F495080

General Info

Members Datasets Scaffolds Average Seq Length
1621 626 1620 69

Family's Representative Sequence

Representative Sequence 3300003792|Ga0055540_1001991|Ga0055540_10019912
Length 85
Sequence MNTGTVKWFNSSKGFGFIQPDDGSTDVFVHISAVERAGLSSLSDGQKIVYELVRDKKSARIPPTACAQPNSPLACLTTDVWQPSA

Samples

Sample ID Description Type Environment
1 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
11 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
12 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
13 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
14 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
15 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
16 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
17 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
18 3300002868 Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_10 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
21 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
23 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
27 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
28 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
29 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
32 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
34 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
35 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
36 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
37 3300003717 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_9 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
38 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
39 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
40 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
41 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
42 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
43 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
44 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
45 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
46 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
47 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
48 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
49 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
50 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
51 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
52 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
53 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
54 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
55 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
56 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
57 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
58 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
59 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
60 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
61 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
62 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
63 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
64 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
65 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
66 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
67 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
68 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
69 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
70 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
71 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
72 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
73 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
74 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
75 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
76 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
77 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
78 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
79 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
80 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
81 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
82 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
83 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
84 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
85 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
86 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
87 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
88 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
89 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
90 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
91 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
92 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
93 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
94 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
95 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
96 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
97 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
98 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
99 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
100 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
101 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
102 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
103 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
104 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
105 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
106 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
107 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
108 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
109 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
110 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
111 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
112 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
113 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
114 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
115 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
116 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
117 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
118 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
119 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
120 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
121 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
122 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
123 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
124 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
125 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
126 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
127 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
128 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
129 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
130 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
131 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
132 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
133 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
134 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
135 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
136 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
137 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
138 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
139 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
140 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
141 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
142 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
143 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
144 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
145 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
146 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
147 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
148 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
149 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
150 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
151 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
152 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
153 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
154 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
155 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
156 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
157 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
158 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
159 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
160 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
161 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
162 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
163 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
164 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
165 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
166 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
168 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
169 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
170 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
171 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
172 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
173 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
174 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
175 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
176 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
177 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
178 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
179 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
180 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
181 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
182 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
183 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
184 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
185 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
186 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
188 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
189 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
190 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
192 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
193 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
194 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
195 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
196 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
197 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
198 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
199 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
200 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
201 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
202 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
203 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
204 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
206 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
207 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
208 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
209 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
210 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
212 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
213 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
214 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
215 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
217 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
218 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
219 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
221 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
222 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
223 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
225 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
226 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
290 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
291 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
293 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
295 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
296 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
300 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
301 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
302 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
303 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
304 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
310 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
311 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
312 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
313 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
314 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
315 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
316 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
317 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
318 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
319 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
320 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
321 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
322 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
323 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
324 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
325 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
326 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
327 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
328 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
329 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
330 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
331 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
332 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
333 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
334 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
335 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
336 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
339 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
340 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
341 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
342 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
343 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
344 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
345 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
346 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
347 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
348 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
349 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
350 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
351 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
352 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
353 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
354 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
355 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
356 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
357 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
358 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
359 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
360 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
361 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
362 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
363 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
364 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
365 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
366 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
367 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
368 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
369 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
370 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
371 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
372 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
373 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
374 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
375 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
376 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
377 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
378 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
379 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
380 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
381 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
382 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
383 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
384 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
385 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
386 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
387 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
388 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
389 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
390 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
391 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
392 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
393 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
394 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
395 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
396 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
397 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
398 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
399 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
400 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
401 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
402 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
403 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
404 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
405 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
406 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
407 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
408 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
409 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
410 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
411 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
412 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
413 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
414 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
415 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
416 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
417 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
418 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
419 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
420 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
421 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
422 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
423 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
424 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
425 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
426 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
427 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
428 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
429 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
430 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
431 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
432 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
433 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
434 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
435 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
436 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
437 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
438 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
439 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
440 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
441 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
442 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
443 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
444 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
445 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
446 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
447 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
448 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
449 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
450 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
451 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
452 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
453 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
454 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
455 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
456 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
457 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
458 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
459 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
460 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
461 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
462 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
463 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
464 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
465 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
466 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
467 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
468 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
469 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
470 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
471 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
472 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
473 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
474 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
475 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
476 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
477 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
478 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
479 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
480 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
481 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
482 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
483 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
484 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
485 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
486 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
487 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
488 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
489 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
490 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
491 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
492 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
493 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
494 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
495 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
496 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
497 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
498 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
499 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
500 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
501 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
502 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
503 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
504 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
505 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
506 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
507 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
508 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
509 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
510 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
511 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
512 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
513 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
514 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
515 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
516 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
517 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
518 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
519 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
520 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
521 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
522 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
523 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
524 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
525 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
526 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
527 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
528 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
529 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
530 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
531 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
532 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
533 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
534 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
535 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
536 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
537 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
538 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
539 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
540 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
541 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
542 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
543 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
544 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
545 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
546 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
547 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
548 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
549 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
550 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
551 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
552 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
553 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
554 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
555 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
556 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
557 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
558 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
559 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
560 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
561 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
562 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
563 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
564 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
565 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
566 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
567 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
568 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
569 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
570 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
571 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
572 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
573 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
574 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
575 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
576 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
577 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
578 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
579 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
580 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
581 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
582 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
583 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
584 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
585 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
586 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
587 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
588 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
589 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
590 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
591 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
592 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
593 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
594 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
595 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
596 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
597 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
598 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
599 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
600 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
601 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
602 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
603 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
604 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
605 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
606 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
607 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
608 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
609 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
610 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
611 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
612 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
613 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
614 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
615 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
616 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
617 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
618 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
619 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
620 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
621 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
622 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
623 3300060245 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 6R_CD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
624 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
625 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
626 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.63
Metatranscriptomes 5.31
Isolates 0.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.84
Nodule 1.17
Rhizoplane 2.04
Rhizosphere 69.71
Stem 0
Stem Tuber 0
Unclassified 10.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1008199 3300000549 Bacteria 1274
2 JGI24752J21851_1010252 3300001976 Bacteria 1223
3 JGI24740J21852_10079157 3300001979 Bacteria 864
4 JGI24740J21852_10129760 3300001979 Bacteria 629
5 JGI24740J21852_10132098 3300001979 Bacteria 623
6 JGI24739J22299_10032005 3300001989 Bacteria 1814
7 JGI24739J22299_10045697 3300001989 Bacteria 1436
8 JGI24739J22299_10085716 3300001989 Bacteria 963
9 JGI24739J22299_10116097 3300001989 Bacteria 801
10 JGI24737J22298_10187079 3300001990 Bacteria 611
11 JGI24737J22298_10189199 3300001990 Bacteria 608
12 JGI24735J21928_10101112 3300002067 Bacteria 828
13 JGI24735J21928_10163373 3300002067 Bacteria 643
14 JGI24748J21848_1043570 3300002074 Bacteria 575
15 JGI24738J21930_10024573 3300002075 Bacteria 1239
16 JGI24738J21930_10107785 3300002075 Bacteria 598
17 JGI25155J39150_1000011 3300002704 Bacteria 207685
18 JGI25155J39150_1000330 3300002704 Bacteria 15499
19 JGI25156J39149_1000030 3300002705 Bacteria 126029
20 JGI25156J39149_1000795 3300002705 Bacteria 16198
21 JGI25156J39149_1002222 3300002705 Bacteria 7189
22 JGI25156J39149_1051441 3300002705 Bacteria 539
23 JGI25162J39368_1000069 3300002737 Bacteria 125244
24 JGI25162J39368_1000476 3300002737 Bacteria 30796
25 JGI25154J39366_1000289 3300002738 Bacteria 30213
26 JGI25154J39366_1000696 3300002738 Bacteria 15400
27 JGI25154J39366_1020412 3300002738 Bacteria 635
28 JGI25158J39367_1000188 3300002739 Bacteria 14642
29 JGI25157J39369_1000010 3300002741 Bacteria 207685
30 JGI25157J39369_1000786 3300002741 Bacteria 16228
31 JGI25157J39369_1002208 3300002741 Bacteria 5323
32 JGI25152J39213_1000001 3300002773 Bacteria 224104
33 JGI25152J39213_1000013 3300002773 Bacteria 123999
34 JGI25152J39213_1000015 3300002773 Bacteria 120605
35 JGI25152J39213_1000301 3300002773 Bacteria 31895
36 JGI25152J39213_1004424 3300002773 Bacteria 4430
37 JGI25150J39212_1000007 3300002774 Bacteria 253635
38 JGI25150J39212_1000810 3300002774 Bacteria 10584
39 Ga0006767J43181_101308 3300002868 Bacteria 584
40 Ga0006763J43179_100527 3300002870 Bacteria 944
41 JGI25159J45721_1000133 3300002987 Bacteria 35035
42 JGI25159J45721_1001957 3300002987 Bacteria 8207
43 JGI25159J45721_1002071 3300002987 Bacteria 7912
44 Ga0006759J45824_1001793 3300003163 Bacteria 1115
45 JGI25151J46595_10000013 3300003187 Bacteria 253635
46 JGI25151J46595_10000110 3300003187 Bacteria 111972
47 JGI25151J46595_10005211 3300003187 Bacteria 6743
48 JGI25151J46595_10022787 3300003187 Bacteria 2593
49 JGI25151J46595_10053839 3300003187 Bacteria 1340
50 JGI25165J46597_1000006 3300003214 Bacteria 529784
51 JGI25165J46597_1000018 3300003214 Bacteria 374701
52 JGI25165J46597_1000068 3300003214 Bacteria 196201
53 JGI25153J46596_10000378 3300003215 Bacteria 30471
54 JGI25153J46596_10000437 3300003215 Bacteria 26782
55 JGI25153J46596_10001081 3300003215 Bacteria 16614
56 JGI25153J46596_10047561 3300003215 Bacteria 1261
57 Ga0006758J48902_1000593 3300003300 Bacteria 1062
58 Ga0006777J48905_1004194 3300003308 Bacteria 966
59 rootH1_10061686 3300003316 Bacteria 2225
60 rootH2_10039599 3300003320 Bacteria 12140
61 rootH2_10130185 3300003320 Bacteria 6703
62 rootL2_10002287 3300003322 Bacteria 11668
63 rootL2_10149362 3300003322 Bacteria 4895
64 rootH1_10078983 3300003323 Bacteria 7255
65 JGI25160J50197_1000300 3300003354 Bacteria 34955
66 JGI25160J50197_1067736 3300003354 Bacteria 690
67 JGI25407J50210_10167016 3300003373 Bacteria 542
68 JGI25161J50226_1000026 3300003374 Bacteria 146134
69 Ga0007427J51700_100616 3300003559 Bacteria 2056
70 Ga0006562J51391_1000820 3300003578 Bacteria 2855
71 Ga0032354_1014652 3300003693 Bacteria 2147
72 Ga0032354_1023888 3300003693 Bacteria 556
73 Ga0032354_1032325 3300003693 Bacteria 741
74 Ga0006766_105963 3300003717 Bacteria 712
75 Ga0006780_1010778 3300003735 Bacteria 1380
76 Ga0055539_1003524 3300003752 Bacteria 2179
77 Ga0055526_1000385 3300003771 Bacteria 35743
78 Ga0055526_1000755 3300003771 Bacteria 24181
79 Ga0055526_1000922 3300003771 Bacteria 21824
80 Ga0055526_1014497 3300003771 Bacteria 3238
81 Ga0055526_1022880 3300003771 Bacteria 2106
82 Ga0055526_1040784 3300003771 Bacteria 1165
83 Ga0055524_1000208 3300003775 Bacteria 63030
84 Ga0055524_1002743 3300003775 Bacteria 8886
85 Ga0055524_1002804 3300003775 Bacteria 8750
86 Ga0055524_1005658 3300003775 Bacteria 5543
87 Ga0055524_1043618 3300003775 Bacteria 1100
88 Ga0055536_1008548 3300003781 Bacteria 4385
89 Ga0055534_1016321 3300003784 Bacteria 1336
90 Ga0055528_1000716 3300003790 Bacteria 23431
91 Ga0055528_1001208 3300003790 Bacteria 16552
92 Ga0055528_1005621 3300003790 Bacteria 5795
93 Ga0055528_1011838 3300003790 Bacteria 3429
94 Ga0055528_1011997 3300003790 Bacteria 3395
95 Ga0055530_10009766 3300003791 Bacteria 3634
96 Ga0055540_1001255 3300003792 Bacteria 15521
97 Ga0055540_1001932 3300003792 Bacteria 11586
98 Ga0055540_1001991 3300003792 Bacteria 11414
99 Ga0055540_1090854 3300003792 Bacteria 576
100 Ga0055531_10008208 3300003794 Bacteria 5557
101 Ga0055531_10064848 3300003794 Bacteria 871
102 Ga0055531_10091833 3300003794 Bacteria 642
103 Ga0058692_1001660 3300003856 Bacteria 7987
104 Ga0058692_1002829 3300003856 Bacteria 5688
105 Ga0058692_1050931 3300003856 Bacteria 686
106 Ga0055543_1000085 3300004625 Bacteria 81274
107 Ga0055543_1006378 3300004625 Bacteria 2859
108 Ga0055543_1020485 3300004625 Bacteria 1214
109 Ga0058859_11782138 3300004798 Bacteria 835
110 Ga0065165_1000777 3300005262 Bacteria 42783
111 Ga0065165_1001054 3300005262 Bacteria 33088
112 Ga0065165_1001529 3300005262 Bacteria 24281
113 Ga0065165_1003064 3300005262 Bacteria 12513
114 Ga0065165_1006194 3300005262 Bacteria 6383
115 Ga0065704_10006703 3300005289 Bacteria 2489
116 Ga0070658_10039686 3300005327 Bacteria 3798
117 Ga0070658_10118807 3300005327 Bacteria 2195
118 Ga0070658_10272484 3300005327 Bacteria 1440
119 Ga0070676_10233713 3300005328 Bacteria 1219
120 Ga0070676_10657123 3300005328 Bacteria 761
121 Ga0070683_100061536 3300005329 Bacteria 3491
122 Ga0070683_101343506 3300005329 Bacteria 687
123 Ga0070690_100637002 3300005330 Bacteria 813
124 Ga0070670_100327420 3300005331 Bacteria 1343
125 Ga0070670_100492354 3300005331 Bacteria 1089
126 Ga0070670_101915433 3300005331 Bacteria 546
127 Ga0068869_100780617 3300005334 Bacteria 820
128 Ga0070666_10121615 3300005335 Bacteria 1810
129 Ga0070666_10488704 3300005335 Bacteria 892
130 Ga0070666_10666486 3300005335 Bacteria 762
131 Ga0070680_100005174 3300005336 Bacteria 9867
132 Ga0070680_100025420 3300005336 Bacteria 4733
133 Ga0070680_100062215 3300005336 Bacteria 3056
134 Ga0070680_100068383 3300005336 Bacteria 2915
135 Ga0070682_100021284 3300005337 Bacteria 3824
136 Ga0070682_100158227 3300005337 Bacteria 1562
137 Ga0070682_100459445 3300005337 Bacteria 977
138 Ga0070682_100577631 3300005337 Bacteria 884
139 Ga0070682_100697167 3300005337 Bacteria 814
140 Ga0070682_100865942 3300005337 Bacteria 739
141 Ga0070682_101211643 3300005337 Bacteria 638
142 Ga0070682_101505544 3300005337 Bacteria 579
143 Ga0068868_100234537 3300005338 Bacteria 1540
144 Ga0068868_101114712 3300005338 Bacteria 726
145 Ga0070660_100004682 3300005339 Bacteria 9471
146 Ga0070660_100411100 3300005339 Bacteria 1120
147 Ga0070689_100294893 3300005340 Bacteria 1349
148 Ga0070691_10423161 3300005341 Bacteria 755
149 Ga0070691_10912275 3300005341 Bacteria 543
150 Ga0070661_100090662 3300005344 Bacteria 2264
151 Ga0070661_101296377 3300005344 Bacteria 611
152 Ga0070661_101786598 3300005344 Bacteria 522
153 Ga0070692_10829648 3300005345 Bacteria 634
154 Ga0070668_100022443 3300005347 Bacteria 4771
155 Ga0070668_100336439 3300005347 Bacteria 1274
156 Ga0070668_100549735 3300005347 Bacteria 1005
157 Ga0070668_100757294 3300005347 Bacteria 860
158 Ga0070668_100828021 3300005347 Bacteria 824
159 Ga0070668_100996973 3300005347 Bacteria 753
160 Ga0070668_101503784 3300005347 Bacteria 615
161 Ga0070668_101809691 3300005347 Bacteria 562
162 Ga0070669_100410468 3300005353 Bacteria 1110
163 Ga0070669_101031725 3300005353 Bacteria 706
164 Ga0070669_101102288 3300005353 Bacteria 684
165 Ga0070669_101622792 3300005353 Bacteria 563
166 Ga0070671_100209677 3300005355 Bacteria 1652
167 Ga0070671_101754663 3300005355 Bacteria 551
168 Ga0070671_101777485 3300005355 Bacteria 548
169 Ga0070674_100228616 3300005356 Bacteria 1450
170 Ga0070674_100902288 3300005356 Bacteria 770
171 Ga0070674_101104155 3300005356 Bacteria 700
172 Ga0070674_101274462 3300005356 Bacteria 655
173 Ga0070673_100189893 3300005364 Bacteria 1764
174 Ga0070673_101925350 3300005364 Bacteria 561
175 Ga0070688_100206308 3300005365 Bacteria 1378
176 Ga0070688_100406709 3300005365 Bacteria 1008
177 Ga0070688_100591804 3300005365 Bacteria 848
178 Ga0070688_101487784 3300005365 Bacteria 551
179 Ga0070659_100115257 3300005366 Bacteria 2172
180 Ga0070659_100322412 3300005366 Bacteria 1292
181 Ga0070659_100927678 3300005366 Bacteria 762
182 Ga0070659_101113855 3300005366 Bacteria 696
183 Ga0070659_101135034 3300005366 Bacteria 690
184 Ga0070667_100602799 3300005367 Bacteria 1012
185 Ga0070667_100842051 3300005367 Bacteria 852
186 Ga0070667_100897904 3300005367 Bacteria 825
187 Ga0070667_101218124 3300005367 Bacteria 705
188 Ga0070709_10016520 3300005434 Bacteria 4216
189 Ga0070709_10035902 3300005434 Bacteria 3015
190 Ga0070709_10063889 3300005434 Bacteria 2352
191 Ga0070709_10134473 3300005434 Bacteria 1692
192 Ga0070709_10156008 3300005434 Bacteria 1582
193 Ga0070709_10179578 3300005434 Bacteria 1485
194 Ga0070714_100024895 3300005435 Bacteria 4934
195 Ga0070714_100030577 3300005435 Bacteria 4484
196 Ga0070714_100102121 3300005435 Bacteria 2528
197 Ga0070714_100130483 3300005435 Bacteria 2246
198 Ga0070713_100003931 3300005436 Bacteria 9866
199 Ga0070713_100017989 3300005436 Bacteria 5365
200 Ga0070713_100090069 3300005436 Bacteria 2636
201 Ga0070713_101698664 3300005436 Bacteria 613
202 Ga0070710_10001221 3300005437 Bacteria 12167
203 Ga0070710_10006078 3300005437 Bacteria 5774
204 Ga0070710_10011233 3300005437 Bacteria 4421
205 Ga0070710_10302347 3300005437 Bacteria 1044
206 Ga0070710_11253951 3300005437 Bacteria 550
207 Ga0070701_10508213 3300005438 Bacteria 784
208 Ga0070711_100002618 3300005439 Bacteria 10300
209 Ga0070711_100074580 3300005439 Bacteria 2400
210 Ga0070711_100167066 3300005439 Bacteria 1673
211 Ga0070711_100476977 3300005439 Bacteria 1025
212 Ga0070711_100599482 3300005439 Bacteria 919
213 Ga0070705_100366232 3300005440 Bacteria 1056
214 Ga0070705_101254736 3300005440 Bacteria 613
215 Ga0070700_100306874 3300005441 Bacteria 1161
216 Ga0070700_100347399 3300005441 Bacteria 1099
217 Ga0070700_101144688 3300005441 Bacteria 647
218 Ga0070694_101700448 3300005444 Bacteria 537
219 Ga0070708_100063270 3300005445 Bacteria 3312
220 Ga0070663_100164844 3300005455 Bacteria 1708
221 Ga0070663_100417081 3300005455 Bacteria 1100
222 Ga0070663_100521433 3300005455 Bacteria 989
223 Ga0070663_100889103 3300005455 Bacteria 769
224 Ga0070663_100896973 3300005455 Bacteria 765
225 Ga0070663_101061914 3300005455 Bacteria 707
226 Ga0070663_101086581 3300005455 Bacteria 699
227 Ga0070663_101215199 3300005455 Bacteria 663
228 Ga0070663_101545680 3300005455 Bacteria 591
229 Ga0070663_102045993 3300005455 Bacteria 516
230 Ga0070678_100317287 3300005456 Bacteria 1330
231 Ga0070678_100687664 3300005456 Bacteria 920
232 Ga0070678_100774144 3300005456 Bacteria 869
233 Ga0070678_100791054 3300005456 Bacteria 861
234 Ga0070678_101417730 3300005456 Bacteria 649
235 Ga0070662_100063389 3300005457 Bacteria 2704
236 Ga0070662_100137147 3300005457 Bacteria 1892
237 Ga0070662_100590274 3300005457 Bacteria 934
238 Ga0070662_100819153 3300005457 Bacteria 792
239 Ga0070681_10010435 3300005458 Bacteria 9175
240 Ga0070681_10014949 3300005458 Bacteria 7717
241 Ga0070681_10101039 3300005458 Bacteria 2830
242 Ga0068867_100076157 3300005459 Bacteria 2518
243 Ga0068867_100872840 3300005459 Bacteria 807
244 Ga0068867_102342585 3300005459 Bacteria 508
245 Ga0070706_100848581 3300005467 Bacteria 845
246 Ga0070706_101684089 3300005467 Bacteria 578
247 Ga0070707_100057080 3300005468 Bacteria 3746
248 Ga0070707_102201363 3300005468 Bacteria 519
249 Ga0070698_100091164 3300005471 Bacteria 3031
250 Ga0070698_100313544 3300005471 Bacteria 1499
251 Ga0070698_100496052 3300005471 Bacteria 1159
252 Ga0070699_100142677 3300005518 Bacteria 2116
253 Ga0070679_100000584 3300005530 Bacteria 30891
254 Ga0070679_100075690 3300005530 Bacteria 3355
255 Ga0070679_100101247 3300005530 Bacteria 2868
256 Ga0070679_100346942 3300005530 Bacteria 1432
257 Ga0070679_100777677 3300005530 Bacteria 900
258 Ga0070679_101969212 3300005530 Bacteria 533
259 Ga0070684_100043633 3300005535 Bacteria 3873
260 Ga0070684_100607120 3300005535 Bacteria 1017
261 Ga0070684_101609607 3300005535 Bacteria 613
262 Ga0070697_100338087 3300005536 Bacteria 1299
263 Ga0070697_100866005 3300005536 Bacteria 801
264 Ga0068853_100007383 3300005539 Bacteria 8794
265 Ga0068853_100111118 3300005539 Bacteria 2435
266 Ga0068853_100150401 3300005539 Bacteria 2095
267 Ga0068853_100232122 3300005539 Bacteria 1688
268 Ga0068853_100473679 3300005539 Bacteria 1180
269 Ga0068853_102286243 3300005539 Bacteria 524
270 Ga0070672_100434179 3300005543 Bacteria 1129
271 Ga0070672_101108436 3300005543 Bacteria 703
272 Ga0070672_101142100 3300005543 Bacteria 693
273 Ga0070672_101912571 3300005543 Bacteria 534
274 Ga0070696_101009071 3300005546 Bacteria 696
275 Ga0070665_100010030 3300005548 Bacteria 9581
276 Ga0070665_100011730 3300005548 Bacteria 8852
277 Ga0070665_100129470 3300005548 Bacteria 2526
278 Ga0070665_100171160 3300005548 Bacteria 2173
279 Ga0070665_100275615 3300005548 Bacteria 1684
280 Ga0070665_100430736 3300005548 Bacteria 1328
281 Ga0070665_100627161 3300005548 Bacteria 1088
282 Ga0070665_100885572 3300005548 Bacteria 905
283 Ga0070665_101051388 3300005548 Bacteria 826
284 Ga0070665_101066579 3300005548 Bacteria 820
285 Ga0070665_101092863 3300005548 Bacteria 809
286 Ga0070704_100666717 3300005549 Bacteria 920
287 Ga0070704_100747081 3300005549 Bacteria 871
288 Ga0068855_100023319 3300005563 Bacteria 7411
289 Ga0068855_100119356 3300005563 Bacteria 3019
290 Ga0068855_100167683 3300005563 Bacteria 2488
291 Ga0068855_100749453 3300005563 Bacteria 1041
292 Ga0068855_101377753 3300005563 Bacteria 728
293 Ga0068855_101713595 3300005563 Bacteria 640
294 Ga0070664_100370331 3300005564 Bacteria 1306
295 Ga0070664_101253071 3300005564 Bacteria 700
296 Ga0068857_100038424 3300005577 Bacteria 4239
297 Ga0068857_100110809 3300005577 Bacteria 2467
298 Ga0068857_100439499 3300005577 Bacteria 1218
299 Ga0068857_101954682 3300005577 Bacteria 575
300 Ga0068854_100315988 3300005578 Bacteria 1268
301 Ga0068854_101426848 3300005578 Bacteria 627
302 Ga0068854_102143692 3300005578 Bacteria 516
303 Ga0068856_100000651 3300005614 Bacteria 37648
304 Ga0068856_100036991 3300005614 Bacteria 4788
305 Ga0068856_100170919 3300005614 Bacteria 2185
306 Ga0068856_100361700 3300005614 Bacteria 1470
307 Ga0068856_100739727 3300005614 Bacteria 1003
308 Ga0068856_100886621 3300005614 Bacteria 911
309 Ga0068856_101005596 3300005614 Bacteria 852
310 Ga0068856_101019078 3300005614 Bacteria 846
311 Ga0068852_100002449 3300005616 Bacteria 12781
312 Ga0068852_100583092 3300005616 Bacteria 1121
313 Ga0068852_100678940 3300005616 Bacteria 1039
314 Ga0068852_100863990 3300005616 Bacteria 920
315 Ga0068852_101991358 3300005616 Bacteria 603
316 Ga0068859_100105112 3300005617 Bacteria 2883
317 Ga0068859_100321492 3300005617 Bacteria 1641
318 Ga0068859_100940427 3300005617 Bacteria 948
319 Ga0068864_100884327 3300005618 Bacteria 881
320 Ga0068864_101023014 3300005618 Bacteria 820
321 Ga0068866_10524739 3300005718 Bacteria 787
322 Ga0068866_10611223 3300005718 Bacteria 737
323 Ga0068861_100152859 3300005719 Bacteria 1895
324 Ga0068861_102158497 3300005719 Bacteria 557
325 Ga0068851_10002569 3300005834 Bacteria 7987
326 Ga0068851_10902872 3300005834 Bacteria 553
327 Ga0068851_10912857 3300005834 Bacteria 551
328 Ga0068870_11343312 3300005840 Bacteria 522
329 Ga0068863_100385697 3300005841 Bacteria 1369
330 Ga0068863_100712823 3300005841 Bacteria 998
331 Ga0068863_101067590 3300005841 Bacteria 812
332 Ga0068858_100059111 3300005842 Bacteria 3543
333 Ga0068858_100156342 3300005842 Bacteria 2145
334 Ga0068858_100565271 3300005842 Bacteria 1101
335 Ga0068858_101235566 3300005842 Bacteria 735
336 Ga0068860_101297974 3300005843 Bacteria 749
337 Ga0068862_100941012 3300005844 Bacteria 851
338 Ga0068862_101166870 3300005844 Bacteria 767
339 Ga0068862_101402027 3300005844 Bacteria 702
340 Ga0068862_101436506 3300005844 Bacteria 694
341 Ga0081455_10371635 3300005937 Bacteria 1002
342 Ga0081538_10039548 3300005981 Bacteria 3023
343 Ga0081540_1234082 3300005983 Bacteria 647
344 Ga0081540_1252620 3300005983 Bacteria 615
345 Ga0081540_1325924 3300005983 Bacteria 526
346 Ga0070717_10226297 3300006028 Bacteria 1646
347 Ga0070717_11084846 3300006028 Bacteria 729
348 Ga0075365_10077588 3300006038 Bacteria 2244
349 Ga0075365_10311375 3300006038 Bacteria 1108
350 Ga0075365_10431488 3300006038 Bacteria 930
351 Ga0075365_10435417 3300006038 Bacteria 926
352 Ga0075365_10441009 3300006038 Bacteria 919
353 Ga0075365_10607957 3300006038 Bacteria 773
354 Ga0075365_10845685 3300006038 Bacteria 645
355 Ga0075365_11018704 3300006038 Bacteria 583
356 Ga0075368_10001274 3300006042 Bacteria 7977
357 Ga0075368_10019912 3300006042 Bacteria 2536
358 Ga0075368_10073329 3300006042 Bacteria 1385
359 Ga0075368_10207272 3300006042 Bacteria 830
360 Ga0075368_10488389 3300006042 Bacteria 549
361 Ga0075363_100006553 3300006048 Bacteria 5301
362 Ga0075363_100045350 3300006048 Bacteria 2331
363 Ga0075363_100341400 3300006048 Bacteria 873
364 Ga0075364_10000320 3300006051 Bacteria 23654
365 Ga0075364_10027644 3300006051 Bacteria 3625
366 Ga0075364_10069975 3300006051 Bacteria 2309
367 Ga0075364_10120941 3300006051 Bacteria 1752
368 Ga0075364_10149731 3300006051 Bacteria 1572
369 Ga0075364_10333638 3300006051 Bacteria 1033
370 Ga0075364_10557811 3300006051 Bacteria 783
371 Ga0075364_10753009 3300006051 Bacteria 664
372 Ga0075364_11207545 3300006051 Bacteria 512
373 Ga0075364_11224085 3300006051 Bacteria 509
374 Ga0075432_10171685 3300006058 Bacteria 843
375 Ga0075432_10380921 3300006058 Bacteria 605
376 Ga0070716_100259803 3300006173 Bacteria 1188
377 Ga0070716_100533230 3300006173 Bacteria 872
378 Ga0070712_100055890 3300006175 Bacteria 2766
379 Ga0070712_100146164 3300006175 Bacteria 1810
380 Ga0075362_10179934 3300006177 Bacteria 1024
381 Ga0075362_10191992 3300006177 Bacteria 992
382 Ga0075362_10339392 3300006177 Bacteria 750
383 Ga0075362_10421840 3300006177 Bacteria 675
384 Ga0075367_10053258 3300006178 Bacteria 2397
385 Ga0075367_10158743 3300006178 Bacteria 1406
386 Ga0075367_10259649 3300006178 Bacteria 1090
387 Ga0075367_10340727 3300006178 Bacteria 946
388 Ga0075367_10415412 3300006178 Bacteria 851
389 Ga0075367_10480755 3300006178 Bacteria 787
390 Ga0075367_10495465 3300006178 Bacteria 775
391 Ga0075367_10914942 3300006178 Bacteria 559
392 Ga0075369_10024521 3300006186 Bacteria 2500
393 Ga0075369_10033975 3300006186 Bacteria 2163
394 Ga0075369_10229622 3300006186 Bacteria 860
395 Ga0075369_10230793 3300006186 Bacteria 857
396 Ga0075369_10347070 3300006186 Bacteria 696
397 Ga0075369_10494535 3300006186 Bacteria 581
398 Ga0075366_10154332 3300006195 Bacteria 1391
399 Ga0075366_10322383 3300006195 Bacteria 947
400 Ga0075366_10367725 3300006195 Bacteria 883
401 Ga0075366_10456368 3300006195 Bacteria 788
402 Ga0075366_10891196 3300006195 Bacteria 554
403 Ga0097621_100993433 3300006237 Bacteria 785
404 Ga0097621_101167118 3300006237 Bacteria 725
405 Ga0075370_10008389 3300006353 Bacteria 5316
406 Ga0075370_10018171 3300006353 Bacteria 3811
407 Ga0075370_10097282 3300006353 Bacteria 1702
408 Ga0075370_10129730 3300006353 Bacteria 1471
409 Ga0075370_10176598 3300006353 Bacteria 1256
410 Ga0075370_10181643 3300006353 Bacteria 1238
411 Ga0075370_10203448 3300006353 Bacteria 1168
412 Ga0075370_10341172 3300006353 Bacteria 894
413 Ga0075370_10476095 3300006353 Bacteria 752
414 Ga0075370_10892697 3300006353 Bacteria 543
415 Ga0075370_10916021 3300006353 Bacteria 536
416 Ga0075370_10946572 3300006353 Bacteria 527
417 Ga0068871_100058693 3300006358 Bacteria 3133
418 Ga0068871_101189418 3300006358 Bacteria 715
419 Ga0068871_101488021 3300006358 Bacteria 639
420 Ga0068871_101854791 3300006358 Bacteria 573
421 Ga0068871_102264715 3300006358 Bacteria 518
422 Ga0075428_101083300 3300006844 Bacteria 847
423 Ga0075430_100938742 3300006846 Bacteria 713
424 Ga0068865_100201405 3300006881 Bacteria 1545
425 Ga0068865_100224699 3300006881 Bacteria 1469
426 Ga0068865_100335828 3300006881 Bacteria 1220
427 Ga0068865_100782959 3300006881 Bacteria 822
428 Ga0068865_100914050 3300006881 Bacteria 764
429 Ga0068865_101963691 3300006881 Bacteria 530
430 Ga0097620_100105110 3300006931 Bacteria 2883
431 Ga0097620_100321510 3300006931 Bacteria 1641
432 Ga0097620_100940446 3300006931 Bacteria 948
433 Ga0079104_1002834 3300006946 Bacteria 8719
434 Ga0079104_1004884 3300006946 Bacteria 5543
435 Ga0099826_10000040 3300006948 Bacteria 98176
436 Ga0099826_10013124 3300006948 Bacteria 6255
437 Ga0099826_10154666 3300006948 Bacteria 1308
438 Ga0099794_10031348 3300007265 Bacteria 2488
439 Ga0099794_10156085 3300007265 Bacteria 1160
440 Ga0099794_10275053 3300007265 Bacteria 870
441 Ga0099795_10047082 3300007788 Bacteria 1557
442 Ga0099795_10071229 3300007788 Bacteria 1312
443 Ga0099795_10314917 3300007788 Bacteria 691
444 Ga0105251_10421297 3300009011 Bacteria 616
445 Ga0105244_10260270 3300009036 Bacteria 807
446 Ga0105250_10038075 3300009092 Bacteria 1929
447 Ga0105250_10051849 3300009092 Bacteria 1645
448 Ga0105250_10195860 3300009092 Bacteria 851
449 Ga0105250_10386922 3300009092 Bacteria 618
450 Ga0105240_10016396 3300009093 Bacteria 10032
451 Ga0105240_10038936 3300009093 Bacteria 6094
452 Ga0105240_10076364 3300009093 Bacteria 4130
453 Ga0105240_10117780 3300009093 Bacteria 3202
454 Ga0105240_10275568 3300009093 Bacteria 1935
455 Ga0105240_11056313 3300009093 Bacteria 866
456 Ga0105240_11119653 3300009093 Bacteria 837
457 Ga0105240_11330344 3300009093 Bacteria 757
458 Ga0105240_11973457 3300009093 Bacteria 607
459 Ga0105240_12603742 3300009093 Bacteria 523
460 Ga0111539_10365680 3300009094 Bacteria 1679
461 Ga0111539_12143718 3300009094 Bacteria 648
462 Ga0105245_10255993 3300009098 Bacteria 1702
463 Ga0105245_10382719 3300009098 Bacteria 1401
464 Ga0105245_10661227 3300009098 Bacteria 1076
465 Ga0105245_11210102 3300009098 Bacteria 803
466 Ga0105245_11390540 3300009098 Bacteria 752
467 Ga0105245_12418004 3300009098 Bacteria 579
468 Ga0105245_13127780 3300009098 Bacteria 513
469 Ga0105247_10083415 3300009101 Bacteria 2018
470 Ga0105247_10406813 3300009101 Bacteria 971
471 Ga0105247_10407874 3300009101 Bacteria 970
472 Ga0105247_10488703 3300009101 Bacteria 895
473 Ga0105247_10823433 3300009101 Bacteria 710
474 Ga0114129_10829415 3300009147 Bacteria 1177
475 Ga0105243_10279507 3300009148 Bacteria 1503
476 Ga0105243_10387961 3300009148 Bacteria 1294
477 Ga0105243_10625283 3300009148 Bacteria 1040
478 Ga0105243_11182451 3300009148 Bacteria 777
479 Ga0105241_10161174 3300009174 Bacteria 1844
480 Ga0105241_10490543 3300009174 Bacteria 1094
481 Ga0105241_10941055 3300009174 Bacteria 805
482 Ga0105241_10974714 3300009174 Bacteria 792
483 Ga0105241_11519992 3300009174 Bacteria 645
484 Ga0105241_11520199 3300009174 Bacteria 645
485 Ga0105241_12035785 3300009174 Bacteria 566
486 Ga0105242_10401881 3300009176 Bacteria 1279
487 Ga0105242_11596121 3300009176 Bacteria 686
488 Ga0105248_10065542 3300009177 Bacteria 4078
489 Ga0105248_10123749 3300009177 Bacteria 2917
490 Ga0105248_10837738 3300009177 Bacteria 1038
491 Ga0105248_11259711 3300009177 Bacteria 836
492 Ga0105248_11528483 3300009177 Bacteria 756
493 Ga0105248_13106904 3300009177 Bacteria 528
494 Ga0105237_10009263 3300009545 Bacteria 10554
495 Ga0105237_10055965 3300009545 Bacteria 3949
496 Ga0105237_10086048 3300009545 Bacteria 3133
497 Ga0105237_10155143 3300009545 Bacteria 2286
498 Ga0105237_10229457 3300009545 Bacteria 1857
499 Ga0105237_10695272 3300009545 Bacteria 1023
500 Ga0105237_11361988 3300009545 Bacteria 716
501 Ga0105237_12543513 3300009545 Bacteria 522
502 Ga0105237_12715303 3300009545 Bacteria 506
503 Ga0105238_10000586 3300009551 Bacteria 38241
504 Ga0105238_10008521 3300009551 Bacteria 10262
505 Ga0105238_10043599 3300009551 Bacteria 4539
506 Ga0105238_10079916 3300009551 Bacteria 3259
507 Ga0105238_10233792 3300009551 Bacteria 1815
508 Ga0105238_10631627 3300009551 Bacteria 1080
509 Ga0105238_10692192 3300009551 Bacteria 1031
510 Ga0105238_10805939 3300009551 Bacteria 955
511 Ga0105238_11913949 3300009551 Bacteria 626
512 Ga0105238_12460429 3300009551 Bacteria 556
513 Ga0105238_13036591 3300009551 Bacteria 504
514 Ga0105249_10628591 3300009553 Bacteria 1130
515 Ga0105249_11183471 3300009553 Bacteria 835
516 Ga0105249_11562792 3300009553 Bacteria 732
517 Ga0105249_13416319 3300009553 Bacteria 511
518 Ga0099796_10154089 3300010159 Bacteria 907
519 Ga0099796_10449343 3300010159 Bacteria 573
520 Ga0099796_10461234 3300010159 Bacteria 566
521 Ga0099796_10465944 3300010159 Bacteria 564
522 Ga0105239_10077487 3300010375 Bacteria 3658
523 Ga0105239_10079462 3300010375 Bacteria 3609
524 Ga0105239_10190814 3300010375 Bacteria 2293
525 Ga0105239_10259657 3300010375 Bacteria 1952
526 Ga0105239_10273508 3300010375 Bacteria 1900
527 Ga0105239_10340603 3300010375 Bacteria 1692
528 Ga0105239_10374440 3300010375 Bacteria 1610
529 Ga0105239_11119395 3300010375 Bacteria 907
530 Ga0105239_11604850 3300010375 Bacteria 752
531 Ga0105239_11929401 3300010375 Bacteria 685
532 Ga0105239_11982474 3300010375 Bacteria 676
533 Ga0105246_10064102 3300011119 Bacteria 2566
534 Ga0105246_10222943 3300011119 Bacteria 1479
535 Ga0105246_10327631 3300011119 Bacteria 1247
536 Ga0105246_10482571 3300011119 Bacteria 1049
537 Ga0105246_11774398 3300011119 Bacteria 589
538 Ga0157319_1023130 3300012497 Bacteria 620
539 Ga0157314_1002158 3300012500 Bacteria 1361
540 Ga0157326_1032763 3300012513 Bacteria 696
541 Ga0157326_1100258 3300012513 Bacteria 500
542 Ga0154010_157882 3300013062 Bacteria 600
543 Ga0157373_10066042 3300013100 Bacteria 2560
544 Ga0157373_10107862 3300013100 Bacteria 1958
545 Ga0157373_10731187 3300013100 Bacteria 727
546 Ga0157373_10813394 3300013100 Bacteria 690
547 Ga0157371_10002849 3300013102 Bacteria 16156
548 Ga0157371_10860734 3300013102 Bacteria 686
549 Ga0157370_10004657 3300013104 Bacteria 15662
550 Ga0157370_10015115 3300013104 Bacteria 7863
551 Ga0157370_10042298 3300013104 Bacteria 4392
552 Ga0157370_10225131 3300013104 Bacteria 1736
553 Ga0157370_11133646 3300013104 Bacteria 706
554 Ga0157370_12055904 3300013104 Bacteria 512
555 Ga0157369_10003351 3300013105 Bacteria 19026
556 Ga0157369_10029343 3300013105 Bacteria 6079
557 Ga0157369_10058855 3300013105 Bacteria 4144
558 Ga0157369_10144676 3300013105 Bacteria 2514
559 Ga0157369_10772610 3300013105 Bacteria 988
560 Ga0157369_10797558 3300013105 Bacteria 970
561 Ga0157369_11200497 3300013105 Bacteria 774
562 Ga0171463_1003 3300013249 Bacteria 695693
563 Ga0157374_10310684 3300013296 Bacteria 1561
564 Ga0157374_10376181 3300013296 Bacteria 1414
565 Ga0157374_10457756 3300013296 Bacteria 1278
566 Ga0157374_11085245 3300013296 Bacteria 821
567 Ga0157374_11336775 3300013296 Bacteria 739
568 Ga0157374_12059028 3300013296 Bacteria 597
569 Ga0157374_12916675 3300013296 Bacteria 505
570 Ga0157378_10014660 3300013297 Bacteria 6864
571 Ga0157378_10911924 3300013297 Bacteria 910
572 Ga0157378_11010873 3300013297 Bacteria 866
573 Ga0157378_11016669 3300013297 Bacteria 864
574 Ga0157378_11725166 3300013297 Bacteria 673
575 Ga0157378_11776161 3300013297 Bacteria 665
576 Ga0157378_12831116 3300013297 Bacteria 537
577 Ga0163162_10060142 3300013306 Bacteria 3833
578 Ga0163162_10202905 3300013306 Bacteria 2112
579 Ga0163162_11102854 3300013306 Bacteria 899
580 Ga0163162_11533273 3300013306 Bacteria 759
581 Ga0163162_11951395 3300013306 Bacteria 672
582 Ga0163162_12300561 3300013306 Bacteria 619
583 Ga0157372_10145791 3300013307 Bacteria 2730
584 Ga0157372_10489221 3300013307 Bacteria 1434
585 Ga0157372_10582434 3300013307 Bacteria 1304
586 Ga0157372_11446328 3300013307 Bacteria 792
587 Ga0157372_12490391 3300013307 Bacteria 594
588 Ga0157372_12902104 3300013307 Bacteria 549
589 Ga0157372_13310479 3300013307 Bacteria 513
590 Ga0157375_11585474 3300013308 Bacteria 774
591 Ga0157375_13464937 3300013308 Bacteria 525
592 Ga0163163_10003826 3300014325 Bacteria 12814
593 Ga0163163_10018613 3300014325 Bacteria 6506
594 Ga0163163_11558662 3300014325 Bacteria 722
595 Ga0163163_13025160 3300014325 Bacteria 524
596 Ga0157380_10192376 3300014326 Bacteria 1802
597 Ga0157380_10748488 3300014326 Bacteria 988
598 Ga0157380_10902202 3300014326 Bacteria 910
599 Ga0182008_10508635 3300014497 Bacteria 663
600 Ga0182008_10830994 3300014497 Bacteria 538
601 Ga0157377_10449732 3300014745 Bacteria 889
602 Ga0157377_11310966 3300014745 Bacteria 566
603 Ga0157379_10161603 3300014968 Bacteria 2022
604 Ga0157379_10194905 3300014968 Bacteria 1831
605 Ga0157379_10205386 3300014968 Bacteria 1782
606 Ga0157379_10235462 3300014968 Bacteria 1660
607 Ga0157376_10290978 3300014969 Bacteria 1542
608 Ga0157376_10578972 3300014969 Bacteria 1115
609 Ga0157376_10792461 3300014969 Bacteria 960
610 Ga0157376_10986277 3300014969 Bacteria 864
611 Ga0157376_11431980 3300014969 Bacteria 723
612 Ga0157376_11944450 3300014969 Bacteria 625
613 Ga0157376_11962462 3300014969 Bacteria 623
614 Ga0183365_11929 3300015684 Bacteria 748
615 Ga0183363_1168 3300015690 Bacteria 15051
616 Ga0163161_10454435 3300017792 Bacteria 1036
617 Ga0184603_100425 3300019192 Bacteria 527
618 Ga0206356_10018687 3300020070 Bacteria 642
619 Ga0206351_10069610 3300020077 Bacteria 701
620 Ga0206354_10465592 3300020081 Bacteria 859
621 Ga0154015_1351868 3300020610 Bacteria 585
622 Ga0214544_1000646 3300021320 Bacteria 66087
623 Ga0214542_1000027 3300021321 Bacteria 175107
624 Ga0214543_1000047 3300021327 Bacteria 150894
625 Ga0214543_1002177 3300021327 Bacteria 38571
626 Ga0213872_10058728 3300021361 Bacteria 1741
627 Ga0213876_10000865 3300021384 Bacteria 20256
628 Ga0213876_10035923 3300021384 Bacteria 2614
629 Ga0213875_10053600 3300021388 Bacteria 1889
630 Ga0213871_10294354 3300021441 Bacteria 523
631 Ga0224712_10615057 3300022467 Bacteria 531
632 Ga0228711_1006836 3300022739 Bacteria 16770
633 Ga0228710_1006916 3300022740 Bacteria 16965
634 Ga0228598_1057208 3300024227 Bacteria 775
635 Ga0209435_100022 3300025206 Bacteria 207766
636 Ga0209435_100086 3300025206 Bacteria 45054
637 Ga0209436_100016 3300025208 Bacteria 117496
638 Ga0209436_134582 3300025208 Bacteria 508
639 Ga0209563_104597 3300025230 Bacteria 2617
640 Ga0209563_106926 3300025230 Bacteria 1904
641 Ga0207427_120023 3300025231 Bacteria 606
642 Ga0209437_100022 3300025233 Bacteria 625694
643 Ga0209437_100067 3300025233 Bacteria 317685
644 Ga0207425_1000012 3300025245 Bacteria 528324
645 Ga0207425_1000032 3300025245 Bacteria 253689
646 Ga0207425_1003086 3300025245 Bacteria 5507
647 Ga0207425_1006874 3300025245 Bacteria 3070
648 Ga0209646_1000078 3300025246 Bacteria 207766
649 Ga0209646_1000279 3300025246 Bacteria 45163
650 Ga0209646_1004843 3300025246 Bacteria 2414
651 Ga0209646_1010572 3300025246 Bacteria 1444
652 Ga0209026_1000065 3300025250 Bacteria 207766
653 Ga0209026_1000089 3300025250 Bacteria 175907
654 Ga0209026_1000341 3300025250 Bacteria 45163
655 Ga0209148_1003572 3300025254 Bacteria 4204
656 Ga0209148_1006083 3300025254 Bacteria 2659
657 Ga0209148_1041685 3300025254 Bacteria 632
658 Ga0209759_1000055 3300025256 Bacteria 207766
659 Ga0209759_1000471 3300025256 Bacteria 45163
660 Ga0209759_1000539 3300025256 Bacteria 39826
661 Ga0209759_1013305 3300025256 Bacteria 2233
662 Ga0209759_1027489 3300025256 Bacteria 1174
663 Ga0209129_1000056 3300025258 Bacteria 253689
664 Ga0209129_1000166 3300025258 Bacteria 97875
665 Ga0209129_1000453 3300025258 Bacteria 30523
666 Ga0209129_1001565 3300025258 Bacteria 12562
667 Ga0209129_1002345 3300025258 Bacteria 9370
668 Ga0209233_1000010 3300025261 Bacteria 1194329
669 Ga0209233_1000031 3300025261 Bacteria 624646
670 Ga0209233_1000088 3300025261 Bacteria 317980
671 Ga0209565_1050572 3300025263 Bacteria 747
672 Ga0209455_1008214 3300025272 Bacteria 2859
673 Ga0209455_1036213 3300025272 Bacteria 787
674 Ga0209673_1001400 3300025273 Bacteria 23490
675 Ga0209673_1002430 3300025273 Bacteria 12947
676 Ga0209673_1005708 3300025273 Bacteria 6206
677 Ga0209673_1007049 3300025273 Bacteria 5273
678 Ga0209673_1017468 3300025273 Bacteria 2643
679 Ga0209673_1047925 3300025273 Bacteria 1155
680 Ga0209130_1000049 3300025284 Bacteria 226841
681 Ga0209130_1000264 3300025284 Bacteria 65849
682 Ga0209130_1001049 3300025284 Bacteria 20972
683 Ga0209675_1001620 3300025291 Bacteria 12656
684 Ga0209676_1002997 3300025292 Bacteria 10988
685 Ga0209025_1000016 3300025294 Bacteria 770739
686 Ga0209025_1000024 3300025294 Bacteria 528324
687 Ga0209025_1000090 3300025294 Bacteria 253689
688 Ga0209025_1000336 3300025294 Bacteria 103514
689 Ga0209025_1000374 3300025294 Bacteria 93607
690 Ga0209025_1000917 3300025294 Bacteria 45335
691 Ga0209025_1001912 3300025294 Bacteria 24208
692 Ga0209025_1003123 3300025294 Bacteria 16204
693 Ga0209025_1059125 3300025294 Bacteria 1449
694 Ga0209025_1060690 3300025294 Bacteria 1417
695 Ga0209564_1000023 3300025295 Bacteria 555102
696 Ga0209564_1000354 3300025295 Bacteria 85718
697 Ga0209564_1000403 3300025295 Bacteria 76834
698 Ga0209564_1002352 3300025295 Bacteria 15256
699 Ga0209564_1002912 3300025295 Bacteria 12455
700 Ga0209758_1000084 3300025297 Bacteria 256346
701 Ga0209758_1000150 3300025297 Bacteria 163494
702 Ga0209758_1000383 3300025297 Bacteria 76487
703 Ga0209758_1000396 3300025297 Bacteria 75453
704 Ga0209758_1001244 3300025297 Bacteria 31708
705 Ga0209758_1001532 3300025297 Bacteria 26653
706 Ga0209758_1018391 3300025297 Bacteria 3426
707 Ga0209758_1023867 3300025297 Bacteria 2748
708 Ga0209050_1006153 3300025298 Bacteria 7222
709 Ga0209256_1000042 3300025299 Bacteria 341821
710 Ga0209256_1000176 3300025299 Bacteria 126545
711 Ga0209256_1000436 3300025299 Bacteria 64360
712 Ga0209256_1001515 3300025299 Bacteria 23483
713 Ga0209256_1001769 3300025299 Bacteria 20511
714 Ga0209256_1029391 3300025299 Bacteria 1533
715 Ga0207426_1000140 3300025302 Bacteria 195664
716 Ga0207426_1003465 3300025302 Bacteria 8537
717 Ga0207426_1008701 3300025302 Bacteria 4069
718 Ga0209051_1000202 3300025303 Bacteria 106010
719 Ga0209051_1002097 3300025303 Bacteria 14992
720 Ga0209051_1002339 3300025303 Bacteria 13731
721 Ga0209051_1047889 3300025303 Bacteria 1455
722 Ga0209257_1002210 3300025304 Bacteria 20082
723 Ga0209257_1026228 3300025304 Bacteria 1969
724 Ga0207697_10469124 3300025315 Bacteria 557
725 Ga0207656_10289265 3300025321 Bacteria 809
726 Ga0207692_10800031 3300025898 Bacteria 616
727 Ga0207642_11108421 3300025899 Bacteria 512
728 Ga0207710_10752476 3300025900 Bacteria 512
729 Ga0207688_10038101 3300025901 Bacteria 2668
730 Ga0207680_10457350 3300025903 Bacteria 906
731 Ga0207647_10020192 3300025904 Bacteria 4471
732 Ga0207647_10787280 3300025904 Bacteria 512
733 Ga0207685_10599264 3300025905 Bacteria 591
734 Ga0207699_10184842 3300025906 Bacteria 1403
735 Ga0207699_11316213 3300025906 Bacteria 535
736 Ga0207645_10124466 3300025907 Bacteria 1675
737 Ga0207645_10314810 3300025907 Bacteria 1043
738 Ga0207643_10366596 3300025908 Bacteria 906
739 Ga0207705_10314146 3300025909 Bacteria 1203
740 Ga0207705_10461712 3300025909 Bacteria 985
741 Ga0207705_10483989 3300025909 Bacteria 961
742 Ga0207684_10540691 3300025910 Bacteria 997
743 Ga0207684_10558079 3300025910 Bacteria 979
744 Ga0207684_10876246 3300025910 Bacteria 756
745 Ga0207654_10122105 3300025911 Bacteria 1637
746 Ga0207707_10001548 3300025912 Bacteria 21188
747 Ga0207695_10026590 3300025913 Bacteria 6458
748 Ga0207695_10031741 3300025913 Bacteria 5788
749 Ga0207695_10234865 3300025913 Bacteria 1736
750 Ga0207695_10360149 3300025913 Bacteria 1341
751 Ga0207671_10128696 3300025914 Bacteria 1942
752 Ga0207671_10253836 3300025914 Bacteria 1383
753 Ga0207671_10321150 3300025914 Bacteria 1225
754 Ga0207671_10376419 3300025914 Bacteria 1128
755 Ga0207663_10472981 3300025916 Bacteria 970
756 Ga0207663_11149460 3300025916 Bacteria 624
757 Ga0207660_10235674 3300025917 Bacteria 1440
758 Ga0207662_10163992 3300025918 Bacteria 1421
759 Ga0207657_10003813 3300025919 Bacteria 16023
760 Ga0207657_10637474 3300025919 Bacteria 830
761 Ga0207649_11587350 3300025920 Bacteria 518
762 Ga0207652_10807821 3300025921 Bacteria 833
763 Ga0207652_10948362 3300025921 Bacteria 758
764 Ga0207646_10052931 3300025922 Bacteria 3632
765 Ga0207681_10895929 3300025923 Bacteria 743
766 Ga0207681_11489412 3300025923 Bacteria 567
767 Ga0207694_10005521 3300025924 Bacteria 9700
768 Ga0207694_10082752 3300025924 Bacteria 2523
769 Ga0207694_11634681 3300025924 Bacteria 543
770 Ga0207650_10413734 3300025925 Bacteria 1118
771 Ga0207659_10729929 3300025926 Bacteria 849
772 Ga0207687_10302241 3300025927 Bacteria 1289
773 Ga0207664_10185455 3300025929 Bacteria 1788
774 Ga0207644_10715100 3300025931 Bacteria 836
775 Ga0207644_11575578 3300025931 Bacteria 551
776 Ga0207690_10230621 3300025932 Bacteria 1421
777 Ga0207690_10782027 3300025932 Bacteria 788
778 Ga0207706_10241537 3300025933 Bacteria 1579
779 Ga0207686_11122443 3300025934 Bacteria 642
780 Ga0207686_11264160 3300025934 Bacteria 605
781 Ga0207709_10038819 3300025935 Bacteria 2839
782 Ga0207670_10177137 3300025936 Bacteria 1603
783 Ga0207670_11308611 3300025936 Bacteria 615
784 Ga0207669_10093822 3300025937 Bacteria 1962
785 Ga0207669_10179754 3300025937 Bacteria 1515
786 Ga0207669_10645044 3300025937 Bacteria 865
787 Ga0207704_10077449 3300025938 Bacteria 2135
788 Ga0207704_10407950 3300025938 Bacteria 1074
789 Ga0207665_10097692 3300025939 Bacteria 2045
790 Ga0207691_10162516 3300025940 Bacteria 1958
791 Ga0207691_10255411 3300025940 Bacteria 1512
792 Ga0207691_10412390 3300025940 Bacteria 1151
793 Ga0207689_10030772 3300025942 Bacteria 4472
794 Ga0207689_10534510 3300025942 Bacteria 984
795 Ga0207661_10137427 3300025944 Bacteria 2100
796 Ga0207679_10374629 3300025945 Bacteria 1247
797 Ga0207667_10086152 3300025949 Bacteria 3251
798 Ga0207667_10593244 3300025949 Bacteria 1118
799 Ga0207667_10806942 3300025949 Bacteria 935
800 Ga0207651_10744256 3300025960 Bacteria 866
801 Ga0207651_10848228 3300025960 Bacteria 812
802 Ga0207651_11090557 3300025960 Bacteria 715
803 Ga0207712_11310577 3300025961 Bacteria 647
804 Ga0207668_10416394 3300025972 Bacteria 1139
805 Ga0207668_10652805 3300025972 Bacteria 921
806 Ga0207668_10667885 3300025972 Bacteria 911
807 Ga0207668_10833030 3300025972 Bacteria 818
808 Ga0207668_10853263 3300025972 Bacteria 808
809 Ga0207668_11609372 3300025972 Bacteria 586
810 Ga0207668_11942410 3300025972 Bacteria 530
811 Ga0207658_10044456 3300025986 Bacteria 3234
812 Ga0207677_12269250 3300026023 Bacteria 505
813 Ga0207677_12285938 3300026023 Bacteria 503
814 Ga0207703_10178567 3300026035 Bacteria 1872
815 Ga0207703_11341514 3300026035 Bacteria 688
816 Ga0207703_11596577 3300026035 Bacteria 627
817 Ga0207703_11942697 3300026035 Bacteria 565
818 Ga0207639_10009172 3300026041 Bacteria 6818
819 Ga0207639_10152599 3300026041 Bacteria 1936
820 Ga0207678_10187943 3300026067 Bacteria 1765
821 Ga0207678_10446427 3300026067 Bacteria 1124
822 Ga0207678_10479257 3300026067 Bacteria 1083
823 Ga0207678_11083002 3300026067 Bacteria 710
824 Ga0207708_10303663 3300026075 Bacteria 1299
825 Ga0207708_10371502 3300026075 Bacteria 1177
826 Ga0207702_10000546 3300026078 Bacteria 42023
827 Ga0207702_10004644 3300026078 Bacteria 12146
828 Ga0207702_10033523 3300026078 Bacteria 4290
829 Ga0207702_11287383 3300026078 Bacteria 725
830 Ga0207702_11878437 3300026078 Bacteria 590
831 Ga0207641_10506513 3300026088 Bacteria 1173
832 Ga0207648_10438622 3300026089 Bacteria 1188
833 Ga0207648_10736609 3300026089 Bacteria 915
834 Ga0207648_12159564 3300026089 Bacteria 518
835 Ga0207674_10030653 3300026116 Bacteria 5654
836 Ga0207674_10268667 3300026116 Bacteria 1653
837 Ga0207674_11154109 3300026116 Bacteria 744
838 Ga0207674_11305657 3300026116 Bacteria 695
839 Ga0207675_100080427 3300026118 Bacteria 3055
840 Ga0207675_100281434 3300026118 Bacteria 1616
841 Ga0207683_10057053 3300026121 Bacteria 3427
842 Ga0207683_10211177 3300026121 Bacteria 1767
843 Ga0207698_10053786 3300026142 Bacteria 3093
844 Ga0207698_10520190 3300026142 Bacteria 1161
845 Ga0207698_10568603 3300026142 Bacteria 1114
846 Ga0207698_11418138 3300026142 Bacteria 710
847 Ga0209281_1000106 3300027111 Bacteria 219666
848 Ga0209281_1000426 3300027111 Bacteria 62651
849 Ga0209371_1000003 3300027312 Bacteria 1122971
850 Ga0209371_1000990 3300027312 Bacteria 21859
851 Ga0209371_1008618 3300027312 Bacteria 3356
852 Ga0209179_1100768 3300027512 Bacteria 643
853 Ga0209282_1000083 3300027666 Bacteria 70247
854 Ga0209282_1000167 3300027666 Bacteria 37134
855 Ga0209282_1044704 3300027666 Bacteria 2596
856 Ga0209588_1016674 3300027671 Bacteria 2271
857 Ga0209588_1067862 3300027671 Bacteria 1152
858 Ga0209813_10183950 3300027866 Bacteria 766
859 Ga0207428_10087187 3300027907 Bacteria 2429
860 Ga0268266_10011520 3300028379 Bacteria 7678
861 Ga0268266_10021951 3300028379 Bacteria 5440
862 Ga0268266_10041638 3300028379 Bacteria 3920
863 Ga0268266_10232819 3300028379 Bacteria 1697
864 Ga0268266_10242298 3300028379 Bacteria 1665
865 Ga0268266_10297658 3300028379 Bacteria 1504
866 Ga0268266_10442705 3300028379 Bacteria 1234
867 Ga0268266_10649621 3300028379 Bacteria 1015
868 Ga0268266_11502122 3300028379 Bacteria 649
869 Ga0268265_10200832 3300028380 Bacteria 1729
870 Ga0268265_10643265 3300028380 Bacteria 1018
871 Ga0268265_12427940 3300028380 Bacteria 530
872 Ga0268264_11514417 3300028381 Bacteria 681
873 Ga0265334_10065282 3300028573 Bacteria 1365
874 Ga0307517_10289775 3300028786 Bacteria 926
875 Ga0307515_10002180 3300028794 Bacteria 42989
876 Ga0307515_10162439 3300028794 Bacteria 2270
877 Ga0307515_10189868 3300028794 Bacteria 1969
878 Ga0268256_1000004 3300030500 Bacteria 1122967
879 Ga0268256_1000571 3300030500 Bacteria 29712
880 Ga0268256_1009027 3300030500 Bacteria 3356
881 Ga0316181_1012064 3300030744 Bacteria 4601
882 Ga0265762_1056251 3300030760 Bacteria 800
883 Ga0265763_1020674 3300030763 Bacteria 690
884 Ga0265764_116286 3300030882 Bacteria 515
885 Ga0265761_105536 3300030889 Bacteria 662
886 Ga0265760_10035293 3300031090 Bacteria 1480
887 Ga0265760_10091973 3300031090 Bacteria 950
888 Ga0265760_10209769 3300031090 Bacteria 661
889 Ga0265760_10355728 3300031090 Bacteria 524
890 Ga0265330_10040535 3300031235 Bacteria 2068
891 Ga0265330_10069394 3300031235 Bacteria 1526
892 Ga0265332_10219582 3300031238 Bacteria 788
893 Ga0265328_10072620 3300031239 Bacteria 1265
894 Ga0265320_10148836 3300031240 Bacteria 1058
895 Ga0265325_10476155 3300031241 Bacteria 542
896 Ga0265329_10144457 3300031242 Bacteria 769
897 Ga0265340_10004702 3300031247 Bacteria 7593
898 Ga0265339_10002135 3300031249 Bacteria 14404
899 Ga0265316_10047181 3300031344 Bacteria 3408
900 Ga0265316_10384691 3300031344 Bacteria 1012
901 Ga0307513_10953235 3300031456 Bacteria 567
902 Ga0307408_100275327 3300031548 Bacteria 1399
903 Ga0265313_10005700 3300031595 Bacteria 9082
904 Ga0265313_10052844 3300031595 Bacteria 1937
905 Ga0265342_10006876 3300031712 Bacteria 8406
906 Ga0307516_10140743 3300031730 Bacteria 2183
907 Ga0307516_10243085 3300031730 Bacteria 1498
908 Ga0307405_10000482 3300031731 Bacteria 14958
909 Ga0307405_10072659 3300031731 Bacteria 2218
910 Ga0307405_10193704 3300031731 Bacteria 1470
911 Ga0307405_12050864 3300031731 Bacteria 513
912 Ga0307413_10644764 3300031824 Bacteria 873
913 Ga0307406_10114120 3300031901 Bacteria 1865
914 Ga0307406_10361519 3300031901 Bacteria 1138
915 Ga0307406_11194383 3300031901 Bacteria 660
916 Ga0307406_11327832 3300031901 Bacteria 628
917 Ga0307407_11138994 3300031903 Bacteria 608
918 Ga0307412_10165722 3300031911 Bacteria 1647
919 Ga0307412_10465998 3300031911 Bacteria 1044
920 Ga0307412_11425315 3300031911 Bacteria 628
921 Ga0307412_11928336 3300031911 Bacteria 546
922 Ga0315914_1002550 3300031967 Bacteria 27863
923 Ga0307409_100794824 3300031995 Bacteria 953
924 Ga0307409_101436686 3300031995 Bacteria 716
925 Ga0307416_100247550 3300032002 Bacteria 1732
926 Ga0307416_100515546 3300032002 Bacteria 1263
927 Ga0307416_102907326 3300032002 Bacteria 573
928 Ga0307414_10588713 3300032004 Bacteria 996
929 Ga0307414_12178587 3300032004 Bacteria 518
930 Ga0307415_100305987 3300032126 Bacteria 1319
931 Ga0307415_100857311 3300032126 Bacteria 834
932 Ga0307510_10000908 3300033180 Bacteria 31266
933 Ga0315913_1001274 3300033430 Bacteria 27225
934 Ga0315915_1000010 3300033464 Bacteria 240214
935 Ga0316592_1108090 3300033524 Bacteria 642
936 Ga0316586_1102401 3300033527 Bacteria 548
937 Ga0373926_0195151 3300035083 Bacteria 778
938 Ga0373929_0268048 3300035085 Bacteria 501
939 Ga0373934_0003991 3300035086 Bacteria 5432
940 Ga0373934_0195445 3300035086 Bacteria 832
941 Ga0373934_0238184 3300035086 Bacteria 751
942 Ga0373944_0448344 3300035089 Bacteria 503
943 Ga0373923_0032731 3300035111 Bacteria 2101
944 Ga0373923_0033929 3300035111 Bacteria 2069
945 Ga0373936_0009309 3300035113 Bacteria 3700
946 Ga0373936_0041934 3300035113 Bacteria 1836
947 Ga0373936_0177635 3300035113 Bacteria 933
948 Ga0373936_0324084 3300035113 Bacteria 698
949 Ga0373941_0540805 3300035115 Bacteria 500
950 Ga0373945_0011814 3300035116 Bacteria 2892
951 Ga0373945_0179700 3300035116 Bacteria 870
952 Ga0373945_0564359 3300035116 Bacteria 512
953 Ga0373953_0000428 3300035117 Bacteria 11481
954 Ga0373953_0002249 3300035117 Bacteria 5794
955 Ga0373954_0000096 3300035118 Bacteria 29585
956 Ga0373954_0001427 3300035118 Bacteria 9689
957 Ga0373954_0101679 3300035118 Bacteria 1387
958 Ga0373956_0000452 3300035119 Bacteria 16781
959 Ga0373956_0010045 3300035119 Bacteria 3863
960 Ga0373957_0000472 3300035120 Bacteria 10170
961 Ga0373957_0004660 3300035120 Bacteria 4190
962 Ga0373957_0152452 3300035120 Bacteria 949
963 Ga0373943_0000777 3300035170 Bacteria 13945
964 Ga0373943_0054685 3300035170 Bacteria 1975
965 Ga0373946_0189125 3300035171 Bacteria 981
966 Ga0373955_0004288 3300035172 Bacteria 6298
967 Ga0373955_0020206 3300035172 Bacteria 3345
968 Ga0373955_0020557 3300035172 Bacteria 3320
969 Ga0373955_0048964 3300035172 Bacteria 2293
970 Ga0373924_0017494 3300035410 Bacteria 2751
971 Ga0373924_0027795 3300035410 Bacteria 2251
972 Ga0373924_0029306 3300035410 Bacteria 2199
973 Ga0373924_0407551 3300035410 Bacteria 608
974 Ga0373935_0000251 3300035692 Bacteria 26431
975 Ga0373935_0034983 3300035692 Bacteria 3134
976 Ga0373935_0124310 3300035692 Bacteria 1727
977 Ga0373935_0195258 3300035692 Bacteria 1396
978 Ga0373935_0375420 3300035692 Bacteria 1017
979 Ga0373927_0000074 3300035695 Bacteria 72943
980 Ga0373927_0005560 3300035695 Bacteria 8667
981 Ga0373927_0007493 3300035695 Bacteria 7380
982 Ga0373927_0015747 3300035695 Bacteria 4991
983 Ga0373927_0272776 3300035695 Bacteria 1112
984 Ga0373927_0742355 3300035695 Bacteria 648
985 Ga0373933_0014530 3300035724 Bacteria 4381
986 Ga0373933_0016964 3300035724 Bacteria 4081
987 Ga0373933_0513331 3300035724 Bacteria 785
988 Ga0373947_0001064 3300035725 Bacteria 16792
989 Ga0373947_0016295 3300035725 Bacteria 4272
990 Ga0373947_0083971 3300035725 Bacteria 1976
991 Ga0373947_0403375 3300035725 Bacteria 922
992 Ga0373937_0006552 3300036401 Bacteria 10058
993 Ga0373937_0021873 3300036401 Bacteria 5742
994 Ga0373937_0083215 3300036401 Bacteria 2960
995 Ga0373937_0200728 3300036401 Bacteria 1875
996 Ga0373937_1082155 3300036401 Bacteria 750
997 Ga0373925_0001364 3300037068 Bacteria 21294
998 Ga0373925_0002665 3300037068 Bacteria 14170
999 Ga0373925_0112710 3300037068 Bacteria 2103
1000 Ga0373925_0860384 3300037068 Bacteria 747
1001 Ga0395899_0000217 3300037312 Bacteria 80044
1002 Ga0395900_0000270 3300037418 Bacteria 80046
1003 Ga0395900_0245470 3300037418 Bacteria 1794
1004 Ga0395900_0303078 3300037418 Bacteria 1583
1005 Ga0395900_0414198 3300037418 Bacteria 1309
1006 Ga0395900_0979486 3300037418 Bacteria 766
1007 Ga0395898_0000470 3300037466 Bacteria 80783
1008 Ga0395898_0101804 3300037466 Bacteria 2758
1009 Ga0395905_0000253 3300037471 Bacteria 80046
1010 Ga0395905_0048715 3300037471 Bacteria 3970
1011 Ga0395905_0290864 3300037471 Bacteria 1520
1012 Ga0395905_0722324 3300037471 Bacteria 898
1013 Ga0395905_1215535 3300037471 Bacteria 657
1014 Ga0436364_0651817 3300037853 Bacteria 2612
1015 Ga0395901_0002922 3300038443 Bacteria 17251
1016 Ga0395901_0023878 3300038443 Bacteria 6271
1017 Ga0395901_0419545 3300038443 Bacteria 1372
1018 Ga0395901_0578115 3300038443 Bacteria 1135
1019 Ga0400483_048591 3300039062 Bacteria 1716
1020 Ga0400483_170970 3300039062 Bacteria 18881
1021 Ga0400483_241924 3300039062 Bacteria 1826
1022 Ga0436365_1865485 3300039437 Bacteria 3146
1023 Ga0436365_1892130 3300039437 Bacteria 1190
1024 Ga0436360_0012434 3300039438 Bacteria 685
1025 Ga0436361_1090572 3300039447 Bacteria 3438
1026 Ga0439465_0039012 3300041413 Bacteria 1532
1027 Ga0439465_0079945 3300041413 Bacteria 1107
1028 Ga0439465_0124953 3300041413 Bacteria 904
1029 Ga0439465_0165409 3300041413 Bacteria 795
1030 Ga0451787_496701 3300041441 Bacteria 1203
1031 Ga0451801_03670 3300041455 Bacteria 549
1032 Ga0451800_0127875 3300041459 Bacteria 573
1033 Ga0451800_0697454 3300041459 Bacteria 541
1034 Ga0451802_1735530 3300041460 Bacteria 502
1035 Ga0451833_0730984 3300041491 Bacteria 726
1036 Ga0451835_0230868 3300041492 Bacteria 501
1037 Ga0451849_1043510 3300041505 Bacteria 630
1038 Ga0451855_0029132 3300041511 Bacteria 586
1039 Ga0451853_1360697 3300041512 Bacteria 535
1040 Ga0451853_2612147 3300041512 Bacteria 661
1041 Ga0452268_09526 3300041907 Bacteria 522
1042 Ga0439431_0149061 3300041997 Bacteria 664
1043 Ga0439445_0207797 3300042004 Bacteria 579
1044 Ga0439445_0231528 3300042004 Bacteria 550
1045 Ga0439432_051122 3300042006 Bacteria 1289
1046 Ga0439462_0149295 3300042015 Bacteria 657
1047 Ga0450923_088673 3300042125 Bacteria 703
1048 Ga0450900_080592 3300042136 Bacteria 523
1049 Ga0450902_070321 3300042137 Bacteria 610
1050 Ga0439434_0080586 3300042435 Bacteria 1033
1051 Ga0439434_0207908 3300042435 Bacteria 661
1052 Ga0466972_0027947 3300044658 Bacteria 2787
1053 Ga0466965_0618337 3300044683 Bacteria 616
1054 Ga0466968_0078165 3300044735 Bacteria 1450
1055 Ga0466968_0085724 3300044735 Bacteria 1390
1056 Ga0466970_0770781 3300044765 Bacteria 563
1057 Ga0466960_0063323 3300044901 Bacteria 1820
1058 Ga0495617_009338 3300046452 Bacteria 3366
1059 Ga0495592_0012453 3300046454 Bacteria 6460
1060 Ga0495592_0026565 3300046454 Bacteria 4388
1061 Ga0495592_0129265 3300046454 Bacteria 1768
1062 Ga0495592_0631062 3300046454 Bacteria 651
1063 Ga0495603_0000208 3300046455 Bacteria 30287
1064 Ga0495603_0002458 3300046455 Bacteria 10897
1065 Ga0495603_0030037 3300046455 Bacteria 3274
1066 Ga0495590_0038159 3300046457 Bacteria 1674
1067 Ga0495590_0337127 3300046457 Bacteria 571
1068 Ga0495629_0000216 3300046459 Bacteria 51517
1069 Ga0495629_0001181 3300046459 Bacteria 20620
1070 Ga0495629_0017800 3300046459 Bacteria 5093
1071 Ga0495638_0003832 3300046460 Bacteria 11675
1072 Ga0495638_0017927 3300046460 Bacteria 4711
1073 Ga0495638_0081801 3300046460 Bacteria 1959
1074 Ga0495638_0584049 3300046460 Bacteria 551
1075 Ga0495641_0001151 3300046461 Bacteria 22739
1076 Ga0495641_0050675 3300046461 Bacteria 1897
1077 Ga0495651_0022957 3300046462 Bacteria 4851
1078 Ga0495651_0087175 3300046462 Bacteria 2348
1079 Ga0495651_0090122 3300046462 Bacteria 2300
1080 Ga0495653_0001775 3300046463 Bacteria 17020
1081 Ga0495653_0052490 3300046463 Bacteria 3124
1082 Ga0495650_0027634 3300046471 Bacteria 2618
1083 Ga0495650_0034475 3300046471 Bacteria 2240
1084 Ga0495650_0040206 3300046471 Bacteria 2011
1085 Ga0495580_0003553 3300046472 Bacteria 13243
1086 Ga0495580_0419342 3300046472 Bacteria 901
1087 Ga0495582_0000311 3300046473 Bacteria 26740
1088 Ga0495582_0082986 3300046473 Bacteria 1781
1089 Ga0495605_0134183 3300046474 Bacteria 1114
1090 Ga0495639_0000395 3300046475 Bacteria 20621
1091 Ga0495639_0031163 3300046475 Bacteria 2373
1092 Ga0495662_0000259 3300046476 Bacteria 22394
1093 Ga0495662_0522403 3300046476 Bacteria 582
1094 Ga0495664_0007806 3300046477 Bacteria 5955
1095 Ga0495664_0090710 3300046477 Bacteria 1837
1096 Ga0495664_0574492 3300046477 Bacteria 671
1097 Ga0495664_0784699 3300046477 Bacteria 560
1098 Ga0495584_0096587 3300046491 Bacteria 1492
1099 Ga0495584_0330744 3300046491 Bacteria 774
1100 Ga0495585_0110883 3300046492 Bacteria 1459
1101 Ga0495585_0155899 3300046492 Bacteria 1188
1102 Ga0495594_0000272 3300046499 Bacteria 25431
1103 Ga0495594_0031294 3300046499 Bacteria 2884
1104 Ga0495594_0055421 3300046499 Bacteria 2186
1105 Ga0495596_0070770 3300046500 Bacteria 1355
1106 Ga0495607_0101871 3300046501 Bacteria 1537
1107 Ga0495606_0030274 3300046507 Bacteria 3784
1108 Ga0495606_0468081 3300046507 Bacteria 642
1109 Ga0495606_0524117 3300046507 Bacteria 594
1110 Ga0495608_0001705 3300046511 Bacteria 15778
1111 Ga0495608_0143472 3300046511 Bacteria 1523
1112 Ga0495608_0200299 3300046511 Bacteria 1258
1113 Ga0495610_0002231 3300046512 Bacteria 16389
1114 Ga0495610_0002393 3300046512 Bacteria 15800
1115 Ga0495616_0073369 3300046513 Bacteria 1651
1116 Ga0495618_0002323 3300046514 Bacteria 12311
1117 Ga0495618_0081179 3300046514 Bacteria 2070
1118 Ga0495620_0232938 3300046515 Bacteria 704
1119 Ga0495628_0044858 3300046516 Bacteria 3515
1120 Ga0495628_0068594 3300046516 Bacteria 2766
1121 Ga0495628_0140726 3300046516 Bacteria 1841
1122 Ga0495628_0462694 3300046516 Bacteria 920
1123 Ga0495630_0000820 3300046517 Bacteria 21887
1124 Ga0495630_0052865 3300046517 Bacteria 3041
1125 Ga0495630_0188804 3300046517 Bacteria 1572
1126 Ga0495630_1445099 3300046517 Bacteria 517
1127 Ga0495631_0042096 3300046518 Bacteria 2019
1128 Ga0495631_0098942 3300046518 Bacteria 1255
1129 Ga0495631_0384483 3300046518 Bacteria 597
1130 Ga0495632_0002224 3300046519 Bacteria 14967
1131 Ga0495632_0016291 3300046519 Bacteria 4141
1132 Ga0495632_0259824 3300046519 Bacteria 777
1133 Ga0495637_0145697 3300046520 Bacteria 896
1134 Ga0495643_0040480 3300046522 Bacteria 2546
1135 Ga0495643_0156057 3300046522 Bacteria 1126
1136 Ga0495644_0080056 3300046523 Bacteria 1231
1137 Ga0495648_0006515 3300046524 Bacteria 9516
1138 Ga0495648_0065290 3300046524 Bacteria 2140
1139 Ga0495648_0084732 3300046524 Bacteria 1793
1140 Ga0495663_0014069 3300046525 Bacteria 2241
1141 Ga0495663_0019623 3300046525 Bacteria 1937
1142 Ga0495663_0057692 3300046525 Bacteria 1215
1143 Ga0495666_0188905 3300046526 Bacteria 949
1144 Ga0495642_0381141 3300046528 Bacteria 621
1145 Ga0495652_0010856 3300046529 Bacteria 8252
1146 Ga0495652_0038453 3300046529 Bacteria 4145
1147 Ga0495652_0627066 3300046529 Bacteria 730
1148 Ga0495654_0001294 3300046530 Bacteria 17558
1149 Ga0495654_0074371 3300046530 Bacteria 1605
1150 Ga0495654_0357306 3300046530 Bacteria 586
1151 Ga0495665_0006722 3300046531 Bacteria 6200
1152 Ga0495665_0393296 3300046531 Bacteria 703
1153 Ga0495640_0012590 3300046533 Bacteria 6458
1154 Ga0495640_0022779 3300046533 Bacteria 4574
1155 Ga0495640_0028987 3300046533 Bacteria 3979
1156 Ga0495586_0066223 3300046535 Bacteria 1970
1157 Ga0495586_0436771 3300046535 Bacteria 754
1158 Ga0495587_0001236 3300046536 Bacteria 16943
1159 Ga0495587_0016699 3300046536 Bacteria 4565
1160 Ga0495598_0015362 3300046537 Bacteria 1932
1161 Ga0495598_0019716 3300046537 Bacteria 1772
1162 Ga0495609_0055515 3300046538 Bacteria 1757
1163 Ga0495609_0239193 3300046538 Bacteria 750
1164 Ga0495621_0008718 3300046539 Bacteria 3050
1165 Ga0495597_0014017 3300046542 Bacteria 3828
1166 Ga0495597_0159731 3300046542 Bacteria 920
1167 Ga0495645_0028470 3300046543 Bacteria 4060
1168 Ga0495645_0051544 3300046543 Bacteria 2994
1169 Ga0495622_0003774 3300046557 Bacteria 7085
1170 Ga0495622_0022348 3300046557 Bacteria 2947
1171 Ga0495633_0058244 3300046558 Bacteria 1813
1172 Ga0495633_0192950 3300046558 Bacteria 936
1173 Ga0495667_0021654 3300046559 Bacteria 4338
1174 Ga0495667_0057976 3300046559 Bacteria 2544
1175 Ga0495667_0205769 3300046559 Bacteria 1258
1176 Ga0495656_0002847 3300046615 Bacteria 5795
1177 Ga0495656_0012766 3300046615 Bacteria 3108
1178 Ga0495656_0099730 3300046615 Bacteria 1341
1179 Ga0495668_0013820 3300046616 Bacteria 4748
1180 Ga0495668_0075775 3300046616 Bacteria 1847
1181 Ga0495668_0212800 3300046616 Bacteria 1058
1182 Ga0495634_0001816 3300046642 Bacteria 18416
1183 Ga0495634_0022564 3300046642 Bacteria 4434
1184 Ga0495634_0046348 3300046642 Bacteria 2934
1185 Ga0495611_0393796 3300046648 Bacteria 633
1186 Ga0495625_0061712 3300046660 Bacteria 2652
1187 Ga0495625_0148119 3300046660 Bacteria 1579
1188 Ga0495625_0189866 3300046660 Bacteria 1362
1189 Ga0495625_0335331 3300046660 Bacteria 959
1190 Ga0495625_0655067 3300046660 Bacteria 625
1191 Ga0495625_0885160 3300046660 Bacteria 513
1192 Ga0495635_0000392 3300046663 Bacteria 27895
1193 Ga0495635_0000913 3300046663 Bacteria 19383
1194 Ga0495635_0013724 3300046663 Bacteria 5669
1195 Ga0495635_0890859 3300046663 Bacteria 570
1196 Ga0495659_0010639 3300046664 Bacteria 2958
1197 Ga0495661_0191126 3300046665 Bacteria 1078
1198 Ga0495588_0012713 3300046674 Bacteria 3987
1199 Ga0495588_0025063 3300046674 Bacteria 2969
1200 Ga0495588_0131282 3300046674 Bacteria 1321
1201 Ga0495588_0145658 3300046674 Bacteria 1252
1202 Ga0495588_0672244 3300046674 Bacteria 542
1203 Ga0495657_0017255 3300046675 Bacteria 5244
1204 Ga0495657_0057220 3300046675 Bacteria 2593
1205 Ga0495657_0264147 3300046675 Bacteria 1033
1206 Ga0495599_0022199 3300046678 Bacteria 3961
1207 Ga0495599_0039450 3300046678 Bacteria 2967
1208 Ga0495599_0687111 3300046678 Bacteria 591
1209 Ga0495623_0005202 3300046679 Bacteria 8535
1210 Ga0495623_0143454 3300046679 Bacteria 1418
1211 Ga0495646_0011455 3300046680 Bacteria 5629
1212 Ga0495646_0011689 3300046680 Bacteria 5581
1213 Ga0495647_0000430 3300046681 Bacteria 12037
1214 Ga0495658_0001021 3300046683 Bacteria 14800
1215 Ga0495613_0021060 3300046689 Bacteria 4860
1216 Ga0495613_0046810 3300046689 Bacteria 3197
1217 Ga0495613_0595391 3300046689 Bacteria 736
1218 Ga0495624_0001716 3300046690 Bacteria 16747
1219 Ga0495624_0246670 3300046690 Bacteria 1080
1220 Ga0495624_0625971 3300046690 Bacteria 641
1221 Ga0495624_0704503 3300046690 Bacteria 599
1222 Ga0495670_0046299 3300046691 Bacteria 2172
1223 Ga0495670_0101183 3300046691 Bacteria 1484
1224 Ga0495671_0135119 3300046692 Bacteria 1202
1225 Ga0495671_0212299 3300046692 Bacteria 938
1226 Ga0495649_0161965 3300046694 Bacteria 1172
1227 Ga0495589_0090919 3300046794 Bacteria 1482
1228 Ga0495600_0013868 3300046809 Bacteria 5075
1229 Ga0495600_0054637 3300046809 Bacteria 2608
1230 Ga0495600_0064160 3300046809 Bacteria 2401
1231 Ga0495660_0178542 3300046810 Bacteria 1029
1232 Ga0495581_0000559 3300047315 Bacteria 19297
1233 Ga0495581_0297773 3300047315 Bacteria 943
1234 Ga0495604_0010363 3300047317 Bacteria 7382
1235 Ga0495604_0011190 3300047317 Bacteria 7124
1236 Ga0495636_0124834 3300047318 Bacteria 1141
1237 Ga0495674_0001216 3300047319 Bacteria 24946
1238 Ga0495674_0012665 3300047319 Bacteria 7949
1239 Ga0495674_0070782 3300047319 Bacteria 3013
1240 Ga0495674_0476187 3300047319 Bacteria 1001
1241 Ga0495674_1054639 3300047319 Bacteria 621
1242 Ga0495674_1485784 3300047319 Bacteria 502
1243 Ga0495672_0256285 3300047320 Bacteria 846
1244 Ga0495672_0527303 3300047320 Bacteria 521
1245 Ga0495676_0013658 3300047321 Bacteria 7288
1246 Ga0495676_0056178 3300047321 Bacteria 3115
1247 Ga0495680_0041225 3300047322 Bacteria 3672
1248 Ga0495680_0252145 3300047322 Bacteria 1250
1249 Ga0495675_0005490 3300047444 Bacteria 7736
1250 Ga0495675_0544420 3300047444 Bacteria 662
1251 Ga0495677_0085011 3300047445 Bacteria 1188
1252 Ga0495677_0169532 3300047445 Bacteria 844
1253 Ga0495685_040561 3300047447 Bacteria 1592
1254 Ga0495673_0048086 3300047469 Bacteria 1882
1255 Ga0495673_0055147 3300047469 Bacteria 1725
1256 Ga0495673_0152210 3300047469 Bacteria 893
1257 Ga0495673_0202116 3300047469 Bacteria 743
1258 Ga0495673_0209976 3300047469 Bacteria 725
1259 Ga0495681_0244518 3300047470 Bacteria 711
1260 Ga0495681_0247833 3300047470 Bacteria 704
1261 Ga0495684_0002174 3300047471 Bacteria 15708
1262 Ga0495684_0012372 3300047471 Bacteria 6582
1263 Ga0495684_0070557 3300047471 Bacteria 2656
1264 Ga0495686_0003677 3300047472 Bacteria 13109
1265 Ga0495686_0025883 3300047472 Bacteria 3842
1266 Ga0495686_0026151 3300047472 Bacteria 3819
1267 Ga0495686_0328385 3300047472 Bacteria 837
1268 Ga0495593_0000100 3300047673 Bacteria 39337
1269 Ga0495593_0000132 3300047673 Bacteria 35973
1270 Ga0495602_0013942 3300048088 Bacteria 8189
1271 Ga0495602_0027269 3300048088 Bacteria 5492
1272 Ga0495602_0175408 3300048088 Bacteria 1659
1273 Ga0495614_0022088 3300048089 Bacteria 2747
1274 Ga0495615_0114452 3300048090 Bacteria 775
1275 Ga0495615_0313995 3300048090 Bacteria 510
1276 Ga0495626_0132922 3300048091 Bacteria 1061
1277 Ga0496100_0228189 3300048903 Bacteria 1369
1278 Ga0496100_0298806 3300048903 Bacteria 1205
1279 Ga0496100_0992456 3300048903 Bacteria 661
1280 Ga0496101_0587486 3300048904 Bacteria 881
1281 Ga0496102_0561544 3300048905 Bacteria 1064
1282 Ga0496102_0709223 3300048905 Bacteria 929
1283 Ga0496102_1202640 3300048905 Bacteria 677
1284 Ga0496103_0118156 3300048906 Bacteria 1688
1285 Ga0496103_1057417 3300048906 Bacteria 503
1286 Ga0496104_0650771 3300048907 Bacteria 963
1287 Ga0496106_0113204 3300048909 Bacteria 2115
1288 Ga0496107_0761783 3300048910 Bacteria 710
1289 Ga0496108_0327470 3300048911 Bacteria 1336
1290 Ga0496108_1410217 3300048911 Bacteria 582
1291 Ga0496109_0599125 3300048912 Bacteria 1038
1292 Ga0496110_0380724 3300048913 Bacteria 1286
1293 Ga0496110_0438288 3300048913 Bacteria 1191
1294 Ga0496110_1024342 3300048913 Bacteria 733
1295 Ga0496112_0537352 3300048915 Bacteria 1103
1296 Ga0496113_0079189 3300048916 Bacteria 2515
1297 Ga0496114_1052057 3300048917 Bacteria 698
1298 Ga0496114_1070575 3300048917 Bacteria 691
1299 Ga0496115_0088436 3300048918 Bacteria 2529
1300 Ga0496115_0153163 3300048918 Bacteria 1904
1301 Ga0496115_0188888 3300048918 Bacteria 1702
1302 Ga0496115_0504776 3300048918 Bacteria 971
1303 Ga0496115_0640362 3300048918 Bacteria 841
1304 Ga0496115_1110982 3300048918 Bacteria 599
1305 Ga0496116_0000036 3300048919 Bacteria 388508
1306 Ga0496116_0002794 3300048919 Bacteria 17923
1307 Ga0496116_0007250 3300048919 Bacteria 9881
1308 Ga0496116_0021310 3300048919 Bacteria 4892
1309 Ga0496116_0174178 3300048919 Bacteria 1161
1310 Ga0496116_0321765 3300048919 Bacteria 724
1311 Ga0496117_0010131 3300048920 Bacteria 8654
1312 Ga0496117_0013726 3300048920 Bacteria 7039
1313 Ga0496117_0054538 3300048920 Bacteria 2800
1314 Ga0496117_0104782 3300048920 Bacteria 1779
1315 Ga0496117_0123294 3300048920 Bacteria 1587
1316 Ga0496117_0149818 3300048920 Bacteria 1383
1317 Ga0496117_0170664 3300048920 Bacteria 1263
1318 Ga0496117_0376488 3300048920 Bacteria 724
1319 Ga0496118_0007062 3300048921 Bacteria 12070
1320 Ga0496118_0023486 3300048921 Bacteria 5354
1321 Ga0496118_0038896 3300048921 Bacteria 3805
1322 Ga0496118_0113625 3300048921 Bacteria 1788
1323 Ga0496118_0226790 3300048921 Bacteria 1082
1324 Ga0496118_0465007 3300048921 Bacteria 638
1325 Ga0496118_0571167 3300048921 Bacteria 547
1326 Ga0496119_0005479 3300048922 Bacteria 12138
1327 Ga0496119_0021490 3300048922 Bacteria 4664
1328 Ga0496119_0027654 3300048922 Bacteria 3892
1329 Ga0496119_0034617 3300048922 Bacteria 3322
1330 Ga0496119_0043581 3300048922 Bacteria 2833
1331 Ga0496119_0051300 3300048922 Bacteria 2536
1332 Ga0496119_0072593 3300048922 Bacteria 2010
1333 Ga0496119_0078576 3300048922 Bacteria 1908
1334 Ga0496119_0217818 3300048922 Bacteria 978
1335 Ga0496119_0328292 3300048922 Bacteria 747
1336 Ga0496119_0400113 3300048922 Bacteria 655
1337 Ga0496119_0408209 3300048922 Bacteria 647
1338 Ga0496120_0025241 3300048923 Bacteria 3691
1339 Ga0496120_0097482 3300048923 Bacteria 1560
1340 Ga0496120_0133494 3300048923 Bacteria 1268
1341 Ga0496120_0321289 3300048923 Bacteria 703
1342 Ga0496121_0000001 3300048924 Bacteria 1830318
1343 Ga0496121_0010678 3300048924 Bacteria 10307
1344 Ga0496121_0015359 3300048924 Bacteria 8031
1345 Ga0496121_0071104 3300048924 Bacteria 2799
1346 Ga0496121_0196002 3300048924 Bacteria 1444
1347 Ga0496121_0246527 3300048924 Bacteria 1241
1348 Ga0496121_0383911 3300048924 Bacteria 925
1349 Ga0496121_0399908 3300048924 Bacteria 900
1350 Ga0496121_0418989 3300048924 Bacteria 872
1351 Ga0496121_0784536 3300048924 Bacteria 562
1352 Ga0496122_0000172 3300048925 Bacteria 153862
1353 Ga0496122_0001281 3300048925 Bacteria 41818
1354 Ga0496122_0004854 3300048925 Bacteria 16371
1355 Ga0496122_0010659 3300048925 Bacteria 9438
1356 Ga0496122_0043395 3300048925 Bacteria 3524
1357 Ga0496122_0083059 3300048925 Bacteria 2222
1358 Ga0496122_0115276 3300048925 Bacteria 1751
1359 Ga0496122_0115381 3300048925 Bacteria 1750
1360 Ga0496122_0171571 3300048925 Bacteria 1306
1361 Ga0496122_0195488 3300048925 Bacteria 1188
1362 Ga0496122_0226094 3300048925 Bacteria 1069
1363 Ga0496122_0395121 3300048925 Bacteria 704
1364 Ga0496122_0527716 3300048925 Bacteria 567
1365 Ga0496123_0000132 3300048926 Bacteria 153568
1366 Ga0496123_0001497 3300048926 Bacteria 32439
1367 Ga0496123_0006065 3300048926 Bacteria 11861
1368 Ga0496123_0009982 3300048926 Bacteria 8463
1369 Ga0496123_0016524 3300048926 Bacteria 5986
1370 Ga0496123_0044522 3300048926 Bacteria 3034
1371 Ga0496123_0065064 3300048926 Bacteria 2320
1372 Ga0496123_0103894 3300048926 Bacteria 1644
1373 Ga0496123_0225584 3300048926 Bacteria 941
1374 Ga0496123_0357678 3300048926 Bacteria 677
1375 Ga0496123_0370822 3300048926 Bacteria 660
1376 Ga0496123_0378917 3300048926 Bacteria 649
1377 Ga0496124_0006047 3300048927 Bacteria 13334
1378 Ga0496124_0011220 3300048927 Bacteria 8981
1379 Ga0496124_0024032 3300048927 Bacteria 5548
1380 Ga0496124_0048640 3300048927 Bacteria 3622
1381 Ga0496124_0060917 3300048927 Bacteria 3164
1382 Ga0496124_0066786 3300048927 Bacteria 2994
1383 Ga0496124_0085685 3300048927 Bacteria 2581
1384 Ga0496124_0087923 3300048927 Bacteria 2541
1385 Ga0496124_0127317 3300048927 Bacteria 2027
1386 Ga0496124_0207469 3300048927 Bacteria 1485
1387 Ga0496124_0277966 3300048927 Bacteria 1222
1388 Ga0496124_0678953 3300048927 Bacteria 656
1389 Ga0496124_0715194 3300048927 Bacteria 633
1390 Ga0496125_0000001 3300048928 Bacteria 1766138
1391 Ga0496125_0060025 3300048928 Bacteria 3060
1392 Ga0496125_0061181 3300048928 Bacteria 3021
1393 Ga0496125_0068188 3300048928 Bacteria 2799
1394 Ga0496125_0095573 3300048928 Bacteria 2210
1395 Ga0496125_0124377 3300048928 Bacteria 1831
1396 Ga0496125_0142145 3300048928 Bacteria 1666
1397 Ga0496125_0147367 3300048928 Bacteria 1624
1398 Ga0496126_0000597 3300048929 Bacteria 68119
1399 Ga0496126_0005070 3300048929 Bacteria 15280
1400 Ga0496126_0008753 3300048929 Bacteria 10867
1401 Ga0496126_0018683 3300048929 Bacteria 6859
1402 Ga0496126_0049320 3300048929 Bacteria 3844
1403 Ga0496126_0052371 3300048929 Bacteria 3710
1404 Ga0496126_0052478 3300048929 Bacteria 3705
1405 Ga0496126_0064532 3300048929 Bacteria 3280
1406 Ga0496126_0334951 3300048929 Bacteria 1241
1407 Ga0496126_0589479 3300048929 Bacteria 877
1408 Ga0496126_0765118 3300048929 Bacteria 744
1409 Ga0496126_1030425 3300048929 Bacteria 616
1410 Ga0496126_1130527 3300048929 Bacteria 580
1411 Ga0501305_121133 3300049161 Bacteria 502
1412 Ga0495678_005943 3300049459 Bacteria 6598
1413 Ga0495678_048764 3300049459 Bacteria 1650
1414 Ga0495678_120106 3300049459 Bacteria 884
1415 Ga0501317_023130 3300049533 Bacteria 856
1416 Ga0501031_0779037 3300049568 Bacteria 613
1417 Ga0501032_0105612 3300049569 Bacteria 1866
1418 Ga0501032_0415889 3300049569 Bacteria 863
1419 Ga0501032_0645451 3300049569 Bacteria 672
1420 Ga0501032_0680297 3300049569 Bacteria 653
1421 Ga0501033_0000050 3300049570 Bacteria 111819
1422 Ga0501033_0052194 3300049570 Bacteria 3030
1423 Ga0501033_0075543 3300049570 Bacteria 2473
1424 Ga0501033_0385568 3300049570 Bacteria 979
1425 Ga0501034_0005317 3300049571 Bacteria 14111
1426 Ga0501034_0021763 3300049571 Bacteria 6533
1427 Ga0501034_0074864 3300049571 Bacteria 3393
1428 Ga0501034_1424141 3300049571 Bacteria 568
1429 Ga0501036_0103938 3300049572 Bacteria 2402
1430 Ga0501036_0180955 3300049572 Bacteria 1775
1431 Ga0501037_0087849 3300049573 Bacteria 2250
1432 Ga0501038_0722907 3300049574 Bacteria 744
1433 Ga0501040_0047475 3300049576 Bacteria 2932
1434 Ga0501041_0200954 3300049577 Bacteria 1249
1435 Ga0501041_0911947 3300049577 Bacteria 565
1436 Ga0501043_0809665 3300049579 Bacteria 677
1437 Ga0501043_0810294 3300049579 Bacteria 677
1438 Ga0501043_1194948 3300049579 Bacteria 534
1439 Ga0501046_0281833 3300049580 Bacteria 1217
1440 Ga0501046_0735240 3300049580 Bacteria 694
1441 Ga0501046_0970742 3300049580 Bacteria 590
1442 Ga0501047_0088252 3300049581 Bacteria 2978
1443 Ga0501047_0094313 3300049581 Bacteria 2872
1444 Ga0501047_0314097 3300049581 Bacteria 1407
1445 Ga0501047_0548393 3300049581 Bacteria 981
1446 Ga0501048_0061003 3300049582 Bacteria 2671
1447 Ga0501067_0061270 3300049583 Bacteria 2083
1448 Ga0501067_0520388 3300049583 Bacteria 666
1449 Ga0501068_0072553 3300049584 Bacteria 2102
1450 Ga0501068_0319965 3300049584 Bacteria 994
1451 Ga0501069_0200304 3300049585 Bacteria 1157
1452 Ga0501070_0913173 3300049586 Bacteria 684
1453 Ga0501070_1307874 3300049586 Bacteria 553
1454 Ga0501073_1134278 3300049589 Bacteria 537
1455 Ga0501074_0179781 3300049590 Bacteria 1509
1456 Ga0501074_1153973 3300049590 Bacteria 544
1457 Ga0501238_007369 3300049671 Bacteria 1429
1458 Ga0501253_134140 3300049683 Bacteria 611
1459 Ga0501079_0343952 3300049741 Bacteria 1168
1460 Ga0501080_0153318 3300049742 Bacteria 2129
1461 Ga0501080_0597821 3300049742 Bacteria 980
1462 Ga0501080_1400354 3300049742 Bacteria 596
1463 Ga0501083_0092804 3300049744 Bacteria 1993
1464 Ga0501083_0092920 3300049744 Bacteria 1991
1465 Ga0501241_011950 3300049758 Bacteria 1577
1466 Ga0501241_135822 3300049758 Bacteria 557
1467 Ga0501035_0001982 3300049822 Bacteria 20487
1468 Ga0501035_0003519 3300049822 Bacteria 14970
1469 Ga0501035_0569761 3300049822 Bacteria 926
1470 Ga0501035_1553312 3300049822 Bacteria 503
1471 Ga0501044_0382637 3300049823 Bacteria 1322
1472 Ga0501044_0508275 3300049823 Bacteria 1105
1473 Ga0501044_1263587 3300049823 Bacteria 605
1474 Ga0501044_1331652 3300049823 Bacteria 584
1475 nmdc:mga03683_16528_c1 3300050489 Bacteria 2773
1476 nmdc:mga03683_169159_c1 3300050489 Bacteria 992
1477 nmdc:mga03n38_48732_c1 3300050490 Bacteria 1881
1478 nmdc:mga03n38_905166_c1 3300050490 Bacteria 519
1479 nmdc:mga00v17_1052520_c1 3300050491 Bacteria 511
1480 nmdc:mga00v17_119083_c1 3300050491 Bacteria 1680
1481 nmdc:mga00v17_63187_c1 3300050491 Bacteria 2280
1482 nmdc:mga00v17_725596_c1 3300050491 Bacteria 636
1483 nmdc:mga00v17_728_c1 3300050491 Bacteria 17963
1484 nmdc:mga00v17_84260_c1 3300050491 Bacteria 1989
1485 nmdc:mga00v17_886430_c1 3300050491 Bacteria 565
1486 nmdc:mga0yw44_1143200_c1 3300050492 Bacteria 526
1487 nmdc:mga0yw44_1180437_c1 3300050492 Bacteria 516
1488 nmdc:mga0yw44_231721_c1 3300050492 Bacteria 1226
1489 nmdc:mga0yw44_5416_c1 3300050492 Bacteria 6026
1490 nmdc:mga0yw44_546422_c1 3300050492 Bacteria 787
1491 nmdc:mga0yw44_79540_c1 3300050492 Bacteria 2051
1492 nmdc:mga0yw44_985723_c1 3300050492 Bacteria 571
1493 nmdc:mga0k408_151925_c1 3300050493 Bacteria 1379
1494 nmdc:mga0k408_558834_c1 3300050493 Bacteria 676
1495 nmdc:mga0k408_789108_c1 3300050493 Bacteria 554
1496 nmdc:mga06z11_309373_c1 3300050494 Bacteria 941
1497 nmdc:mga06z11_345327_c1 3300050494 Bacteria 890
1498 nmdc:mga06z11_59652_c1 3300050494 Bacteria 1984
1499 nmdc:mga06z11_713135_c1 3300050494 Bacteria 611
1500 nmdc:mga04h51_48624_c1 3300050495 Bacteria 1414
1501 nmdc:mga07m45_167727_c1 3300050496 Unclassified 1275
1502 nmdc:mga07m45_24802_c1 3300050496 Bacteria 3287
1503 nmdc:mga07m45_443576_c1 3300050496 Bacteria 753
1504 nmdc:mga07m45_544878_c1 3300050496 Bacteria 671
1505 nmdc:mga07m45_71443_c1 3300050496 Bacteria 1975
1506 nmdc:mga05p37_833956_c1 3300050507 Bacteria 1004
1507 nmdc:mga06r32_1862570_c1 3300050510 Bacteria 536
1508 nmdc:mga08y16_695244_c1 3300050511 Bacteria 1017
1509 nmdc:mga08y16_701951_c1 3300050511 Bacteria 1011
1510 nmdc:mga0sz30_170331_c1 3300050516 Bacteria 965
1511 nmdc:mga0sz30_20504_c1 3300050516 Bacteria 2667
1512 nmdc:mga0sz30_216534_c1 3300050516 Bacteria 851
1513 nmdc:mga0sz30_443335_c1 3300050516 Bacteria 583
1514 nmdc:mga0sz30_541268_c1 3300050516 Bacteria 525
1515 nmdc:mga0sz30_568279_c1 3300050516 Bacteria 512
1516 nmdc:mga0sz30_99662_c1 3300050516 Bacteria 1268
1517 Ga0495601_0044623 3300053077 Bacteria 2786
1518 Ga0495601_0140646 3300053077 Bacteria 1574
1519 Ga0495601_0294647 3300053077 Bacteria 1057
1520 Ga0495612_0030474 3300053078 Bacteria 2172
1521 Ga0495612_0344559 3300053078 Bacteria 672
1522 Ga0495655_0051043 3300053083 Bacteria 1095
1523 Ga0495595_0000874 3300053084 Bacteria 11553
1524 Ga0495595_0086754 3300053084 Bacteria 1497
1525 Ga0495619_0040923 3300053085 Bacteria 3029
1526 Ga0495619_0086850 3300053085 Bacteria 2114
1527 Ga0495619_0240304 3300053085 Bacteria 1255
1528 Ga0495619_0705386 3300053085 Bacteria 686
1529 Ga0500578_0206785 3300053086 Bacteria 1199
1530 Ga0500643_059261 3300053087 Bacteria 1078
1531 Ga0500644_0069871 3300053088 Bacteria 1263
1532 Ga0500581_234965 3300053089 Bacteria 783
1533 Ga0500646_0389680 3300053090 Bacteria 513
1534 Ga0500647_0389411 3300053091 Bacteria 568
1535 Ga0500660_238462 3300053100 Bacteria 575
1536 Ga0500555_079236 3300053103 Bacteria 857
1537 Ga0500556_0151922 3300053104 Bacteria 913
1538 Ga0500572_221805 3300053111 Bacteria 618
1539 Ga0500572_234648 3300053111 Bacteria 599
1540 Ga0500592_081115 3300053116 Bacteria 539
1541 Ga0500607_275720 3300053121 Bacteria 645
1542 Ga0500618_000560 3300053125 Bacteria 23031
1543 Ga0500618_010534 3300053125 Bacteria 2478
1544 Ga0500628_164554 3300053129 Bacteria 627
1545 Ga0500642_0205541 3300053130 Bacteria 915
1546 Ga0500559_0075911 3300053136 Bacteria 1521
1547 Ga0500577_0280266 3300053142 Bacteria 726
1548 Ga0500586_163893 3300053145 Bacteria 752
1549 Ga0500588_0142048 3300053146 Bacteria 863
1550 Ga0500604_0113727 3300053151 Bacteria 900
1551 Ga0500616_0001686 3300053153 Bacteria 20346
1552 Ga0500616_0041654 3300053153 Bacteria 2463
1553 Ga0500616_0188181 3300053153 Bacteria 924
1554 Ga0500622_0026143 3300053156 Bacteria 3082
1555 Ga0500622_0082165 3300053156 Bacteria 1612
1556 Ga0500627_0059149 3300053158 Bacteria 1683
1557 Ga0500627_0130792 3300053158 Bacteria 1133
1558 Ga0500627_0139126 3300053158 Bacteria 1097
1559 Ga0500627_0267933 3300053158 Bacteria 752
1560 Ga0500633_0053860 3300053160 Bacteria 1397
1561 Ga0500638_342658 3300053162 Bacteria 558
1562 Ga0500611_032595 3300053727 Bacteria 1091
1563 Ga0500645_107824 3300053730 Bacteria 783
1564 Ga0501084_0401350 3300054114 Bacteria 1159
1565 Ga0587084_032264 3300059477 Bacteria 850
1566 Ga0587084_122147 3300059477 Bacteria 549
1567 Ga0587066_003392 3300059490 Bacteria 1867
1568 Ga0587066_075045 3300059490 Bacteria 720
1569 Ga0587073_0070342 3300059492 Bacteria 844
1570 Ga0587080_112850 3300059503 Bacteria 594
1571 Ga0587082_073323 3300059504 Bacteria 700
1572 Ga0587083_0265568 3300059505 Bacteria 517
1573 Ga0587085_051183 3300059506 Bacteria 753
1574 Ga0587088_053930 3300059508 Bacteria 796
1575 Ga0587088_177784 3300059508 Bacteria 531
1576 Ga0587089_081117 3300059509 Bacteria 565
1577 Ga0587089_094271 3300059509 Bacteria 536
1578 Ga0587090_156438 3300059510 Bacteria 520
1579 Ga0587091_120787 3300059511 Bacteria 636
1580 Ga0587092_144234 3300059512 Bacteria 527
1581 Ga0587094_067450 3300059513 Bacteria 638
1582 Ga0587098_057932 3300059604 Bacteria 602
1583 Ga0587106_093114 3300059605 Bacteria 605
1584 Ga0587106_117048 3300059605 Bacteria 561
1585 Ga0587125_081280 3300059607 Bacteria 504
1586 Ga0587129_012337 3300059608 Bacteria 682
1587 Ga0587099_038709 3300059622 Bacteria 604
1588 Ga0587101_152743 3300059623 Bacteria 501
1589 Ga0587109_110315 3300059624 Bacteria 642
1590 Ga0587109_141068 3300059624 Bacteria 588
1591 Ga0587109_172366 3300059624 Bacteria 548
1592 Ga0587113_020044 3300059625 Bacteria 697
1593 Ga0587113_053499 3300059625 Bacteria 509
1594 Ga0587122_052835 3300059628 Bacteria 531
1595 Ga0587122_055920 3300059628 Bacteria 521
1596 Ga0587128_062583 3300059630 Bacteria 706
1597 Ga0587128_065140 3300059630 Bacteria 697
1598 Ga0587067_107281 3300059640 Bacteria 654
1599 Ga0587067_190785 3300059640 Bacteria 539
1600 Ga0587068_102435 3300059641 Bacteria 603
1601 Ga0587072_197399 3300059643 Bacteria 510
1602 Ga0587076_004448 3300059645 Bacteria 1750
1603 Ga0587076_025539 3300059645 Bacteria 1011
1604 Ga0587078_078213 3300059646 Bacteria 527
1605 Ga0587079_092152 3300059647 Bacteria 711
1606 Ga0587102_070864 3300059649 Bacteria 502
1607 Ga0587107_142623 3300059652 Bacteria 513
1608 Ga0587110_028814 3300059654 Bacteria 668
1609 Ga0587110_054836 3300059654 Bacteria 540
1610 Ga0587114_119261 3300059655 Bacteria 532
1611 Ga0587116_18054 3300059656 Bacteria 525
1612 Ga0587120_035344 3300059659 Bacteria 523
1613 Ga0587065_09177 3300060245 Bacteria 614
1614 Ga0587111_0097279 3300060346 Bacteria 728
1615 Ga0587111_0130142 3300060346 Bacteria 657
1616 Ga0587111_0256972 3300060346 Bacteria 519
1617 Ga0501082_0129966 3300060353 Bacteria 2185
1618 Ga0501082_0335152 3300060353 Bacteria 1318
1619 Ga0501082_0370725 3300060353 Bacteria 1249
1620 Ga0530510_0018821 3300061734 Bacteria 4897

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300001976 JGI24752J21851_1010252 JGI24752J21851_10102523 67
2 3300001979 JGI24740J21852_10132098 JGI24740J21852_101320982 67
3 3300001989 JGI24739J22299_10032005 JGI24739J22299_100320053 67
4 3300001989 JGI24739J22299_10116097 JGI24739J22299_101160972 67
5 3300002074 JGI24748J21848_1043570 JGI24748J21848_10435701 67
6 3300002075 JGI24738J21930_10024573 JGI24738J21930_100245732 67
7 3300003373 JGI25407J50210_10167016 JGI25407J50210_101670161 67
8 3300003752 Ga0055539_1003524 Ga0055539_10035243 67
9 3300003794 Ga0055531_10091833 Ga0055531_100918331 67
10 3300004798 Ga0058859_11782138 Ga0058859_117821382 67
11 3300005335 Ga0070666_10121615 Ga0070666_101216153 67
12 3300005336 Ga0070680_100062215 Ga0070680_1000622152 67
13 3300005337 Ga0070682_100021284 Ga0070682_1000212842 67
14 3300005340 Ga0070689_100294893 Ga0070689_1002948933 67
15 3300005347 Ga0070668_100022443 Ga0070668_1000224433 67
16 3300005353 Ga0070669_100410468 Ga0070669_1004104682 67
17 3300005355 Ga0070671_100209677 Ga0070671_1002096773 67
18 3300005365 Ga0070688_100206308 Ga0070688_1002063081 67
19 3300005366 Ga0070659_100322412 Ga0070659_1003224122 67
20 3300005366 Ga0070659_101135034 Ga0070659_1011350341 67
21 3300005367 Ga0070667_101218124 Ga0070667_1012181241 67
22 3300005434 Ga0070709_10016520 Ga0070709_100165203 67
23 3300005434 Ga0070709_10035902 Ga0070709_100359022 67
24 3300005434 Ga0070709_10063889 Ga0070709_100638894 67
25 3300005434 Ga0070709_10156008 Ga0070709_101560083 67
26 3300005434 Ga0070709_10179578 Ga0070709_101795781 67
27 3300005435 Ga0070714_100024895 Ga0070714_1000248955 67
28 3300005435 Ga0070714_100102121 Ga0070714_1001021214 67
29 3300005435 Ga0070714_100130483 Ga0070714_1001304833 67
30 3300005436 Ga0070713_100003931 Ga0070713_10000393112 67
31 3300005436 Ga0070713_100017989 Ga0070713_1000179895 67
32 3300005436 Ga0070713_100090069 Ga0070713_1000900694 67
33 3300005437 Ga0070710_10001221 Ga0070710_1000122112 67
34 3300005437 Ga0070710_10006078 Ga0070710_100060785 67
35 3300005437 Ga0070710_10011233 Ga0070710_100112333 67
36 3300005437 Ga0070710_10302347 Ga0070710_103023472 67
37 3300005439 Ga0070711_100002618 Ga0070711_1000026187 67
38 3300005439 Ga0070711_100074580 Ga0070711_1000745802 67
39 3300005439 Ga0070711_100167066 Ga0070711_1001670662 67
40 3300005455 Ga0070663_100417081 Ga0070663_1004170812 67
41 3300005455 Ga0070663_100889103 Ga0070663_1008891031 67
42 3300005455 Ga0070663_100896973 Ga0070663_1008969732 67
43 3300005455 Ga0070663_101545680 Ga0070663_1015456802 67
44 3300005456 Ga0070678_100774144 Ga0070678_1007741442 67
45 3300005457 Ga0070662_100063389 Ga0070662_1000633892 67
46 3300005457 Ga0070662_100137147 Ga0070662_1001371472 67
47 3300005458 Ga0070681_10014949 Ga0070681_100149495 67
48 3300005471 Ga0070698_100091164 Ga0070698_1000911645 67
49 3300005530 Ga0070679_100075690 Ga0070679_1000756902 67
50 3300005535 Ga0070684_100607120 Ga0070684_1006071202 67
51 3300005539 Ga0068853_100111118 Ga0068853_1001111183 67
52 3300005548 Ga0070665_100885572 Ga0070665_1008855722 67
53 3300005563 Ga0068855_100119356 Ga0068855_1001193563 67
54 3300005563 Ga0068855_101377753 Ga0068855_1013777532 67
55 3300005577 Ga0068857_100110809 Ga0068857_1001108092 67
56 3300005578 Ga0068854_102143692 Ga0068854_1021436921 67
57 3300005614 Ga0068856_100170919 Ga0068856_1001709193 67
58 3300005614 Ga0068856_100361700 Ga0068856_1003617001 67
59 3300005616 Ga0068852_100863990 Ga0068852_1008639902 67
60 3300005617 Ga0068859_100105112 Ga0068859_1001051123 67
61 3300005841 Ga0068863_100712823 Ga0068863_1007128232 67
62 3300005841 Ga0068863_101067590 Ga0068863_1010675901 67
63 3300005842 Ga0068858_100059111 Ga0068858_1000591112 67
64 3300005842 Ga0068858_100156342 Ga0068858_1001563423 67
65 3300005937 Ga0081455_10371635 Ga0081455_103716352 67
66 3300005981 Ga0081538_10039548 Ga0081538_100395485 67
67 3300005983 Ga0081540_1234082 Ga0081540_12340822 67
68 3300005983 Ga0081540_1252620 Ga0081540_12526201 67
69 3300005983 Ga0081540_1325924 Ga0081540_13259242 67
70 3300006028 Ga0070717_11084846 Ga0070717_110848462 67
71 3300006038 Ga0075365_10431488 Ga0075365_104314881 67
72 3300006042 Ga0075368_10001274 Ga0075368_1000127410 67
73 3300006042 Ga0075368_10073329 Ga0075368_100733292 67
74 3300006042 Ga0075368_10207272 Ga0075368_102072723 67
75 3300006048 Ga0075363_100006553 Ga0075363_1000065534 67
76 3300006051 Ga0075364_10027644 Ga0075364_100276442 67
77 3300006051 Ga0075364_11207545 Ga0075364_112075451 67
78 3300006173 Ga0070716_100259803 Ga0070716_1002598032 67
79 3300006175 Ga0070712_100055890 Ga0070712_1000558901 67
80 3300006175 Ga0070712_100146164 Ga0070712_1001461643 67
81 3300006177 Ga0075362_10421840 Ga0075362_104218402 67
82 3300006178 Ga0075367_10480755 Ga0075367_104807552 67
83 3300006178 Ga0075367_10914942 Ga0075367_109149421 67
84 3300006186 Ga0075369_10024521 Ga0075369_100245212 67
85 3300006195 Ga0075366_10154332 Ga0075366_101543321 67
86 3300006195 Ga0075366_10456368 Ga0075366_104563682 67
87 3300006353 Ga0075370_10008389 Ga0075370_100083895 67
88 3300006353 Ga0075370_10176598 Ga0075370_101765982 67
89 3300006931 Ga0097620_100105110 Ga0097620_1001051103 67
90 3300007788 Ga0099795_10047082 Ga0099795_100470823 67
91 3300009011 Ga0105251_10421297 Ga0105251_104212972 67
92 3300009092 Ga0105250_10038075 Ga0105250_100380751 67
93 3300009092 Ga0105250_10051849 Ga0105250_100518493 67
94 3300009092 Ga0105250_10386922 Ga0105250_103869221 67
95 3300009093 Ga0105240_11119653 Ga0105240_111196532 67
96 3300009093 Ga0105240_11973457 Ga0105240_119734571 67
97 3300009093 Ga0105240_12603742 Ga0105240_126037421 67
98 3300009098 Ga0105245_10382719 Ga0105245_103827192 67
99 3300009098 Ga0105245_10661227 Ga0105245_106612272 67
100 3300009101 Ga0105247_10083415 Ga0105247_100834153 67
101 3300009101 Ga0105247_10488703 Ga0105247_104887031 67
102 3300009148 Ga0105243_10279507 Ga0105243_102795072 67
103 3300009174 Ga0105241_10490543 Ga0105241_104905431 67
104 3300009174 Ga0105241_10941055 Ga0105241_109410552 67
105 3300009174 Ga0105241_11520199 Ga0105241_115201992 67
106 3300009177 Ga0105248_10065542 Ga0105248_100655426 67
107 3300009177 Ga0105248_10837738 Ga0105248_108377381 67
108 3300009177 Ga0105248_11528483 Ga0105248_115284833 67
109 3300009545 Ga0105237_10055965 Ga0105237_100559653 67
110 3300009545 Ga0105237_10155143 Ga0105237_101551432 67
111 3300009545 Ga0105237_12543513 Ga0105237_125435131 67
112 3300009551 Ga0105238_10043599 Ga0105238_100435996 67
113 3300009551 Ga0105238_10233792 Ga0105238_102337923 67
114 3300009551 Ga0105238_10631627 Ga0105238_106316271 67
115 3300009553 Ga0105249_13416319 Ga0105249_134163192 67
116 3300010159 Ga0099796_10154089 Ga0099796_101540891 67
117 3300010375 Ga0105239_10079462 Ga0105239_100794624 67
118 3300010375 Ga0105239_10273508 Ga0105239_102735083 67
119 3300010375 Ga0105239_10340603 Ga0105239_103406032 67
120 3300010375 Ga0105239_10374440 Ga0105239_103744401 67
121 3300010375 Ga0105239_11119395 Ga0105239_111193952 67
122 3300011119 Ga0105246_10064102 Ga0105246_100641023 67
123 3300011119 Ga0105246_10222943 Ga0105246_102229431 67
124 3300011119 Ga0105246_10327631 Ga0105246_103276313 67
125 3300012497 Ga0157319_1023130 Ga0157319_10231302 67
126 3300012513 Ga0157326_1032763 Ga0157326_10327631 67
127 3300012513 Ga0157326_1100258 Ga0157326_11002582 67
128 3300013062 Ga0154010_157882 Ga0154010_1578821 67
129 3300013102 Ga0157371_10860734 Ga0157371_108607342 67
130 3300013104 Ga0157370_12055904 Ga0157370_120559041 67
131 3300013105 Ga0157369_10003351 Ga0157369_100033514 67
132 3300013105 Ga0157369_10772610 Ga0157369_107726101 67
133 3300013105 Ga0157369_10797558 Ga0157369_107975581 67
134 3300013296 Ga0157374_10310684 Ga0157374_103106842 67
135 3300013296 Ga0157374_12059028 Ga0157374_120590282 67
136 3300013297 Ga0157378_10911924 Ga0157378_109119242 67
137 3300013297 Ga0157378_11725166 Ga0157378_117251661 67
138 3300013306 Ga0163162_10202905 Ga0163162_102029053 67
139 3300013306 Ga0163162_11102854 Ga0163162_111028541 67
140 3300013307 Ga0157372_10145791 Ga0157372_101457913 67
141 3300013307 Ga0157372_11446328 Ga0157372_114463281 67
142 3300013307 Ga0157372_12490391 Ga0157372_124903911 67
143 3300013307 Ga0157372_13310479 Ga0157372_133104791 67
144 3300014325 Ga0163163_10003826 Ga0163163_1000382615 67
145 3300014325 Ga0163163_10018613 Ga0163163_100186137 67
146 3300014745 Ga0157377_11310966 Ga0157377_113109661 67
147 3300014968 Ga0157379_10161603 Ga0157379_101616032 67
148 3300014968 Ga0157379_10194905 Ga0157379_101949053 67
149 3300014968 Ga0157379_10235462 Ga0157379_102354623 67
150 3300014969 Ga0157376_10578972 Ga0157376_105789723 67
151 3300021441 Ga0213871_10294354 Ga0213871_102943541 67
152 3300048918 Ga0496115_0188888 Ga0496115_0188888_141_350 67
153 3300005327 Ga0070658_10118807 Ga0070658_101188072 68
154 3300005329 Ga0070683_101343506 Ga0070683_1013435062 68
155 3300005330 Ga0070690_100637002 Ga0070690_1006370021 68
156 3300005331 Ga0070670_101915433 Ga0070670_1019154331 68
157 3300005336 Ga0070680_100005174 Ga0070680_1000051749 68
158 3300005336 Ga0070680_100068383 Ga0070680_1000683833 68
159 3300005337 Ga0070682_101505544 Ga0070682_1015055442 68
160 3300005338 Ga0068868_100234537 Ga0068868_1002345371 68
161 3300005347 Ga0070668_100828021 Ga0070668_1008280212 68
162 3300005364 Ga0070673_101925350 Ga0070673_1019253501 68
163 3300005367 Ga0070667_100602799 Ga0070667_1006027992 68
164 3300005367 Ga0070667_100897904 Ga0070667_1008979042 68
165 3300005455 Ga0070663_102045993 Ga0070663_1020459932 68
166 3300005456 Ga0070678_101417730 Ga0070678_1014177302 68
167 3300005458 Ga0070681_10010435 Ga0070681_100104358 68
168 3300005458 Ga0070681_10101039 Ga0070681_101010392 68
169 3300005530 Ga0070679_100000584 Ga0070679_10000058420 68
170 3300005530 Ga0070679_100101247 Ga0070679_1001012472 68
171 3300005535 Ga0070684_101609607 Ga0070684_1016096072 68
172 3300005539 Ga0068853_102286243 Ga0068853_1022862431 68
173 3300005543 Ga0070672_101142100 Ga0070672_1011421002 68
174 3300005548 Ga0070665_100627161 Ga0070665_1006271613 68
175 3300005549 Ga0070704_100747081 Ga0070704_1007470811 68
176 3300005563 Ga0068855_100023319 Ga0068855_1000233194 68
177 3300005578 Ga0068854_100315988 Ga0068854_1003159883 68
178 3300005614 Ga0068856_101005596 Ga0068856_1010055962 68
179 3300005614 Ga0068856_101019078 Ga0068856_1010190782 68
180 3300005618 Ga0068864_101023014 Ga0068864_1010230141 68
181 3300005834 Ga0068851_10902872 Ga0068851_109028721 68
182 3300005844 Ga0068862_101402027 Ga0068862_1014020271 68
183 3300006173 Ga0070716_100533230 Ga0070716_1005332302 68
184 3300006237 Ga0097621_100993433 Ga0097621_1009934332 68
185 3300006358 Ga0068871_100058693 Ga0068871_1000586937 68
186 3300006358 Ga0068871_102264715 Ga0068871_1022647152 68
187 3300006881 Ga0068865_100914050 Ga0068865_1009140502 68
188 3300007265 Ga0099794_10275053 Ga0099794_102750531 68
189 3300009093 Ga0105240_10117780 Ga0105240_101177802 68
190 3300009093 Ga0105240_10275568 Ga0105240_102755683 68
191 3300009098 Ga0105245_11210102 Ga0105245_112101022 68
192 3300009098 Ga0105245_11390540 Ga0105245_113905402 68
193 3300009148 Ga0105243_11182451 Ga0105243_111824511 68
194 3300009177 Ga0105248_10123749 Ga0105248_101237496 68
195 3300009177 Ga0105248_11259711 Ga0105248_112597112 68
196 3300009545 Ga0105237_10695272 Ga0105237_106952721 68
197 3300009545 Ga0105237_11361988 Ga0105237_113619881 68
198 3300009551 Ga0105238_10000586 Ga0105238_1000058617 68
199 3300009551 Ga0105238_10692192 Ga0105238_106921922 68
200 3300009551 Ga0105238_13036591 Ga0105238_130365912 68
201 3300010375 Ga0105239_11604850 Ga0105239_116048501 68
202 3300011119 Ga0105246_11774398 Ga0105246_117743981 68
203 3300013104 Ga0157370_10004657 Ga0157370_100046578 68
204 3300013104 Ga0157370_10015115 Ga0157370_100151153 68
205 3300013296 Ga0157374_10457756 Ga0157374_104577562 68
206 3300013296 Ga0157374_12916675 Ga0157374_129166752 68
207 3300013297 Ga0157378_10014660 Ga0157378_100146603 68
208 3300013297 Ga0157378_11010873 Ga0157378_110108732 68
209 3300013306 Ga0163162_11951395 Ga0163162_119513952 68
210 3300013307 Ga0157372_10489221 Ga0157372_104892213 68
211 3300013307 Ga0157372_12902104 Ga0157372_129021041 68
212 3300013308 Ga0157375_13464937 Ga0157375_134649372 68
213 3300014969 Ga0157376_11962462 Ga0157376_119624622 68
214 3300033524 Ga0316592_1108090 Ga0316592_11080901 68
215 3300033527 Ga0316586_1102401 Ga0316586_11024011 68
216 3300035113 Ga0373936_0177635 Ga0373936_0177635_609_818 68
217 3300039062 Ga0400483_048591 Ga0400483_048591_788_1015 68
218 3300039062 Ga0400483_170970 Ga0400483_170970_5594_5809 68
219 3300039062 Ga0400483_241924 Ga0400483_241924_1191_1418 68
220 3300049569 Ga0501032_0105612 Ga0501032_0105612_409_618 68
221 3300049570 Ga0501033_0075543 Ga0501033_0075543_234_443 68
222 3300049576 Ga0501040_0047475 Ga0501040_0047475_730_939 68
223 3300049580 Ga0501046_0281833 Ga0501046_0281833_965_1174 68
224 3300049580 Ga0501046_0735240 Ga0501046_0735240_261_470 68
225 3300049581 Ga0501047_0088252 Ga0501047_0088252_2287_2496 68
226 3300049582 Ga0501048_0061003 Ga0501048_0061003_618_827 68
227 3300049584 Ga0501068_0072553 Ga0501068_0072553_30_239 68
228 3300049585 Ga0501069_0200304 Ga0501069_0200304_771_980 68
229 3300049586 Ga0501070_1307874 Ga0501070_1307874_90_299 68
230 3300049741 Ga0501079_0343952 Ga0501079_0343952_429_638 68
231 3300049742 Ga0501080_0153318 Ga0501080_0153318_1746_1955 68
232 3300049823 Ga0501044_0382637 Ga0501044_0382637_982_1191 68
233 3300060353 Ga0501082_0129966 Ga0501082_0129966_1574_1783 68
234 3300061734 Ga0530510_0018821 Ga0530510_0018821_2907_3116 68
235 3300000549 LJQas_1008199 LJQas_10081992 69
236 3300001979 JGI24740J21852_10079157 JGI24740J21852_100791571 69
237 3300001979 JGI24740J21852_10129760 JGI24740J21852_101297601 69
238 3300001989 JGI24739J22299_10045697 JGI24739J22299_100456973 69
239 3300001989 JGI24739J22299_10085716 JGI24739J22299_100857161 69
240 3300001990 JGI24737J22298_10187079 JGI24737J22298_101870792 69
241 3300001990 JGI24737J22298_10189199 JGI24737J22298_101891993 69
242 3300002067 JGI24735J21928_10101112 JGI24735J21928_101011123 69
243 3300002067 JGI24735J21928_10163373 JGI24735J21928_101633732 69
244 3300002075 JGI24738J21930_10107785 JGI24738J21930_101077852 69
245 3300002704 JGI25155J39150_1000011 JGI25155J39150_1000011205 69
246 3300002704 JGI25155J39150_1000330 JGI25155J39150_10003303 69
247 3300002705 JGI25156J39149_1000030 JGI25156J39149_1000030119 69
248 3300002705 JGI25156J39149_1000795 JGI25156J39149_100079516 69
249 3300002705 JGI25156J39149_1002222 JGI25156J39149_10022223 69
250 3300002705 JGI25156J39149_1051441 JGI25156J39149_10514411 69
251 3300002737 JGI25162J39368_1000069 JGI25162J39368_100006938 69
252 3300002737 JGI25162J39368_1000476 JGI25162J39368_100047630 69
253 3300002738 JGI25154J39366_1000289 JGI25154J39366_100028927 69
254 3300002738 JGI25154J39366_1000696 JGI25154J39366_100069616 69
255 3300002738 JGI25154J39366_1020412 JGI25154J39366_10204121 69
256 3300002739 JGI25158J39367_1000188 JGI25158J39367_100018819 69
257 3300002741 JGI25157J39369_1000010 JGI25157J39369_10000107 69
258 3300002741 JGI25157J39369_1000786 JGI25157J39369_10007865 69
259 3300002741 JGI25157J39369_1002208 JGI25157J39369_10022084 69
260 3300002773 JGI25152J39213_1000001 JGI25152J39213_10000011 69
261 3300002773 JGI25152J39213_1000013 JGI25152J39213_1000013126 69
262 3300002773 JGI25152J39213_1000015 JGI25152J39213_1000015108 69
263 3300002773 JGI25152J39213_1000301 JGI25152J39213_100030114 69
264 3300002773 JGI25152J39213_1004424 JGI25152J39213_10044244 69
265 3300002774 JGI25150J39212_1000007 JGI25150J39212_1000007231 69
266 3300002774 JGI25150J39212_1000810 JGI25150J39212_10008103 69
267 3300002868 Ga0006767J43181_101308 Ga0006767J43181_1013081 69
268 3300002870 Ga0006763J43179_100527 Ga0006763J43179_1005271 69
269 3300002987 JGI25159J45721_1000133 JGI25159J45721_10001335 69
270 3300002987 JGI25159J45721_1001957 JGI25159J45721_10019577 69
271 3300002987 JGI25159J45721_1002071 JGI25159J45721_10020711 69
272 3300003163 Ga0006759J45824_1001793 Ga0006759J45824_10017931 69
273 3300003187 JGI25151J46595_10000013 JGI25151J46595_10000013234 69
274 3300003187 JGI25151J46595_10000110 JGI25151J46595_100001108 69
275 3300003187 JGI25151J46595_10005211 JGI25151J46595_100052112 69
276 3300003187 JGI25151J46595_10022787 JGI25151J46595_100227877 69
277 3300003187 JGI25151J46595_10053839 JGI25151J46595_100538393 69
278 3300003214 JGI25165J46597_1000006 JGI25165J46597_1000006247 69
279 3300003214 JGI25165J46597_1000018 JGI25165J46597_1000018112 69
280 3300003214 JGI25165J46597_1000068 JGI25165J46597_100006865 69
281 3300003215 JGI25153J46596_10000378 JGI25153J46596_1000037828 69
282 3300003215 JGI25153J46596_10000437 JGI25153J46596_1000043732 69
283 3300003215 JGI25153J46596_10001081 JGI25153J46596_100010814 69
284 3300003215 JGI25153J46596_10047561 JGI25153J46596_100475611 69
285 3300003300 Ga0006758J48902_1000593 Ga0006758J48902_10005931 69
286 3300003308 Ga0006777J48905_1004194 Ga0006777J48905_10041941 69
287 3300003316 rootH1_10061686 rootH1_100616863 69
288 3300003320 rootH2_10039599 rootH2_1003959914 69
289 3300003320 rootH2_10130185 rootH2_101301856 69
290 3300003322 rootL2_10002287 rootL2_100022871 69
291 3300003322 rootL2_10149362 rootL2_101493626 69
292 3300003323 rootH1_10078983 rootH1_100789836 69
293 3300003354 JGI25160J50197_1000300 JGI25160J50197_100030037 69
294 3300003354 JGI25160J50197_1067736 JGI25160J50197_10677361 69
295 3300003374 JGI25161J50226_1000026 JGI25161J50226_100002622 69
296 3300003559 Ga0007427J51700_100616 Ga0007427J51700_1006161 69
297 3300003578 Ga0006562J51391_1000820 Ga0006562J51391_10008204 69
298 3300003693 Ga0032354_1014652 Ga0032354_10146521 69
299 3300003693 Ga0032354_1023888 Ga0032354_10238881 69
300 3300003693 Ga0032354_1032325 Ga0032354_10323251 69
301 3300003717 Ga0006766_105963 Ga0006766_1059631 69
302 3300003735 Ga0006780_1010778 Ga0006780_10107781 69
303 3300003771 Ga0055526_1000385 Ga0055526_100038524 69
304 3300003771 Ga0055526_1000755 Ga0055526_10007554 69
305 3300003771 Ga0055526_1000922 Ga0055526_100092230 69
306 3300003771 Ga0055526_1014497 Ga0055526_10144971 69
307 3300003771 Ga0055526_1022880 Ga0055526_10228802 69
308 3300003771 Ga0055526_1040784 Ga0055526_10407841 69
309 3300003775 Ga0055524_1000208 Ga0055524_100020861 69
310 3300003775 Ga0055524_1002743 Ga0055524_10027432 69
311 3300003775 Ga0055524_1002804 Ga0055524_10028047 69
312 3300003775 Ga0055524_1005658 Ga0055524_10056583 69
313 3300003775 Ga0055524_1043618 Ga0055524_10436182 69
314 3300003781 Ga0055536_1008548 Ga0055536_10085484 69
315 3300003784 Ga0055534_1016321 Ga0055534_10163212 69
316 3300003790 Ga0055528_1000716 Ga0055528_10007162 69
317 3300003790 Ga0055528_1001208 Ga0055528_100120816 69
318 3300003790 Ga0055528_1005621 Ga0055528_10056214 69
319 3300003790 Ga0055528_1011838 Ga0055528_10118385 69
320 3300003790 Ga0055528_1011997 Ga0055528_10119977 69
321 3300003791 Ga0055530_10009766 Ga0055530_100097664 69
322 3300003792 Ga0055540_1001255 Ga0055540_10012555 69
323 3300003792 Ga0055540_1001932 Ga0055540_100193216 69
324 3300003792 Ga0055540_1001991 Ga0055540_10019912 69
325 3300003792 Ga0055540_1090854 Ga0055540_10908541 69
326 3300003794 Ga0055531_10008208 Ga0055531_100082087 69
327 3300003794 Ga0055531_10064848 Ga0055531_100648483 69
328 3300003856 Ga0058692_1001660 Ga0058692_10016607 69
329 3300003856 Ga0058692_1002829 Ga0058692_10028294 69
330 3300003856 Ga0058692_1050931 Ga0058692_10509311 69
331 3300004625 Ga0055543_1000085 Ga0055543_100008582 69
332 3300004625 Ga0055543_1006378 Ga0055543_10063784 69
333 3300004625 Ga0055543_1020485 Ga0055543_10204853 69
334 3300005262 Ga0065165_1000777 Ga0065165_100077718 69
335 3300005262 Ga0065165_1001054 Ga0065165_100105416 69
336 3300005262 Ga0065165_1001529 Ga0065165_100152917 69
337 3300005262 Ga0065165_1003064 Ga0065165_100306415 69
338 3300005262 Ga0065165_1006194 Ga0065165_10061944 69
339 3300005289 Ga0065704_10006703 Ga0065704_100067037 69
340 3300005327 Ga0070658_10039686 Ga0070658_100396864 69
341 3300005327 Ga0070658_10272484 Ga0070658_102724843 69
342 3300005328 Ga0070676_10233713 Ga0070676_102337131 69
343 3300005328 Ga0070676_10657123 Ga0070676_106571232 69
344 3300005329 Ga0070683_100061536 Ga0070683_1000615362 69
345 3300005331 Ga0070670_100327420 Ga0070670_1003274202 69
346 3300005331 Ga0070670_100492354 Ga0070670_1004923542 69
347 3300005334 Ga0068869_100780617 Ga0068869_1007806172 69
348 3300005335 Ga0070666_10488704 Ga0070666_104887042 69
349 3300005335 Ga0070666_10666486 Ga0070666_106664862 69
350 3300005336 Ga0070680_100025420 Ga0070680_1000254205 69
351 3300005337 Ga0070682_100158227 Ga0070682_1001582271 69
352 3300005337 Ga0070682_100459445 Ga0070682_1004594452 69
353 3300005337 Ga0070682_100577631 Ga0070682_1005776312 69
354 3300005337 Ga0070682_100697167 Ga0070682_1006971672 69
355 3300005337 Ga0070682_100865942 Ga0070682_1008659421 69
356 3300005337 Ga0070682_101211643 Ga0070682_1012116432 69
357 3300005338 Ga0068868_101114712 Ga0068868_1011147122 69
358 3300005339 Ga0070660_100004682 Ga0070660_1000046829 69
359 3300005339 Ga0070660_100411100 Ga0070660_1004111001 69
360 3300005341 Ga0070691_10423161 Ga0070691_104231611 69
361 3300005341 Ga0070691_10912275 Ga0070691_109122752 69
362 3300005344 Ga0070661_100090662 Ga0070661_1000906622 69
363 3300005344 Ga0070661_101296377 Ga0070661_1012963771 69
364 3300005344 Ga0070661_101786598 Ga0070661_1017865981 69
365 3300005345 Ga0070692_10829648 Ga0070692_108296481 69
366 3300005347 Ga0070668_100336439 Ga0070668_1003364392 69
367 3300005347 Ga0070668_100549735 Ga0070668_1005497351 69
368 3300005347 Ga0070668_100757294 Ga0070668_1007572942 69
369 3300005347 Ga0070668_100996973 Ga0070668_1009969731 69
370 3300005347 Ga0070668_101503784 Ga0070668_1015037842 69
371 3300005347 Ga0070668_101809691 Ga0070668_1018096911 69
372 3300005353 Ga0070669_101031725 Ga0070669_1010317252 69
373 3300005353 Ga0070669_101102288 Ga0070669_1011022882 69
374 3300005353 Ga0070669_101622792 Ga0070669_1016227921 69
375 3300005355 Ga0070671_101754663 Ga0070671_1017546631 69
376 3300005355 Ga0070671_101777485 Ga0070671_1017774851 69
377 3300005356 Ga0070674_100228616 Ga0070674_1002286162 69
378 3300005356 Ga0070674_100902288 Ga0070674_1009022881 69
379 3300005356 Ga0070674_101104155 Ga0070674_1011041552 69
380 3300005356 Ga0070674_101274462 Ga0070674_1012744622 69
381 3300005364 Ga0070673_100189893 Ga0070673_1001898932 69
382 3300005365 Ga0070688_100406709 Ga0070688_1004067092 69
383 3300005365 Ga0070688_100591804 Ga0070688_1005918042 69
384 3300005365 Ga0070688_101487784 Ga0070688_1014877841 69
385 3300005366 Ga0070659_100115257 Ga0070659_1001152572 69
386 3300005366 Ga0070659_100927678 Ga0070659_1009276782 69
387 3300005366 Ga0070659_101113855 Ga0070659_1011138551 69
388 3300005367 Ga0070667_100842051 Ga0070667_1008420511 69
389 3300005434 Ga0070709_10134473 Ga0070709_101344732 69
390 3300005435 Ga0070714_100030577 Ga0070714_1000305773 69
391 3300005436 Ga0070713_101698664 Ga0070713_1016986641 69
392 3300005437 Ga0070710_11253951 Ga0070710_112539511 69
393 3300005438 Ga0070701_10508213 Ga0070701_105082132 69
394 3300005439 Ga0070711_100476977 Ga0070711_1004769771 69
395 3300005439 Ga0070711_100599482 Ga0070711_1005994821 69
396 3300005440 Ga0070705_100366232 Ga0070705_1003662322 69
397 3300005440 Ga0070705_101254736 Ga0070705_1012547361 69
398 3300005441 Ga0070700_100306874 Ga0070700_1003068742 69
399 3300005441 Ga0070700_100347399 Ga0070700_1003473992 69
400 3300005441 Ga0070700_101144688 Ga0070700_1011446881 69
401 3300005444 Ga0070694_101700448 Ga0070694_1017004481 69
402 3300005445 Ga0070708_100063270 Ga0070708_1000632702 69
403 3300005455 Ga0070663_100164844 Ga0070663_1001648441 69
404 3300005455 Ga0070663_100521433 Ga0070663_1005214332 69
405 3300005455 Ga0070663_101061914 Ga0070663_1010619142 69
406 3300005455 Ga0070663_101086581 Ga0070663_1010865811 69
407 3300005455 Ga0070663_101215199 Ga0070663_1012151992 69
408 3300005456 Ga0070678_100317287 Ga0070678_1003172871 69
409 3300005456 Ga0070678_100687664 Ga0070678_1006876641 69
410 3300005456 Ga0070678_100791054 Ga0070678_1007910542 69
411 3300005457 Ga0070662_100590274 Ga0070662_1005902742 69
412 3300005457 Ga0070662_100819153 Ga0070662_1008191532 69
413 3300005459 Ga0068867_100076157 Ga0068867_1000761571 69
414 3300005459 Ga0068867_100872840 Ga0068867_1008728402 69
415 3300005459 Ga0068867_102342585 Ga0068867_1023425851 69
416 3300005467 Ga0070706_100848581 Ga0070706_1008485811 69
417 3300005467 Ga0070706_101684089 Ga0070706_1016840891 69
418 3300005468 Ga0070707_100057080 Ga0070707_1000570804 69
419 3300005468 Ga0070707_102201363 Ga0070707_1022013631 69
420 3300005471 Ga0070698_100313544 Ga0070698_1003135442 69
421 3300005471 Ga0070698_100496052 Ga0070698_1004960521 69
422 3300005518 Ga0070699_100142677 Ga0070699_1001426771 69
423 3300005530 Ga0070679_100346942 Ga0070679_1003469422 69
424 3300005530 Ga0070679_100777677 Ga0070679_1007776772 69
425 3300005530 Ga0070679_101969212 Ga0070679_1019692121 69
426 3300005535 Ga0070684_100043633 Ga0070684_1000436332 69
427 3300005536 Ga0070697_100338087 Ga0070697_1003380872 69
428 3300005536 Ga0070697_100866005 Ga0070697_1008660051 69
429 3300005539 Ga0068853_100007383 Ga0068853_1000073839 69
430 3300005539 Ga0068853_100150401 Ga0068853_1001504013 69
431 3300005539 Ga0068853_100232122 Ga0068853_1002321222 69
432 3300005539 Ga0068853_100473679 Ga0068853_1004736793 69
433 3300005543 Ga0070672_100434179 Ga0070672_1004341793 69
434 3300005543 Ga0070672_101108436 Ga0070672_1011084362 69
435 3300005543 Ga0070672_101912571 Ga0070672_1019125712 69
436 3300005546 Ga0070696_101009071 Ga0070696_1010090711 69
437 3300005548 Ga0070665_100010030 Ga0070665_1000100307 69
438 3300005548 Ga0070665_100011730 Ga0070665_1000117309 69
439 3300005548 Ga0070665_100129470 Ga0070665_1001294705 69
440 3300005548 Ga0070665_100171160 Ga0070665_1001711605 69
441 3300005548 Ga0070665_100275615 Ga0070665_1002756152 69
442 3300005548 Ga0070665_100430736 Ga0070665_1004307362 69
443 3300005548 Ga0070665_101051388 Ga0070665_1010513882 69
444 3300005548 Ga0070665_101066579 Ga0070665_1010665791 69
445 3300005548 Ga0070665_101092863 Ga0070665_1010928632 69
446 3300005549 Ga0070704_100666717 Ga0070704_1006667172 69
447 3300005563 Ga0068855_100167683 Ga0068855_1001676833 69
448 3300005563 Ga0068855_100749453 Ga0068855_1007494532 69
449 3300005563 Ga0068855_101713595 Ga0068855_1017135951 69
450 3300005564 Ga0070664_100370331 Ga0070664_1003703313 69
451 3300005564 Ga0070664_101253071 Ga0070664_1012530712 69
452 3300005577 Ga0068857_100038424 Ga0068857_1000384245 69
453 3300005577 Ga0068857_100439499 Ga0068857_1004394991 69
454 3300005577 Ga0068857_101954682 Ga0068857_1019546821 69
455 3300005578 Ga0068854_101426848 Ga0068854_1014268481 69
456 3300005614 Ga0068856_100000651 Ga0068856_10000065110 69
457 3300005614 Ga0068856_100036991 Ga0068856_1000369914 69
458 3300005614 Ga0068856_100739727 Ga0068856_1007397272 69
459 3300005614 Ga0068856_100886621 Ga0068856_1008866212 69
460 3300005616 Ga0068852_100002449 Ga0068852_1000024495 69
461 3300005616 Ga0068852_100583092 Ga0068852_1005830922 69
462 3300005616 Ga0068852_100678940 Ga0068852_1006789402 69
463 3300005616 Ga0068852_101991358 Ga0068852_1019913581 69
464 3300005617 Ga0068859_100321492 Ga0068859_1003214921 69
465 3300005617 Ga0068859_100940427 Ga0068859_1009404272 69
466 3300005618 Ga0068864_100884327 Ga0068864_1008843272 69
467 3300005718 Ga0068866_10524739 Ga0068866_105247392 69
468 3300005718 Ga0068866_10611223 Ga0068866_106112232 69
469 3300005719 Ga0068861_100152859 Ga0068861_1001528592 69
470 3300005719 Ga0068861_102158497 Ga0068861_1021584972 69
471 3300005834 Ga0068851_10002569 Ga0068851_100025692 69
472 3300005834 Ga0068851_10912857 Ga0068851_109128571 69
473 3300005840 Ga0068870_11343312 Ga0068870_113433122 69
474 3300005841 Ga0068863_100385697 Ga0068863_1003856972 69
475 3300005842 Ga0068858_100565271 Ga0068858_1005652712 69
476 3300005842 Ga0068858_101235566 Ga0068858_1012355662 69
477 3300005843 Ga0068860_101297974 Ga0068860_1012979742 69
478 3300005844 Ga0068862_100941012 Ga0068862_1009410121 69
479 3300005844 Ga0068862_101166870 Ga0068862_1011668702 69
480 3300005844 Ga0068862_101436506 Ga0068862_1014365062 69
481 3300006028 Ga0070717_10226297 Ga0070717_102262972 69
482 3300006038 Ga0075365_10077588 Ga0075365_100775882 69
483 3300006038 Ga0075365_10311375 Ga0075365_103113752 69
484 3300006038 Ga0075365_10435417 Ga0075365_104354172 69
485 3300006038 Ga0075365_10441009 Ga0075365_104410091 69
486 3300006038 Ga0075365_10607957 Ga0075365_106079571 69
487 3300006038 Ga0075365_10845685 Ga0075365_108456852 69
488 3300006038 Ga0075365_11018704 Ga0075365_110187042 69
489 3300006042 Ga0075368_10019912 Ga0075368_100199124 69
490 3300006042 Ga0075368_10488389 Ga0075368_104883892 69
491 3300006048 Ga0075363_100045350 Ga0075363_1000453504 69
492 3300006048 Ga0075363_100341400 Ga0075363_1003414001 69
493 3300006051 Ga0075364_10000320 Ga0075364_100003207 69
494 3300006051 Ga0075364_10069975 Ga0075364_100699752 69
495 3300006051 Ga0075364_10120941 Ga0075364_101209412 69
496 3300006051 Ga0075364_10149731 Ga0075364_101497313 69
497 3300006051 Ga0075364_10333638 Ga0075364_103336382 69
498 3300006051 Ga0075364_10557811 Ga0075364_105578112 69
499 3300006051 Ga0075364_10753009 Ga0075364_107530091 69
500 3300006051 Ga0075364_11224085 Ga0075364_112240851 69
501 3300006058 Ga0075432_10171685 Ga0075432_101716851 69
502 3300006058 Ga0075432_10380921 Ga0075432_103809211 69
503 3300006177 Ga0075362_10179934 Ga0075362_101799342 69
504 3300006177 Ga0075362_10191992 Ga0075362_101919922 69
505 3300006177 Ga0075362_10339392 Ga0075362_103393922 69
506 3300006178 Ga0075367_10053258 Ga0075367_100532584 69
507 3300006178 Ga0075367_10158743 Ga0075367_101587432 69
508 3300006178 Ga0075367_10259649 Ga0075367_102596491 69
509 3300006178 Ga0075367_10340727 Ga0075367_103407272 69
510 3300006178 Ga0075367_10415412 Ga0075367_104154122 69
511 3300006178 Ga0075367_10495465 Ga0075367_104954652 69
512 3300006186 Ga0075369_10033975 Ga0075369_100339753 69
513 3300006186 Ga0075369_10229622 Ga0075369_102296221 69
514 3300006186 Ga0075369_10230793 Ga0075369_102307932 69
515 3300006186 Ga0075369_10347070 Ga0075369_103470702 69
516 3300006186 Ga0075369_10494535 Ga0075369_104945352 69
517 3300006195 Ga0075366_10322383 Ga0075366_103223832 69
518 3300006195 Ga0075366_10367725 Ga0075366_103677252 69
519 3300006195 Ga0075366_10891196 Ga0075366_108911962 69
520 3300006237 Ga0097621_101167118 Ga0097621_1011671182 69
521 3300006353 Ga0075370_10018171 Ga0075370_100181715 69
522 3300006353 Ga0075370_10097282 Ga0075370_100972826 69
523 3300006353 Ga0075370_10129730 Ga0075370_101297301 69
524 3300006353 Ga0075370_10181643 Ga0075370_101816432 69
525 3300006353 Ga0075370_10203448 Ga0075370_102034482 69
526 3300006353 Ga0075370_10341172 Ga0075370_103411722 69
527 3300006353 Ga0075370_10476095 Ga0075370_104760952 69
528 3300006353 Ga0075370_10892697 Ga0075370_108926971 69
529 3300006353 Ga0075370_10916021 Ga0075370_109160211 69
530 3300006353 Ga0075370_10946572 Ga0075370_109465721 69
531 3300006358 Ga0068871_101189418 Ga0068871_1011894181 69
532 3300006358 Ga0068871_101488021 Ga0068871_1014880212 69
533 3300006358 Ga0068871_101854791 Ga0068871_1018547912 69
534 3300006844 Ga0075428_101083300 Ga0075428_1010833002 69
535 3300006846 Ga0075430_100938742 Ga0075430_1009387421 69
536 3300006881 Ga0068865_100201405 Ga0068865_1002014052 69
537 3300006881 Ga0068865_100224699 Ga0068865_1002246993 69
538 3300006881 Ga0068865_100335828 Ga0068865_1003358282 69
539 3300006881 Ga0068865_100782959 Ga0068865_1007829592 69
540 3300006881 Ga0068865_101963691 Ga0068865_1019636911 69
541 3300006931 Ga0097620_100321510 Ga0097620_1003215102 69
542 3300006931 Ga0097620_100940446 Ga0097620_1009404462 69
543 3300006946 Ga0079104_1002834 Ga0079104_10028347 69
544 3300006946 Ga0079104_1004884 Ga0079104_10048843 69
545 3300006948 Ga0099826_10000040 Ga0099826_1000004063 69
546 3300006948 Ga0099826_10013124 Ga0099826_100131248 69
547 3300006948 Ga0099826_10154666 Ga0099826_101546661 69
548 3300007265 Ga0099794_10031348 Ga0099794_100313483 69
549 3300007265 Ga0099794_10156085 Ga0099794_101560851 69
550 3300007788 Ga0099795_10071229 Ga0099795_100712292 69
551 3300007788 Ga0099795_10314917 Ga0099795_103149172 69
552 3300009036 Ga0105244_10260270 Ga0105244_102602702 69
553 3300009092 Ga0105250_10195860 Ga0105250_101958602 69
554 3300009093 Ga0105240_10016396 Ga0105240_100163964 69
555 3300009093 Ga0105240_10038936 Ga0105240_100389363 69
556 3300009093 Ga0105240_10076364 Ga0105240_100763645 69
557 3300009093 Ga0105240_11056313 Ga0105240_110563132 69
558 3300009093 Ga0105240_11330344 Ga0105240_113303442 69
559 3300009094 Ga0111539_10365680 Ga0111539_103656802 69
560 3300009094 Ga0111539_12143718 Ga0111539_121437182 69
561 3300009098 Ga0105245_10255993 Ga0105245_102559932 69
562 3300009098 Ga0105245_12418004 Ga0105245_124180042 69
563 3300009098 Ga0105245_13127780 Ga0105245_131277801 69
564 3300009101 Ga0105247_10406813 Ga0105247_104068132 69
565 3300009101 Ga0105247_10407874 Ga0105247_104078742 69
566 3300009101 Ga0105247_10823433 Ga0105247_108234333 69
567 3300009147 Ga0114129_10829415 Ga0114129_108294152 69
568 3300009148 Ga0105243_10387961 Ga0105243_103879612 69
569 3300009148 Ga0105243_10625283 Ga0105243_106252831 69
570 3300009174 Ga0105241_10161174 Ga0105241_101611742 69
571 3300009174 Ga0105241_10974714 Ga0105241_109747141 69
572 3300009174 Ga0105241_11519992 Ga0105241_115199922 69
573 3300009174 Ga0105241_12035785 Ga0105241_120357851 69
574 3300009176 Ga0105242_10401881 Ga0105242_104018812 69
575 3300009176 Ga0105242_11596121 Ga0105242_115961211 69
576 3300009177 Ga0105248_13106904 Ga0105248_131069041 69
577 3300009545 Ga0105237_10009263 Ga0105237_100092639 69
578 3300009545 Ga0105237_10086048 Ga0105237_100860483 69
579 3300009545 Ga0105237_10229457 Ga0105237_102294574 69
580 3300009545 Ga0105237_12715303 Ga0105237_127153031 69
581 3300009551 Ga0105238_10008521 Ga0105238_100085215 69
582 3300009551 Ga0105238_10079916 Ga0105238_100799162 69
583 3300009551 Ga0105238_10805939 Ga0105238_108059392 69
584 3300009551 Ga0105238_11913949 Ga0105238_119139491 69
585 3300009551 Ga0105238_12460429 Ga0105238_124604291 69
586 3300009553 Ga0105249_10628591 Ga0105249_106285911 69
587 3300009553 Ga0105249_11183471 Ga0105249_111834711 69
588 3300009553 Ga0105249_11562792 Ga0105249_115627922 69
589 3300010159 Ga0099796_10449343 Ga0099796_104493431 69
590 3300010159 Ga0099796_10461234 Ga0099796_104612341 69
591 3300010159 Ga0099796_10465944 Ga0099796_104659442 69
592 3300010375 Ga0105239_10077487 Ga0105239_100774874 69
593 3300010375 Ga0105239_10190814 Ga0105239_101908141 69
594 3300010375 Ga0105239_10259657 Ga0105239_102596572 69
595 3300010375 Ga0105239_11929401 Ga0105239_119294011 69
596 3300010375 Ga0105239_11982474 Ga0105239_119824741 69
597 3300011119 Ga0105246_10482571 Ga0105246_104825712 69
598 3300012500 Ga0157314_1002158 Ga0157314_10021583 69
599 3300013100 Ga0157373_10066042 Ga0157373_100660423 69
600 3300013100 Ga0157373_10107862 Ga0157373_101078621 69
601 3300013100 Ga0157373_10731187 Ga0157373_107311872 69
602 3300013100 Ga0157373_10813394 Ga0157373_108133942 69
603 3300013102 Ga0157371_10002849 Ga0157371_1000284910 69
604 3300013104 Ga0157370_10042298 Ga0157370_100422983 69
605 3300013104 Ga0157370_10225131 Ga0157370_102251312 69
606 3300013104 Ga0157370_11133646 Ga0157370_111336462 69
607 3300013105 Ga0157369_10029343 Ga0157369_100293437 69
608 3300013105 Ga0157369_10058855 Ga0157369_100588553 69
609 3300013105 Ga0157369_10144676 Ga0157369_101446764 69
610 3300013105 Ga0157369_11200497 Ga0157369_112004972 69
611 3300013249 Ga0171463_1003 Ga0171463_1003306 69
612 3300013296 Ga0157374_10376181 Ga0157374_103761811 69
613 3300013296 Ga0157374_11085245 Ga0157374_110852452 69
614 3300013296 Ga0157374_11336775 Ga0157374_113367752 69
615 3300013297 Ga0157378_11016669 Ga0157378_110166692 69
616 3300013297 Ga0157378_11776161 Ga0157378_117761612 69
617 3300013297 Ga0157378_12831116 Ga0157378_128311161 69
618 3300013306 Ga0163162_10060142 Ga0163162_100601422 69
619 3300013306 Ga0163162_11533273 Ga0163162_115332732 69
620 3300013306 Ga0163162_12300561 Ga0163162_123005611 69
621 3300013307 Ga0157372_10582434 Ga0157372_105824341 69
622 3300013308 Ga0157375_11585474 Ga0157375_115854741 69
623 3300014325 Ga0163163_11558662 Ga0163163_115586622 69
624 3300014325 Ga0163163_13025160 Ga0163163_130251601 69
625 3300014326 Ga0157380_10192376 Ga0157380_101923762 69
626 3300014326 Ga0157380_10748488 Ga0157380_107484882 69
627 3300014326 Ga0157380_10902202 Ga0157380_109022022 69
628 3300014497 Ga0182008_10508635 Ga0182008_105086351 69
629 3300014497 Ga0182008_10830994 Ga0182008_108309941 69
630 3300014745 Ga0157377_10449732 Ga0157377_104497322 69
631 3300014968 Ga0157379_10205386 Ga0157379_102053863 69
632 3300014969 Ga0157376_10290978 Ga0157376_102909782 69
633 3300014969 Ga0157376_10792461 Ga0157376_107924612 69
634 3300014969 Ga0157376_10986277 Ga0157376_109862772 69
635 3300014969 Ga0157376_11431980 Ga0157376_114319801 69
636 3300014969 Ga0157376_11944450 Ga0157376_119444502 69
637 3300015684 Ga0183365_11929 Ga0183365_119291 69
638 3300015690 Ga0183363_1168 Ga0183363_116810 69
639 3300017792 Ga0163161_10454435 Ga0163161_104544352 69
640 3300019192 Ga0184603_100425 Ga0184603_1004252 69
641 3300020070 Ga0206356_10018687 Ga0206356_100186871 69
642 3300020077 Ga0206351_10069610 Ga0206351_100696101 69
643 3300020081 Ga0206354_10465592 Ga0206354_104655923 69
644 3300020610 Ga0154015_1351868 Ga0154015_13518682 69
645 3300021320 Ga0214544_1000646 Ga0214544_100064642 69
646 3300021321 Ga0214542_1000027 Ga0214542_100002748 69
647 3300021327 Ga0214543_1000047 Ga0214543_100004722 69
648 3300021327 Ga0214543_1002177 Ga0214543_100217727 69
649 3300021361 Ga0213872_10058728 Ga0213872_100587281 69
650 3300021384 Ga0213876_10000865 Ga0213876_100008655 69
651 3300021384 Ga0213876_10035923 Ga0213876_100359233 69
652 3300021388 Ga0213875_10053600 Ga0213875_100536002 69
653 3300022467 Ga0224712_10615057 Ga0224712_106150572 69
654 3300022739 Ga0228711_1006836 Ga0228711_100683618 69
655 3300022740 Ga0228710_1006916 Ga0228710_100691618 69
656 3300024227 Ga0228598_1057208 Ga0228598_10572081 69
657 3300025206 Ga0209435_100022 Ga0209435_1000225 69
658 3300025206 Ga0209435_100086 Ga0209435_10008627 69
659 3300025208 Ga0209436_100016 Ga0209436_10001618 69
660 3300025208 Ga0209436_134582 Ga0209436_1345822 69
661 3300025230 Ga0209563_104597 Ga0209563_1045972 69
662 3300025230 Ga0209563_106926 Ga0209563_1069261 69
663 3300025231 Ga0207427_120023 Ga0207427_1200231 69
664 3300025233 Ga0209437_100022 Ga0209437_100022174 69
665 3300025233 Ga0209437_100067 Ga0209437_100067141 69
666 3300025245 Ga0207425_1000012 Ga0207425_1000012157 69
667 3300025245 Ga0207425_1000032 Ga0207425_1000032231 69
668 3300025245 Ga0207425_1003086 Ga0207425_10030868 69
669 3300025245 Ga0207425_1006874 Ga0207425_10068748 69
670 3300025246 Ga0209646_1000078 Ga0209646_10000785 69
671 3300025246 Ga0209646_1000279 Ga0209646_100027927 69
672 3300025246 Ga0209646_1004843 Ga0209646_10048432 69
673 3300025246 Ga0209646_1010572 Ga0209646_10105721 69
674 3300025250 Ga0209026_1000065 Ga0209026_10000655 69
675 3300025250 Ga0209026_1000089 Ga0209026_1000089173 69
676 3300025250 Ga0209026_1000341 Ga0209026_100034127 69
677 3300025254 Ga0209148_1003572 Ga0209148_10035721 69
678 3300025254 Ga0209148_1006083 Ga0209148_10060832 69
679 3300025254 Ga0209148_1041685 Ga0209148_10416851 69
680 3300025256 Ga0209759_1000055 Ga0209759_10000555 69
681 3300025256 Ga0209759_1000471 Ga0209759_100047127 69
682 3300025256 Ga0209759_1000539 Ga0209759_100053933 69
683 3300025256 Ga0209759_1013305 Ga0209759_10133055 69
684 3300025256 Ga0209759_1027489 Ga0209759_10274892 69
685 3300025258 Ga0209129_1000056 Ga0209129_1000056231 69
686 3300025258 Ga0209129_1000166 Ga0209129_100016698 69
687 3300025258 Ga0209129_1000453 Ga0209129_100045328 69
688 3300025258 Ga0209129_1001565 Ga0209129_10015653 69
689 3300025258 Ga0209129_1002345 Ga0209129_10023455 69
690 3300025261 Ga0209233_1000010 Ga0209233_1000010828 69
691 3300025261 Ga0209233_1000031 Ga0209233_1000031174 69
692 3300025261 Ga0209233_1000088 Ga0209233_1000088141 69
693 3300025263 Ga0209565_1050572 Ga0209565_10505721 69
694 3300025272 Ga0209455_1008214 Ga0209455_10082144 69
695 3300025272 Ga0209455_1036213 Ga0209455_10362131 69
696 3300025273 Ga0209673_1001400 Ga0209673_10014002 69
697 3300025273 Ga0209673_1002430 Ga0209673_100243021 69
698 3300025273 Ga0209673_1005708 Ga0209673_10057088 69
699 3300025273 Ga0209673_1007049 Ga0209673_10070494 69
700 3300025273 Ga0209673_1017468 Ga0209673_10174681 69
701 3300025273 Ga0209673_1047925 Ga0209673_10479252 69
702 3300025284 Ga0209130_1000049 Ga0209130_1000049220 69
703 3300025284 Ga0209130_1000264 Ga0209130_100026437 69
704 3300025284 Ga0209130_1001049 Ga0209130_10010498 69
705 3300025291 Ga0209675_1001620 Ga0209675_100162015 69
706 3300025292 Ga0209676_1002997 Ga0209676_10029978 69
707 3300025294 Ga0209025_1000016 Ga0209025_1000016288 69
708 3300025294 Ga0209025_1000024 Ga0209025_1000024157 69
709 3300025294 Ga0209025_1000090 Ga0209025_1000090231 69
710 3300025294 Ga0209025_1000336 Ga0209025_1000336100 69
711 3300025294 Ga0209025_1000374 Ga0209025_100037465 69
712 3300025294 Ga0209025_1000917 Ga0209025_100091713 69
713 3300025294 Ga0209025_1001912 Ga0209025_100191225 69
714 3300025294 Ga0209025_1003123 Ga0209025_10031239 69
715 3300025294 Ga0209025_1059125 Ga0209025_10591252 69
716 3300025294 Ga0209025_1060690 Ga0209025_10606903 69
717 3300025295 Ga0209564_1000023 Ga0209564_1000023341 69
718 3300025295 Ga0209564_1000354 Ga0209564_100035487 69
719 3300025295 Ga0209564_1000403 Ga0209564_100040321 69
720 3300025295 Ga0209564_1002352 Ga0209564_10023523 69
721 3300025295 Ga0209564_1002912 Ga0209564_100291213 69
722 3300025297 Ga0209758_1000084 Ga0209758_1000084231 69
723 3300025297 Ga0209758_1000150 Ga0209758_10001508 69
724 3300025297 Ga0209758_1000383 Ga0209758_100038321 69
725 3300025297 Ga0209758_1000396 Ga0209758_100039645 69
726 3300025297 Ga0209758_1001244 Ga0209758_100124430 69
727 3300025297 Ga0209758_1001532 Ga0209758_10015323 69
728 3300025297 Ga0209758_1018391 Ga0209758_10183911 69
729 3300025297 Ga0209758_1023867 Ga0209758_10238672 69
730 3300025298 Ga0209050_1006153 Ga0209050_10061532 69
731 3300025299 Ga0209256_1000042 Ga0209256_1000042370 69
732 3300025299 Ga0209256_1000176 Ga0209256_100017666 69
733 3300025299 Ga0209256_1000436 Ga0209256_10004369 69
734 3300025299 Ga0209256_1001515 Ga0209256_10015152 69
735 3300025299 Ga0209256_1001769 Ga0209256_100176915 69
736 3300025299 Ga0209256_1029391 Ga0209256_10293912 69
737 3300025302 Ga0207426_1000140 Ga0207426_100014016 69
738 3300025302 Ga0207426_1003465 Ga0207426_10034659 69
739 3300025302 Ga0207426_1008701 Ga0207426_10087015 69
740 3300025303 Ga0209051_1000202 Ga0209051_100020250 69
741 3300025303 Ga0209051_1002097 Ga0209051_100209720 69
742 3300025303 Ga0209051_1002339 Ga0209051_10023394 69
743 3300025303 Ga0209051_1047889 Ga0209051_10478892 69
744 3300025304 Ga0209257_1002210 Ga0209257_10022108 69
745 3300025304 Ga0209257_1026228 Ga0209257_10262283 69
746 3300025315 Ga0207697_10469124 Ga0207697_104691242 69
747 3300025321 Ga0207656_10289265 Ga0207656_102892651 69
748 3300025898 Ga0207692_10800031 Ga0207692_108000311 69
749 3300025899 Ga0207642_11108421 Ga0207642_111084212 69
750 3300025900 Ga0207710_10752476 Ga0207710_107524762 69
751 3300025901 Ga0207688_10038101 Ga0207688_100381012 69
752 3300025903 Ga0207680_10457350 Ga0207680_104573502 69
753 3300025904 Ga0207647_10020192 Ga0207647_100201923 69
754 3300025904 Ga0207647_10787280 Ga0207647_107872803 69
755 3300025905 Ga0207685_10599264 Ga0207685_105992642 69
756 3300025906 Ga0207699_10184842 Ga0207699_101848423 69
757 3300025906 Ga0207699_11316213 Ga0207699_113162131 69
758 3300025907 Ga0207645_10124466 Ga0207645_101244663 69
759 3300025907 Ga0207645_10314810 Ga0207645_103148102 69
760 3300025908 Ga0207643_10366596 Ga0207643_103665961 69
761 3300025909 Ga0207705_10314146 Ga0207705_103141462 69
762 3300025909 Ga0207705_10461712 Ga0207705_104617121 69
763 3300025909 Ga0207705_10483989 Ga0207705_104839892 69
764 3300025910 Ga0207684_10540691 Ga0207684_105406912 69
765 3300025910 Ga0207684_10558079 Ga0207684_105580792 69
766 3300025910 Ga0207684_10876246 Ga0207684_108762461 69
767 3300025911 Ga0207654_10122105 Ga0207654_101221052 69
768 3300025912 Ga0207707_10001548 Ga0207707_100015485 69
769 3300025913 Ga0207695_10026590 Ga0207695_100265904 69
770 3300025913 Ga0207695_10031741 Ga0207695_100317415 69
771 3300025913 Ga0207695_10234865 Ga0207695_102348653 69
772 3300025913 Ga0207695_10360149 Ga0207695_103601492 69
773 3300025914 Ga0207671_10128696 Ga0207671_101286963 69
774 3300025914 Ga0207671_10253836 Ga0207671_102538361 69
775 3300025914 Ga0207671_10321150 Ga0207671_103211501 69
776 3300025914 Ga0207671_10376419 Ga0207671_103764191 69
777 3300025916 Ga0207663_10472981 Ga0207663_104729812 69
778 3300025916 Ga0207663_11149460 Ga0207663_111494602 69
779 3300025917 Ga0207660_10235674 Ga0207660_102356742 69
780 3300025918 Ga0207662_10163992 Ga0207662_101639922 69
781 3300025919 Ga0207657_10003813 Ga0207657_1000381316 69
782 3300025919 Ga0207657_10637474 Ga0207657_106374742 69
783 3300025920 Ga0207649_11587350 Ga0207649_115873501 69
784 3300025921 Ga0207652_10807821 Ga0207652_108078212 69
785 3300025921 Ga0207652_10948362 Ga0207652_109483621 69
786 3300025922 Ga0207646_10052931 Ga0207646_100529314 69
787 3300025923 Ga0207681_10895929 Ga0207681_108959292 69
788 3300025923 Ga0207681_11489412 Ga0207681_114894121 69
789 3300025924 Ga0207694_10005521 Ga0207694_100055215 69
790 3300025924 Ga0207694_10082752 Ga0207694_100827523 69
791 3300025924 Ga0207694_11634681 Ga0207694_116346811 69
792 3300025925 Ga0207650_10413734 Ga0207650_104137342 69
793 3300025926 Ga0207659_10729929 Ga0207659_107299292 69
794 3300025927 Ga0207687_10302241 Ga0207687_103022412 69
795 3300025929 Ga0207664_10185455 Ga0207664_101854552 69
796 3300025931 Ga0207644_10715100 Ga0207644_107151002 69
797 3300025931 Ga0207644_11575578 Ga0207644_115755781 69
798 3300025932 Ga0207690_10230621 Ga0207690_102306213 69
799 3300025932 Ga0207690_10782027 Ga0207690_107820271 69
800 3300025933 Ga0207706_10241537 Ga0207706_102415372 69
801 3300025934 Ga0207686_11122443 Ga0207686_111224433 69
802 3300025934 Ga0207686_11264160 Ga0207686_112641601 69
803 3300025935 Ga0207709_10038819 Ga0207709_100388194 69
804 3300025936 Ga0207670_10177137 Ga0207670_101771372 69
805 3300025936 Ga0207670_11308611 Ga0207670_113086111 69
806 3300025937 Ga0207669_10093822 Ga0207669_100938223 69
807 3300025937 Ga0207669_10179754 Ga0207669_101797541 69
808 3300025937 Ga0207669_10645044 Ga0207669_106450442 69
809 3300025938 Ga0207704_10077449 Ga0207704_100774492 69
810 3300025938 Ga0207704_10407950 Ga0207704_104079502 69
811 3300025939 Ga0207665_10097692 Ga0207665_100976922 69
812 3300025940 Ga0207691_10162516 Ga0207691_101625162 69
813 3300025940 Ga0207691_10255411 Ga0207691_102554112 69
814 3300025940 Ga0207691_10412390 Ga0207691_104123901 69
815 3300025942 Ga0207689_10030772 Ga0207689_100307723 69
816 3300025942 Ga0207689_10534510 Ga0207689_105345101 69
817 3300025944 Ga0207661_10137427 Ga0207661_101374272 69
818 3300025945 Ga0207679_10374629 Ga0207679_103746293 69
819 3300025949 Ga0207667_10086152 Ga0207667_100861523 69
820 3300025949 Ga0207667_10593244 Ga0207667_105932442 69
821 3300025949 Ga0207667_10806942 Ga0207667_108069421 69
822 3300025960 Ga0207651_10744256 Ga0207651_107442561 69
823 3300025960 Ga0207651_10848228 Ga0207651_108482282 69
824 3300025960 Ga0207651_11090557 Ga0207651_110905572 69
825 3300025961 Ga0207712_11310577 Ga0207712_113105771 69
826 3300025972 Ga0207668_10416394 Ga0207668_104163942 69
827 3300025972 Ga0207668_10652805 Ga0207668_106528052 69
828 3300025972 Ga0207668_10667885 Ga0207668_106678852 69
829 3300025972 Ga0207668_10833030 Ga0207668_108330302 69
830 3300025972 Ga0207668_10853263 Ga0207668_108532631 69
831 3300025972 Ga0207668_11609372 Ga0207668_116093722 69
832 3300025972 Ga0207668_11942410 Ga0207668_119424102 69
833 3300025986 Ga0207658_10044456 Ga0207658_100444561 69
834 3300026023 Ga0207677_12269250 Ga0207677_122692502 69
835 3300026023 Ga0207677_12285938 Ga0207677_122859382 69
836 3300026035 Ga0207703_10178567 Ga0207703_101785673 69
837 3300026035 Ga0207703_11341514 Ga0207703_113415142 69
838 3300026035 Ga0207703_11596577 Ga0207703_115965771 69
839 3300026035 Ga0207703_11942697 Ga0207703_119426972 69
840 3300026041 Ga0207639_10009172 Ga0207639_100091725 69
841 3300026041 Ga0207639_10152599 Ga0207639_101525992 69
842 3300026067 Ga0207678_10187943 Ga0207678_101879431 69
843 3300026067 Ga0207678_10446427 Ga0207678_104464273 69
844 3300026067 Ga0207678_10479257 Ga0207678_104792572 69
845 3300026067 Ga0207678_11083002 Ga0207678_110830021 69
846 3300026075 Ga0207708_10303663 Ga0207708_103036632 69
847 3300026075 Ga0207708_10371502 Ga0207708_103715022 69
848 3300026078 Ga0207702_10000546 Ga0207702_1000054610 69
849 3300026078 Ga0207702_10004644 Ga0207702_1000464415 69
850 3300026078 Ga0207702_10033523 Ga0207702_100335235 69
851 3300026078 Ga0207702_11287383 Ga0207702_112873831 69
852 3300026078 Ga0207702_11878437 Ga0207702_118784371 69
853 3300026088 Ga0207641_10506513 Ga0207641_105065132 69
854 3300026089 Ga0207648_10438622 Ga0207648_104386221 69
855 3300026089 Ga0207648_10736609 Ga0207648_107366092 69
856 3300026089 Ga0207648_12159564 Ga0207648_121595641 69
857 3300026116 Ga0207674_10030653 Ga0207674_100306534 69
858 3300026116 Ga0207674_10268667 Ga0207674_102686672 69
859 3300026116 Ga0207674_11154109 Ga0207674_111541092 69
860 3300026116 Ga0207674_11305657 Ga0207674_113056572 69
861 3300026118 Ga0207675_100080427 Ga0207675_1000804273 69
862 3300026118 Ga0207675_100281434 Ga0207675_1002814342 69
863 3300026121 Ga0207683_10057053 Ga0207683_100570532 69
864 3300026121 Ga0207683_10211177 Ga0207683_102111772 69
865 3300026142 Ga0207698_10053786 Ga0207698_100537863 69
866 3300026142 Ga0207698_10520190 Ga0207698_105201902 69
867 3300026142 Ga0207698_10568603 Ga0207698_105686032 69
868 3300026142 Ga0207698_11418138 Ga0207698_114181382 69
869 3300027111 Ga0209281_1000106 Ga0209281_100010652 69
870 3300027111 Ga0209281_1000426 Ga0209281_10004267 69
871 3300027312 Ga0209371_1000003 Ga0209371_1000003155 69
872 3300027312 Ga0209371_1000990 Ga0209371_100099026 69
873 3300027312 Ga0209371_1008618 Ga0209371_10086185 69
874 3300027512 Ga0209179_1100768 Ga0209179_11007681 69
875 3300027666 Ga0209282_1000083 Ga0209282_100008319 69
876 3300027666 Ga0209282_1000167 Ga0209282_100016732 69
877 3300027666 Ga0209282_1044704 Ga0209282_10447042 69
878 3300027671 Ga0209588_1016674 Ga0209588_10166741 69
879 3300027671 Ga0209588_1067862 Ga0209588_10678623 69
880 3300027866 Ga0209813_10183950 Ga0209813_101839501 69
881 3300027907 Ga0207428_10087187 Ga0207428_100871873 69
882 3300028379 Ga0268266_10011520 Ga0268266_1001152012 69
883 3300028379 Ga0268266_10021951 Ga0268266_100219515 69
884 3300028379 Ga0268266_10041638 Ga0268266_100416381 69
885 3300028379 Ga0268266_10232819 Ga0268266_102328192 69
886 3300028379 Ga0268266_10242298 Ga0268266_102422982 69
887 3300028379 Ga0268266_10297658 Ga0268266_102976581 69
888 3300028379 Ga0268266_10442705 Ga0268266_104427053 69
889 3300028379 Ga0268266_10649621 Ga0268266_106496212 69
890 3300028379 Ga0268266_11502122 Ga0268266_115021222 69
891 3300028380 Ga0268265_10200832 Ga0268265_102008322 69
892 3300028380 Ga0268265_10643265 Ga0268265_106432652 69
893 3300028380 Ga0268265_12427940 Ga0268265_124279402 69
894 3300028381 Ga0268264_11514417 Ga0268264_115144171 69
895 3300028573 Ga0265334_10065282 Ga0265334_100652822 69
896 3300028786 Ga0307517_10289775 Ga0307517_102897751 69
897 3300028794 Ga0307515_10002180 Ga0307515_1000218012 69
898 3300028794 Ga0307515_10162439 Ga0307515_101624392 69
899 3300028794 Ga0307515_10189868 Ga0307515_101898682 69
900 3300030500 Ga0268256_1000004 Ga0268256_1000004896 69
901 3300030500 Ga0268256_1000571 Ga0268256_100057127 69
902 3300030500 Ga0268256_1009027 Ga0268256_10090275 69
903 3300030744 Ga0316181_1012064 Ga0316181_10120644 69
904 3300030760 Ga0265762_1056251 Ga0265762_10562512 69
905 3300030763 Ga0265763_1020674 Ga0265763_10206742 69
906 3300030882 Ga0265764_116286 Ga0265764_1162861 69
907 3300030889 Ga0265761_105536 Ga0265761_1055362 69
908 3300031090 Ga0265760_10035293 Ga0265760_100352934 69
909 3300031090 Ga0265760_10091973 Ga0265760_100919732 69
910 3300031090 Ga0265760_10209769 Ga0265760_102097691 69
911 3300031090 Ga0265760_10355728 Ga0265760_103557281 69
912 3300031235 Ga0265330_10040535 Ga0265330_100405352 69
913 3300031235 Ga0265330_10069394 Ga0265330_100693942 69
914 3300031238 Ga0265332_10219582 Ga0265332_102195821 69
915 3300031239 Ga0265328_10072620 Ga0265328_100726202 69
916 3300031240 Ga0265320_10148836 Ga0265320_101488363 69
917 3300031241 Ga0265325_10476155 Ga0265325_104761551 69
918 3300031242 Ga0265329_10144457 Ga0265329_101444571 69
919 3300031247 Ga0265340_10004702 Ga0265340_100047027 69
920 3300031249 Ga0265339_10002135 Ga0265339_100021353 69
921 3300031344 Ga0265316_10047181 Ga0265316_100471815 69
922 3300031344 Ga0265316_10384691 Ga0265316_103846913 69
923 3300031456 Ga0307513_10953235 Ga0307513_109532352 69
924 3300031548 Ga0307408_100275327 Ga0307408_1002753274 69
925 3300031595 Ga0265313_10005700 Ga0265313_100057003 69
926 3300031595 Ga0265313_10052844 Ga0265313_100528441 69
927 3300031712 Ga0265342_10006876 Ga0265342_100068769 69
928 3300031730 Ga0307516_10140743 Ga0307516_101407432 69
929 3300031730 Ga0307516_10243085 Ga0307516_102430851 69
930 3300031731 Ga0307405_10000482 Ga0307405_100004828 69
931 3300031731 Ga0307405_10072659 Ga0307405_100726595 69
932 3300031731 Ga0307405_10193704 Ga0307405_101937045 69
933 3300031731 Ga0307405_12050864 Ga0307405_120508641 69
934 3300031824 Ga0307413_10644764 Ga0307413_106447642 69
935 3300031901 Ga0307406_10114120 Ga0307406_101141202 69
936 3300031901 Ga0307406_10361519 Ga0307406_103615191 69
937 3300031901 Ga0307406_11194383 Ga0307406_111943831 69
938 3300031901 Ga0307406_11327832 Ga0307406_113278322 69
939 3300031903 Ga0307407_11138994 Ga0307407_111389942 69
940 3300031911 Ga0307412_10165722 Ga0307412_101657222 69
941 3300031911 Ga0307412_10465998 Ga0307412_104659983 69
942 3300031911 Ga0307412_11425315 Ga0307412_114253151 69
943 3300031911 Ga0307412_11928336 Ga0307412_119283362 69
944 3300031967 Ga0315914_1002550 Ga0315914_100255019 69
945 3300031995 Ga0307409_100794824 Ga0307409_1007948241 69
946 3300031995 Ga0307409_101436686 Ga0307409_1014366862 69
947 3300032002 Ga0307416_100247550 Ga0307416_1002475502 69
948 3300032002 Ga0307416_100515546 Ga0307416_1005155461 69
949 3300032002 Ga0307416_102907326 Ga0307416_1029073261 69
950 3300032004 Ga0307414_10588713 Ga0307414_105887133 69
951 3300032004 Ga0307414_12178587 Ga0307414_121785871 69
952 3300032126 Ga0307415_100305987 Ga0307415_1003059873 69
953 3300032126 Ga0307415_100857311 Ga0307415_1008573111 69
954 3300033180 Ga0307510_10000908 Ga0307510_1000090827 69
955 3300033430 Ga0315913_1001274 Ga0315913_100127418 69
956 3300033464 Ga0315915_1000010 Ga0315915_100001085 69
957 3300035083 Ga0373926_0195151 Ga0373926_0195151_302_511 69
958 3300035085 Ga0373929_0268048 Ga0373929_0268048_38_247 69
959 3300035086 Ga0373934_0003991 Ga0373934_0003991_2025_2234 69
960 3300035086 Ga0373934_0195445 Ga0373934_0195445_305_514 69
961 3300035086 Ga0373934_0238184 Ga0373934_0238184_394_603 69
962 3300035089 Ga0373944_0448344 Ga0373944_0448344_257_466 69
963 3300035111 Ga0373923_0032731 Ga0373923_0032731_389_598 69
964 3300035111 Ga0373923_0033929 Ga0373923_0033929_717_926 69
965 3300035113 Ga0373936_0009309 Ga0373936_0009309_2088_2297 69
966 3300035113 Ga0373936_0041934 Ga0373936_0041934_1324_1533 69
967 3300035113 Ga0373936_0324084 Ga0373936_0324084_67_276 69
968 3300035115 Ga0373941_0540805 Ga0373941_0540805_94_306 69
969 3300035116 Ga0373945_0011814 Ga0373945_0011814_1766_1975 69
970 3300035116 Ga0373945_0179700 Ga0373945_0179700_503_712 69
971 3300035116 Ga0373945_0564359 Ga0373945_0564359_114_323 69
972 3300035117 Ga0373953_0000428 Ga0373953_0000428_7483_7692 69
973 3300035117 Ga0373953_0002249 Ga0373953_0002249_1511_1720 69
974 3300035118 Ga0373954_0000096 Ga0373954_0000096_3283_3492 69
975 3300035118 Ga0373954_0001427 Ga0373954_0001427_3314_3523 69
976 3300035118 Ga0373954_0101679 Ga0373954_0101679_159_368 69
977 3300035119 Ga0373956_0000452 Ga0373956_0000452_10860_11069 69
978 3300035119 Ga0373956_0010045 Ga0373956_0010045_997_1206 69
979 3300035120 Ga0373957_0000472 Ga0373957_0000472_5272_5481 69
980 3300035120 Ga0373957_0004660 Ga0373957_0004660_659_868 69
981 3300035120 Ga0373957_0152452 Ga0373957_0152452_586_795 69
982 3300035170 Ga0373943_0000777 Ga0373943_0000777_8905_9114 69
983 3300035170 Ga0373943_0054685 Ga0373943_0054685_344_553 69
984 3300035171 Ga0373946_0189125 Ga0373946_0189125_276_485 69
985 3300035172 Ga0373955_0004288 Ga0373955_0004288_2191_2400 69
986 3300035172 Ga0373955_0020206 Ga0373955_0020206_2827_3036 69
987 3300035172 Ga0373955_0020557 Ga0373955_0020557_392_601 69
988 3300035172 Ga0373955_0048964 Ga0373955_0048964_1814_2023 69
989 3300035410 Ga0373924_0017494 Ga0373924_0017494_391_600 69
990 3300035410 Ga0373924_0027795 Ga0373924_0027795_1038_1247 69
991 3300035410 Ga0373924_0029306 Ga0373924_0029306_1069_1278 69
992 3300035410 Ga0373924_0407551 Ga0373924_0407551_343_552 69
993 3300035692 Ga0373935_0000251 Ga0373935_0000251_17158_17367 69
994 3300035692 Ga0373935_0034983 Ga0373935_0034983_2780_2989 69
995 3300035692 Ga0373935_0124310 Ga0373935_0124310_856_1065 69
996 3300035692 Ga0373935_0195258 Ga0373935_0195258_131_340 69
997 3300035692 Ga0373935_0375420 Ga0373935_0375420_206_442 69
998 3300035695 Ga0373927_0000074 Ga0373927_0000074_8339_8548 69
999 3300035695 Ga0373927_0005560 Ga0373927_0005560_4326_4535 69
1000 3300035695 Ga0373927_0007493 Ga0373927_0007493_3149_3358 69
1001 3300035695 Ga0373927_0015747 Ga0373927_0015747_3413_3622 69
1002 3300035695 Ga0373927_0272776 Ga0373927_0272776_207_416 69
1003 3300035695 Ga0373927_0742355 Ga0373927_0742355_288_497 69
1004 3300035724 Ga0373933_0014530 Ga0373933_0014530_698_907 69
1005 3300035724 Ga0373933_0016964 Ga0373933_0016964_2340_2549 69
1006 3300035724 Ga0373933_0513331 Ga0373933_0513331_265_474 69
1007 3300035725 Ga0373947_0001064 Ga0373947_0001064_8511_8720 69
1008 3300035725 Ga0373947_0016295 Ga0373947_0016295_774_983 69
1009 3300035725 Ga0373947_0083971 Ga0373947_0083971_1244_1453 69
1010 3300035725 Ga0373947_0403375 Ga0373947_0403375_95_304 69
1011 3300036401 Ga0373937_0006552 Ga0373937_0006552_1490_1699 69
1012 3300036401 Ga0373937_0021873 Ga0373937_0021873_2299_2508 69
1013 3300036401 Ga0373937_0083215 Ga0373937_0083215_2394_2603 69
1014 3300036401 Ga0373937_0200728 Ga0373937_0200728_336_548 69
1015 3300036401 Ga0373937_1082155 Ga0373937_1082155_272_481 69
1016 3300037068 Ga0373925_0001364 Ga0373925_0001364_15872_16081 69
1017 3300037068 Ga0373925_0002665 Ga0373925_0002665_4001_4210 69
1018 3300037068 Ga0373925_0112710 Ga0373925_0112710_1066_1275 69
1019 3300037068 Ga0373925_0860384 Ga0373925_0860384_438_647 69
1020 3300037312 Ga0395899_0000217 Ga0395899_0000217_69047_69256 69
1021 3300037418 Ga0395900_0000270 Ga0395900_0000270_69047_69256 69
1022 3300037418 Ga0395900_0245470 Ga0395900_0245470_1202_1414 69
1023 3300037418 Ga0395900_0303078 Ga0395900_0303078_140_352 69
1024 3300037418 Ga0395900_0414198 Ga0395900_0414198_714_926 69
1025 3300037418 Ga0395900_0979486 Ga0395900_0979486_387_599 69
1026 3300037466 Ga0395898_0000470 Ga0395898_0000470_69784_69993 69
1027 3300037466 Ga0395898_0101804 Ga0395898_0101804_2216_2428 69
1028 3300037471 Ga0395905_0000253 Ga0395905_0000253_10791_11000 69
1029 3300037471 Ga0395905_0048715 Ga0395905_0048715_2241_2453 69
1030 3300037471 Ga0395905_0290864 Ga0395905_0290864_693_905 69
1031 3300037471 Ga0395905_0722324 Ga0395905_0722324_183_395 69
1032 3300037471 Ga0395905_1215535 Ga0395905_1215535_137_349 69
1033 3300037853 Ga0436364_0651817 Ga0436364_0651817_475_684 69
1034 3300038443 Ga0395901_0002922 Ga0395901_0002922_6252_6461 69
1035 3300038443 Ga0395901_0023878 Ga0395901_0023878_5890_6102 69
1036 3300038443 Ga0395901_0419545 Ga0395901_0419545_361_573 69
1037 3300038443 Ga0395901_0578115 Ga0395901_0578115_577_789 69
1038 3300039437 Ga0436365_1865485 Ga0436365_1865485_555_764 69
1039 3300039437 Ga0436365_1892130 Ga0436365_1892130_752_961 69
1040 3300039438 Ga0436360_0012434 Ga0436360_0012434_136_345 69
1041 3300039447 Ga0436361_1090572 Ga0436361_1090572_2776_2985 69
1042 3300041413 Ga0439465_0039012 Ga0439465_0039012_598_807 69
1043 3300041413 Ga0439465_0079945 Ga0439465_0079945_272_484 69
1044 3300041413 Ga0439465_0124953 Ga0439465_0124953_188_400 69
1045 3300041413 Ga0439465_0165409 Ga0439465_0165409_424_633 69
1046 3300041441 Ga0451787_496701 Ga0451787_496701_834_1046 69
1047 3300041455 Ga0451801_03670 Ga0451801_03670_85_297 69
1048 3300041459 Ga0451800_0127875 Ga0451800_0127875_43_252 69
1049 3300041459 Ga0451800_0697454 Ga0451800_0697454_26_238 69
1050 3300041460 Ga0451802_1735530 Ga0451802_1735530_32_244 69
1051 3300041491 Ga0451833_0730984 Ga0451833_0730984_226_435 69
1052 3300041492 Ga0451835_0230868 Ga0451835_0230868_13_225 69
1053 3300041505 Ga0451849_1043510 Ga0451849_1043510_386_598 69
1054 3300041511 Ga0451855_0029132 Ga0451855_0029132_265_477 69
1055 3300041512 Ga0451853_1360697 Ga0451853_1360697_198_407 69
1056 3300041512 Ga0451853_2612147 Ga0451853_2612147_348_560 69
1057 3300041907 Ga0452268_09526 Ga0452268_09526_152_364 69
1058 3300041997 Ga0439431_0149061 Ga0439431_0149061_153_365 69
1059 3300042004 Ga0439445_0207797 Ga0439445_0207797_20_229 69
1060 3300042004 Ga0439445_0231528 Ga0439445_0231528_85_297 69
1061 3300042006 Ga0439432_051122 Ga0439432_051122_825_1037 69
1062 3300042015 Ga0439462_0149295 Ga0439462_0149295_315_527 69
1063 3300042125 Ga0450923_088673 Ga0450923_088673_129_341 69
1064 3300042136 Ga0450900_080592 Ga0450900_080592_263_472 69
1065 3300042137 Ga0450902_070321 Ga0450902_070321_319_531 69
1066 3300042435 Ga0439434_0080586 Ga0439434_0080586_313_525 69
1067 3300042435 Ga0439434_0207908 Ga0439434_0207908_118_327 69
1068 3300044658 Ga0466972_0027947 Ga0466972_0027947_692_904 69
1069 3300044683 Ga0466965_0618337 Ga0466965_0618337_333_545 69
1070 3300044735 Ga0466968_0078165 Ga0466968_0078165_224_436 69
1071 3300044735 Ga0466968_0085724 Ga0466968_0085724_856_1080 69
1072 3300044765 Ga0466970_0770781 Ga0466970_0770781_214_426 69
1073 3300044901 Ga0466960_0063323 Ga0466960_0063323_60_272 69
1074 3300046452 Ga0495617_009338 Ga0495617_009338_56_265 69
1075 3300046454 Ga0495592_0012453 Ga0495592_0012453_951_1160 69
1076 3300046454 Ga0495592_0026565 Ga0495592_0026565_392_601 69
1077 3300046454 Ga0495592_0129265 Ga0495592_0129265_874_1083 69
1078 3300046454 Ga0495592_0631062 Ga0495592_0631062_419_628 69
1079 3300046455 Ga0495603_0000208 Ga0495603_0000208_8912_9121 69
1080 3300046455 Ga0495603_0002458 Ga0495603_0002458_1601_1810 69
1081 3300046455 Ga0495603_0030037 Ga0495603_0030037_2258_2467 69
1082 3300046457 Ga0495590_0038159 Ga0495590_0038159_322_531 69
1083 3300046457 Ga0495590_0337127 Ga0495590_0337127_244_453 69
1084 3300046459 Ga0495629_0000216 Ga0495629_0000216_13817_14026 69
1085 3300046459 Ga0495629_0001181 Ga0495629_0001181_4128_4337 69
1086 3300046459 Ga0495629_0017800 Ga0495629_0017800_1947_2156 69
1087 3300046460 Ga0495638_0003832 Ga0495638_0003832_7090_7302 69
1088 3300046460 Ga0495638_0017927 Ga0495638_0017927_179_391 69
1089 3300046460 Ga0495638_0081801 Ga0495638_0081801_1331_1540 69
1090 3300046460 Ga0495638_0584049 Ga0495638_0584049_101_313 69
1091 3300046461 Ga0495641_0001151 Ga0495641_0001151_13376_13585 69
1092 3300046461 Ga0495641_0050675 Ga0495641_0050675_1107_1316 69
1093 3300046462 Ga0495651_0022957 Ga0495651_0022957_264_473 69
1094 3300046462 Ga0495651_0087175 Ga0495651_0087175_970_1179 69
1095 3300046462 Ga0495651_0090122 Ga0495651_0090122_1740_1949 69
1096 3300046463 Ga0495653_0001775 Ga0495653_0001775_15944_16153 69
1097 3300046463 Ga0495653_0052490 Ga0495653_0052490_2522_2731 69
1098 3300046471 Ga0495650_0027634 Ga0495650_0027634_1779_1988 69
1099 3300046471 Ga0495650_0034475 Ga0495650_0034475_992_1201 69
1100 3300046471 Ga0495650_0040206 Ga0495650_0040206_1675_1884 69
1101 3300046472 Ga0495580_0003553 Ga0495580_0003553_7540_7749 69
1102 3300046472 Ga0495580_0419342 Ga0495580_0419342_490_699 69
1103 3300046473 Ga0495582_0000311 Ga0495582_0000311_16211_16420 69
1104 3300046473 Ga0495582_0082986 Ga0495582_0082986_162_371 69
1105 3300046474 Ga0495605_0134183 Ga0495605_0134183_430_639 69
1106 3300046475 Ga0495639_0000395 Ga0495639_0000395_4129_4338 69
1107 3300046475 Ga0495639_0031163 Ga0495639_0031163_1724_1933 69
1108 3300046476 Ga0495662_0000259 Ga0495662_0000259_5339_5548 69
1109 3300046476 Ga0495662_0522403 Ga0495662_0522403_75_284 69
1110 3300046477 Ga0495664_0007806 Ga0495664_0007806_3523_3732 69
1111 3300046477 Ga0495664_0090710 Ga0495664_0090710_488_697 69
1112 3300046477 Ga0495664_0574492 Ga0495664_0574492_422_631 69
1113 3300046477 Ga0495664_0784699 Ga0495664_0784699_115_324 69
1114 3300046491 Ga0495584_0096587 Ga0495584_0096587_905_1114 69
1115 3300046491 Ga0495584_0330744 Ga0495584_0330744_345_554 69
1116 3300046492 Ga0495585_0110883 Ga0495585_0110883_999_1208 69
1117 3300046492 Ga0495585_0155899 Ga0495585_0155899_582_791 69
1118 3300046499 Ga0495594_0000272 Ga0495594_0000272_16256_16465 69
1119 3300046499 Ga0495594_0031294 Ga0495594_0031294_2607_2816 69
1120 3300046499 Ga0495594_0055421 Ga0495594_0055421_1584_1793 69
1121 3300046500 Ga0495596_0070770 Ga0495596_0070770_410_619 69
1122 3300046501 Ga0495607_0101871 Ga0495607_0101871_999_1208 69
1123 3300046507 Ga0495606_0030274 Ga0495606_0030274_394_603 69
1124 3300046507 Ga0495606_0468081 Ga0495606_0468081_109_318 69
1125 3300046507 Ga0495606_0524117 Ga0495606_0524117_51_260 69
1126 3300046511 Ga0495608_0001705 Ga0495608_0001705_13098_13307 69
1127 3300046511 Ga0495608_0143472 Ga0495608_0143472_772_981 69
1128 3300046511 Ga0495608_0200299 Ga0495608_0200299_756_965 69
1129 3300046512 Ga0495610_0002231 Ga0495610_0002231_9470_9679 69
1130 3300046512 Ga0495610_0002393 Ga0495610_0002393_13870_14079 69
1131 3300046513 Ga0495616_0073369 Ga0495616_0073369_1254_1463 69
1132 3300046514 Ga0495618_0002323 Ga0495618_0002323_2277_2486 69
1133 3300046514 Ga0495618_0081179 Ga0495618_0081179_1702_1911 69
1134 3300046515 Ga0495620_0232938 Ga0495620_0232938_408_617 69
1135 3300046516 Ga0495628_0044858 Ga0495628_0044858_2468_2677 69
1136 3300046516 Ga0495628_0068594 Ga0495628_0068594_2370_2579 69
1137 3300046516 Ga0495628_0140726 Ga0495628_0140726_1175_1384 69
1138 3300046516 Ga0495628_0462694 Ga0495628_0462694_241_450 69
1139 3300046517 Ga0495630_0000820 Ga0495630_0000820_5685_5894 69
1140 3300046517 Ga0495630_0052865 Ga0495630_0052865_1836_2045 69
1141 3300046517 Ga0495630_0188804 Ga0495630_0188804_1135_1344 69
1142 3300046517 Ga0495630_1445099 Ga0495630_1445099_126_335 69
1143 3300046518 Ga0495631_0042096 Ga0495631_0042096_1449_1658 69
1144 3300046518 Ga0495631_0098942 Ga0495631_0098942_70_279 69
1145 3300046518 Ga0495631_0384483 Ga0495631_0384483_40_249 69
1146 3300046519 Ga0495632_0002224 Ga0495632_0002224_14745_14954 69
1147 3300046519 Ga0495632_0016291 Ga0495632_0016291_1714_1923 69
1148 3300046519 Ga0495632_0259824 Ga0495632_0259824_551_760 69
1149 3300046520 Ga0495637_0145697 Ga0495637_0145697_109_318 69
1150 3300046522 Ga0495643_0040480 Ga0495643_0040480_1451_1660 69
1151 3300046522 Ga0495643_0156057 Ga0495643_0156057_142_351 69
1152 3300046523 Ga0495644_0080056 Ga0495644_0080056_1010_1219 69
1153 3300046524 Ga0495648_0006515 Ga0495648_0006515_8436_8645 69
1154 3300046524 Ga0495648_0065290 Ga0495648_0065290_615_824 69
1155 3300046524 Ga0495648_0084732 Ga0495648_0084732_342_551 69
1156 3300046525 Ga0495663_0014069 Ga0495663_0014069_1613_1822 69
1157 3300046525 Ga0495663_0019623 Ga0495663_0019623_699_908 69
1158 3300046525 Ga0495663_0057692 Ga0495663_0057692_854_1063 69
1159 3300046526 Ga0495666_0188905 Ga0495666_0188905_111_320 69
1160 3300046528 Ga0495642_0381141 Ga0495642_0381141_66_275 69
1161 3300046529 Ga0495652_0010856 Ga0495652_0010856_2327_2536 69
1162 3300046529 Ga0495652_0038453 Ga0495652_0038453_2122_2331 69
1163 3300046529 Ga0495652_0627066 Ga0495652_0627066_338_547 69
1164 3300046530 Ga0495654_0001294 Ga0495654_0001294_16348_16557 69
1165 3300046530 Ga0495654_0074371 Ga0495654_0074371_112_321 69
1166 3300046530 Ga0495654_0357306 Ga0495654_0357306_77_286 69
1167 3300046531 Ga0495665_0006722 Ga0495665_0006722_1865_2074 69
1168 3300046531 Ga0495665_0393296 Ga0495665_0393296_30_239 69
1169 3300046533 Ga0495640_0012590 Ga0495640_0012590_589_798 69
1170 3300046533 Ga0495640_0022779 Ga0495640_0022779_1487_1696 69
1171 3300046533 Ga0495640_0028987 Ga0495640_0028987_2780_2989 69
1172 3300046535 Ga0495586_0066223 Ga0495586_0066223_266_475 69
1173 3300046535 Ga0495586_0436771 Ga0495586_0436771_458_667 69
1174 3300046536 Ga0495587_0001236 Ga0495587_0001236_16345_16554 69
1175 3300046536 Ga0495587_0016699 Ga0495587_0016699_1203_1412 69
1176 3300046537 Ga0495598_0015362 Ga0495598_0015362_998_1207 69
1177 3300046537 Ga0495598_0019716 Ga0495598_0019716_151_360 69
1178 3300046538 Ga0495609_0055515 Ga0495609_0055515_904_1113 69
1179 3300046538 Ga0495609_0239193 Ga0495609_0239193_483_692 69
1180 3300046539 Ga0495621_0008718 Ga0495621_0008718_1987_2196 69
1181 3300046542 Ga0495597_0014017 Ga0495597_0014017_1304_1513 69
1182 3300046542 Ga0495597_0159731 Ga0495597_0159731_238_447 69
1183 3300046543 Ga0495645_0028470 Ga0495645_0028470_3559_3768 69
1184 3300046543 Ga0495645_0051544 Ga0495645_0051544_639_848 69
1185 3300046557 Ga0495622_0003774 Ga0495622_0003774_5378_5587 69
1186 3300046557 Ga0495622_0022348 Ga0495622_0022348_1036_1245 69
1187 3300046558 Ga0495633_0058244 Ga0495633_0058244_1491_1700 69
1188 3300046558 Ga0495633_0192950 Ga0495633_0192950_615_824 69
1189 3300046559 Ga0495667_0021654 Ga0495667_0021654_1526_1735 69
1190 3300046559 Ga0495667_0057976 Ga0495667_0057976_1957_2166 69
1191 3300046559 Ga0495667_0205769 Ga0495667_0205769_390_599 69
1192 3300046615 Ga0495656_0002847 Ga0495656_0002847_2143_2352 69
1193 3300046615 Ga0495656_0012766 Ga0495656_0012766_197_406 69
1194 3300046615 Ga0495656_0099730 Ga0495656_0099730_580_789 69
1195 3300046616 Ga0495668_0013820 Ga0495668_0013820_3779_3988 69
1196 3300046616 Ga0495668_0075775 Ga0495668_0075775_150_359 69
1197 3300046616 Ga0495668_0212800 Ga0495668_0212800_175_384 69
1198 3300046642 Ga0495634_0001816 Ga0495634_0001816_8947_9156 69
1199 3300046642 Ga0495634_0022564 Ga0495634_0022564_2008_2217 69
1200 3300046642 Ga0495634_0046348 Ga0495634_0046348_2274_2483 69
1201 3300046648 Ga0495611_0393796 Ga0495611_0393796_14_223 69
1202 3300046660 Ga0495625_0061712 Ga0495625_0061712_2053_2262 69
1203 3300046660 Ga0495625_0148119 Ga0495625_0148119_983_1192 69
1204 3300046660 Ga0495625_0189866 Ga0495625_0189866_291_500 69
1205 3300046660 Ga0495625_0335331 Ga0495625_0335331_438_647 69
1206 3300046660 Ga0495625_0655067 Ga0495625_0655067_173_382 69
1207 3300046660 Ga0495625_0885160 Ga0495625_0885160_275_484 69
1208 3300046663 Ga0495635_0000392 Ga0495635_0000392_8649_8858 69
1209 3300046663 Ga0495635_0000913 Ga0495635_0000913_1516_1725 69
1210 3300046663 Ga0495635_0013724 Ga0495635_0013724_5222_5431 69
1211 3300046663 Ga0495635_0890859 Ga0495635_0890859_323_532 69
1212 3300046664 Ga0495659_0010639 Ga0495659_0010639_2532_2741 69
1213 3300046665 Ga0495661_0191126 Ga0495661_0191126_98_307 69
1214 3300046674 Ga0495588_0012713 Ga0495588_0012713_820_1029 69
1215 3300046674 Ga0495588_0025063 Ga0495588_0025063_2473_2682 69
1216 3300046674 Ga0495588_0131282 Ga0495588_0131282_1095_1304 69
1217 3300046674 Ga0495588_0145658 Ga0495588_0145658_451_660 69
1218 3300046674 Ga0495588_0672244 Ga0495588_0672244_34_243 69
1219 3300046675 Ga0495657_0017255 Ga0495657_0017255_2210_2419 69
1220 3300046675 Ga0495657_0057220 Ga0495657_0057220_518_727 69
1221 3300046675 Ga0495657_0264147 Ga0495657_0264147_46_255 69
1222 3300046678 Ga0495599_0022199 Ga0495599_0022199_2472_2681 69
1223 3300046678 Ga0495599_0039450 Ga0495599_0039450_2194_2403 69
1224 3300046678 Ga0495599_0687111 Ga0495599_0687111_235_447 69
1225 3300046679 Ga0495623_0005202 Ga0495623_0005202_392_601 69
1226 3300046679 Ga0495623_0143454 Ga0495623_0143454_991_1200 69
1227 3300046680 Ga0495646_0011455 Ga0495646_0011455_719_928 69
1228 3300046680 Ga0495646_0011689 Ga0495646_0011689_1838_2047 69
1229 3300046681 Ga0495647_0000430 Ga0495647_0000430_7702_7911 69
1230 3300046683 Ga0495658_0001021 Ga0495658_0001021_7302_7511 69
1231 3300046689 Ga0495613_0021060 Ga0495613_0021060_1263_1472 69
1232 3300046689 Ga0495613_0046810 Ga0495613_0046810_930_1139 69
1233 3300046689 Ga0495613_0595391 Ga0495613_0595391_406_615 69
1234 3300046690 Ga0495624_0001716 Ga0495624_0001716_75_284 69
1235 3300046690 Ga0495624_0246670 Ga0495624_0246670_763_972 69
1236 3300046690 Ga0495624_0625971 Ga0495624_0625971_263_472 69
1237 3300046690 Ga0495624_0704503 Ga0495624_0704503_185_394 69
1238 3300046691 Ga0495670_0046299 Ga0495670_0046299_1932_2141 69
1239 3300046691 Ga0495670_0101183 Ga0495670_0101183_890_1099 69
1240 3300046692 Ga0495671_0135119 Ga0495671_0135119_50_259 69
1241 3300046692 Ga0495671_0212299 Ga0495671_0212299_527_736 69
1242 3300046694 Ga0495649_0161965 Ga0495649_0161965_610_819 69
1243 3300046794 Ga0495589_0090919 Ga0495589_0090919_1118_1327 69
1244 3300046809 Ga0495600_0013868 Ga0495600_0013868_2681_2890 69
1245 3300046809 Ga0495600_0054637 Ga0495600_0054637_1325_1534 69
1246 3300046809 Ga0495600_0064160 Ga0495600_0064160_1890_2099 69
1247 3300046810 Ga0495660_0178542 Ga0495660_0178542_395_604 69
1248 3300047315 Ga0495581_0000559 Ga0495581_0000559_18464_18673 69
1249 3300047315 Ga0495581_0297773 Ga0495581_0297773_124_333 69
1250 3300047317 Ga0495604_0010363 Ga0495604_0010363_4312_4521 69
1251 3300047317 Ga0495604_0011190 Ga0495604_0011190_1075_1284 69
1252 3300047318 Ga0495636_0124834 Ga0495636_0124834_43_252 69
1253 3300047319 Ga0495674_0001216 Ga0495674_0001216_9328_9537 69
1254 3300047319 Ga0495674_0012665 Ga0495674_0012665_5413_5622 69
1255 3300047319 Ga0495674_0070782 Ga0495674_0070782_2540_2749 69
1256 3300047319 Ga0495674_0476187 Ga0495674_0476187_347_556 69
1257 3300047319 Ga0495674_1054639 Ga0495674_1054639_140_349 69
1258 3300047319 Ga0495674_1485784 Ga0495674_1485784_269_478 69
1259 3300047320 Ga0495672_0256285 Ga0495672_0256285_112_321 69
1260 3300047320 Ga0495672_0527303 Ga0495672_0527303_242_451 69
1261 3300047321 Ga0495676_0013658 Ga0495676_0013658_6754_6963 69
1262 3300047321 Ga0495676_0056178 Ga0495676_0056178_1710_1919 69
1263 3300047322 Ga0495680_0041225 Ga0495680_0041225_1725_1934 69
1264 3300047322 Ga0495680_0252145 Ga0495680_0252145_178_387 69
1265 3300047444 Ga0495675_0005490 Ga0495675_0005490_5056_5265 69
1266 3300047444 Ga0495675_0544420 Ga0495675_0544420_302_511 69
1267 3300047445 Ga0495677_0085011 Ga0495677_0085011_137_346 69
1268 3300047445 Ga0495677_0169532 Ga0495677_0169532_86_295 69
1269 3300047447 Ga0495685_040561 Ga0495685_040561_207_416 69
1270 3300047469 Ga0495673_0048086 Ga0495673_0048086_608_817 69
1271 3300047469 Ga0495673_0055147 Ga0495673_0055147_949_1158 69
1272 3300047469 Ga0495673_0152210 Ga0495673_0152210_536_745 69
1273 3300047469 Ga0495673_0202116 Ga0495673_0202116_511_720 69
1274 3300047469 Ga0495673_0209976 Ga0495673_0209976_64_273 69
1275 3300047470 Ga0495681_0244518 Ga0495681_0244518_31_240 69
1276 3300047470 Ga0495681_0247833 Ga0495681_0247833_408_617 69
1277 3300047471 Ga0495684_0002174 Ga0495684_0002174_13761_13970 69
1278 3300047471 Ga0495684_0012372 Ga0495684_0012372_1891_2100 69
1279 3300047471 Ga0495684_0070557 Ga0495684_0070557_177_386 69
1280 3300047472 Ga0495686_0003677 Ga0495686_0003677_6716_6925 69
1281 3300047472 Ga0495686_0025883 Ga0495686_0025883_1140_1352 69
1282 3300047472 Ga0495686_0026151 Ga0495686_0026151_1777_1986 69
1283 3300047472 Ga0495686_0328385 Ga0495686_0328385_429_638 69
1284 3300047673 Ga0495593_0000100 Ga0495593_0000100_36999_37208 69
1285 3300047673 Ga0495593_0000132 Ga0495593_0000132_15662_15871 69
1286 3300048088 Ga0495602_0013942 Ga0495602_0013942_6576_6785 69
1287 3300048088 Ga0495602_0027269 Ga0495602_0027269_3838_4047 69
1288 3300048088 Ga0495602_0175408 Ga0495602_0175408_567_776 69
1289 3300048089 Ga0495614_0022088 Ga0495614_0022088_2295_2504 69
1290 3300048090 Ga0495615_0114452 Ga0495615_0114452_459_668 69
1291 3300048090 Ga0495615_0313995 Ga0495615_0313995_256_465 69
1292 3300048091 Ga0495626_0132922 Ga0495626_0132922_121_330 69
1293 3300048903 Ga0496100_0228189 Ga0496100_0228189_563_772 69
1294 3300048903 Ga0496100_0298806 Ga0496100_0298806_486_695 69
1295 3300048903 Ga0496100_0992456 Ga0496100_0992456_245_457 69
1296 3300048904 Ga0496101_0587486 Ga0496101_0587486_121_330 69
1297 3300048905 Ga0496102_0561544 Ga0496102_0561544_399_611 69
1298 3300048905 Ga0496102_0709223 Ga0496102_0709223_102_311 69
1299 3300048905 Ga0496102_1202640 Ga0496102_1202640_223_435 69
1300 3300048906 Ga0496103_0118156 Ga0496103_0118156_597_809 69
1301 3300048906 Ga0496103_1057417 Ga0496103_1057417_271_483 69
1302 3300048907 Ga0496104_0650771 Ga0496104_0650771_269_478 69
1303 3300048909 Ga0496106_0113204 Ga0496106_0113204_902_1111 69
1304 3300048910 Ga0496107_0761783 Ga0496107_0761783_412_621 69
1305 3300048911 Ga0496108_0327470 Ga0496108_0327470_826_1035 69
1306 3300048911 Ga0496108_1410217 Ga0496108_1410217_19_228 69
1307 3300048912 Ga0496109_0599125 Ga0496109_0599125_272_481 69
1308 3300048913 Ga0496110_0380724 Ga0496110_0380724_877_1086 69
1309 3300048913 Ga0496110_0438288 Ga0496110_0438288_709_918 69
1310 3300048913 Ga0496110_1024342 Ga0496110_1024342_126_335 69
1311 3300048915 Ga0496112_0537352 Ga0496112_0537352_415_627 69
1312 3300048916 Ga0496113_0079189 Ga0496113_0079189_1235_1444 69
1313 3300048917 Ga0496114_1052057 Ga0496114_1052057_227_439 69
1314 3300048917 Ga0496114_1070575 Ga0496114_1070575_225_434 69
1315 3300048918 Ga0496115_0088436 Ga0496115_0088436_2045_2254 69
1316 3300048918 Ga0496115_0153163 Ga0496115_0153163_1122_1331 69
1317 3300048918 Ga0496115_0504776 Ga0496115_0504776_610_822 69
1318 3300048918 Ga0496115_0640362 Ga0496115_0640362_331_540 69
1319 3300048918 Ga0496115_1110982 Ga0496115_1110982_277_486 69
1320 3300048919 Ga0496116_0000036 Ga0496116_0000036_191289_191498 69
1321 3300048919 Ga0496116_0002794 Ga0496116_0002794_4024_4233 69
1322 3300048919 Ga0496116_0007250 Ga0496116_0007250_9435_9644 69
1323 3300048919 Ga0496116_0021310 Ga0496116_0021310_13_222 69
1324 3300048919 Ga0496116_0174178 Ga0496116_0174178_779_988 69
1325 3300048919 Ga0496116_0321765 Ga0496116_0321765_48_257 69
1326 3300048920 Ga0496117_0010131 Ga0496117_0010131_7085_7294 69
1327 3300048920 Ga0496117_0013726 Ga0496117_0013726_59_268 69
1328 3300048920 Ga0496117_0054538 Ga0496117_0054538_1350_1559 69
1329 3300048920 Ga0496117_0104782 Ga0496117_0104782_1107_1316 69
1330 3300048920 Ga0496117_0123294 Ga0496117_0123294_348_557 69
1331 3300048920 Ga0496117_0149818 Ga0496117_0149818_219_431 69
1332 3300048920 Ga0496117_0170664 Ga0496117_0170664_76_285 69
1333 3300048920 Ga0496117_0376488 Ga0496117_0376488_323_532 69
1334 3300048921 Ga0496118_0007062 Ga0496118_0007062_6341_6550 69
1335 3300048921 Ga0496118_0023486 Ga0496118_0023486_1773_1982 69
1336 3300048921 Ga0496118_0038896 Ga0496118_0038896_3455_3664 69
1337 3300048921 Ga0496118_0113625 Ga0496118_0113625_446_655 69
1338 3300048921 Ga0496118_0226790 Ga0496118_0226790_81_290 69
1339 3300048921 Ga0496118_0465007 Ga0496118_0465007_238_447 69
1340 3300048921 Ga0496118_0571167 Ga0496118_0571167_63_272 69
1341 3300048922 Ga0496119_0005479 Ga0496119_0005479_752_961 69
1342 3300048922 Ga0496119_0021490 Ga0496119_0021490_2534_2743 69
1343 3300048922 Ga0496119_0027654 Ga0496119_0027654_2292_2501 69
1344 3300048922 Ga0496119_0034617 Ga0496119_0034617_741_953 69
1345 3300048922 Ga0496119_0043581 Ga0496119_0043581_2461_2670 69
1346 3300048922 Ga0496119_0051300 Ga0496119_0051300_2180_2389 69
1347 3300048922 Ga0496119_0072593 Ga0496119_0072593_890_1102 69
1348 3300048922 Ga0496119_0078576 Ga0496119_0078576_1342_1551 69
1349 3300048922 Ga0496119_0217818 Ga0496119_0217818_353_562 69
1350 3300048922 Ga0496119_0328292 Ga0496119_0328292_19_228 69
1351 3300048922 Ga0496119_0400113 Ga0496119_0400113_17_226 69
1352 3300048922 Ga0496119_0408209 Ga0496119_0408209_85_294 69
1353 3300048923 Ga0496120_0025241 Ga0496120_0025241_3175_3387 69
1354 3300048923 Ga0496120_0097482 Ga0496120_0097482_618_827 69
1355 3300048923 Ga0496120_0133494 Ga0496120_0133494_406_615 69
1356 3300048923 Ga0496120_0321289 Ga0496120_0321289_273_482 69
1357 3300048924 Ga0496121_0000001 Ga0496121_0000001_1364332_1364541 69
1358 3300048924 Ga0496121_0010678 Ga0496121_0010678_4303_4512 69
1359 3300048924 Ga0496121_0015359 Ga0496121_0015359_4330_4539 69
1360 3300048924 Ga0496121_0071104 Ga0496121_0071104_270_479 69
1361 3300048924 Ga0496121_0196002 Ga0496121_0196002_918_1127 69
1362 3300048924 Ga0496121_0246527 Ga0496121_0246527_367_576 69
1363 3300048924 Ga0496121_0383911 Ga0496121_0383911_668_877 69
1364 3300048924 Ga0496121_0399908 Ga0496121_0399908_241_453 69
1365 3300048924 Ga0496121_0418989 Ga0496121_0418989_451_660 69
1366 3300048924 Ga0496121_0784536 Ga0496121_0784536_245_454 69
1367 3300048925 Ga0496122_0000172 Ga0496122_0000172_119252_119461 69
1368 3300048925 Ga0496122_0001281 Ga0496122_0001281_3779_3988 69
1369 3300048925 Ga0496122_0004854 Ga0496122_0004854_14579_14788 69
1370 3300048925 Ga0496122_0010659 Ga0496122_0010659_7001_7210 69
1371 3300048925 Ga0496122_0043395 Ga0496122_0043395_1703_1912 69
1372 3300048925 Ga0496122_0083059 Ga0496122_0083059_2001_2210 69
1373 3300048925 Ga0496122_0115276 Ga0496122_0115276_516_725 69
1374 3300048925 Ga0496122_0115381 Ga0496122_0115381_535_744 69
1375 3300048925 Ga0496122_0171571 Ga0496122_0171571_924_1133 69
1376 3300048925 Ga0496122_0195488 Ga0496122_0195488_942_1151 69
1377 3300048925 Ga0496122_0226094 Ga0496122_0226094_816_1025 69
1378 3300048925 Ga0496122_0395121 Ga0496122_0395121_20_229 69
1379 3300048925 Ga0496122_0527716 Ga0496122_0527716_34_243 69
1380 3300048926 Ga0496123_0000132 Ga0496123_0000132_119300_119509 69
1381 3300048926 Ga0496123_0001497 Ga0496123_0001497_4499_4708 69
1382 3300048926 Ga0496123_0006065 Ga0496123_0006065_7610_7819 69
1383 3300048926 Ga0496123_0009982 Ga0496123_0009982_3733_3942 69
1384 3300048926 Ga0496123_0016524 Ga0496123_0016524_2004_2213 69
1385 3300048926 Ga0496123_0044522 Ga0496123_0044522_706_915 69
1386 3300048926 Ga0496123_0065064 Ga0496123_0065064_988_1197 69
1387 3300048926 Ga0496123_0103894 Ga0496123_0103894_134_343 69
1388 3300048926 Ga0496123_0225584 Ga0496123_0225584_720_929 69
1389 3300048926 Ga0496123_0357678 Ga0496123_0357678_218_427 69
1390 3300048926 Ga0496123_0370822 Ga0496123_0370822_432_641 69
1391 3300048926 Ga0496123_0378917 Ga0496123_0378917_267_476 69
1392 3300048927 Ga0496124_0006047 Ga0496124_0006047_5796_6005 69
1393 3300048927 Ga0496124_0011220 Ga0496124_0011220_7124_7333 69
1394 3300048927 Ga0496124_0024032 Ga0496124_0024032_4326_4535 69
1395 3300048927 Ga0496124_0048640 Ga0496124_0048640_2911_3120 69
1396 3300048927 Ga0496124_0060917 Ga0496124_0060917_963_1172 69
1397 3300048927 Ga0496124_0066786 Ga0496124_0066786_2470_2679 69
1398 3300048927 Ga0496124_0085685 Ga0496124_0085685_1877_2086 69
1399 3300048927 Ga0496124_0087923 Ga0496124_0087923_39_248 69
1400 3300048927 Ga0496124_0127317 Ga0496124_0127317_1774_1983 69
1401 3300048927 Ga0496124_0207469 Ga0496124_0207469_324_533 69
1402 3300048927 Ga0496124_0277966 Ga0496124_0277966_754_963 69
1403 3300048927 Ga0496124_0678953 Ga0496124_0678953_306_515 69
1404 3300048927 Ga0496124_0715194 Ga0496124_0715194_67_276 69
1405 3300048928 Ga0496125_0000001 Ga0496125_0000001_1524038_1524247 69
1406 3300048928 Ga0496125_0060025 Ga0496125_0060025_1998_2207 69
1407 3300048928 Ga0496125_0061181 Ga0496125_0061181_320_529 69
1408 3300048928 Ga0496125_0068188 Ga0496125_0068188_2321_2530 69
1409 3300048928 Ga0496125_0095573 Ga0496125_0095573_1391_1600 69
1410 3300048928 Ga0496125_0124377 Ga0496125_0124377_949_1158 69
1411 3300048928 Ga0496125_0142145 Ga0496125_0142145_1362_1571 69
1412 3300048928 Ga0496125_0147367 Ga0496125_0147367_1276_1488 69
1413 3300048929 Ga0496126_0000597 Ga0496126_0000597_25602_25811 69
1414 3300048929 Ga0496126_0005070 Ga0496126_0005070_2918_3127 69
1415 3300048929 Ga0496126_0008753 Ga0496126_0008753_5696_5905 69
1416 3300048929 Ga0496126_0018683 Ga0496126_0018683_6258_6467 69
1417 3300048929 Ga0496126_0049320 Ga0496126_0049320_1553_1762 69
1418 3300048929 Ga0496126_0052371 Ga0496126_0052371_1755_1967 69
1419 3300048929 Ga0496126_0052478 Ga0496126_0052478_635_844 69
1420 3300048929 Ga0496126_0064532 Ga0496126_0064532_1676_1885 69
1421 3300048929 Ga0496126_0334951 Ga0496126_0334951_552_761 69
1422 3300048929 Ga0496126_0589479 Ga0496126_0589479_238_447 69
1423 3300048929 Ga0496126_0765118 Ga0496126_0765118_205_414 69
1424 3300048929 Ga0496126_1030425 Ga0496126_1030425_391_600 69
1425 3300048929 Ga0496126_1130527 Ga0496126_1130527_318_533 69
1426 3300049161 Ga0501305_121133 Ga0501305_121133_120_332 69
1427 3300049459 Ga0495678_005943 Ga0495678_005943_5422_5631 69
1428 3300049459 Ga0495678_048764 Ga0495678_048764_1045_1254 69
1429 3300049459 Ga0495678_120106 Ga0495678_120106_158_367 69
1430 3300049533 Ga0501317_023130 Ga0501317_023130_109_318 69
1431 3300049568 Ga0501031_0779037 Ga0501031_0779037_185_394 69
1432 3300049569 Ga0501032_0415889 Ga0501032_0415889_449_664 69
1433 3300049569 Ga0501032_0645451 Ga0501032_0645451_214_423 69
1434 3300049569 Ga0501032_0680297 Ga0501032_0680297_46_255 69
1435 3300049570 Ga0501033_0000050 Ga0501033_0000050_5222_5431 69
1436 3300049570 Ga0501033_0052194 Ga0501033_0052194_1167_1376 69
1437 3300049570 Ga0501033_0385568 Ga0501033_0385568_558_770 69
1438 3300049571 Ga0501034_0005317 Ga0501034_0005317_4117_4326 69
1439 3300049571 Ga0501034_0021763 Ga0501034_0021763_6262_6474 69
1440 3300049571 Ga0501034_0074864 Ga0501034_0074864_552_767 69
1441 3300049571 Ga0501034_1424141 Ga0501034_1424141_102_311 69
1442 3300049572 Ga0501036_0103938 Ga0501036_0103938_400_615 69
1443 3300049572 Ga0501036_0180955 Ga0501036_0180955_693_902 69
1444 3300049573 Ga0501037_0087849 Ga0501037_0087849_551_760 69
1445 3300049574 Ga0501038_0722907 Ga0501038_0722907_383_598 69
1446 3300049577 Ga0501041_0200954 Ga0501041_0200954_876_1085 69
1447 3300049577 Ga0501041_0911947 Ga0501041_0911947_36_248 69
1448 3300049579 Ga0501043_0809665 Ga0501043_0809665_325_540 69
1449 3300049579 Ga0501043_0810294 Ga0501043_0810294_371_580 69
1450 3300049579 Ga0501043_1194948 Ga0501043_1194948_60_272 69
1451 3300049580 Ga0501046_0970742 Ga0501046_0970742_222_431 69
1452 3300049581 Ga0501047_0094313 Ga0501047_0094313_472_687 69
1453 3300049581 Ga0501047_0314097 Ga0501047_0314097_226_435 69
1454 3300049581 Ga0501047_0548393 Ga0501047_0548393_173_385 69
1455 3300049583 Ga0501067_0061270 Ga0501067_0061270_1755_1967 69
1456 3300049583 Ga0501067_0520388 Ga0501067_0520388_221_430 69
1457 3300049584 Ga0501068_0319965 Ga0501068_0319965_265_474 69
1458 3300049586 Ga0501070_0913173 Ga0501070_0913173_261_476 69
1459 3300049589 Ga0501073_1134278 Ga0501073_1134278_161_373 69
1460 3300049590 Ga0501074_0179781 Ga0501074_0179781_1262_1477 69
1461 3300049590 Ga0501074_1153973 Ga0501074_1153973_187_399 69
1462 3300049671 Ga0501238_007369 Ga0501238_007369_836_1045 69
1463 3300049683 Ga0501253_134140 Ga0501253_134140_192_401 69
1464 3300049742 Ga0501080_0597821 Ga0501080_0597821_398_607 69
1465 3300049742 Ga0501080_1400354 Ga0501080_1400354_167_382 69
1466 3300049744 Ga0501083_0092804 Ga0501083_0092804_21_230 69
1467 3300049744 Ga0501083_0092920 Ga0501083_0092920_1647_1856 69
1468 3300049758 Ga0501241_011950 Ga0501241_011950_474_683 69
1469 3300049758 Ga0501241_135822 Ga0501241_135822_127_336 69
1470 3300049822 Ga0501035_0001982 Ga0501035_0001982_9845_10054 69
1471 3300049822 Ga0501035_0003519 Ga0501035_0003519_7626_7835 69
1472 3300049822 Ga0501035_0569761 Ga0501035_0569761_167_376 69
1473 3300049822 Ga0501035_1553312 Ga0501035_1553312_77_292 69
1474 3300049823 Ga0501044_0508275 Ga0501044_0508275_707_922 69
1475 3300049823 Ga0501044_1263587 Ga0501044_1263587_176_385 69
1476 3300049823 Ga0501044_1331652 Ga0501044_1331652_167_376 69
1477 3300050489 nmdc:mga03683_16528_c1 nmdc:mga03683_16528_c1_1851_2063 69
1478 3300050489 nmdc:mga03683_169159_c1 nmdc:mga03683_169159_c1_432_641 69
1479 3300050490 nmdc:mga03n38_48732_c1 nmdc:mga03n38_48732_c1_374_586 69
1480 3300050490 nmdc:mga03n38_905166_c1 nmdc:mga03n38_905166_c1_99_308 69
1481 3300050491 nmdc:mga00v17_1052520_c1 nmdc:mga00v17_1052520_c1_39_248 69
1482 3300050491 nmdc:mga00v17_119083_c1 nmdc:mga00v17_119083_c1_345_554 69
1483 3300050491 nmdc:mga00v17_63187_c1 nmdc:mga00v17_63187_c1_660_869 69
1484 3300050491 nmdc:mga00v17_725596_c1 nmdc:mga00v17_725596_c1_309_518 69
1485 3300050491 nmdc:mga00v17_728_c1 nmdc:mga00v17_728_c1_2172_2381 69
1486 3300050491 nmdc:mga00v17_84260_c1 nmdc:mga00v17_84260_c1_1251_1463 69
1487 3300050491 nmdc:mga00v17_886430_c1 nmdc:mga00v17_886430_c1_194_403 69
1488 3300050492 nmdc:mga0yw44_1143200_c1 nmdc:mga0yw44_1143200_c1_144_353 69
1489 3300050492 nmdc:mga0yw44_1180437_c1 nmdc:mga0yw44_1180437_c1_236_445 69
1490 3300050492 nmdc:mga0yw44_231721_c1 nmdc:mga0yw44_231721_c1_995_1204 69
1491 3300050492 nmdc:mga0yw44_5416_c1 nmdc:mga0yw44_5416_c1_4327_4536 69
1492 3300050492 nmdc:mga0yw44_546422_c1 nmdc:mga0yw44_546422_c1_483_692 69
1493 3300050492 nmdc:mga0yw44_79540_c1 nmdc:mga0yw44_79540_c1_1156_1365 69
1494 3300050492 nmdc:mga0yw44_985723_c1 nmdc:mga0yw44_985723_c1_127_339 69
1495 3300050493 nmdc:mga0k408_151925_c1 nmdc:mga0k408_151925_c1_800_1009 69
1496 3300050493 nmdc:mga0k408_558834_c1 nmdc:mga0k408_558834_c1_95_304 69
1497 3300050493 nmdc:mga0k408_789108_c1 nmdc:mga0k408_789108_c1_276_485 69
1498 3300050494 nmdc:mga06z11_309373_c1 nmdc:mga06z11_309373_c1_636_848 69
1499 3300050494 nmdc:mga06z11_345327_c1 nmdc:mga06z11_345327_c1_350_559 69
1500 3300050494 nmdc:mga06z11_59652_c1 nmdc:mga06z11_59652_c1_703_915 69
1501 3300050494 nmdc:mga06z11_713135_c1 nmdc:mga06z11_713135_c1_135_344 69
1502 3300050495 nmdc:mga04h51_48624_c1 nmdc:mga04h51_48624_c1_788_1000 69
1503 3300050496 nmdc:mga07m45_167727_c1 nmdc:mga07m45_167727_c1_1038_1247 69
1504 3300050496 nmdc:mga07m45_24802_c1 nmdc:mga07m45_24802_c1_754_963 69
1505 3300050496 nmdc:mga07m45_443576_c1 nmdc:mga07m45_443576_c1_512_721 69
1506 3300050496 nmdc:mga07m45_544878_c1 nmdc:mga07m45_544878_c1_240_449 69
1507 3300050496 nmdc:mga07m45_71443_c1 nmdc:mga07m45_71443_c1_831_1043 69
1508 3300050507 nmdc:mga05p37_833956_c1 nmdc:mga05p37_833956_c1_662_871 69
1509 3300050510 nmdc:mga06r32_1862570_c1 nmdc:mga06r32_1862570_c1_33_242 69
1510 3300050511 nmdc:mga08y16_695244_c1 nmdc:mga08y16_695244_c1_421_630 69
1511 3300050511 nmdc:mga08y16_701951_c1 nmdc:mga08y16_701951_c1_140_352 69
1512 3300050516 nmdc:mga0sz30_170331_c1 nmdc:mga0sz30_170331_c1_600_812 69
1513 3300050516 nmdc:mga0sz30_20504_c1 nmdc:mga0sz30_20504_c1_42_251 69
1514 3300050516 nmdc:mga0sz30_216534_c1 nmdc:mga0sz30_216534_c1_574_783 69
1515 3300050516 nmdc:mga0sz30_443335_c1 nmdc:mga0sz30_443335_c1_74_283 69
1516 3300050516 nmdc:mga0sz30_541268_c1 nmdc:mga0sz30_541268_c1_92_301 69
1517 3300050516 nmdc:mga0sz30_568279_c1 nmdc:mga0sz30_568279_c1_196_405 69
1518 3300050516 nmdc:mga0sz30_99662_c1 nmdc:mga0sz30_99662_c1_284_493 69
1519 3300053077 Ga0495601_0044623 Ga0495601_0044623_998_1207 69
1520 3300053077 Ga0495601_0140646 Ga0495601_0140646_1133_1342 69
1521 3300053077 Ga0495601_0294647 Ga0495601_0294647_531_740 69
1522 3300053078 Ga0495612_0030474 Ga0495612_0030474_1654_1863 69
1523 3300053078 Ga0495612_0344559 Ga0495612_0344559_13_222 69
1524 3300053083 Ga0495655_0051043 Ga0495655_0051043_648_857 69
1525 3300053084 Ga0495595_0000874 Ga0495595_0000874_2260_2469 69
1526 3300053084 Ga0495595_0086754 Ga0495595_0086754_991_1200 69
1527 3300053085 Ga0495619_0040923 Ga0495619_0040923_2545_2754 69
1528 3300053085 Ga0495619_0086850 Ga0495619_0086850_390_599 69
1529 3300053085 Ga0495619_0240304 Ga0495619_0240304_205_414 69
1530 3300053085 Ga0495619_0705386 Ga0495619_0705386_182_391 69
1531 3300053086 Ga0500578_0206785 Ga0500578_0206785_878_1087 69
1532 3300053087 Ga0500643_059261 Ga0500643_059261_822_1031 69
1533 3300053088 Ga0500644_0069871 Ga0500644_0069871_689_898 69
1534 3300053089 Ga0500581_234965 Ga0500581_234965_262_471 69
1535 3300053090 Ga0500646_0389680 Ga0500646_0389680_128_337 69
1536 3300053091 Ga0500647_0389411 Ga0500647_0389411_320_529 69
1537 3300053100 Ga0500660_238462 Ga0500660_238462_147_356 69
1538 3300053103 Ga0500555_079236 Ga0500555_079236_27_236 69
1539 3300053104 Ga0500556_0151922 Ga0500556_0151922_202_411 69
1540 3300053111 Ga0500572_221805 Ga0500572_221805_101_310 69
1541 3300053111 Ga0500572_234648 Ga0500572_234648_271_480 69
1542 3300053116 Ga0500592_081115 Ga0500592_081115_152_364 69
1543 3300053121 Ga0500607_275720 Ga0500607_275720_30_239 69
1544 3300053125 Ga0500618_000560 Ga0500618_000560_1261_1470 69
1545 3300053125 Ga0500618_010534 Ga0500618_010534_703_912 69
1546 3300053129 Ga0500628_164554 Ga0500628_164554_151_363 69
1547 3300053130 Ga0500642_0205541 Ga0500642_0205541_592_801 69
1548 3300053136 Ga0500559_0075911 Ga0500559_0075911_645_854 69
1549 3300053142 Ga0500577_0280266 Ga0500577_0280266_36_245 69
1550 3300053145 Ga0500586_163893 Ga0500586_163893_325_534 69
1551 3300053146 Ga0500588_0142048 Ga0500588_0142048_446_658 69
1552 3300053151 Ga0500604_0113727 Ga0500604_0113727_266_478 69
1553 3300053153 Ga0500616_0001686 Ga0500616_0001686_10160_10369 69
1554 3300053153 Ga0500616_0041654 Ga0500616_0041654_394_606 69
1555 3300053153 Ga0500616_0188181 Ga0500616_0188181_45_257 69
1556 3300053156 Ga0500622_0026143 Ga0500622_0026143_2744_2953 69
1557 3300053156 Ga0500622_0082165 Ga0500622_0082165_874_1083 69
1558 3300053158 Ga0500627_0059149 Ga0500627_0059149_1275_1484 69
1559 3300053158 Ga0500627_0130792 Ga0500627_0130792_656_868 69
1560 3300053158 Ga0500627_0139126 Ga0500627_0139126_370_579 69
1561 3300053158 Ga0500627_0267933 Ga0500627_0267933_252_461 69
1562 3300053160 Ga0500633_0053860 Ga0500633_0053860_1133_1342 69
1563 3300053162 Ga0500638_342658 Ga0500638_342658_158_367 69
1564 3300053727 Ga0500611_032595 Ga0500611_032595_248_460 69
1565 3300053730 Ga0500645_107824 Ga0500645_107824_102_311 69
1566 3300054114 Ga0501084_0401350 Ga0501084_0401350_288_500 69
1567 3300059477 Ga0587084_032264 Ga0587084_032264_531_740 69
1568 3300059477 Ga0587084_122147 Ga0587084_122147_235_444 69
1569 3300059490 Ga0587066_003392 Ga0587066_003392_1411_1620 69
1570 3300059490 Ga0587066_075045 Ga0587066_075045_397_606 69
1571 3300059492 Ga0587073_0070342 Ga0587073_0070342_528_737 69
1572 3300059503 Ga0587080_112850 Ga0587080_112850_185_394 69
1573 3300059504 Ga0587082_073323 Ga0587082_073323_381_590 69
1574 3300059505 Ga0587083_0265568 Ga0587083_0265568_192_404 69
1575 3300059506 Ga0587085_051183 Ga0587085_051183_254_463 69
1576 3300059508 Ga0587088_053930 Ga0587088_053930_106_315 69
1577 3300059508 Ga0587088_177784 Ga0587088_177784_114_326 69
1578 3300059509 Ga0587089_081117 Ga0587089_081117_105_314 69
1579 3300059509 Ga0587089_094271 Ga0587089_094271_212_424 69
1580 3300059510 Ga0587090_156438 Ga0587090_156438_102_311 69
1581 3300059511 Ga0587091_120787 Ga0587091_120787_95_304 69
1582 3300059512 Ga0587092_144234 Ga0587092_144234_208_420 69
1583 3300059513 Ga0587094_067450 Ga0587094_067450_106_315 69
1584 3300059604 Ga0587098_057932 Ga0587098_057932_116_325 69
1585 3300059605 Ga0587106_093114 Ga0587106_093114_69_281 69
1586 3300059605 Ga0587106_117048 Ga0587106_117048_251_460 69
1587 3300059607 Ga0587125_081280 Ga0587125_081280_108_320 69
1588 3300059608 Ga0587129_012337 Ga0587129_012337_297_506 69
1589 3300059622 Ga0587099_038709 Ga0587099_038709_222_434 69
1590 3300059623 Ga0587101_152743 Ga0587101_152743_180_392 69
1591 3300059624 Ga0587109_110315 Ga0587109_110315_323_532 69
1592 3300059624 Ga0587109_141068 Ga0587109_141068_109_321 69
1593 3300059624 Ga0587109_172366 Ga0587109_172366_120_329 69
1594 3300059625 Ga0587113_020044 Ga0587113_020044_374_583 69
1595 3300059625 Ga0587113_053499 Ga0587113_053499_190_402 69
1596 3300059628 Ga0587122_052835 Ga0587122_052835_113_325 69
1597 3300059628 Ga0587122_055920 Ga0587122_055920_206_415 69
1598 3300059630 Ga0587128_062583 Ga0587128_062583_382_591 69
1599 3300059630 Ga0587128_065140 Ga0587128_065140_382_591 69
1600 3300059640 Ga0587067_107281 Ga0587067_107281_104_313 69
1601 3300059640 Ga0587067_190785 Ga0587067_190785_205_414 69
1602 3300059641 Ga0587068_102435 Ga0587068_102435_284_496 69
1603 3300059643 Ga0587072_197399 Ga0587072_197399_166_378 69
1604 3300059645 Ga0587076_004448 Ga0587076_004448_1311_1520 69
1605 3300059645 Ga0587076_025539 Ga0587076_025539_139_348 69
1606 3300059646 Ga0587078_078213 Ga0587078_078213_201_413 69
1607 3300059647 Ga0587079_092152 Ga0587079_092152_299_511 69
1608 3300059649 Ga0587102_070864 Ga0587102_070864_192_404 69
1609 3300059652 Ga0587107_142623 Ga0587107_142623_189_401 69
1610 3300059654 Ga0587110_028814 Ga0587110_028814_110_319 69
1611 3300059654 Ga0587110_054836 Ga0587110_054836_116_328 69
1612 3300059655 Ga0587114_119261 Ga0587114_119261_208_420 69
1613 3300059656 Ga0587116_18054 Ga0587116_18054_208_420 69
1614 3300059659 Ga0587120_035344 Ga0587120_035344_104_316 69
1615 3300060245 Ga0587065_09177 Ga0587065_09177_174_383 69
1616 3300060346 Ga0587111_0097279 Ga0587111_0097279_104_313 69
1617 3300060346 Ga0587111_0130142 Ga0587111_0130142_106_315 69
1618 3300060346 Ga0587111_0256972 Ga0587111_0256972_199_408 69
1619 3300060353 Ga0501082_0335152 Ga0501082_0335152_203_412 69
1620 3300060353 Ga0501082_0370725 Ga0501082_0370725_734_943 69
1621 iso_pu_bacteria 2958064165 2958070758 69

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00313

CSD

'Cold-shock' DNA-binding domain

2

61

0.95

PF08206

OB_RNB

Ribonuclease B OB domain

4

38

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8h1i-assembly1.cif.gz_B crystal structure of plygrcs, a bacteriophage endolysin in complex with cold shock protein c 0.8989 2 69
1mjc-assembly1.cif.gz_A crystal structure of cspa, the major cold shock protein of escherichia coli 0.8907 2 69
3i2z-assembly3.cif.gz_A structure of cold shock protein e from salmonella typhimurium 0.8787 2 69
3i2z-assembly2.cif.gz_B structure of cold shock protein e from salmonella typhimurium 0.8709 1 69
1hza-assembly1.cif.gz_B bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability 0.8701 1 69
ID Description Score Start End Superfamily
af_I1LPN7_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9036 2 66 2.40.50.140
af_Q94C69_1_75_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8858 2 66 2.40.50.140
af_Q9VRN5_36_116_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8854 2 69 2.40.50.140
af_P92186_48_133_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8553 2 66 2.40.50.140
af_Q4DCA9_18_92_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8492 3 68 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A2D7IW85-F1-model_v4 Cold-shock protein 0.9912 1 51 GO:0003676
AF-A0A7W6W2S8-F1-model_v4 deleted 0.9852 1 68
AF-A0A4Q7DKD5-F1-model_v4 Cold-shock protein 0.9837 1 67 GO:0003676
GO:0005829
AF-A0A2S6U6G3-F1-model_v4 Cold shock protein CspA 0.9816 1 69 GO:0003676
GO:0005829
AF-A0A7D5MY86-F1-model_v4 Cold shock domain-containing protein 0.9797 2 69 GO:0003676
GO:0005829

Feature Viewer

pLDDT pTM Quality
91.04 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map