017596 3300025937 Bacteria 3672
786 Ga0207669_10040698 3300025937 Bacteria 2698
787 Ga0207669_10044761 3300025937 Bacteria 2603
788 Ga0207704_10009452 3300025938 Bacteria 4705
789 Ga0207704_10023727 3300025938 Bacteria 3311
790 Ga0207704_10568257 3300025938 Bacteria 924
791 Ga0207665_10003728 3300025939 Bacteria 10183
792 Ga0207665_10088617 3300025939 Bacteria 2141
793 Ga0207691_10000085 3300025940 Bacteria 79681
794 Ga0207691_10005557 3300025940 Bacteria 12179
795 Ga0207691_10014238 3300025940 Bacteria 7588
796 Ga0207691_10028769 3300025940 Bacteria 5201
797 Ga0207691_10042288 3300025940 Bacteria 4201
798 Ga0207691_10055496 3300025940 Bacteria 3610
799 Ga0207711_10000044 3300025941 Bacteria 157113
800 Ga0207711_10001646 3300025941 Bacteria 20609
801 Ga0207711_10003531 3300025941 Bacteria 13537
802 Ga0207711_10013510 3300025941 Bacteria 6779
803 Ga0207711_10016809 3300025941 Bacteria 6076
804 Ga0207711_10018189 3300025941 Bacteria 5842
805 Ga0207711_10067752 3300025941 Bacteria 3090
806 Ga0207711_10126210 3300025941 Bacteria 2289
807 Ga0207711_10204104 3300025941 Bacteria 1804
808 Ga0207689_10000016 3300025942 Bacteria 118140
809 Ga0207689_10206683 3300025942 Bacteria 1622
810 Ga0207661_10241640 3300025944 Bacteria 1602
811 Ga0207661_10271472 3300025944 Bacteria 1513
812 Ga0207661_10292219 3300025944 Bacteria 1459
813 Ga0207661_10632087 3300025944 Bacteria 983
814 Ga0207679_10007667 3300025945 Bacteria 6857
815 Ga0207679_10010617 3300025945 Bacteria 5934
816 Ga0207679_10036640 3300025945 Bacteria 3480
817 Ga0207679_10043131 3300025945 Bacteria 3246
818 Ga0207679_10046835 3300025945 Bacteria 3137
819 Ga0207679_10055968 3300025945 Bacteria 2910
820 Ga0207679_10068889 3300025945 Bacteria 2660
821 Ga0207679_10069531 3300025945 Bacteria 2650
822 Ga0207679_10123116 3300025945 Bacteria 2068
823 Ga0207679_10346695 3300025945 Bacteria 1293
824 Ga0207679_10399253 3300025945 Bacteria 1209
825 Ga0207667_10000859 3300025949 Bacteria 39082
826 Ga0207667_10001013 3300025949 Bacteria 35783
827 Ga0207667_10002514 3300025949 Bacteria 22864
828 Ga0207667_10009692 3300025949 Bacteria 11328
829 Ga0207667_10019156 3300025949 Bacteria 7653
830 Ga0207667_10031313 3300025949 Bacteria 5742
831 Ga0207667_10047606 3300025949 Bacteria 4538
832 Ga0207667_10059750 3300025949 Bacteria 3991
833 Ga0207667_10061643 3300025949 Bacteria 3923
834 Ga0207667_10067595 3300025949 Bacteria 3722
835 Ga0207667_10204972 3300025949 Bacteria 2022
836 Ga0207651_10008254 3300025960 Bacteria 5613
837 Ga0207651_10011713 3300025960 Bacteria 4921
838 Ga0207651_10022903 3300025960 Bacteria 3831
839 Ga0207651_10033107 3300025960 Bacteria 3329
840 Ga0207651_10098449 3300025960 Bacteria 2163
841 Ga0207651_10108710 3300025960 Bacteria 2076
842 Ga0207651_10128440 3300025960 Bacteria 1936
843 Ga0207651_10129071 3300025960 Bacteria 1932
844 Ga0207651_10131109 3300025960 Bacteria 1919
845 Ga0207712_10000437 3300025961 Bacteria 35483
846 Ga0207712_10019374 3300025961 Bacteria 4442
847 Ga0207712_10026842 3300025961 Bacteria 3841
848 Ga0207712_10087146 3300025961 Bacteria 2289
849 Ga0207712_10134122 3300025961 Bacteria 1891
850 Ga0207668_10009261 3300025972 Bacteria 5893
851 Ga0207668_10254800 3300025972 Bacteria 1427
852 Ga0207640_10000851 3300025981 Bacteria 17314
853 Ga0207640_10007010 3300025981 Bacteria 6204
854 Ga0207640_10015163 3300025981 Bacteria 4455
855 Ga0207640_10059129 3300025981 Bacteria 2528
856 Ga0207640_10064025 3300025981 Bacteria 2446
857 Ga0207640_10085744 3300025981 Bacteria 2166
858 Ga0207640_10093371 3300025981 Bacteria 2090
859 Ga0207640_10162338 3300025981 Bacteria 1655
860 Ga0207658_10000936 3300025986 Bacteria 24076
861 Ga0207658_10002942 3300025986 Bacteria 12198
862 Ga0207658_10005057 3300025986 Bacteria 9074
863 Ga0207658_10006132 3300025986 Bacteria 8205
864 Ga0207658_10011779 3300025986 Bacteria 5957
865 Ga0207658_10085660 3300025986 Bacteria 2427
866 Ga0207658_10091455 3300025986 Bacteria 2361
867 Ga0207658_10379621 3300025986 Bacteria 1237
868 Ga0207677_10003694 3300026023 Bacteria 8118
869 Ga0207677_10026050 3300026023 Bacteria 3661
870 Ga0207677_10094729 3300026023 Bacteria 2180
871 Ga0207677_10469250 3300026023 Bacteria 1082
872 Ga0207703_10000183 3300026035 Bacteria 73109
873 Ga0207703_10001302 3300026035 Bacteria 23082
874 Ga0207703_10003806 3300026035 Bacteria 12534
875 Ga0207703_10005275 3300026035 Bacteria 10418
876 Ga0207703_10007702 3300026035 Bacteria 8527
877 Ga0207703_10009541 3300026035 Bacteria 7617
878 Ga0207703_10214932 3300026035 Bacteria 1716
879 Ga0207703_10313617 3300026035 Bacteria 1434
880 Ga0207703_10321811 3300026035 Bacteria 1416
881 Ga0207703_10357478 3300026035 Bacteria 1346
882 Ga0207639_10000181 3300026041 Bacteria 49444
883 Ga0207639_10007288 3300026041 Bacteria 7534
884 Ga0207639_10034006 3300026041 Bacteria 3765
885 Ga0207639_10072027 3300026041 Bacteria 2705
886 Ga0207639_10314472 3300026041 Bacteria 1388
887 Ga0207639_10326436 3300026041 Bacteria 1364
888 Ga0207639_10615379 3300026041 Bacteria 1002
889 Ga0207678_10001321 3300026067 Bacteria 22898
890 Ga0207678_10002048 3300026067 Bacteria 18285
891 Ga0207678_10003177 3300026067 Bacteria 14856
892 Ga0207678_10006824 3300026067 Bacteria 10123
893 Ga0207678_10009022 3300026067 Bacteria 8779
894 Ga0207678_10011197 3300026067 Bacteria 7877
895 Ga0207678_10013529 3300026067 Bacteria 7165
896 Ga0207678_10019862 3300026067 Bacteria 5905
897 Ga0207678_10030836 3300026067 Bacteria 4682
898 Ga0207678_10088130 3300026067 Bacteria 2653
899 Ga0207702_10021703 3300026078 Bacteria 5316
900 Ga0207702_10049667 3300026078 Bacteria 3540
901 Ga0207702_10054024 3300026078 Bacteria 3402
902 Ga0207702_10113075 3300026078 Bacteria 2417
903 Ga0207702_10267956 3300026078 Bacteria 1610
904 Ga0207702_10548173 3300026078 Bacteria 1131
905 Ga0207641_10001338 3300026088 Bacteria 24391
906 Ga0207641_10001458 3300026088 Bacteria 23179
907 Ga0207641_10002484 3300026088 Bacteria 17013
908 Ga0207641_10008289 3300026088 Bacteria 8587
909 Ga0207641_10016012 3300026088 Bacteria 6139
910 Ga0207641_10056936 3300026088 Bacteria 3324
911 Ga0207641_10060015 3300026088 Bacteria 3241
912 Ga0207641_10079359 3300026088 Bacteria 2845
913 Ga0207641_10087245 3300026088 Bacteria 2722
914 Ga0207641_10389998 3300026088 Bacteria 1335
915 Ga0207648_10003603 3300026089 Bacteria 16196
916 Ga0207648_10007718 3300026089 Bacteria 10518
917 Ga0207648_10016176 3300026089 Bacteria 6827
918 Ga0207648_10044684 3300026089 Bacteria 3887
919 Ga0207648_10113725 3300026089 Bacteria 2377
920 Ga0207648_10165891 3300026089 Bacteria 1952
921 Ga0207676_10005209 3300026095 Bacteria 9201
922 Ga0207676_10049201 3300026095 Bacteria 3277
923 Ga0207676_10110374 3300026095 Bacteria 2300
924 Ga0207676_10128368 3300026095 Bacteria 2151
925 Ga0207676_10203987 3300026095 Bacteria 1749
926 Ga0207674_10000114 3300026116 Bacteria 93676
927 Ga0207674_10001036 3300026116 Bacteria 36260
928 Ga0207674_10001151 3300026116 Bacteria 34261
929 Ga0207674_10006687 3300026116 Bacteria 13544
930 Ga0207674_10014936 3300026116 Bacteria 8556
931 Ga0207674_10018868 3300026116 Bacteria 7481
932 Ga0207674_10144034 3300026116 Bacteria 2342
933 Ga0207674_10193615 3300026116 Bacteria 1983
934 Ga0207674_10381259 3300026116 Bacteria 1363
935 Ga0207675_100190179 3300026118 Bacteria 1969
936 Ga0207675_100205088 3300026118 Bacteria 1894
937 Ga0207675_100242861 3300026118 Bacteria 1741
938 Ga0207675_100306334 3300026118 Bacteria 1548
939 Ga0207683_10007850 3300026121 Bacteria 9131
940 Ga0207683_10007992 3300026121 Bacteria 9046
941 Ga0207683_10197588 3300026121 Bacteria 1827
942 Ga0207698_10000796 3300026142 Bacteria 18339
943 Ga0207698_10000887 3300026142 Bacteria 17369
944 Ga0207698_10002867 3300026142 Bacteria 10309
945 Ga0207698_10003119 3300026142 Bacteria 9933
946 Ga0207698_10003206 3300026142 Bacteria 9824
947 Ga0207698_10006634 3300026142 Bacteria 7238
948 Ga0207698_10010230 3300026142 Bacteria 6015
949 Ga0207698_10061767 3300026142 Bacteria 2922
950 Ga0207698_10194133 3300026142 Bacteria 1812
951 Ga0207698_10274367 3300026142 Bacteria 1556
952 Ga0207698_10317675 3300026142 Bacteria 1457
953 Ga0207698_10332579 3300026142 Bacteria 1427
954 Ga0207698_10363565 3300026142 Bacteria 1371
955 Ga0207698_10509720 3300026142 Bacteria 1172
956 Ga0209982_1012035 3300027552 Bacteria 1296
957 Ga0209974_10001961 3300027876 Bacteria 7514
958 Ga0207428_10033260 3300027907 Bacteria 4236
959 Ga0268266_10000834 3300028379 Bacteria 40263
960 Ga0268266_10007466 3300028379 Bacteria 9860
961 Ga0268266_10010282 3300028379 Bacteria 8191
962 Ga0268266_10013691 3300028379 Bacteria 6985
963 Ga0268266_10079389 3300028379 Bacteria 2857
964 Ga0268266_10080781 3300028379 Bacteria 2833
965 Ga0268266_10092782 3300028379 Bacteria 2649
966 Ga0268266_10098990 3300028379 Bacteria 2566
967 Ga0268266_10214787 3300028379 Bacteria 1765
968 Ga0268266_10250475 3300028379 Bacteria 1638
969 Ga0268266_10433352 3300028379 Bacteria 1247
970 Ga0268265_10002414 3300028380 Bacteria 14116
971 Ga0268265_10007856 3300028380 Bacteria 7197
972 Ga0268265_10009708 3300028380 Bacteria 6497
973 Ga0268265_10010713 3300028380 Bacteria 6190
974 Ga0268265_10071818 3300028380 Bacteria 2697
975 Ga0268265_10146124 3300028380 Bacteria 1987
976 Ga0268264_10000057 3300028381 Bacteria 309824
977 Ga0268264_10001982 3300028381 Bacteria 18419
978 Ga0268264_10006236 3300028381 Bacteria 10060
979 Ga0268264_10009364 3300028381 Bacteria 8106
980 Ga0268264_10110522 3300028381 Bacteria 2406
981 Ga0268264_10120880 3300028381 Bacteria 2308
982 Ga0268264_10236227 3300028381 Bacteria 1691
983 Ga0268264_10272591 3300028381 Bacteria 1581
984 Ga0265334_10076257 3300028573 Bacteria 1242
985 Ga0307515_10068006 3300028794 Bacteria 4903
986 Ga0307515_10098372 3300028794 Bacteria 3564
987 Ga0307511_10001123 3300030521 Bacteria 28507
988 Ga0265762_1019634 3300030760 Bacteria 1239
989 Ga0265340_10008897 3300031247 Bacteria 5411
990 Ga0265340_10028939 3300031247 Bacteria 2784
991 Ga0307513_10054594 3300031456 Bacteria 4282
992 Ga0307513_10085117 3300031456 Bacteria 3245
993 Ga0307509_10000013 3300031507 Bacteria 283027
994 Ga0307408_100020656 3300031548 Bacteria 4447
995 Ga0307408_100030450 3300031548 Bacteria 3748
996 Ga0307408_100100370 3300031548 Bacteria 2204
997 Ga0307408_100123141 3300031548 Bacteria 2012
998 Ga0307408_100249374 3300031548 Bacteria 1463
999 Ga0307508_10198678 3300031616 Bacteria 1606
1000 Ga0316576_10261048 3300031727 Bacteria 1299
1001 Ga0316578_10003227 3300031728 Bacteria 7400
1002 Ga0307516_10086048 3300031730 Bacteria 2980
1003 Ga0307405_10022992 3300031731 Bacteria 3534
1004 Ga0307405_10034261 3300031731 Bacteria 3020
1005 Ga0307405_10079712 3300031731 Bacteria 2135
1006 Ga0307405_10128402 3300031731 Bacteria 1747
1007 Ga0316577_10020096 3300031733 Bacteria 3700
1008 Ga0307413_10000739 3300031824 Bacteria 11290
1009 Ga0307413_10001898 3300031824 Bacteria 8267
1010 Ga0307413_10002115 3300031824 Bacteria 7964
1011 Ga0307413_10010806 3300031824 Bacteria 4451
1012 Ga0307413_10022007 3300031824 Bacteria 3426
1013 Ga0307413_10046641 3300031824 Bacteria 2578
1014 Ga0307413_10290569 3300031824 Bacteria 1234
1015 Ga0307413_10365662 3300031824 Bacteria 1118
1016 Ga0307410_10000171 3300031852 Bacteria 23683
1017 Ga0307410_10002848 3300031852 Bacteria 8505
1018 Ga0307410_10004835 3300031852 Bacteria 7038
1019 Ga0307410_10009406 3300031852 Bacteria 5481
1020 Ga0307410_10012882 3300031852 Bacteria 4855
1021 Ga0307410_10016770 3300031852 Bacteria 4379
1022 Ga0307410_10018471 3300031852 Bacteria 4214
1023 Ga0307410_10021886 3300031852 Bacteria 3941
1024 Ga0307410_10023442 3300031852 Bacteria 3836
1025 Ga0307410_10027779 3300031852 Bacteria 3579
1026 Ga0307410_10074094 3300031852 Bacteria 2369
1027 Ga0307410_10113753 3300031852 Bacteria 1962
1028 Ga0307410_10198571 3300031852 Bacteria 1530
1029 Ga0307410_10214472 3300031852 Bacteria 1477
1030 Ga0307406_10001149 3300031901 Bacteria 14799
1031 Ga0307406_10003488 3300031901 Bacteria 8558
1032 Ga0307406_10027008 3300031901 Bacteria 3453
1033 Ga0307406_10039950 3300031901 Bacteria 2914
1034 Ga0307406_10091701 3300031901 Bacteria 2047
1035 Ga0307406_10107328 3300031901 Bacteria 1914
1036 Ga0307406_10109031 3300031901 Bacteria 1902
1037 Ga0307406_10150396 3300031901 Bacteria 1660
1038 Ga0307406_10196705 3300031901 Bacteria 1480
1039 Ga0307406_10237779 3300031901 Bacteria 1364
1040 Ga0307406_10569416 3300031901 Bacteria 929
1041 Ga0307407_10001542 3300031903 Bacteria 8455
1042 Ga0307407_10001946 3300031903 Bacteria 7826
1043 Ga0307407_10002595 3300031903 Bacteria 7131
1044 Ga0307407_10007483 3300031903 Bacteria 4948
1045 Ga0307407_10015178 3300031903 Bacteria 3797
1046 Ga0307407_10026119 3300031903 Bacteria 3088
1047 Ga0307407_10080559 3300031903 Bacteria 1968
1048 Ga0307407_10340773 3300031903 Bacteria 1058
1049 Ga0307407_10344137 3300031903 Bacteria 1054
1050 Ga0307412_10007148 3300031911 Bacteria 6337
1051 Ga0307412_10011156 3300031911 Bacteria 5197
1052 Ga0307412_10011193 3300031911 Bacteria 5191
1053 Ga0307412_10040563 3300031911 Bacteria 3012
1054 Ga0307412_10098314 3300031911 Bacteria 2064
1055 Ga0307412_10139287 3300031911 Bacteria 1774
1056 Ga0307412_10173253 3300031911 Bacteria 1615
1057 Ga0307412_10332824 3300031911 Bacteria 1212
1058 Ga0307412_10476910 3300031911 Bacteria 1034
1059 Ga0307412_10488346 3300031911 Bacteria 1023
1060 Ga0307409_100001095 3300031995 Bacteria 12802
1061 Ga0307409_100004656 3300031995 Bacteria 7752
1062 Ga0307409_100008214 3300031995 Bacteria 6315
1063 Ga0307409_100009931 3300031995 Bacteria 5879
1064 Ga0307409_100022413 3300031995 Bacteria 4355
1065 Ga0307409_100042410 3300031995 Bacteria 3407
1066 Ga0307409_100049332 3300031995 Bacteria 3209
1067 Ga0307409_100075465 3300031995 Bacteria 2699
1068 Ga0307409_100075567 3300031995 Bacteria 2698
1069 Ga0307409_100081411 3300031995 Bacteria 2617
1070 Ga0307409_100105977 3300031995 Bacteria 2345
1071 Ga0307409_100143466 3300031995 Bacteria 2061
1072 Ga0307409_100193406 3300031995 Bacteria 1813
1073 Ga0307409_100252790 3300031995 Bacteria 1612
1074 Ga0307416_100002009 3300032002 Bacteria 11429
1075 Ga0307416_100004801 3300032002 Bacteria 8213
1076 Ga0307416_100006767 3300032002 Bacteria 7206
1077 Ga0307416_100027504 3300032002 Bacteria 4213
1078 Ga0307416_100049275 3300032002 Bacteria 3348
1079 Ga0307416_100066877 3300032002 Bacteria 2961
1080 Ga0307416_100120266 3300032002 Bacteria 2338
1081 Ga0307416_100220359 3300032002 Bacteria 1819
1082 Ga0307416_100253714 3300032002 Bacteria 1714
1083 Ga0307416_100441309 3300032002 Bacteria 1352
1084 Ga0307416_100754314 3300032002 Bacteria 1066
1085 Ga0307414_10016999 3300032004 Bacteria 4441
1086 Ga0307414_10022664 3300032004 Bacteria 3967
1087 Ga0307414_10049644 3300032004 Bacteria 2902
1088 Ga0307414_10057325 3300032004 Bacteria 2738
1089 Ga0307414_10058986 3300032004 Bacteria 2707
1090 Ga0307414_10064078 3300032004 Bacteria 2615
1091 Ga0307414_10065439 3300032004 Bacteria 2593
1092 Ga0307414_10071176 3300032004 Bacteria 2507
1093 Ga0307414_10074410 3300032004 Bacteria 2461
1094 Ga0307414_10080822 3300032004 Bacteria 2378
1095 Ga0307414_10082256 3300032004 Bacteria 2360
1096 Ga0307414_10102582 3300032004 Bacteria 2156
1097 Ga0307414_10128179 3300032004 Bacteria 1965
1098 Ga0307414_10128387 3300032004 Bacteria 1963
1099 Ga0307414_10132324 3300032004 Bacteria 1938
1100 Ga0307411_10000997 3300032005 Bacteria 10907
1101 Ga0307411_10001612 3300032005 Bacteria 9392
1102 Ga0307411_10001951 3300032005 Bacteria 8837
1103 Ga0307411_10007559 3300032005 Bacteria 5550
1104 Ga0307411_10008119 3300032005 Bacteria 5412
1105 Ga0307411_10011823 3300032005 Bacteria 4732
1106 Ga0307411_10017680 3300032005 Bacteria 4071
1107 Ga0307411_10050205 3300032005 Bacteria 2715
1108 Ga0307411_10054530 3300032005 Bacteria 2625
1109 Ga0307411_10057500 3300032005 Bacteria 2570
1110 Ga0307411_10060348 3300032005 Bacteria 2518
1111 Ga0307411_10064323 3300032005 Bacteria 2455
1112 Ga0307411_10079612 3300032005 Bacteria 2250
1113 Ga0307411_10080096 3300032005 Bacteria 2244
1114 Ga0307411_10089268 3300032005 Bacteria 2146
1115 Ga0307411_10152872 3300032005 Bacteria 1717
1116 Ga0307411_10156608 3300032005 Bacteria 1700
1117 Ga0307411_10203181 3300032005 Bacteria 1523
1118 Ga0307411_10217963 3300032005 Bacteria 1478
1119 Ga0307411_10344298 3300032005 Bacteria 1212
1120 Ga0307411_10399819 3300032005 Bacteria 1135
1121 Ga0307415_100005998 3300032126 Bacteria 6512
1122 Ga0307415_100011428 3300032126 Bacteria 5081
1123 Ga0307415_100011638 3300032126 Bacteria 5046
1124 Ga0307415_100035538 3300032126 Bacteria 3255
1125 Ga0307415_100061923 3300032126 Bacteria 2593
1126 Ga0307415_100093123 3300032126 Bacteria 2187
1127 Ga0307415_100097719 3300032126 Bacteria 2144
1128 Ga0307415_100159647 3300032126 Bacteria 1746
1129 Ga0307415_100230721 3300032126 Bacteria 1490
1130 Ga0307415_100351179 3300032126 Bacteria 1241
1131 Ga0307415_100513058 3300032126 Bacteria 1050
1132 Ga0307510_10000014 3300033180 Bacteria 271607
1133 Ga0307510_10009003 3300033180 Bacteria 11888
1134 Ga0373959_0029053 3300034820 Bacteria 1107
1135 Ga0373936_0000241 3300035113 Bacteria 18098
1136 Ga0373939_0000094 3300035114 Bacteria 27768
1137 Ga0373957_0137901 3300035120 Bacteria 996
1138 Ga0373957_0184698 3300035120 Bacteria 865
1139 Ga0373943_0005992 3300035170 Bacteria 5455
1140 Ga0373943_0164833 3300035170 Bacteria 1209
1141 Ga0373961_0066743 3300035241 Bacteria 1104
1142 Ga0373962_0012366 3300035242 Bacteria 2150
1143 Ga0316574_0037011 3300035398 Bacteria 2990
1144 Ga0373931_0007647 3300035691 Bacteria 5095
1145 Ga0373931_0033030 3300035691 Bacteria 2680
1146 Ga0373935_0081666 3300035692 Bacteria 2102
1147 Ga0373927_0009097 3300035695 Bacteria 6666
1148 Ga0373927_0040428 3300035695 Bacteria 3025
1149 Ga0373933_0044992 3300035724 Bacteria 2616
1150 Ga0373937_0011845 3300036401 Bacteria 7659
1151 Ga0373937_0016107 3300036401 Bacteria 6632
1152 Ga0373937_0400537 3300036401 Bacteria 1302
1153 Ga0316584_0079129 3300036712 Bacteria 2462
1154 Ga0373925_0440835 3300037068 Bacteria 1066
1155 Ga0395899_0000334 3300037312 Bacteria 59344
1156 Ga0395899_0002441 3300037312 Bacteria 15108
1157 Ga0395899_0002612 3300037312 Bacteria 14528
1158 Ga0395899_0002671 3300037312 Bacteria 14376
1159 Ga0395899_0002940 3300037312 Bacteria 13659
1160 Ga0395899_0010568 3300037312 Bacteria 7073
1161 Ga0395899_0015016 3300037312 Bacteria 5905
1162 Ga0395899_0022102 3300037312 Bacteria 4823
1163 Ga0395899_0023172 3300037312 Bacteria 4705
1164 Ga0395899_0029558 3300037312 Bacteria 4122
1165 Ga0395899_0034202 3300037312 Bacteria 3815
1166 Ga0395899_0036935 3300037312 Bacteria 3663
1167 Ga0395899_0103198 3300037312 Bacteria 2057
1168 Ga0395899_0120893 3300037312 Bacteria 1876
1169 Ga0395899_0145804 3300037312 Bacteria 1681
1170 Ga0395899_0203517 3300037312 Bacteria 1379
1171 Ga0395899_0205323 3300037312 Bacteria 1371
1172 Ga0395899_0205340 3300037312 Bacteria 1371
1173 Ga0395900_0000084 3300037418 Bacteria 172593
1174 Ga0395900_0002289 3300037418 Bacteria 21271
1175 Ga0395900_0002759 3300037418 Bacteria 19188
1176 Ga0395900_0011437 3300037418 Bacteria 9085
1177 Ga0395900_0015453 3300037418 Bacteria 7782
1178 Ga0395900_0024121 3300037418 Bacteria 6226
1179 Ga0395900_0032811 3300037418 Bacteria 5341
1180 Ga0395900_0041524 3300037418 Bacteria 4742
1181 Ga0395900_0048166 3300037418 Bacteria 4390
1182 Ga0395900_0053389 3300037418 Bacteria 4159
1183 Ga0395900_0056181 3300037418 Bacteria 4052
1184 Ga0395900_0105776 3300037418 Bacteria 2891
1185 Ga0395900_0120563 3300037418 Bacteria 2691
1186 Ga0395900_0149447 3300037418 Bacteria 2387
1187 Ga0395900_0202719 3300037418 Bacteria 2006
1188 Ga0395900_0239781 3300037418 Bacteria 1820
1189 Ga0395900_0290894 3300037418 Bacteria 1622
1190 Ga0395900_0344262 3300037418 Bacteria 1465
1191 Ga0395900_0354423 3300037418 Bacteria 1440
1192 Ga0395900_0462939 3300037418 Bacteria 1222
1193 Ga0395900_0551139 3300037418 Bacteria 1097
1194 Ga0395900_0584499 3300037418 Bacteria 1058
1195 Ga0395900_0635176 3300037418 Bacteria 1005
1196 Ga0395898_0000021 3300037466 Bacteria 393971
1197 Ga0395898_0002115 3300037466 Bacteria 24534
1198 Ga0395898_0006097 3300037466 Bacteria 12931
1199 Ga0395898_0014592 3300037466 Bacteria 8067
1200 Ga0395898_0018292 3300037466 Bacteria 7145
1201 Ga0395898_0025894 3300037466 Bacteria 5906
1202 Ga0395898_0030307 3300037466 Bacteria 5415
1203 Ga0395898_0053534 3300037466 Bacteria 3942
1204 Ga0395898_0058017 3300037466 Bacteria 3770
1205 Ga0395898_0067055 3300037466 Bacteria 3476
1206 Ga0395898_0072080 3300037466 Bacteria 3337
1207 Ga0395898_0076730 3300037466 Bacteria 3226
1208 Ga0395898_0202801 3300037466 Bacteria 1893
1209 Ga0395898_0383496 3300037466 Bacteria 1340
1210 Ga0395898_0616775 3300037466 Bacteria 1027
1211 Ga0395898_0703572 3300037466 Bacteria 952
1212 Ga0395898_0867950 3300037466 Bacteria 841
1213 Ga0395905_0000006 3300037471 Bacteria 549428
1214 Ga0395905_0000191 3300037471 Bacteria 97191
1215 Ga0395905_0000372 3300037471 Bacteria 63933
1216 Ga0395905_0001643 3300037471 Bacteria 26485
1217 Ga0395905_0003116 3300037471 Bacteria 17889
1218 Ga0395905_0003972 3300037471 Bacteria 15557
1219 Ga0395905_0005548 3300037471 Bacteria 12864
1220 Ga0395905_0006958 3300037471 Bacteria 11303
1221 Ga0395905_0007174 3300037471 Bacteria 11130
1222 Ga0395905_0007663 3300037471 Bacteria 10715
1223 Ga0395905_0009025 3300037471 Bacteria 9782
1224 Ga0395905_0009210 3300037471 Bacteria 9667
1225 Ga0395905_0015666 3300037471 Bacteria 7203
1226 Ga0395905_0028190 3300037471 Bacteria 5293
1227 Ga0395905_0047025 3300037471 Bacteria 4045
1228 Ga0395905_0060448 3300037471 Bacteria 3543
1229 Ga0395905_0068122 3300037471 Bacteria 3334
1230 Ga0395905_0095817 3300037471 Bacteria 2786
1231 Ga0395905_0099676 3300037471 Bacteria 2728
1232 Ga0395905_0109931 3300037471 Bacteria 2588
1233 Ga0395905_0134983 3300037471 Bacteria 2321
1234 Ga0395905_0152826 3300037471 Bacteria 2171
1235 Ga0395905_0219699 3300037471 Bacteria 1778
1236 Ga0395905_0221727 3300037471 Bacteria 1770
1237 Ga0395905_0222740 3300037471 Bacteria 1765
1238 Ga0395905_0268916 3300037471 Bacteria 1590
1239 Ga0395905_0290052 3300037471 Bacteria 1523
1240 Ga0395905_0369760 3300037471 Bacteria 1327
1241 Ga0395905_0414683 3300037471 Bacteria 1242
1242 Ga0395905_0456551 3300037471 Bacteria 1176
1243 Ga0395905_0526669 3300037471 Bacteria 1082
1244 Ga0436364_1182596 3300037853 Bacteria 26080
1245 Ga0395901_0001258 3300038443 Bacteria 26908
1246 Ga0395901_0001740 3300038443 Bacteria 22491
1247 Ga0395901_0004352 3300038443 Bacteria 14287
1248 Ga0395901_0004669 3300038443 Bacteria 13811
1249 Ga0395901_0012257 3300038443 Bacteria 8701
1250 Ga0395901_0018587 3300038443 Bacteria 7098
1251 Ga0395901_0048742 3300038443 Bacteria 4399
1252 Ga0395901_0052514 3300038443 Bacteria 4236
1253 Ga0395901_0093886 3300038443 Bacteria 3142
1254 Ga0395901_0142105 3300038443 Bacteria 2522
1255 Ga0395901_0177328 3300038443 Bacteria 2235
1256 Ga0395901_0184793 3300038443 Bacteria 2186
1257 Ga0395901_0195571 3300038443 Bacteria 2121
1258 Ga0395901_0208692 3300038443 Bacteria 2045
1259 Ga0395901_0217593 3300038443 Bacteria 1997
1260 Ga0395901_0269392 3300038443 Bacteria 1772
1261 Ga0395901_0377658 3300038443 Bacteria 1459
1262 Ga0395901_0433438 3300038443 Bacteria 1346
1263 Ga0395901_0517240 3300038443 Bacteria 1213
1264 Ga0237819_00570 3300038705 Bacteria 12398
1265 Ga0436365_0184456 3300039437 Bacteria 3207
1266 Ga0436365_0774506 3300039437 Bacteria 12388
1267 Ga0436365_0998972 3300039437 Bacteria 5629
1268 Ga0436365_1009784 3300039437 Bacteria 2896
1269 Ga0436365_1119595 3300039437 Bacteria 3071
1270 Ga0436360_1163113 3300039438 Bacteria 8239
1271 Ga0436363_0550894 3300039450 Bacteria 1400
1272 Ga0436363_0893184 3300039450 Bacteria 6655
1273 Ga0436363_1642796 3300039450 Bacteria 14852
1274 Ga0436362_0126459 3300039453 Bacteria 236400
1275 Ga0436362_0195334 3300039453 Bacteria 2520
1276 Ga0439461_0018756 3300041410 Bacteria 1357
1277 Ga0451853_1650316 3300041512 Bacteria 1072
1278 Ga0439443_000059 3300042003 Bacteria 6223
1279 Ga0439432_013232 3300042006 Bacteria 2809
1280 Ga0439449_0021135 3300042007 Bacteria 2437
1281 Ga0439449_0075806 3300042007 Bacteria 1240
1282 Ga0439455_0074891 3300042012 Bacteria 914
1283 Ga0439456_000086 3300042013 Bacteria 32013
1284 Ga0450890_000770 3300042127 Bacteria 4625
1285 Ga0450892_000388 3300042130 Bacteria 5184
1286 Ga0450900_013602 3300042136 Bacteria 1077
1287 Ga0450905_000289 3300042142 Bacteria 5985
1288 Ga0450889_000091 3300042144 Bacteria 8434
1289 Ga0450889_000640 3300042144 Bacteria 3867
1290 Ga0439458_0001847 3300042157 Bacteria 5265
1291 Ga0439459_0006633 3300042438 Bacteria 1934
1292 Ga0450893_0006315 3300042532 Bacteria 1916
1293 Ga0451577_0597389 3300042876 Bacteria 1002
1294 Ga0466969_0000561 3300044656 Bacteria 20372
1295 Ga0466969_0005115 3300044656 Bacteria 6973
1296 Ga0466969_0053865 3300044656 Bacteria 1972
1297 Ga0466972_0064982 3300044658 Bacteria 1745
1298 Ga0466972_0177931 3300044658 Bacteria 998
1299 Ga0466965_0039691 3300044683 Bacteria 2315
1300 Ga0466966_0001104 3300044684 Bacteria 17300
1301 Ga0466966_0023711 3300044684 Bacteria 4015
1302 Ga0466966_0064836 3300044684 Bacteria 2299
1303 Ga0466966_0427027 3300044684 Bacteria 796
1304 Ga0466961_0000806 3300044693 Bacteria 19537
1305 Ga0466961_0020251 3300044693 Bacteria 4280
1306 Ga0466961_0032193 3300044693 Bacteria 3368
1307 Ga0466961_0060425 3300044693 Bacteria 2410
1308 Ga0466961_0081205 3300044693 Bacteria 2052
1309 Ga0466963_0008859 3300044694 Bacteria 6038
1310 Ga0466963_0010369 3300044694 Bacteria 5639
1311 Ga0466963_0056161 3300044694 Bacteria 2619
1312 Ga0466963_0115748 3300044694 Bacteria 1842
1313 Ga0466963_0193183 3300044694 Bacteria 1422
1314 Ga0466964_0004970 3300044706 Bacteria 4915
1315 Ga0466964_0049721 3300044706 Bacteria 1717
1316 Ga0466964_0082767 3300044706 Bacteria 1381
1317 Ga0466964_0142905 3300044706 Bacteria 1102
1318 Ga0466971_0019546 3300044719 Bacteria 3009
1319 Ga0466971_0023960 3300044719 Bacteria 2721
1320 Ga0466971_0032061 3300044719 Bacteria 2354
1321 Ga0466968_0225032 3300044735 Bacteria 885
1322 Ga0466970_0000141 3300044765 Bacteria 33348
1323 Ga0466970_0083823 3300044765 Bacteria 1725
1324 Ga0466970_0096904 3300044765 Bacteria 1604
1325 Ga0466957_0001445 3300044842 Bacteria 12423
1326 Ga0466957_0004083 3300044842 Bacteria 8086
1327 Ga0466957_0012108 3300044842 Bacteria 4989
1328 Ga0466957_0050742 3300044842 Bacteria 2525
1329 Ga0466957_0114841 3300044842 Bacteria 1711
1330 Ga0466960_0017595 3300044901 Bacteria 3119
1331 Ga0466959_0006624 3300045049 Bacteria 8043
1332 Ga0466959_0007471 3300045049 Bacteria 7671
1333 Ga0466959_0026026 3300045049 Bacteria 4338
1334 Ga0466959_0046437 3300045049 Bacteria 3195
1335 Ga0466959_0114087 3300045049 Bacteria 1926
1336 Ga0466959_0236757 3300045049 Bacteria 1262
1337 Ga0466959_0322926 3300045049 Bacteria 1055
1338 Ga0451576_0298183 3300045051 Bacteria 1685
1339 Ga0451576_0316976 3300045051 Bacteria 1632
1340 Ga0466958_0000112 3300045836 Bacteria 26021
1341 Ga0466958_0015179 3300045836 Bacteria 4409
1342 Ga0466958_0028848 3300045836 Bacteria 3293
1343 Ga0466958_0041070 3300045836 Bacteria 2781
1344 Ga0466958_0062214 3300045836 Bacteria 2275
1345 Ga0466967_0054646 3300045976 Bacteria 3516
1346 Ga0466967_0079223 3300045976 Bacteria 2961
1347 Ga0466967_0082683 3300045976 Bacteria 2902
1348 Ga0466967_0086801 3300045976 Bacteria 2835
1349 Ga0466967_0109675 3300045976 Bacteria 2534
1350 Ga0466967_0170652 3300045976 Bacteria 2046
1351 Ga0466967_0210302 3300045976 Bacteria 1845
1352 Ga0466967_0217642 3300045976 Bacteria 1814
1353 Ga0466967_0251882 3300045976 Bacteria 1687
1354 Ga0466967_0326818 3300045976 Bacteria 1480
1355 Ga0466967_0342293 3300045976 Bacteria 1446
1356 Ga0495603_0076531 3300046455 Bacteria 1964
1357 Ga0495590_0001289 3300046457 Bacteria 10915
1358 Ga0495638_0000714 3300046460 Bacteria 35808
1359 Ga0495638_0013012 3300046460 Bacteria 5682
1360 Ga0495638_0071193 3300046460 Bacteria 2127
1361 Ga0495580_0002152 3300046472 Bacteria 17309
1362 Ga0495616_0001437 3300046513 Bacteria 16573
1363 Ga0495643_0147815 3300046522 Bacteria 1166
1364 Ga0495648_0041969 3300046524 Bacteria 2883
1365 Ga0495663_0010721 3300046525 Bacteria 2550
1366 Ga0495663_0037608 3300046525 Bacteria 1460
1367 Ga0495598_0009154 3300046537 Bacteria 2331
1368 Ga0495598_0009515 3300046537 Bacteria 2300
1369 Ga0495621_0000828 3300046539 Bacteria 7840
1370 Ga0495621_0001056 3300046539 Bacteria 7053
1371 Ga0495621_0023643 3300046539 Bacteria 2045
1372 Ga0495633_0019671 3300046558 Bacteria 3411
1373 Ga0495625_0003242 3300046660 Bacteria 16463
1374 Ga0495625_0056158 3300046660 Bacteria 2804
1375 Ga0495625_0121124 3300046660 Bacteria 1780
1376 Ga0495623_0049158 3300046679 Bacteria 2673
1377 Ga0495669_0001546 3300046684 Bacteria 9460
1378 Ga0495669_0006368 3300046684 Bacteria 4932
1379 Ga0495669_0008299 3300046684 Bacteria 4362
1380 Ga0495669_0020004 3300046684 Bacteria 2892
1381 Ga0495669_0031978 3300046684 Bacteria 2311
1382 Ga0495669_0052234 3300046684 Bacteria 1835
1383 Ga0495669_0118758 3300046684 Bacteria 1238
1384 Ga0495670_0002211 3300046691 Bacteria 9613
1385 Ga0495670_0028894 3300046691 Bacteria 2750
1386 Ga0495670_0096201 3300046691 Bacteria 1520
1387 Ga0495649_0001764 3300046694 Bacteria 15947
1388 Ga0495680_0271034 3300047322 Bacteria 1198
1389 Ga0495677_0051924 3300047445 Bacteria 1510
1390 Ga0495677_0087975 3300047445 Bacteria 1169
1391 Ga0496100_0012082 3300048903 Bacteria 4939
1392 Ga0496100_0023756 3300048903 Bacteria 3730
1393 Ga0496100_0034133 3300048903 Bacteria 3190
1394 Ga0496100_0294497 3300048903 Bacteria 1213
1395 Ga0496101_0003206 3300048904 Bacteria 10145
1396 Ga0496101_0006265 3300048904 Bacteria 7656
1397 Ga0496101_0010717 3300048904 Bacteria 6060
1398 Ga0496101_0311987 3300048904 Bacteria 1233
1399 Ga0496101_0538732 3300048904 Bacteria 923
1400 Ga0496102_0021186 3300048905 Bacteria 5748
1401 Ga0496102_0055285 3300048905 Bacteria 3620
1402 Ga0496102_0089784 3300048905 Bacteria 2843
1403 Ga0496102_0115519 3300048905 Bacteria 2504
1404 Ga0496103_0044380 3300048906 Bacteria 2739
1405 Ga0496103_0189132 3300048906 Bacteria 1324
1406 Ga0496103_0335265 3300048906 Bacteria 973
1407 Ga0496105_0014011 3300048908 Bacteria 6378
1408 Ga0496105_0440672 3300048908 Bacteria 1029
1409 Ga0496106_0010145 3300048909 Bacteria 6960
1410 Ga0496106_0040445 3300048909 Bacteria 3492
1411 Ga0496106_0040837 3300048909 Bacteria 3476
1412 Ga0496106_0147975 3300048909 Bacteria 1851
1413 Ga0496106_0193664 3300048909 Bacteria 1617
1414 Ga0496107_0001288 3300048910 Bacteria 15332
1415 Ga0496107_0013115 3300048910 Bacteria 5790
1416 Ga0496107_0028262 3300048910 Bacteria 3984
1417 Ga0496107_0068823 3300048910 Bacteria 2569
1418 Ga0496107_0102333 3300048910 Bacteria 2100
1419 Ga0496107_0122857 3300048910 Bacteria 1913
1420 Ga0496107_0133507 3300048910 Bacteria 1833
1421 Ga0496107_0337987 3300048910 Bacteria 1120
1422 Ga0496108_0000372 3300048911 Bacteria 37378
1423 Ga0496108_0009427 3300048911 Bacteria 7905
1424 Ga0496108_0020262 3300048911 Bacteria 5465
1425 Ga0496108_0055426 3300048911 Bacteria 3328
1426 Ga0496108_0078996 3300048911 Bacteria 2785
1427 Ga0496109_0001137 3300048912 Bacteria 22110
1428 Ga0496109_0001325 3300048912 Bacteria 20432
1429 Ga0496109_0057599 3300048912 Bacteria 3547
1430 Ga0496109_0061301 3300048912 Bacteria 3439
1431 Ga0496109_0103348 3300048912 Bacteria 2644
1432 Ga0496109_0234385 3300048912 Bacteria 1727
1433 Ga0496110_0009927 3300048913 Bacteria 7719
1434 Ga0496110_0016678 3300048913 Bacteria 6135
1435 Ga0496110_0023560 3300048913 Bacteria 5238
1436 Ga0496110_0031418 3300048913 Bacteria 4582
1437 Ga0496110_0128958 3300048913 Bacteria 2283
1438 Ga0496110_0517101 3300048913 Bacteria 1086
1439 Ga0496111_0002146 3300048914 Bacteria 11800
1440 Ga0496111_0009171 3300048914 Bacteria 6587
1441 Ga0496111_0021784 3300048914 Bacteria 4477
1442 Ga0496111_0034718 3300048914 Bacteria 3602
1443 Ga0496111_0085202 3300048914 Bacteria 2310
1444 Ga0496111_0149004 3300048914 Bacteria 1735
1445 Ga0496111_0265164 3300048914 Bacteria 1274
1446 Ga0496111_0353202 3300048914 Bacteria 1088
1447 Ga0496112_0007892 3300048915 Bacteria 9484
1448 Ga0496112_0012135 3300048915 Bacteria 7906
1449 Ga0496112_0025396 3300048915 Bacteria 5688
1450 Ga0496112_0049413 3300048915 Bacteria 4123
1451 Ga0496112_0062421 3300048915 Bacteria 3675
1452 Ga0496112_0142590 3300048915 Bacteria 2365
1453 Ga0496112_0156129 3300048915 Bacteria 2249
1454 Ga0496113_0072071 3300048916 Bacteria 2628
1455 Ga0496113_0167037 3300048916 Bacteria 1741
1456 Ga0496114_0000023 3300048917 Bacteria 219092
1457 Ga0496114_0009720 3300048917 Bacteria 7641
1458 Ga0496114_0025285 3300048917 Bacteria 4852
1459 Ga0496114_0091099 3300048917 Bacteria 2589
1460 Ga0496115_0004751 3300048918 Bacteria 9858
1461 Ga0496115_0006554 3300048918 Bacteria 8533
1462 Ga0496115_0028270 3300048918 Bacteria 4394
1463 Ga0496115_0411564 3300048918 Bacteria 1096
1464 Ga0496117_0000156 3300048920 Bacteria 145285
1465 Ga0496118_0000005 3300048921 Bacteria 697350
1466 Ga0496119_0001995 3300048922 Bacteria 23145
1467 Ga0496119_0027338 3300048922 Bacteria 3924
1468 Ga0496119_0096703 3300048922 Bacteria 1665
1469 Ga0496120_0000173 3300048923 Bacteria 109909
1470 Ga0496120_0013758 3300048923 Bacteria 5429
1471 Ga0496120_0043030 3300048923 Bacteria 2634
1472 Ga0496121_0000371 3300048924 Bacteria 92354
1473 Ga0496121_0000441 3300048924 Bacteria 82090
1474 Ga0496121_0002693 3300048924 Bacteria 26575
1475 Ga0496121_0004828 3300048924 Bacteria 17746
1476 Ga0496121_0045899 3300048924 Bacteria 3747
1477 Ga0496124_0019875 3300048927 Bacteria 6230
1478 Ga0496124_0158874 3300048927 Bacteria 1764
1479 Ga0496125_0001476 3300048928 Bacteria 33987
1480 Ga0496125_0003558 3300048928 Bacteria 18766
1481 Ga0496125_0075785 3300048928 Bacteria 2601
1482 Ga0496125_0264987 3300048928 Bacteria 1074
1483 Ga0496126_0003036 3300048929 Bacteria 21761
1484 Ga0496126_0014156 3300048929 Bacteria 8072
1485 Ga0496126_0018733 3300048929 Bacteria 6849
1486 Ga0496126_0405328 3300048929 Bacteria 1105
1487 Ga0496126_0490316 3300048929 Bacteria 983
1488 Ga0495678_037576 3300049459 Bacteria 1966
1489 Ga0501298_033164 3300049521 Bacteria 1022
1490 Ga0501032_0000083 3300049569 Bacteria 82166
1491 Ga0501032_0002358 3300049569 Bacteria 14796
1492 Ga0501033_0016156 3300049570 Bacteria 5652
1493 Ga0501033_0147790 3300049570 Bacteria 1697
1494 Ga0501034_0000001 3300049571 Bacteria 2184493
1495 Ga0501034_0028292 3300049571 Bacteria 5702
1496 Ga0501034_0809472 3300049571 Bacteria 829
1497 Ga0501036_0008712 3300049572 Bacteria 8321
1498 Ga0501037_0000785 3300049573 Bacteria 23911
1499 Ga0501038_0000644 3300049574 Bacteria 31017
1500 Ga0501038_0001615 3300049574 Bacteria 20948
1501 Ga0501039_0000033 3300049575 Bacteria 128868
1502 Ga0501039_0001268 3300049575 Bacteria 18468
1503 Ga0501042_0366238 3300049578 Bacteria 1043
1504 Ga0501043_0002273 3300049579 Bacteria 16341
1505 Ga0501046_0002264 3300049580 Bacteria 18161
1506 Ga0501047_0039919 3300049581 Bacteria 4539
1507 Ga0501047_0363352 3300049581 Bacteria 1283
1508 Ga0501048_0008512 3300049582 Bacteria 7755
1509 Ga0501067_0001478 3300049583 Bacteria 12775
1510 Ga0501068_0211139 3300049584 Bacteria 1232
1511 Ga0501069_0000429 3300049585 Bacteria 19098
1512 Ga0501070_0006112 3300049586 Bacteria 10263
1513 Ga0501071_0387250 3300049587 Bacteria 1067
1514 Ga0501071_0517305 3300049587 Bacteria 916
1515 Ga0501073_0060098 3300049589 Bacteria 2652
1516 Ga0501074_0006905 3300049590 Bacteria 8196
1517 Ga0501075_0245951 3300049591 Bacteria 1363
1518 Ga0501202_008106 3300049652 Bacteria 1909
1519 Ga0501216_017267 3300049660 Bacteria 1233
1520 Ga0501216_020765 3300049660 Bacteria 1150
1521 Ga0501217_006360 3300049661 Bacteria 2508
1522 Ga0501222_001194 3300049662 Bacteria 3666
1523 Ga0501224_007120 3300049664 Bacteria 1627
1524 Ga0501233_008812 3300049668 Bacteria 1954
1525 Ga0501235_003638 3300049669 Bacteria 3332
1526 Ga0501235_023488 3300049669 Bacteria 1375
1527 Ga0501236_009768 3300049670 Bacteria 1244
1528 Ga0501249_001844 3300049679 Bacteria 4316
1529 Ga0501250_002363 3300049680 Bacteria 1703
1530 Ga0501253_004534 3300049683 Bacteria 1760
1531 Ga0501253_048118 3300049683 Bacteria 884
1532 Ga0501257_021294 3300049686 Bacteria 1528
1533 Ga0501221_001116 3300049704 Bacteria 4416
1534 Ga0501221_002374 3300049704 Bacteria 3118
1535 Ga0501221_005121 3300049704 Bacteria 2186
1536 Ga0501225_0029196 3300049705 Bacteria 1515
1537 Ga0501229_002174 3300049706 Bacteria 2303
1538 Ga0501245_004736 3300049708 Bacteria 1873
1539 Ga0501079_0050464 3300049741 Bacteria 3212
1540 Ga0501080_0004541 3300049742 Bacteria 12373
1541 Ga0501081_0172310 3300049743 Bacteria 1563
1542 Ga0501083_0002945 3300049744 Bacteria 11794
1543 Ga0501083_0029619 3300049744 Bacteria 3763
1544 Ga0501083_0248205 3300049744 Bacteria 1159
1545 Ga0501262_008854 3300049759 Bacteria 1236
1546 Ga0501263_001889 3300049760 Bacteria 2062
1547 Ga0501267_008154 3300049764 Bacteria 1030
1548 Ga0501268_001501 3300049765 Bacteria 2925
1549 Ga0501270_002379 3300049767 Bacteria 1921
1550 Ga0501272_005506 3300049769 Bacteria 1334
1551 Ga0501035_0001739 3300049822 Bacteria 21999
1552 Ga0501044_0004784 3300049823 Bacteria 15146
1553 Ga0501044_0064458 3300049823 Bacteria 3741
1554 Ga0501044_0214603 3300049823 Bacteria 1877
1555 Ga0501045_0135362 3300049824 Bacteria 1832
1556 Ga0501212_012838 3300049851 Bacteria 1224
1557 nmdc:mga03683_58163_c1 3300050489 Bacteria 1628
1558 nmdc:mga00v17_55457_c1 3300050491 Bacteria 2420
1559 nmdc:mga07m45_22427_c1 3300050496 Bacteria 3447
1560 nmdc:mga07m45_27400_c1 3300050496 Bacteria 3138
1561 nmdc:mga09592_197218_c1 3300050508 Bacteria 1743
1562 nmdc:mga0qj67_39866_c1 3300050509 Bacteria 3690
1563 nmdc:mga08y16_160509_c1 3300050511 Bacteria 2336
1564 nmdc:mga08y16_494019_c1 3300050511 Bacteria 1244
1565 nmdc:mga08x19_132574_c1 3300050514 Bacteria 1677
1566 Ga0500643_000366 3300053087 Bacteria 35720
1567 Ga0500644_0004471 3300053088 Bacteria 3500
1568 Ga0500646_0017655 3300053090 Bacteria 1873
1569 Ga0500583_0060020 3300053092 Bacteria 1792
1570 Ga0500557_000019 3300053105 Bacteria 93216
1571 Ga0500591_006428 3300053115 Bacteria 5345
1572 Ga0500592_000162 3300053116 Bacteria 13444
1573 Ga0500597_002257 3300053120 Bacteria 5294
1574 Ga0500658_0000291 3300053134 Bacteria 22597
1575 Ga0500568_0000140 3300053139 Bacteria 65109
1576 Ga0500573_0000363 3300053140 Bacteria 19265
1577 Ga0500616_0006277 3300053153 Bacteria 7819
1578 Ga0500622_0061870 3300053156 Bacteria 1907
1579 Ga0500624_000077 3300053157 Bacteria 54433
1580 Ga0500637_0000931 3300053178 Bacteria 11843
1581 Ga0500637_0043799 3300053178 Bacteria 2535
1582 Ga0500637_0049083 3300053178 Bacteria 2401
1583 Ga0500637_0128958 3300053178 Bacteria 1467
1584 Ga0500611_000980 3300053727 Bacteria 3003
1585 Ga0501084_0009704 3300054114 Bacteria 7961
1586 Ga0501082_0186147 3300060353 Bacteria 1807
1587 Ga0501082_0198675 3300060353 Bacteria 1744
1588 Ga0466962_0000589 3300061719 Bacteria 16003
1589 Ga0466962_0010534 3300061719 Bacteria 4448
1590 Ga0466962_0025028 3300061719 Bacteria 2865
1591 2513593995 2513237087 Bacteria 5817514
1592 2514590293 2513237351 Bacteria 6968952
1593 2643746064 2643221544 Bacteria 5886209
1594 2643937021 2643221585 Bacteria 5812563
1595 2644218007 2643221639 Bacteria 6649903
1596 2644258253 2643221646 Bacteria 6433402
1597 2644318186 2643221656 Bacteria 5809961
1598 2739057144 2738541337 Bacteria 6183410
1599 2852654024 2852653556 Bacteria 4050083
1600 2896429963 2896429255 Bacteria 2557483
1601 2912967717 2912963787 Bacteria 5646108
1602 2939655827 2939651529 Bacteria 5895393
1603 2996341144 2996336353 Bacteria 5511628
1604 8055878932 8055878733 Bacteria 5907058
1605 8057101270 8057101203 Bacteria 5034064
1606 Ga0157370_10005609
1607 LJQas_1004738
1608 JGI24736J21556_1001107
1609 JGI24741J21665_1012174
1610 JGI24752J21851_1007184
1611 JGI24740J21852_10011276
1612 JGI24740J21852_10050555
1613 JGI24739J22299_10001179
1614 JGI24737J22298_10000046
1615 JGI24737J22298_10000144
1616 JGI24737J22298_10012849
1617 JGI24737J22298_10050156
1618 JGI24743J22301_10018929
1619 JGI24735J21928_10008760
1620 JGI24735J21928_10023798
1621 JGI24735J21928_10041445
1622 JGI24735J21928_10049491
1623 JGI24738J21930_10010536
1624 JGI24744J21845_10000547
1625 JGI24751J29686_10028440
1626 JGI25150J39212_1000701
1627 JGI25151J46595_10027072
1628 JGI25406J46586_10009729
1629 JGI25153J46596_10000196
1630 rootL2_10012690
1631 rootH1_10079078
1632 Ga0055536_1018345
1633 Ga0055540_1000907
1634 Ga0055531_10000021
1635 Ga0058863_11714062
1636 Ga0058861_11993753
1637 Ga0058862_12098551
1638 Ga0065712_10117326
1639 Ga0065712_10177284
1640 Ga0065707_10000499
1641 Ga0065707_10082284
1642 Ga0065707_10097429
1643 Ga0070658_10000001
1644 Ga0070658_10001597
1645 Ga0070658_10004859
1646 Ga0070658_10050747
1647 Ga0070658_10083539
1648 Ga0070658_10106638
1649 Ga0070658_10107235
1650 Ga0070658_10177363
1651 Ga0070658_10294338
1652 Ga0070658_10428873
1653 Ga0070658_10553707
1654 Ga0070676_10008390
1655 Ga0070676_10009125
1656 Ga0070676_10055026
1657 Ga0070676_10232010
1658 Ga0070683_100015692
1659 Ga0070683_100065681
1660 Ga0070683_100422038
1661 Ga0070690_100020627
1662 Ga0070690_100056501
1663 Ga0070690_100236747
1664 Ga0070670_100047328
1665 Ga0070670_100080022
1666 Ga0070670_100108075
1667 Ga0070670_100449324
1668 Ga0070670_100474796
1669 Ga0070677_10131526
1670 Ga0068869_100000248
1671 Ga0068869_100222574
1672 Ga0070666_10000381
1673 Ga0070666_10001831
1674 Ga0070666_10018453
1675 Ga0070666_10026728
1676 Ga0070666_10035612
1677 Ga0070666_10040320
1678 Ga0070666_10317357
1679 Ga0070680_100000081
1680 Ga0070680_100004762
1681 Ga0070680_100015293
1682 Ga0070680_100015773
1683 Ga0070680_100051207
1684 Ga0070680_100057907
1685 Ga0070680_100064511
1686 Ga0070680_100080069
1687 Ga0070680_100157302
1688 Ga0070680_100231629
1689 Ga0070682_100017648
1690 Ga0070682_100050955
1691 Ga0070682_100091351
1692 Ga0070682_100464551
1693 Ga0068868_100000638
1694 Ga0068868_100002486
1695 Ga0068868_100012819
1696 Ga0068868_100016220
1697 Ga0068868_100048439
1698 Ga0068868_100061996
1699 Ga0068868_100140909
1700 Ga0070660_100000039
1701 Ga0070660_100000596
1702 Ga0070660_100006325
1703 Ga0070660_100006837
1704 Ga0070660_100010785
1705 Ga0070660_100015799
1706 Ga0070660_100046290
1707 Ga0070660_100051072
1708 Ga0070660_100053647
1709 Ga0070660_100070079
1710 Ga0070660_100073099
1711 Ga0070660_100101765
1712 Ga0070660_100106413
1713 Ga0070660_100155798
1714 Ga0070660_100210874
1715 Ga0070689_100148501
1716 Ga0070689_100258406
1717 Ga0070691_10009897
1718 Ga0070691_10041532
1719 Ga0070661_100000009
1720 Ga0070661_100008809
1721 Ga0070661_100008823
1722 Ga0070661_100019749
1723 Ga0070661_100035443
1724 Ga0070661_100056510
1725 Ga0070661_100059054
1726 Ga0070661_100092995
1727 Ga0070661_100129737
1728 Ga0070661_100218562
1729 Ga0070661_100240686
1730 Ga0070692_10005876
1731 Ga0070668_100000048
1732 Ga0070668_100043246
1733 Ga0070669_100003550
1734 Ga0070669_100021133
1735 Ga0070669_100077138
1736 Ga0070669_100227785
1737 Ga0070675_100000913
1738 Ga0070675_100072925
1739 Ga0070675_100142616
1740 Ga0070675_100230945
1741 Ga0070675_100348052
1742 Ga0070671_100000492
1743 Ga0070671_100000860
1744 Ga0070671_100001033
1745 Ga0070671_100005525
1746 Ga0070671_100011713
1747 Ga0070671_100022902
1748 Ga0070671_100033981
1749 Ga0070671_100056215
1750 Ga0070671_100127994
1751 Ga0070671_100183497
1752 Ga0070674_100014377
1753 Ga0070674_100026131
1754 Ga0070674_100072023
1755 Ga0070674_100251989
1756 Ga0070673_100002642
1757 Ga0070673_100054862
1758 Ga0070673_100090163
1759 Ga0070673_100115071
1760 Ga0070673_100222719
1761 Ga0070673_100236991
1762 Ga0070673_100329494
1763 Ga0070673_100375767
1764 Ga0070659_100001925
1765 Ga0070659_100003113
1766 Ga0070659_100016142
1767 Ga0070659_100019299
1768 Ga0070659_100019630
1769 Ga0070659_100019664
1770 Ga0070659_100034417
1771 Ga0070659_100069013
1772 Ga0070659_100081050
1773 Ga0070659_100366209
1774 Ga0070667_100000363
1775 Ga0070667_100000915
1776 Ga0070667_100001034
1777 Ga0070667_100001800
1778 Ga0070667_100002455
1779 Ga0070667_100003445
1780 Ga0070667_100017753
1781 Ga0070667_100084129
1782 Ga0070667_100096210
1783 Ga0070667_100110842
1784 Ga0070667_100115081
1785 Ga0070667_100141190
1786 Ga0070709_10006352
1787 Ga0070709_10025490
1788 Ga0070709_10114766
1789 Ga0070709_10119281
1790 Ga0070709_10139194
1791 Ga0070714_100013482
1792 Ga0070714_100077928
1793 Ga0070714_100118597
1794 Ga0070714_100428699
1795 Ga0070713_100002739
1796 Ga0070713_100031229
1797 Ga0070713_100067606
1798 Ga0070713_100318538
1799 Ga0070710_10260518
1800 Ga0070711_100058122
1801 Ga0070694_100183080
1802 Ga0070663_100001101
1803 Ga0070663_100022927
1804 Ga0070663_100024555
1805 Ga0070663_100040471
1806 Ga0070663_100114931
1807 Ga0070663_100120055
1808 Ga0070678_100028164
1809 Ga0070678_100291796
1810 Ga0070662_100000077
1811 Ga0070662_100004226
1812 Ga0070662_100017342
1813 Ga0070662_100034607
1814 Ga0070662_100116204
1815 Ga0070662_100244923
1816 Ga0070662_100246120
1817 Ga0070662_100542109
1818 Ga0070681_10002023
1819 Ga0070681_10003522
1820 Ga0070681_10021321
1821 Ga0070681_10022034
1822 Ga0070681_10055363
1823 Ga0070681_10063064
1824 Ga0070681_10079117
1825 Ga0070681_10079732
1826 Ga0070681_10093902
1827 Ga0070681_10248312
1828 Ga0068867_100012318
1829 Ga0068867_100018339
1830 Ga0068867_100095721
1831 Ga0070699_100014057
1832 Ga0070679_100000031
1833 Ga0070679_100006962
1834 Ga0070679_100054990
1835 Ga0070679_100070381
1836 Ga0070679_100092141
1837 Ga0070679_100093706
1838 Ga0070679_100096575
1839 Ga0070679_100126321
1840 Ga0070679_100216875
1841 Ga0070684_100043998
1842 Ga0070684_100056140
1843 Ga0070684_100114544
1844 Ga0070684_100115069
1845 Ga0070684_100478126
1846 Ga0068853_100006336
1847 Ga0068853_100008076
1848 Ga0068853_100029886
1849 Ga0068853_100036478
1850 Ga0068853_100066571
1851 Ga0068853_100090534
1852 Ga0068853_100208194
1853 Ga0068853_100279599
1854 Ga0068853_100899773
1855 Ga0070672_100003257
1856 Ga0070672_100003621
1857 Ga0070672_100022583
1858 Ga0070672_100403882
1859 Ga0070686_100099037
1860 Ga0070695_100136216
1861 Ga0070696_100018654
1862 Ga0070693_100061023
1863 Ga0070665_100001581
1864 Ga0070665_100003133
1865 Ga0070665_100007755
1866 Ga0070665_100008963
1867 Ga0070665_100009801
1868 Ga0070665_100011210
1869 Ga0070665_100058842
1870 Ga0070665_100134878
1871 Ga0070665_100198317
1872 Ga0070665_100533529
1873 Ga0070704_100065882
1874 Ga0068855_100000135
1875 Ga0068855_100000789
1876 Ga0068855_100001165
1877 Ga0068855_100009575
1878 Ga0068855_100016755
1879 Ga0068855_100019907
1880 Ga0068855_100025830
1881 Ga0068855_100041991
1882 Ga0070664_100003529
1883 Ga0070664_100008493
1884 Ga0070664_100041322
1885 Ga0070664_100047682
1886 Ga0070664_100048561
1887 Ga0070664_100059290
1888 Ga0070664_100076492
1889 Ga0070664_100098888
1890 Ga0070664_100101155
1891 Ga0070664_100106890
1892 Ga0068857_100000555
1893 Ga0068857_100002899
1894 Ga0068857_100016286
1895 Ga0068857_100040921
1896 Ga0068857_100140765
1897 Ga0068857_100155652
1898 Ga0068857_100331672
1899 Ga0068854_100001637
1900 Ga0068854_100002406
1901 Ga0068854_100009733
1902 Ga0068854_100023622
1903 Ga0068854_100050636
1904 Ga0068854_100063809
1905 Ga0068854_100085704
1906 Ga0068854_100113560
1907 Ga0068856_100040544
1908 Ga0068856_100045466
1909 Ga0068856_100059987
1910 Ga0068856_100077188
1911 Ga0068856_100090898
1912 Ga0068856_100099313
1913 Ga0068856_100274254
1914 Ga0068856_100317759
1915 Ga0068856_100432976
1916 Ga0068856_100535736
1917 Ga0068852_100000585
1918 Ga0068852_100002847
1919 Ga0068852_100003152
1920 Ga0068852_100004872
1921 Ga0068852_100022981
1922 Ga0068852_100029135
1923 Ga0068852_100030523
1924 Ga0068852_100062026
1925 Ga0068852_100099856
1926 Ga0068852_100159516
1927 Ga0068852_100351348
1928 Ga0068859_100000843
1929 Ga0068859_100002246
1930 Ga0068859_100010758
1931 Ga0068859_100027052
1932 Ga0068859_100035841
1933 Ga0068859_100045999
1934 Ga0068864_100001488
1935 Ga0068864_100002545
1936 Ga0068864_100009367
1937 Ga0068864_100011444
1938 Ga0068864_100035565
1939 Ga0068864_100274950
1940 Ga0068864_100320388
1941 Ga0068866_10018377
1942 Ga0068866_10045342
1943 Ga0068861_100254167
1944 Ga0068861_100353555
1945 Ga0068851_10105631
1946 Ga0068870_10108305
1947 Ga0068863_100002392
1948 Ga0068863_100002503
1949 Ga0068863_100010147
1950 Ga0068863_100011390
1951 Ga0068863_100014403
1952 Ga0068863_100041540
1953 Ga0068863_100056578
1954 Ga0068863_100060914
1955 Ga0068863_100100722
1956 Ga0068863_100106435
1957 Ga0068863_100295134
1958 Ga0068858_100000570
1959 Ga0068858_100001408
1960 Ga0068858_100002531
1961 Ga0068858_100005297
1962 Ga0068858_100007205
1963 Ga0068858_100009318
1964 Ga0068858_100047601
1965 Ga0068858_100137802
1966 Ga0068860_100005362
1967 Ga0068860_100005556
1968 Ga0068860_100007956
1969 Ga0068860_100009212
1970 Ga0068860_100010634
1971 Ga0068860_100070773
1972 Ga0068860_100183540
1973 Ga0068860_100211413
1974 Ga0068860_100280774
1975 Ga0068862_100012763
1976 Ga0068862_100020145
1977 Ga0068862_100030579
1978 Ga0068862_100050029
1979 Ga0068862_100074078
1980 Ga0068862_100237120
1981 Ga0068862_100303677
1982 Ga0068862_100724067
1983 Ga0081455_10012753
1984 Ga0081539_10000004
1985 Ga0081539_10032795
1986 Ga0070717_10010469
1987 Ga0070715_10000333
1988 Ga0070716_100049583
1989 Ga0070712_100002678
1990 Ga0070712_100061466
1991 Ga0097621_100070361
1992 Ga0097621_100086556
1993 Ga0097621_100168213
1994 Ga0075370_10003471
1995 Ga0068871_100008181
1996 Ga0068871_100085791
1997 Ga0068871_100295792
1998 Ga0075428_100026953
1999 Ga0075430_100015171
2000 Ga0075431_100292314
2001 Ga0075429_100337994
2002 Ga0068865_100003326
2003 Ga0068865_100005880
2004 Ga0068865_100028409
2005 Ga0068865_100058849
2006 Ga0068865_100191203
2007 Ga0068865_100308215
2008 Ga0075436_100292776
2009 Ga0097620_100000843
2010 Ga0097620_100002246
2011 Ga0097620_100010758
2012 Ga0097620_100027052
2013 Ga0097620_100035839
2014 Ga0097620_100045999
2015 Ga0105251_10017252
2016 Ga0105251_10093187
2017 Ga0105240_10004389
2018 Ga0105240_10007571
2019 Ga0105240_10010627
2020 Ga0105240_10011630
2021 Ga0105240_10030693
2022 Ga0105240_10041145
2023 Ga0105240_10094481
2024 Ga0105240_10164573
2025 Ga0105240_10205832
2026 Ga0105240_10305369
2027 Ga0105240_10620106
2028 Ga0111539_10024945
2029 Ga0111539_10405206
2030 Ga0105245_10000240
2031 Ga0105245_10001159
2032 Ga0105245_10084045
2033 Ga0105245_10138345
2034 Ga0105245_10272335
2035 Ga0105247_10000212
2036 Ga0105247_10005134
2037 Ga0105247_10030833
2038 Ga0105247_10089192
2039 Ga0105247_10111271
2040 Ga0105243_10015375
2041 Ga0105243_10147537
2042 Ga0105243_10228121
2043 Ga0105241_10008322
2044 Ga0105241_10217923
2045 Ga0105242_10004796
2046 Ga0105242_10041050
2047 Ga0105242_10185446
2048 Ga0105248_10000673
2049 Ga0105248_10002105
2050 Ga0105248_10002346
2051 Ga0105248_10003667
2052 Ga0105248_10019138
2053 Ga0105248_10019438
2054 Ga0105248_10024349
2055 Ga0105248_10031964
2056 Ga0105248_10098505
2057 Ga0105248_10099756
2058 Ga0105248_10127653
2059 Ga0105248_10158553
2060 Ga0105248_10163473
2061 Ga0105248_10378153
2062 Ga0105237_10007858
2063 Ga0105237_10008093
2064 Ga0105237_10071865
2065 Ga0105237_10083461
2066 Ga0105237_10376471
2067 Ga0105238_10012026
2068 Ga0105238_10017564
2069 Ga0105238_10053323
2070 Ga0105238_10097943
2071 Ga0105238_10189751
2072 Ga0105238_10319021
2073 Ga0105238_10328257
2074 Ga0105238_10530489
2075 Ga0105249_10000523
2076 Ga0105249_10008358
2077 Ga0105249_10019924
2078 Ga0105249_10312784
2079 Ga0105249_10323927
2080 Ga0105239_10019470
2081 Ga0105239_10041008
2082 Ga0105239_10061514
2083 Ga0105239_10150182
2084 Ga0105239_10218556
2085 Ga0105239_10850817
2086 Ga0105246_10019993
2087 Ga0105246_10237891
2088 Ga0157373_10007346
2089 Ga0157373_10007738
2090 Ga0157373_10016856
2091 Ga0157373_10023265
2092 Ga0157373_10056665
2093 Ga0157373_10078186
2094 Ga0157373_10109174
2095 Ga0157373_10121335
2096 Ga0157373_10134864
2097 Ga0157371_10001435
2098 Ga0157371_10003052
2099 Ga0157371_10003899
2100 Ga0157371_10023919
2101 Ga0157371_10053508
2102 Ga0157371_10098960
2103 Ga0157371_10142618
2104 Ga0157371_10157594
2105 Ga0157371_10199726
2106 Ga0157371_10285173
2107 Ga0157370_10012562
2108 Ga0157370_10035399
2109 Ga0157370_10035936
2110 Ga0157370_10083008
2111 Ga0157370_10132585
2112 Ga0157370_10246868
2113 Ga0157369_10001579
2114 Ga0157369_10004172
2115 Ga0157369_10006524
2116 Ga0157369_10008300
2117 Ga0157369_10025769
2118 Ga0157369_10029001
2119 Ga0157369_10062380
2120 Ga0157369_10200913
2121 Ga0157369_10341158
2122 Ga0157369_10344203
2123 Ga0157369_10438797
2124 Ga0157369_10472533
2125 Ga0157369_10529259
2126 Ga0157374_10000882
2127 Ga0157374_10002261
2128 Ga0157374_10009049
2129 Ga0157374_10090064
2130 Ga0157374_10109979
2131 Ga0157374_10231593
2132 Ga0157378_10000625
2133 Ga0157378_10003623
2134 Ga0157378_10020195
2135 Ga0163162_10002440
2136 Ga0163162_10085584
2137 Ga0163162_10097768
2138 Ga0163162_10257091
2139 Ga0157372_10004346
2140 Ga0157372_10024533
2141 Ga0157372_10034601
2142 Ga0157372_10040762
2143 Ga0157372_10062828
2144 Ga0157372_10382227
2145 Ga0157372_10414170
2146 Ga0157372_10700861
2147 Ga0157375_10038790
2148 Ga0157375_10063978
2149 Ga0157375_10136739
2150 Ga0157375_10435314
2151 Ga0163163_10002408
2152 Ga0163163_10004034
2153 Ga0163163_10022952
2154 Ga0163163_10038472
2155 Ga0163163_10562117
2156 Ga0157380_10001526
2157 Ga0157380_10002231
2158 Ga0157380_10062065
2159 Ga0157380_10127797
2160 Ga0157380_10270229
2161 Ga0157380_10291720
2162 Ga0182008_10173956
2163 Ga0157377_10049358
2164 Ga0157377_10070643
2165 Ga0157379_10001277
2166 Ga0157379_10003741
2167 Ga0157379_10010195
2168 Ga0157379_10046470
2169 Ga0157379_10105763
2170 Ga0157379_10169928
2171 Ga0157376_10006910
2172 Ga0157376_10103869
2173 Ga0157376_10245106
2174 Ga0157376_10748131
2175 Ga0206356_10519558
2176 Ga0206349_1981439
2177 Ga0206350_11177039
2178 Ga0206354_10918587
2179 Ga0206353_11473440
2180 Ga0206353_12012814
2181 Ga0206353_12019217
2182 Ga0213873_10000012
2183 Ga0213874_10002669
2184 Ga0213876_10000021
2185 Ga0213876_10020022
2186 Ga0213876_10073919
2187 Ga0213875_10006414
2188 Ga0224712_10039436
2189 Ga0224712_10064149
2190 Ga0224712_10151519
2191 Ga0207425_1000146
2192 Ga0209129_1000912
2193 Ga0209676_1041693
2194 Ga0209025_1000431
2195 Ga0209758_1000002
2196 Ga0209050_1000005
2197 Ga0209050_1005562
2198 Ga0209051_1000212
2199 Ga0209051_1003223
2200 Ga0209257_1000032
2201 Ga0209257_1000753
2202 Ga0209257_1000925
2203 Ga0209257_1017966
2204 Ga0207697_10001286
2205 Ga0207656_10159501
2206 Ga0207696_1008898
2207 Ga0207682_10039097
2208 Ga0207692_10203076
2209 Ga0207642_10011765
2210 Ga0207710_10000254
2211 Ga0207710_10013274
2212 Ga0207710_10036857
2213 Ga0207710_10046773
2214 Ga0207688_10021021
2215 Ga0207680_10000492
2216 Ga0207680_10016620
2217 Ga0207680_10227591
2218 Ga0207680_10419231
2219 Ga0207647_10000193
2220 Ga0207647_10001994
2221 Ga0207647_10026542
2222 Ga0207647_10040434
2223 Ga0207685_10002698
2224 Ga0207699_10012746
2225 Ga0207699_10033651
2226 Ga0207699_10085258
2227 Ga0207645_10006989
2228 Ga0207645_10013084
2229 Ga0207645_10015452
2230 Ga0207645_10028032
2231 Ga0207645_10032729
2232 Ga0207645_10036097
2233 Ga0207645_10113522
2234 Ga0207645_10154660
2235 Ga0207645_10183823
2236 Ga0207643_10127142
2237 Ga0207705_10000002
2238 Ga0207705_10000003
2239 Ga0207705_10000050
2240 Ga0207705_10002221
2241 Ga0207705_10014667
2242 Ga0207705_10022419
2243 Ga0207705_10025445
2244 Ga0207705_10037294
2245 Ga0207705_10038884
2246 Ga0207705_10050981
2247 Ga0207705_10077699
2248 Ga0207705_10086332
2249 Ga0207705_10089206
2250 Ga0207705_10154441
2251 Ga0207705_10170351
2252 Ga0207705_10175201
2253 Ga0207705_10226788
2254 Ga0207654_10081542
2255 Ga0207654_10091565
2256 Ga0207654_10222999
2257 Ga0207707_10004072
2258 Ga0207707_10006250
2259 Ga0207707_10008989
2260 Ga0207707_10010843
2261 Ga0207707_10035205
2262 Ga0207707_10060555
2263 Ga0207695_10005303
2264 Ga0207695_10005548
2265 Ga0207695_10009383
2266 Ga0207695_10014202
2267 Ga0207695_10017612
2268 Ga0207695_10024691
2269 Ga0207695_10029814
2270 Ga0207695_10031334
2271 Ga0207695_10039007
2272 Ga0207695_10059200
2273 Ga0207695_10066576
2274 Ga0207695_10079345
2275 Ga0207695_10085135
2276 Ga0207695_10097645
2277 Ga0207695_10654044
2278 Ga0207671_10005586
2279 Ga0207671_10013981
2280 Ga0207671_10018037
2281 Ga0207671_10086024
2282 Ga0207671_10106160
2283 Ga0207693_10000462
2284 Ga0207693_10031567
2285 Ga0207693_10147756
2286 Ga0207663_10007125
2287 Ga0207663_10090318
2288 Ga0207663_10157284
2289 Ga0207660_10000186
2290 Ga0207660_10004190
2291 Ga0207660_10008150
2292 Ga0207660_10030111
2293 Ga0207660_10042085
2294 Ga0207660_10047185
2295 Ga0207660_10052362
2296 Ga0207660_10070663
2297 Ga0207660_10183425
2298 Ga0207662_10145770
2299 Ga0207657_10000121
2300 Ga0207657_10001248
2301 Ga0207657_10003049
2302 Ga0207657_10005568
2303 Ga0207657_10005714
2304 Ga0207657_10008500
2305 Ga0207657_10011471
2306 Ga0207657_10012677
2307 Ga0207657_10021169
2308 Ga0207657_10049190
2309 Ga0207657_10050297
2310 Ga0207657_10079533
2311 Ga0207657_10090824
2312 Ga0207657_10093945
2313 Ga0207649_10000190
2314 Ga0207649_10001220
2315 Ga0207649_10008345
2316 Ga0207649_10057649
2317 Ga0207649_10287111
2318 Ga0207652_10000003
2319 Ga0207652_10001982
2320 Ga0207652_10017644
2321 Ga0207652_10072927
2322 Ga0207652_10127656
2323 Ga0207652_10129200
2324 Ga0207652_10162062
2325 Ga0207652_10219188
2326 Ga0207652_10236421
2327 Ga0207652_10597913
2328 Ga0207681_10004853
2329 Ga0207681_10041120
2330 Ga0207681_10075308
2331 Ga0207681_10207143
2332 Ga0207694_10000667
2333 Ga0207694_10007119
2334 Ga0207694_10067018
2335 Ga0207694_10101162
2336 Ga0207694_10153334
2337 Ga0207694_10164129
2338 Ga0207694_10203768
2339 Ga0207694_10277535
2340 Ga0207694_10337081
2341 Ga0207650_10009214
2342 Ga0207650_10019746
2343 Ga0207650_10034633
2344 Ga0207650_10069191
2345 Ga0207650_10107015
2346 Ga0207650_10175655
2347 Ga0207650_10491802
2348 Ga0207659_10092065
2349 Ga0207659_10281127
2350 Ga0207687_10006042
2351 Ga0207687_10032648
2352 Ga0207687_10150257
2353 Ga0207700_10005097
2354 Ga0207700_10034763
2355 Ga0207700_10072261
2356 Ga0207700_10076030
2357 Ga0207664_10007710
2358 Ga0207664_10063990
2359 Ga0207664_10283922
2360 Ga0207644_10000181
2361 Ga0207644_10001877
2362 Ga0207644_10007510
2363 Ga0207644_10015423
2364 Ga0207644_10076628
2365 Ga0207644_10079575
2366 Ga0207644_10136374
2367 Ga0207644_10193996
2368 Ga0207644_10420002
2369 Ga0207690_10000922
2370 Ga0207690_10012495
2371 Ga0207690_10030611
2372 Ga0207690_10031182
2373 Ga0207690_10068871
2374 Ga0207690_10124238
2375 Ga0207690_10126432
2376 Ga0207690_10229540
2377 Ga0207706_10000320
2378 Ga0207706_10002152
2379 Ga0207706_10005703
2380 Ga0207706_10006809
2381 Ga0207706_10016150
2382 Ga0207706_10033282
2383 Ga0207706_10469011
2384 Ga0207706_10492574
2385 Ga0207686_10032876
2386 Ga0207709_10072557
2387 Ga0207670_10253487
2388 Ga0207669_10005254
2389 Ga0207669_10017120
2390 Ga0207669_10017596
2391 Ga0207669_10040698
2392 Ga0207669_10044761
2393 Ga0207704_10009452
2394 Ga0207704_10023727
2395 Ga0207704_10568257
2396 Ga0207665_10003728
2397 Ga0207665_10088617
2398 Ga0207691_10000085
2399 Ga0207691_10005557
2400 Ga0207691_10014238
2401 Ga0207691_10028769
2402 Ga0207691_10042288
2403 Ga0207691_10055496
2404 Ga0207711_10000044
2405 Ga0207711_10001646
2406 Ga0207711_10003531
2407 Ga0207711_10013510
2408 Ga0207711_10016809
2409 Ga0207711_10018189
2410 Ga0207711_10067752
2411 Ga0207711_10126210
2412 Ga0207711_10204104
2413 Ga0207689_10000016
2414 Ga0207689_10206683
2415 Ga0207661_10241640
2416 Ga0207661_10271472
2417 Ga0207661_10292219
2418 Ga0207661_10632087
2419 Ga0207679_10007667
2420 Ga0207679_10010617
2421 Ga0207679_10036640
2422 Ga0207679_10043131
2423 Ga0207679_10046835
2424 Ga0207679_10055968
2425 Ga0207679_10068889
2426 Ga0207679_10069531
2427 Ga0207679_10123116
2428 Ga0207679_10346695
2429 Ga0207679_10399253
2430 Ga0207667_10000859
2431 Ga0207667_10001013
2432 Ga0207667_10002514
2433 Ga0207667_10009692
2434 Ga0207667_10019156
2435 Ga0207667_10031313
2436 Ga0207667_10047606
2437 Ga0207667_10059750
2438 Ga0207667_10061643
2439 Ga0207667_10067595
2440 Ga0207667_10204972
2441 Ga0207651_10008254
2442 Ga0207651_10011713
2443 Ga0207651_10022903
2444 Ga0207651_10033107
2445 Ga0207651_10098449
2446 Ga0207651_10108710
2447 Ga0207651_10128440
2448 Ga0207651_10129071
2449 Ga0207651_10131109
2450 Ga0207712_10000437
2451 Ga0207712_10019374
2452 Ga0207712_10026842
2453 Ga0207712_10087146
2454 Ga0207712_10134122
2455 Ga0207668_10009261
2456 Ga0207668_10254800
2457 Ga0207640_10000851
2458 Ga0207640_10007010
2459 Ga0207640_10015163
2460 Ga0207640_10059129
2461 Ga0207640_10064025
2462 Ga0207640_10085744
2463 Ga0207640_10093371
2464 Ga0207640_10162338
2465 Ga0207658_10000936
2466 Ga0207658_10002942
2467 Ga0207658_10005057
2468 Ga0207658_10006132
2469 Ga0207658_10011779
2470 Ga0207658_10085660
2471 Ga0207658_10091455
2472 Ga0207658_10379621
2473 Ga0207677_10003694
2474 Ga0207677_10026050
2475 Ga0207677_10094729
2476 Ga0207677_10469250
2477 Ga0207703_10000183
2478 Ga0207703_10001302
2479 Ga0207703_10003806
2480 Ga0207703_10005275
2481 Ga0207703_10007702
2482 Ga0207703_10009541
2483 Ga0207703_10214932
2484 Ga0207703_10313617
2485 Ga0207703_10321811
2486 Ga0207703_10357478
2487 Ga0207639_10000181
2488 Ga0207639_10007288
2489 Ga0207639_10034006
2490 Ga0207639_10072027
2491 Ga0207639_10314472
2492 Ga0207639_10326436
2493 Ga0207639_10615379
2494 Ga0207678_10001321
2495 Ga0207678_10002048
2496 Ga0207678_10003177
2497 Ga0207678_10006824
2498 Ga0207678_10009022
2499 Ga0207678_10011197
2500 Ga0207678_10013529
2501 Ga0207678_10019862
2502 Ga0207678_10030836
2503 Ga0207678_10088130
2504 Ga0207702_10021703
2505 Ga0207702_10049667
2506 Ga0207702_10054024
2507 Ga0207702_10113075
2508 Ga0207702_10267956
2509 Ga0207702_10548173
2510 Ga0207641_10001338
2511 Ga0207641_10001458
2512 Ga0207641_10002484
2513 Ga0207641_10008289
2514 Ga0207641_10016012
2515 Ga0207641_10056936
2516 Ga0207641_10060015
2517 Ga0207641_10079359
2518 Ga0207641_10087245
2519 Ga0207641_10389998
2520 Ga0207648_10003603
2521 Ga0207648_10007718
2522 Ga0207648_10016176
2523 Ga0207648_10044684
2524 Ga0207648_10113725
2525 Ga0207648_10165891
2526 Ga0207676_10005209
2527 Ga0207676_10049201
2528 Ga0207676_10110374
2529 Ga0207676_10128368
2530 Ga0207676_10203987
2531 Ga0207674_10000114
2532 Ga0207674_10001036
2533 Ga0207674_10001151
2534 Ga0207674_10006687
2535 Ga0207674_10014936
2536 Ga0207674_10018868
2537 Ga0207674_10144034
2538 Ga0207674_10193615
2539 Ga0207674_10381259
2540 Ga0207675_100190179
2541 Ga0207675_100205088
2542 Ga0207675_100242861
2543 Ga0207675_100306334
2544 Ga0207683_10007850
2545 Ga0207683_10007992
2546 Ga0207683_10197588
2547 Ga0207698_10000796
2548 Ga0207698_10000887
2549 Ga0207698_10002867
2550 Ga0207698_10003119
2551 Ga0207698_10003206
2552 Ga0207698_10006634
2553 Ga0207698_10010230
2554 Ga0207698_10061767
2555 Ga0207698_10194133
2556 Ga0207698_10274367
2557 Ga0207698_10317675
2558 Ga0207698_10332579
2559 Ga0207698_10363565
2560 Ga0207698_10509720
2561 Ga0209982_1012035
2562 Ga0209974_10001961
2563 Ga0207428_10033260
2564 Ga0268266_10000834
2565 Ga0268266_10007466
2566 Ga0268266_10010282
2567 Ga0268266_10013691
2568 Ga0268266_10079389
2569 Ga0268266_10080781
2570 Ga0268266_10092782
2571 Ga0268266_10098990
2572 Ga0268266_10214787
2573 Ga0268266_10250475
2574 Ga0268266_10433352
2575 Ga0268265_10002414
2576 Ga0268265_10007856
2577 Ga0268265_10009708
2578 Ga0268265_10010713
2579 Ga0268265_10071818
2580 Ga0268265_10146124
2581 Ga0268264_10000057
2582 Ga0268264_10001982
2583 Ga0268264_10006236
2584 Ga0268264_10009364
2585 Ga0268264_10110522
2586 Ga0268264_10120880
2587 Ga0268264_10236227
2588 Ga0268264_10272591
2589 Ga0265334_10076257
2590 Ga0307515_10068006
2591 Ga0307515_10098372
2592 Ga0307511_10001123
2593 Ga0265762_1019634
2594 Ga0265340_10008897
2595 Ga0265340_10028939
2596 Ga0307513_10054594
2597 Ga0307513_10085117
2598 Ga0307509_10000013
2599 Ga0307408_100020656
2600 Ga0307408_100030450
2601 Ga0307408_100100370
2602 Ga0307408_100123141
2603 Ga0307408_100249374
2604 Ga0307508_10198678
2605 Ga0316576_10261048
2606 Ga0316578_10003227
2607 Ga0307516_10086048
2608 Ga0307405_10022992
2609 Ga0307405_10034261
2610 Ga0307405_10079712
2611 Ga0307405_10128402
2612 Ga0316577_10020096
2613 Ga0307413_10000739
2614 Ga0307413_10001898
2615 Ga0307413_10002115
2616 Ga0307413_10010806
2617 Ga0307413_10022007
2618 Ga0307413_10046641
2619 Ga0307413_10290569
2620 Ga0307413_10365662
2621 Ga0307410_10000171
2622 Ga0307410_10002848
2623 Ga0307410_10004835
2624 Ga0307410_10009406
2625 Ga0307410_10012882
2626 Ga0307410_10016770
2627 Ga0307410_10018471
2628 Ga0307410_10021886
2629 Ga0307410_10023442
2630 Ga0307410_10027779
2631 Ga0307410_10074094
2632 Ga0307410_10113753
2633 Ga0307410_10198571
2634 Ga0307410_10214472
2635 Ga0307406_10001149
2636 Ga0307406_10003488
2637 Ga0307406_10027008
2638 Ga0307406_10039950
2639 Ga0307406_10091701
2640 Ga0307406_10107328
2641 Ga0307406_10109031
2642 Ga0307406_10150396
2643 Ga0307406_10196705
2644 Ga0307406_10237779
2645 Ga0307406_10569416
2646 Ga0307407_10001542
2647 Ga0307407_10001946
2648 Ga0307407_10002595
2649 Ga0307407_10007483
2650 Ga0307407_10015178
2651 Ga0307407_10026119
2652 Ga0307407_10080559
2653 Ga0307407_10340773
2654 Ga0307407_10344137
2655 Ga0307412_10007148
2656 Ga0307412_10011156
2657 Ga0307412_10011193
2658 Ga0307412_10040563
2659 Ga0307412_10098314
2660 Ga0307412_10139287
2661 Ga0307412_10173253
2662 Ga0307412_10332824
2663 Ga0307412_10476910
2664 Ga0307412_10488346
2665 Ga0307409_100001095
2666 Ga0307409_100004656
2667 Ga0307409_100008214
2668 Ga0307409_100009931
2669 Ga0307409_100022413
2670 Ga0307409_100042410
2671 Ga0307409_100049332
2672 Ga0307409_100075465
2673 Ga0307409_100075567
2674 Ga0307409_100081411
2675 Ga0307409_100105977
2676 Ga0307409_100143466
2677 Ga0307409_100193406
2678 Ga0307409_100252790
2679 Ga0307416_100002009
2680 Ga0307416_100004801
2681 Ga0307416_100006767
2682 Ga0307416_100027504
2683 Ga0307416_100049275
2684 Ga0307416_100066877
2685 Ga0307416_100120266
2686 Ga0307416_100220359
2687 Ga0307416_100253714
2688 Ga0307416_100441309
2689 Ga0307416_100754314
2690 Ga0307414_10016999
2691 Ga0307414_10022664
2692 Ga0307414_10049644
2693 Ga0307414_10057325
2694 Ga0307414_10058986
2695 Ga0307414_10064078
2696 Ga0307414_10065439
2697 Ga0307414_10071176
2698 Ga0307414_10074410
2699 Ga0307414_10080822
2700 Ga0307414_10082256
2701 Ga0307414_10102582
2702 Ga0307414_10128179
2703 Ga0307414_10128387
2704 Ga0307414_10132324
2705 Ga0307411_10000997
2706 Ga0307411_10001612
2707 Ga0307411_10001951
2708 Ga0307411_10007559
2709 Ga0307411_10008119
2710 Ga0307411_10011823
2711 Ga0307411_10017680
2712 Ga0307411_10050205
2713 Ga0307411_10054530
2714 Ga0307411_10057500
2715 Ga0307411_10060348
2716 Ga0307411_10064323
2717 Ga0307411_10079612
2718 Ga0307411_10080096
2719 Ga0307411_10089268
2720 Ga0307411_10152872
2721 Ga0307411_10156608
2722 Ga0307411_10203181
2723 Ga0307411_10217963
2724 Ga0307411_10344298
2725 Ga0307411_10399819
2726 Ga0307415_100005998
2727 Ga0307415_100011428
2728 Ga0307415_100011638
2729 Ga0307415_100035538
2730 Ga0307415_100061923
2731 Ga0307415_100093123
2732 Ga0307415_100097719
2733 Ga0307415_100159647
2734 Ga0307415_100230721
2735 Ga0307415_100351179
2736 Ga0307415_100513058
2737 Ga0307510_10000014
2738 Ga0307510_10009003
2739 Ga0373959_0029053
2740 Ga0373936_0000241
2741 Ga0373939_0000094
2742 Ga0373957_0137901
2743 Ga0373957_0184698
2744 Ga0373943_0005992
2745 Ga0373943_0164833
2746 Ga0373961_0066743
2747 Ga0373962_0012366
2748 Ga0316574_0037011
2749 Ga0373931_0007647
2750 Ga0373931_0033030
2751 Ga0373935_0081666
2752 Ga0373927_0009097
2753 Ga0373927_0040428
2754 Ga0373933_0044992
2755 Ga0373937_0011845
2756 Ga0373937_0016107
2757 Ga0373937_0400537
2758 Ga0316584_0079129
2759 Ga0373925_0440835
2760 Ga0395899_0000334
2761 Ga0395899_0002441
2762 Ga0395899_0002612
2763 Ga0395899_0002671
2764 Ga0395899_0002940
2765 Ga0395899_0010568
2766 Ga0395899_0015016
2767 Ga0395899_0022102
2768 Ga0395899_0023172
2769 Ga0395899_0029558
2770 Ga0395899_0034202
2771 Ga0395899_0036935
2772 Ga0395899_0103198
2773 Ga0395899_0120893
2774 Ga0395899_0145804
2775 Ga0395899_0203517
2776 Ga0395899_0205323
2777 Ga0395899_0205340
2778 Ga0395900_0000084
2779 Ga0395900_0002289
2780 Ga0395900_0002759
2781 Ga0395900_0011437
2782 Ga0395900_0015453
2783 Ga0395900_0024121
2784 Ga0395900_0032811
2785 Ga0395900_0041524
2786 Ga0395900_0048166
2787 Ga0395900_0053389
2788 Ga0395900_0056181
2789 Ga0395900_0105776
2790 Ga0395900_0120563
2791 Ga0395900_0149447
2792 Ga0395900_0202719
2793 Ga0395900_0239781
2794 Ga0395900_0290894
2795 Ga0395900_0344262
2796 Ga0395900_0354423
2797 Ga0395900_0462939
2798 Ga0395900_0551139
2799 Ga0395900_0584499
2800 Ga0395900_0635176
2801 Ga0395898_0000021
2802 Ga0395898_0002115
2803 Ga0395898_0006097
2804 Ga0395898_0014592
2805 Ga0395898_0018292
2806 Ga0395898_0025894
2807 Ga0395898_0030307
2808 Ga0395898_0053534
2809 Ga0395898_0058017
2810 Ga0395898_0067055
2811 Ga0395898_0072080
2812 Ga0395898_0076730
2813 Ga0395898_0202801
2814 Ga0395898_0383496
2815 Ga0395898_0616775
2816 Ga0395898_0703572
2817 Ga0395898_0867950
2818 Ga0395905_0000006
2819 Ga0395905_0000191
2820 Ga0395905_0000372
2821 Ga0395905_0001643
2822 Ga0395905_0003116
2823 Ga0395905_0003972
2824 Ga0395905_0005548
2825 Ga0395905_0006958
2826 Ga0395905_0007174
2827 Ga0395905_0007663
2828 Ga0395905_0009025
2829 Ga0395905_0009210
2830 Ga0395905_0015666
2831 Ga0395905_0028190
2832 Ga0395905_0047025
2833 Ga0395905_0060448
2834 Ga0395905_0068122
2835 Ga0395905_0095817
2836 Ga0395905_0099676
2837 Ga0395905_0109931
2838 Ga0395905_0134983
2839 Ga0395905_0152826
2840 Ga0395905_0219699
2841 Ga0395905_0221727
2842 Ga0395905_0222740
2843 Ga0395905_0268916
2844 Ga0395905_0290052
2845 Ga0395905_0369760
2846 Ga0395905_0414683
2847 Ga0395905_0456551
2848 Ga0395905_0526669
2849 Ga0436364_1182596
2850 Ga0395901_0001258
2851 Ga0395901_0001740
2852 Ga0395901_0004352
2853 Ga0395901_0004669
2854 Ga0395901_0012257
2855 Ga0395901_0018587
2856 Ga0395901_0048742
2857 Ga0395901_0052514
2858 Ga0395901_0093886
2859 Ga0395901_0142105
2860 Ga0395901_0177328
2861 Ga0395901_0184793
2862 Ga0395901_0195571
2863 Ga0395901_0208692
2864 Ga0395901_0217593
2865 Ga0395901_0269392
2866 Ga0395901_0377658
2867 Ga0395901_0433438
2868 Ga0395901_0517240
2869 Ga0237819_00570
2870 Ga0436365_0184456
2871 Ga0436365_0774506
2872 Ga0436365_0998972
2873 Ga0436365_1009784
2874 Ga0436365_1119595
2875 Ga0436360_1163113
2876 Ga0436363_0550894
2877 Ga0436363_0893184
2878 Ga0436363_1642796
2879 Ga0436362_0126459
2880 Ga0436362_0195334
2881 Ga0439461_0018756
2882 Ga0451853_1650316
2883 Ga0439443_000059
2884 Ga0439432_013232
2885 Ga0439449_0021135
2886 Ga0439449_0075806
2887 Ga0439455_0074891
2888 Ga0439456_000086
2889 Ga0450890_000770
2890 Ga0450892_000388
2891 Ga0450900_013602
2892 Ga0450905_000289
2893 Ga0450889_000091
2894 Ga0450889_000640
2895 Ga0439458_0001847
2896 Ga0439459_0006633
2897 Ga0450893_0006315
2898 Ga0451577_0597389
2899 Ga0466969_0000561
2900 Ga0466969_0005115
2901 Ga0466969_0053865
2902 Ga0466972_0064982
2903 Ga0466972_0177931
2904 Ga0466965_0039691
2905 Ga0466966_0001104
2906 Ga0466966_0023711
2907 Ga0466966_0064836
2908 Ga0466966_0427027
2909 Ga0466961_0000806
2910 Ga0466961_0020251
2911 Ga0466961_0032193
2912 Ga0466961_0060425
2913 Ga0466961_0081205
2914 Ga0466963_0008859
2915 Ga0466963_0010369
2916 Ga0466963_0056161
2917 Ga0466963_0115748
2918 Ga0466963_0193183
2919 Ga0466964_0004970
2920 Ga0466964_0049721
2921 Ga0466964_0082767
2922 Ga0466964_0142905
2923 Ga0466971_0019546
2924 Ga0466971_0023960
2925 Ga0466971_0032061
2926 Ga0466968_0225032
2927 Ga0466970_0000141
2928 Ga0466970_0083823
2929 Ga0466970_0096904
2930 Ga0466957_0001445
2931 Ga0466957_0004083
2932 Ga0466957_0012108
2933 Ga0466957_0050742
2934 Ga0466957_0114841
2935 Ga0466960_0017595
2936 Ga0466959_0006624
2937 Ga0466959_0007471
2938 Ga0466959_0026026
2939 Ga0466959_0046437
2940 Ga0466959_0114087
2941 Ga0466959_0236757
2942 Ga0466959_0322926
2943 Ga0451576_0298183
2944 Ga0451576_0316976
2945 Ga0466958_0000112
2946 Ga0466958_0015179
2947 Ga0466958_0028848
2948 Ga0466958_0041070
2949 Ga0466958_0062214
2950 Ga0466967_0054646
2951 Ga0466967_0079223
2952 Ga0466967_0082683
2953 Ga0466967_0086801
2954 Ga0466967_0109675
2955 Ga0466967_0170652
2956 Ga0466967_0210302
2957 Ga0466967_0217642
2958 Ga0466967_0251882
2959 Ga0466967_0326818
2960 Ga0466967_0342293
2961 Ga0495603_0076531
2962 Ga0495590_0001289
2963 Ga0495638_0000714
2964 Ga0495638_0013012
2965 Ga0495638_0071193
2966 Ga0495580_0002152
2967 Ga0495616_0001437
2968 Ga0495643_0147815
2969 Ga0495648_0041969
2970 Ga0495663_0010721
2971 Ga0495663_0037608
2972 Ga0495598_0009154
2973 Ga0495598_0009515
2974 Ga0495621_0000828
2975 Ga0495621_0001056
2976 Ga0495621_0023643
2977 Ga0495633_0019671
2978 Ga0495625_0003242
2979 Ga0495625_0056158
2980 Ga0495625_0121124
2981 Ga0495623_0049158
2982 Ga0495669_0001546
2983 Ga0495669_0006368
2984 Ga0495669_0008299
2985 Ga0495669_0020004
2986 Ga0495669_0031978
2987 Ga0495669_0052234
2988 Ga0495669_0118758
2989 Ga0495670_0002211
2990 Ga0495670_0028894
2991 Ga0495670_0096201
2992 Ga0495649_0001764
2993 Ga0495680_0271034
2994 Ga0495677_0051924
2995 Ga0495677_0087975
2996 Ga0496100_0012082
2997 Ga0496100_0023756
2998 Ga0496100_0034133
2999 Ga0496100_0294497
3000 Ga0496101_0003206
3001 Ga0496101_0006265
3002 Ga0496101_0010717
3003 Ga0496101_0311987
3004 Ga0496101_0538732
3005 Ga0496102_0021186
3006 Ga0496102_0055285
3007 Ga0496102_0089784
3008 Ga0496102_0115519
3009 Ga0496103_0044380
3010 Ga0496103_0189132
3011 Ga0496103_0335265
3012 Ga0496105_0014011
3013 Ga0496105_0440672
3014 Ga0496106_0010145
3015 Ga0496106_0040445
3016 Ga0496106_0040837
3017 Ga0496106_0147975
3018 Ga0496106_0193664
3019 Ga0496107_0001288
3020 Ga0496107_0013115
3021 Ga0496107_0028262
3022 Ga0496107_0068823
3023 Ga0496107_0102333
3024 Ga0496107_0122857
3025 Ga0496107_0133507
3026 Ga0496107_0337987
3027 Ga0496108_0000372
3028 Ga0496108_0009427
3029 Ga0496108_0020262
3030 Ga0496108_0055426
3031 Ga0496108_0078996
3032 Ga0496109_0001137
3033 Ga0496109_0001325
3034 Ga0496109_0057599
3035 Ga0496109_0061301
3036 Ga0496109_0103348
3037 Ga0496109_0234385
3038 Ga0496110_0009927
3039 Ga0496110_0016678
3040 Ga0496110_0023560
3041 Ga0496110_0031418
3042 Ga0496110_0128958
3043 Ga0496110_0517101
3044 Ga0496111_0002146
3045 Ga0496111_0009171
3046 Ga0496111_0021784
3047 Ga0496111_0034718
3048 Ga0496111_0085202
3049 Ga0496111_0149004
3050 Ga0496111_0265164
3051 Ga0496111_0353202
3052 Ga0496112_0007892
3053 Ga0496112_0012135
3054 Ga0496112_0025396
3055 Ga0496112_0049413
3056 Ga0496112_0062421
3057 Ga0496112_0142590
3058 Ga0496112_0156129
3059 Ga0496113_0072071
3060 Ga0496113_0167037
3061 Ga0496114_0000023
3062 Ga0496114_0009720
3063 Ga0496114_0025285
3064 Ga0496114_0091099
3065 Ga0496115_0004751
3066 Ga0496115_0006554
3067 Ga0496115_0028270
3068 Ga0496115_0411564
3069 Ga0496117_0000156
3070 Ga0496118_0000005
3071 Ga0496119_0001995
3072 Ga0496119_0027338
3073 Ga0496119_0096703
3074 Ga0496120_0000173
3075 Ga0496120_0013758
3076 Ga0496120_0043030
3077 Ga0496121_0000371
3078 Ga0496121_0000441
3079 Ga0496121_0002693
3080 Ga0496121_0004828
3081 Ga0496121_0045899
3082 Ga0496124_0019875
3083 Ga0496124_0158874
3084 Ga0496125_0001476
3085 Ga0496125_0003558
3086 Ga0496125_0075785
3087 Ga0496125_0264987
3088 Ga0496126_0003036
3089 Ga0496126_0014156
3090 Ga0496126_0018733
3091 Ga0496126_0405328
3092 Ga0496126_0490316
3093 Ga0495678_037576
3094 Ga0501298_033164
3095 Ga0501032_0000083
3096 Ga0501032_0002358
3097 Ga0501033_0016156
3098 Ga0501033_0147790
3099 Ga0501034_0000001
3100 Ga0501034_0028292
3101 Ga0501034_0809472
3102 Ga0501036_0008712
3103 Ga0501037_0000785
3104 Ga0501038_0000644
3105 Ga0501038_0001615
3106 Ga0501039_0000033
3107 Ga0501039_0001268
3108 Ga0501042_0366238
3109 Ga0501043_0002273
3110 Ga0501046_0002264
3111 Ga0501047_0039919
3112 Ga0501047_0363352
3113 Ga0501048_0008512
3114 Ga0501067_0001478
3115 Ga0501068_0211139
3116 Ga0501069_0000429
3117 Ga0501070_0006112
3118 Ga0501071_0387250
3119 Ga0501071_0517305
3120 Ga0501073_0060098
3121 Ga0501074_0006905
3122 Ga0501075_0245951
3123 Ga0501202_008106
3124 Ga0501216_017267
3125 Ga0501216_020765
3126 Ga0501217_006360
3127 Ga0501222_001194
3128 Ga0501224_007120
3129 Ga0501233_008812
3130 Ga0501235_003638
3131 Ga0501235_023488
3132 Ga0501236_009768
3133 Ga0501249_001844
3134 Ga0501250_002363
3135 Ga0501253_004534
3136 Ga0501253_048118
3137 Ga0501257_021294
3138 Ga0501221_001116
3139 Ga0501221_002374
3140 Ga0501221_005121
3141 Ga0501225_0029196
3142 Ga0501229_002174
3143 Ga0501245_004736
3144 Ga0501079_0050464
3145 Ga0501080_0004541
3146 Ga0501081_0172310
3147 Ga0501083_0002945
3148 Ga0501083_0029619
3149 Ga0501083_0248205
3150 Ga0501262_008854
3151 Ga0501263_001889
3152 Ga0501267_008154
3153 Ga0501268_001501
3154 Ga0501270_002379
3155 Ga0501272_005506
3156 Ga0501035_0001739
3157 Ga0501044_0004784
3158 Ga0501044_0064458
3159 Ga0501044_0214603
3160 Ga0501045_0135362
3161 Ga0501212_012838
3162 nmdc:mga03683_58163_c1
3163 nmdc:mga00v17_55457_c1
3164 nmdc:mga07m45_22427_c1
3165 nmdc:mga07m45_27400_c1
3166 nmdc:mga09592_197218_c1
3167 nmdc:mga0qj67_39866_c1
3168 nmdc:mga08y16_160509_c1
3169 nmdc:mga08y16_494019_c1
3170 nmdc:mga08x19_132574_c1
3171 Ga0500643_000366
3172 Ga0500644_0004471
3173 Ga0500646_0017655
3174 Ga0500583_0060020
3175 Ga0500557_000019
3176 Ga0500591_006428
3177 Ga0500592_000162
3178 Ga0500597_002257
3179 Ga0500658_0000291
3180 Ga0500568_0000140
3181 Ga0500573_0000363
3182 Ga0500616_0006277
3183 Ga0500622_0061870
3184 Ga0500624_000077
3185 Ga0500637_0000931
3186 Ga0500637_0043799
3187 Ga0500637_0049083
3188 Ga0500637_0128958
3189 Ga0500611_000980
3190 Ga0501084_0009704
3191 Ga0501082_0186147
3192 Ga0501082_0198675
3193 Ga0466962_0000589
3194 Ga0466962_0010534
3195 Ga0466962_0025028
3196 2513593995
3197 2514590293
3198 2643746064
3199 2643937021
3200 2644218007
3201 2644258253
3202 2644318186
3203 2739057144
3204 2852654024
3205 2896429963
3206 2912967717
3207 2939655827
3208 2996341144
3209 8055878932
3210 8057101270

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

57

286

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9959 18 262
4juq-assembly1.cif.gz_A pseudomonas aeruginosa metap t2n mutant, in mn form 0.995 18 266
3tb5-assembly2.cif.gz_B crystal structure of the enterococcus faecalis methionine aminopeptidase apo form 0.9868 18 262
1o0x-assembly1.cif.gz_A crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution 0.9834 18 262
2b3k-assembly1.cif.gz_A crystal structure of human methionine aminopeptidase type i in the holo form 0.9825 18 265
ID Description Score Start End Superfamily
af_Q6Z3V9_1_121_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9893 30 140 3.90.230.10
1o0xA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9834 18 262 3.90.230.10
af_P9WK19_6_284_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9819 20 262 3.90.230.10
4fukB01 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9796 25 267 3.90.230.10
4iecA01 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9788 20 262 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A6B0TU55-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9996 30 269 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A258LEB9-F1-model_v4 Methionine aminopeptidase (EC 3.4.11.18) 0.9989 71 274 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A7Z1N8M5-F1-model_v4 Methionine aminopeptidase (EC 3.4.11.18) 0.9989 49 204 GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A6P0I4I0-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9987 30 262 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A1Z4VBK9-F1-model_v4 deleted 0.9981 18 262

Map