F495080
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1621 | 626 | 1620 | 69 |
Family's Representative Sequence
| Representative Sequence | 3300003792|Ga0055540_1001991|Ga0055540_10019912 |
| Length | 85 |
| Sequence | MNTGTVKWFNSSKGFGFIQPDDGSTDVFVHISAVERAGLSSLSDGQKIVYELVRDKKSARIPPTACAQPNSPLACLTTDVWQPSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 11 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 12 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 13 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 14 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 15 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 16 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 17 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 18 | 3300002868 | Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_10 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300002870 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 21 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 23 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 24 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 25 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 26 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 27 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 28 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 29 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 30 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 31 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 32 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 33 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 34 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 35 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 36 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 37 | 3300003717 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_9 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 38 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 39 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 40 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 41 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 42 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 43 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 44 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 45 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 46 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 47 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 48 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 49 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 50 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 51 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 52 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 53 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 59 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 63 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 74 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 90 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 91 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 96 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 99 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 104 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 106 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 107 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 108 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 109 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 110 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 111 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 112 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 113 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 114 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 115 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 116 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 117 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 118 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 119 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 120 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 121 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 122 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 124 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 125 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 126 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 127 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 128 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 129 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 130 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 131 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 132 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 133 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 134 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 136 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 137 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 138 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 139 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 140 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 142 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 143 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 144 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 145 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 161 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 164 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 165 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 166 | 3300013062 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 172 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 180 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 184 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 185 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 188 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 189 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 190 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 192 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 193 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 194 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 195 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 196 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 197 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 198 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 199 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 200 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 201 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 202 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 203 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 208 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 209 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 210 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 212 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 213 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 215 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 217 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 219 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 220 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 222 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 225 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 290 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 293 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 295 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 296 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 300 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 301 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 302 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 303 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 304 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 310 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 311 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 312 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 313 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 314 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 315 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 316 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 317 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 318 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 319 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 320 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 321 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 322 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 323 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 324 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 325 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 326 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 327 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 328 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 329 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 330 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 331 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 332 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 333 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 334 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 335 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 336 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 339 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 340 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 341 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 342 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 343 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 344 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 345 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 346 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 347 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 348 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 349 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 350 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 351 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 352 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 353 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 354 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 355 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 356 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 357 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 358 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 359 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 360 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 361 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 362 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 363 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 364 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 365 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 366 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 367 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 368 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 369 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 370 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 371 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 372 | 3300041455 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT | Metatranscriptome | Rhizoplane |
| 373 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 374 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 375 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 376 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 377 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 378 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 379 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 380 | 3300041907 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run | Metatranscriptome | Unclassified |
| 381 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 382 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 383 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 384 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 385 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 386 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 387 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 388 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 389 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 390 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 391 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 392 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 393 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 394 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 489 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 490 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 491 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 492 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 493 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 494 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 495 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 496 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 497 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 498 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 499 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 500 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 501 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 502 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 503 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 504 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 505 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 506 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 507 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 508 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 509 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 510 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 511 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 512 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 513 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 514 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 516 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 517 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 518 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 519 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 520 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 521 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 522 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 523 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 524 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 525 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 526 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 527 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 528 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 529 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 530 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 531 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 532 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 533 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 534 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 535 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 536 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 537 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 538 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 539 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 540 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 541 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 542 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 543 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 544 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 545 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 546 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 547 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 548 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 549 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 550 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 551 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 552 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 553 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 554 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 555 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 561 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 562 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 563 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 564 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 565 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 566 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 567 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 568 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 569 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 570 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 571 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 572 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 573 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 574 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 575 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 576 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 577 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 578 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 579 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 580 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 581 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 582 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 583 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 584 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 585 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 586 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 587 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 588 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 589 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 590 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 591 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 592 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 593 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 594 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 595 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 596 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 597 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 598 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 599 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 600 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 601 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 602 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 603 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 604 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 605 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 606 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 607 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 608 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 609 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 610 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 611 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 612 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 613 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 614 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 615 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 616 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 617 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 618 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 619 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 620 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 621 | 3300059656 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 622 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 623 | 3300060245 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 6R_CD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 624 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 625 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 626 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.63 |
| Metatranscriptomes | 5.31 |
| Isolates | 0.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.84 |
| Nodule | 1.17 |
| Rhizoplane | 2.04 |
| Rhizosphere | 69.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1008199 | 3300000549 | Bacteria | 1274 |
| 2 | JGI24752J21851_1010252 | 3300001976 | Bacteria | 1223 |
| 3 | JGI24740J21852_10079157 | 3300001979 | Bacteria | 864 |
| 4 | JGI24740J21852_10129760 | 3300001979 | Bacteria | 629 |
| 5 | JGI24740J21852_10132098 | 3300001979 | Bacteria | 623 |
| 6 | JGI24739J22299_10032005 | 3300001989 | Bacteria | 1814 |
| 7 | JGI24739J22299_10045697 | 3300001989 | Bacteria | 1436 |
| 8 | JGI24739J22299_10085716 | 3300001989 | Bacteria | 963 |
| 9 | JGI24739J22299_10116097 | 3300001989 | Bacteria | 801 |
| 10 | JGI24737J22298_10187079 | 3300001990 | Bacteria | 611 |
| 11 | JGI24737J22298_10189199 | 3300001990 | Bacteria | 608 |
| 12 | JGI24735J21928_10101112 | 3300002067 | Bacteria | 828 |
| 13 | JGI24735J21928_10163373 | 3300002067 | Bacteria | 643 |
| 14 | JGI24748J21848_1043570 | 3300002074 | Bacteria | 575 |
| 15 | JGI24738J21930_10024573 | 3300002075 | Bacteria | 1239 |
| 16 | JGI24738J21930_10107785 | 3300002075 | Bacteria | 598 |
| 17 | JGI25155J39150_1000011 | 3300002704 | Bacteria | 207685 |
| 18 | JGI25155J39150_1000330 | 3300002704 | Bacteria | 15499 |
| 19 | JGI25156J39149_1000030 | 3300002705 | Bacteria | 126029 |
| 20 | JGI25156J39149_1000795 | 3300002705 | Bacteria | 16198 |
| 21 | JGI25156J39149_1002222 | 3300002705 | Bacteria | 7189 |
| 22 | JGI25156J39149_1051441 | 3300002705 | Bacteria | 539 |
| 23 | JGI25162J39368_1000069 | 3300002737 | Bacteria | 125244 |
| 24 | JGI25162J39368_1000476 | 3300002737 | Bacteria | 30796 |
| 25 | JGI25154J39366_1000289 | 3300002738 | Bacteria | 30213 |
| 26 | JGI25154J39366_1000696 | 3300002738 | Bacteria | 15400 |
| 27 | JGI25154J39366_1020412 | 3300002738 | Bacteria | 635 |
| 28 | JGI25158J39367_1000188 | 3300002739 | Bacteria | 14642 |
| 29 | JGI25157J39369_1000010 | 3300002741 | Bacteria | 207685 |
| 30 | JGI25157J39369_1000786 | 3300002741 | Bacteria | 16228 |
| 31 | JGI25157J39369_1002208 | 3300002741 | Bacteria | 5323 |
| 32 | JGI25152J39213_1000001 | 3300002773 | Bacteria | 224104 |
| 33 | JGI25152J39213_1000013 | 3300002773 | Bacteria | 123999 |
| 34 | JGI25152J39213_1000015 | 3300002773 | Bacteria | 120605 |
| 35 | JGI25152J39213_1000301 | 3300002773 | Bacteria | 31895 |
| 36 | JGI25152J39213_1004424 | 3300002773 | Bacteria | 4430 |
| 37 | JGI25150J39212_1000007 | 3300002774 | Bacteria | 253635 |
| 38 | JGI25150J39212_1000810 | 3300002774 | Bacteria | 10584 |
| 39 | Ga0006767J43181_101308 | 3300002868 | Bacteria | 584 |
| 40 | Ga0006763J43179_100527 | 3300002870 | Bacteria | 944 |
| 41 | JGI25159J45721_1000133 | 3300002987 | Bacteria | 35035 |
| 42 | JGI25159J45721_1001957 | 3300002987 | Bacteria | 8207 |
| 43 | JGI25159J45721_1002071 | 3300002987 | Bacteria | 7912 |
| 44 | Ga0006759J45824_1001793 | 3300003163 | Bacteria | 1115 |
| 45 | JGI25151J46595_10000013 | 3300003187 | Bacteria | 253635 |
| 46 | JGI25151J46595_10000110 | 3300003187 | Bacteria | 111972 |
| 47 | JGI25151J46595_10005211 | 3300003187 | Bacteria | 6743 |
| 48 | JGI25151J46595_10022787 | 3300003187 | Bacteria | 2593 |
| 49 | JGI25151J46595_10053839 | 3300003187 | Bacteria | 1340 |
| 50 | JGI25165J46597_1000006 | 3300003214 | Bacteria | 529784 |
| 51 | JGI25165J46597_1000018 | 3300003214 | Bacteria | 374701 |
| 52 | JGI25165J46597_1000068 | 3300003214 | Bacteria | 196201 |
| 53 | JGI25153J46596_10000378 | 3300003215 | Bacteria | 30471 |
| 54 | JGI25153J46596_10000437 | 3300003215 | Bacteria | 26782 |
| 55 | JGI25153J46596_10001081 | 3300003215 | Bacteria | 16614 |
| 56 | JGI25153J46596_10047561 | 3300003215 | Bacteria | 1261 |
| 57 | Ga0006758J48902_1000593 | 3300003300 | Bacteria | 1062 |
| 58 | Ga0006777J48905_1004194 | 3300003308 | Bacteria | 966 |
| 59 | rootH1_10061686 | 3300003316 | Bacteria | 2225 |
| 60 | rootH2_10039599 | 3300003320 | Bacteria | 12140 |
| 61 | rootH2_10130185 | 3300003320 | Bacteria | 6703 |
| 62 | rootL2_10002287 | 3300003322 | Bacteria | 11668 |
| 63 | rootL2_10149362 | 3300003322 | Bacteria | 4895 |
| 64 | rootH1_10078983 | 3300003323 | Bacteria | 7255 |
| 65 | JGI25160J50197_1000300 | 3300003354 | Bacteria | 34955 |
| 66 | JGI25160J50197_1067736 | 3300003354 | Bacteria | 690 |
| 67 | JGI25407J50210_10167016 | 3300003373 | Bacteria | 542 |
| 68 | JGI25161J50226_1000026 | 3300003374 | Bacteria | 146134 |
| 69 | Ga0007427J51700_100616 | 3300003559 | Bacteria | 2056 |
| 70 | Ga0006562J51391_1000820 | 3300003578 | Bacteria | 2855 |
| 71 | Ga0032354_1014652 | 3300003693 | Bacteria | 2147 |
| 72 | Ga0032354_1023888 | 3300003693 | Bacteria | 556 |
| 73 | Ga0032354_1032325 | 3300003693 | Bacteria | 741 |
| 74 | Ga0006766_105963 | 3300003717 | Bacteria | 712 |
| 75 | Ga0006780_1010778 | 3300003735 | Bacteria | 1380 |
| 76 | Ga0055539_1003524 | 3300003752 | Bacteria | 2179 |
| 77 | Ga0055526_1000385 | 3300003771 | Bacteria | 35743 |
| 78 | Ga0055526_1000755 | 3300003771 | Bacteria | 24181 |
| 79 | Ga0055526_1000922 | 3300003771 | Bacteria | 21824 |
| 80 | Ga0055526_1014497 | 3300003771 | Bacteria | 3238 |
| 81 | Ga0055526_1022880 | 3300003771 | Bacteria | 2106 |
| 82 | Ga0055526_1040784 | 3300003771 | Bacteria | 1165 |
| 83 | Ga0055524_1000208 | 3300003775 | Bacteria | 63030 |
| 84 | Ga0055524_1002743 | 3300003775 | Bacteria | 8886 |
| 85 | Ga0055524_1002804 | 3300003775 | Bacteria | 8750 |
| 86 | Ga0055524_1005658 | 3300003775 | Bacteria | 5543 |
| 87 | Ga0055524_1043618 | 3300003775 | Bacteria | 1100 |
| 88 | Ga0055536_1008548 | 3300003781 | Bacteria | 4385 |
| 89 | Ga0055534_1016321 | 3300003784 | Bacteria | 1336 |
| 90 | Ga0055528_1000716 | 3300003790 | Bacteria | 23431 |
| 91 | Ga0055528_1001208 | 3300003790 | Bacteria | 16552 |
| 92 | Ga0055528_1005621 | 3300003790 | Bacteria | 5795 |
| 93 | Ga0055528_1011838 | 3300003790 | Bacteria | 3429 |
| 94 | Ga0055528_1011997 | 3300003790 | Bacteria | 3395 |
| 95 | Ga0055530_10009766 | 3300003791 | Bacteria | 3634 |
| 96 | Ga0055540_1001255 | 3300003792 | Bacteria | 15521 |
| 97 | Ga0055540_1001932 | 3300003792 | Bacteria | 11586 |
| 98 | Ga0055540_1001991 | 3300003792 | Bacteria | 11414 |
| 99 | Ga0055540_1090854 | 3300003792 | Bacteria | 576 |
| 100 | Ga0055531_10008208 | 3300003794 | Bacteria | 5557 |
| 101 | Ga0055531_10064848 | 3300003794 | Bacteria | 871 |
| 102 | Ga0055531_10091833 | 3300003794 | Bacteria | 642 |
| 103 | Ga0058692_1001660 | 3300003856 | Bacteria | 7987 |
| 104 | Ga0058692_1002829 | 3300003856 | Bacteria | 5688 |
| 105 | Ga0058692_1050931 | 3300003856 | Bacteria | 686 |
| 106 | Ga0055543_1000085 | 3300004625 | Bacteria | 81274 |
| 107 | Ga0055543_1006378 | 3300004625 | Bacteria | 2859 |
| 108 | Ga0055543_1020485 | 3300004625 | Bacteria | 1214 |
| 109 | Ga0058859_11782138 | 3300004798 | Bacteria | 835 |
| 110 | Ga0065165_1000777 | 3300005262 | Bacteria | 42783 |
| 111 | Ga0065165_1001054 | 3300005262 | Bacteria | 33088 |
| 112 | Ga0065165_1001529 | 3300005262 | Bacteria | 24281 |
| 113 | Ga0065165_1003064 | 3300005262 | Bacteria | 12513 |
| 114 | Ga0065165_1006194 | 3300005262 | Bacteria | 6383 |
| 115 | Ga0065704_10006703 | 3300005289 | Bacteria | 2489 |
| 116 | Ga0070658_10039686 | 3300005327 | Bacteria | 3798 |
| 117 | Ga0070658_10118807 | 3300005327 | Bacteria | 2195 |
| 118 | Ga0070658_10272484 | 3300005327 | Bacteria | 1440 |
| 119 | Ga0070676_10233713 | 3300005328 | Bacteria | 1219 |
| 120 | Ga0070676_10657123 | 3300005328 | Bacteria | 761 |
| 121 | Ga0070683_100061536 | 3300005329 | Bacteria | 3491 |
| 122 | Ga0070683_101343506 | 3300005329 | Bacteria | 687 |
| 123 | Ga0070690_100637002 | 3300005330 | Bacteria | 813 |
| 124 | Ga0070670_100327420 | 3300005331 | Bacteria | 1343 |
| 125 | Ga0070670_100492354 | 3300005331 | Bacteria | 1089 |
| 126 | Ga0070670_101915433 | 3300005331 | Bacteria | 546 |
| 127 | Ga0068869_100780617 | 3300005334 | Bacteria | 820 |
| 128 | Ga0070666_10121615 | 3300005335 | Bacteria | 1810 |
| 129 | Ga0070666_10488704 | 3300005335 | Bacteria | 892 |
| 130 | Ga0070666_10666486 | 3300005335 | Bacteria | 762 |
| 131 | Ga0070680_100005174 | 3300005336 | Bacteria | 9867 |
| 132 | Ga0070680_100025420 | 3300005336 | Bacteria | 4733 |
| 133 | Ga0070680_100062215 | 3300005336 | Bacteria | 3056 |
| 134 | Ga0070680_100068383 | 3300005336 | Bacteria | 2915 |
| 135 | Ga0070682_100021284 | 3300005337 | Bacteria | 3824 |
| 136 | Ga0070682_100158227 | 3300005337 | Bacteria | 1562 |
| 137 | Ga0070682_100459445 | 3300005337 | Bacteria | 977 |
| 138 | Ga0070682_100577631 | 3300005337 | Bacteria | 884 |
| 139 | Ga0070682_100697167 | 3300005337 | Bacteria | 814 |
| 140 | Ga0070682_100865942 | 3300005337 | Bacteria | 739 |
| 141 | Ga0070682_101211643 | 3300005337 | Bacteria | 638 |
| 142 | Ga0070682_101505544 | 3300005337 | Bacteria | 579 |
| 143 | Ga0068868_100234537 | 3300005338 | Bacteria | 1540 |
| 144 | Ga0068868_101114712 | 3300005338 | Bacteria | 726 |
| 145 | Ga0070660_100004682 | 3300005339 | Bacteria | 9471 |
| 146 | Ga0070660_100411100 | 3300005339 | Bacteria | 1120 |
| 147 | Ga0070689_100294893 | 3300005340 | Bacteria | 1349 |
| 148 | Ga0070691_10423161 | 3300005341 | Bacteria | 755 |
| 149 | Ga0070691_10912275 | 3300005341 | Bacteria | 543 |
| 150 | Ga0070661_100090662 | 3300005344 | Bacteria | 2264 |
| 151 | Ga0070661_101296377 | 3300005344 | Bacteria | 611 |
| 152 | Ga0070661_101786598 | 3300005344 | Bacteria | 522 |
| 153 | Ga0070692_10829648 | 3300005345 | Bacteria | 634 |
| 154 | Ga0070668_100022443 | 3300005347 | Bacteria | 4771 |
| 155 | Ga0070668_100336439 | 3300005347 | Bacteria | 1274 |
| 156 | Ga0070668_100549735 | 3300005347 | Bacteria | 1005 |
| 157 | Ga0070668_100757294 | 3300005347 | Bacteria | 860 |
| 158 | Ga0070668_100828021 | 3300005347 | Bacteria | 824 |
| 159 | Ga0070668_100996973 | 3300005347 | Bacteria | 753 |
| 160 | Ga0070668_101503784 | 3300005347 | Bacteria | 615 |
| 161 | Ga0070668_101809691 | 3300005347 | Bacteria | 562 |
| 162 | Ga0070669_100410468 | 3300005353 | Bacteria | 1110 |
| 163 | Ga0070669_101031725 | 3300005353 | Bacteria | 706 |
| 164 | Ga0070669_101102288 | 3300005353 | Bacteria | 684 |
| 165 | Ga0070669_101622792 | 3300005353 | Bacteria | 563 |
| 166 | Ga0070671_100209677 | 3300005355 | Bacteria | 1652 |
| 167 | Ga0070671_101754663 | 3300005355 | Bacteria | 551 |
| 168 | Ga0070671_101777485 | 3300005355 | Bacteria | 548 |
| 169 | Ga0070674_100228616 | 3300005356 | Bacteria | 1450 |
| 170 | Ga0070674_100902288 | 3300005356 | Bacteria | 770 |
| 171 | Ga0070674_101104155 | 3300005356 | Bacteria | 700 |
| 172 | Ga0070674_101274462 | 3300005356 | Bacteria | 655 |
| 173 | Ga0070673_100189893 | 3300005364 | Bacteria | 1764 |
| 174 | Ga0070673_101925350 | 3300005364 | Bacteria | 561 |
| 175 | Ga0070688_100206308 | 3300005365 | Bacteria | 1378 |
| 176 | Ga0070688_100406709 | 3300005365 | Bacteria | 1008 |
| 177 | Ga0070688_100591804 | 3300005365 | Bacteria | 848 |
| 178 | Ga0070688_101487784 | 3300005365 | Bacteria | 551 |
| 179 | Ga0070659_100115257 | 3300005366 | Bacteria | 2172 |
| 180 | Ga0070659_100322412 | 3300005366 | Bacteria | 1292 |
| 181 | Ga0070659_100927678 | 3300005366 | Bacteria | 762 |
| 182 | Ga0070659_101113855 | 3300005366 | Bacteria | 696 |
| 183 | Ga0070659_101135034 | 3300005366 | Bacteria | 690 |
| 184 | Ga0070667_100602799 | 3300005367 | Bacteria | 1012 |
| 185 | Ga0070667_100842051 | 3300005367 | Bacteria | 852 |
| 186 | Ga0070667_100897904 | 3300005367 | Bacteria | 825 |
| 187 | Ga0070667_101218124 | 3300005367 | Bacteria | 705 |
| 188 | Ga0070709_10016520 | 3300005434 | Bacteria | 4216 |
| 189 | Ga0070709_10035902 | 3300005434 | Bacteria | 3015 |
| 190 | Ga0070709_10063889 | 3300005434 | Bacteria | 2352 |
| 191 | Ga0070709_10134473 | 3300005434 | Bacteria | 1692 |
| 192 | Ga0070709_10156008 | 3300005434 | Bacteria | 1582 |
| 193 | Ga0070709_10179578 | 3300005434 | Bacteria | 1485 |
| 194 | Ga0070714_100024895 | 3300005435 | Bacteria | 4934 |
| 195 | Ga0070714_100030577 | 3300005435 | Bacteria | 4484 |
| 196 | Ga0070714_100102121 | 3300005435 | Bacteria | 2528 |
| 197 | Ga0070714_100130483 | 3300005435 | Bacteria | 2246 |
| 198 | Ga0070713_100003931 | 3300005436 | Bacteria | 9866 |
| 199 | Ga0070713_100017989 | 3300005436 | Bacteria | 5365 |
| 200 | Ga0070713_100090069 | 3300005436 | Bacteria | 2636 |
| 201 | Ga0070713_101698664 | 3300005436 | Bacteria | 613 |
| 202 | Ga0070710_10001221 | 3300005437 | Bacteria | 12167 |
| 203 | Ga0070710_10006078 | 3300005437 | Bacteria | 5774 |
| 204 | Ga0070710_10011233 | 3300005437 | Bacteria | 4421 |
| 205 | Ga0070710_10302347 | 3300005437 | Bacteria | 1044 |
| 206 | Ga0070710_11253951 | 3300005437 | Bacteria | 550 |
| 207 | Ga0070701_10508213 | 3300005438 | Bacteria | 784 |
| 208 | Ga0070711_100002618 | 3300005439 | Bacteria | 10300 |
| 209 | Ga0070711_100074580 | 3300005439 | Bacteria | 2400 |
| 210 | Ga0070711_100167066 | 3300005439 | Bacteria | 1673 |
| 211 | Ga0070711_100476977 | 3300005439 | Bacteria | 1025 |
| 212 | Ga0070711_100599482 | 3300005439 | Bacteria | 919 |
| 213 | Ga0070705_100366232 | 3300005440 | Bacteria | 1056 |
| 214 | Ga0070705_101254736 | 3300005440 | Bacteria | 613 |
| 215 | Ga0070700_100306874 | 3300005441 | Bacteria | 1161 |
| 216 | Ga0070700_100347399 | 3300005441 | Bacteria | 1099 |
| 217 | Ga0070700_101144688 | 3300005441 | Bacteria | 647 |
| 218 | Ga0070694_101700448 | 3300005444 | Bacteria | 537 |
| 219 | Ga0070708_100063270 | 3300005445 | Bacteria | 3312 |
| 220 | Ga0070663_100164844 | 3300005455 | Bacteria | 1708 |
| 221 | Ga0070663_100417081 | 3300005455 | Bacteria | 1100 |
| 222 | Ga0070663_100521433 | 3300005455 | Bacteria | 989 |
| 223 | Ga0070663_100889103 | 3300005455 | Bacteria | 769 |
| 224 | Ga0070663_100896973 | 3300005455 | Bacteria | 765 |
| 225 | Ga0070663_101061914 | 3300005455 | Bacteria | 707 |
| 226 | Ga0070663_101086581 | 3300005455 | Bacteria | 699 |
| 227 | Ga0070663_101215199 | 3300005455 | Bacteria | 663 |
| 228 | Ga0070663_101545680 | 3300005455 | Bacteria | 591 |
| 229 | Ga0070663_102045993 | 3300005455 | Bacteria | 516 |
| 230 | Ga0070678_100317287 | 3300005456 | Bacteria | 1330 |
| 231 | Ga0070678_100687664 | 3300005456 | Bacteria | 920 |
| 232 | Ga0070678_100774144 | 3300005456 | Bacteria | 869 |
| 233 | Ga0070678_100791054 | 3300005456 | Bacteria | 861 |
| 234 | Ga0070678_101417730 | 3300005456 | Bacteria | 649 |
| 235 | Ga0070662_100063389 | 3300005457 | Bacteria | 2704 |
| 236 | Ga0070662_100137147 | 3300005457 | Bacteria | 1892 |
| 237 | Ga0070662_100590274 | 3300005457 | Bacteria | 934 |
| 238 | Ga0070662_100819153 | 3300005457 | Bacteria | 792 |
| 239 | Ga0070681_10010435 | 3300005458 | Bacteria | 9175 |
| 240 | Ga0070681_10014949 | 3300005458 | Bacteria | 7717 |
| 241 | Ga0070681_10101039 | 3300005458 | Bacteria | 2830 |
| 242 | Ga0068867_100076157 | 3300005459 | Bacteria | 2518 |
| 243 | Ga0068867_100872840 | 3300005459 | Bacteria | 807 |
| 244 | Ga0068867_102342585 | 3300005459 | Bacteria | 508 |
| 245 | Ga0070706_100848581 | 3300005467 | Bacteria | 845 |
| 246 | Ga0070706_101684089 | 3300005467 | Bacteria | 578 |
| 247 | Ga0070707_100057080 | 3300005468 | Bacteria | 3746 |
| 248 | Ga0070707_102201363 | 3300005468 | Bacteria | 519 |
| 249 | Ga0070698_100091164 | 3300005471 | Bacteria | 3031 |
| 250 | Ga0070698_100313544 | 3300005471 | Bacteria | 1499 |
| 251 | Ga0070698_100496052 | 3300005471 | Bacteria | 1159 |
| 252 | Ga0070699_100142677 | 3300005518 | Bacteria | 2116 |
| 253 | Ga0070679_100000584 | 3300005530 | Bacteria | 30891 |
| 254 | Ga0070679_100075690 | 3300005530 | Bacteria | 3355 |
| 255 | Ga0070679_100101247 | 3300005530 | Bacteria | 2868 |
| 256 | Ga0070679_100346942 | 3300005530 | Bacteria | 1432 |
| 257 | Ga0070679_100777677 | 3300005530 | Bacteria | 900 |
| 258 | Ga0070679_101969212 | 3300005530 | Bacteria | 533 |
| 259 | Ga0070684_100043633 | 3300005535 | Bacteria | 3873 |
| 260 | Ga0070684_100607120 | 3300005535 | Bacteria | 1017 |
| 261 | Ga0070684_101609607 | 3300005535 | Bacteria | 613 |
| 262 | Ga0070697_100338087 | 3300005536 | Bacteria | 1299 |
| 263 | Ga0070697_100866005 | 3300005536 | Bacteria | 801 |
| 264 | Ga0068853_100007383 | 3300005539 | Bacteria | 8794 |
| 265 | Ga0068853_100111118 | 3300005539 | Bacteria | 2435 |
| 266 | Ga0068853_100150401 | 3300005539 | Bacteria | 2095 |
| 267 | Ga0068853_100232122 | 3300005539 | Bacteria | 1688 |
| 268 | Ga0068853_100473679 | 3300005539 | Bacteria | 1180 |
| 269 | Ga0068853_102286243 | 3300005539 | Bacteria | 524 |
| 270 | Ga0070672_100434179 | 3300005543 | Bacteria | 1129 |
| 271 | Ga0070672_101108436 | 3300005543 | Bacteria | 703 |
| 272 | Ga0070672_101142100 | 3300005543 | Bacteria | 693 |
| 273 | Ga0070672_101912571 | 3300005543 | Bacteria | 534 |
| 274 | Ga0070696_101009071 | 3300005546 | Bacteria | 696 |
| 275 | Ga0070665_100010030 | 3300005548 | Bacteria | 9581 |
| 276 | Ga0070665_100011730 | 3300005548 | Bacteria | 8852 |
| 277 | Ga0070665_100129470 | 3300005548 | Bacteria | 2526 |
| 278 | Ga0070665_100171160 | 3300005548 | Bacteria | 2173 |
| 279 | Ga0070665_100275615 | 3300005548 | Bacteria | 1684 |
| 280 | Ga0070665_100430736 | 3300005548 | Bacteria | 1328 |
| 281 | Ga0070665_100627161 | 3300005548 | Bacteria | 1088 |
| 282 | Ga0070665_100885572 | 3300005548 | Bacteria | 905 |
| 283 | Ga0070665_101051388 | 3300005548 | Bacteria | 826 |
| 284 | Ga0070665_101066579 | 3300005548 | Bacteria | 820 |
| 285 | Ga0070665_101092863 | 3300005548 | Bacteria | 809 |
| 286 | Ga0070704_100666717 | 3300005549 | Bacteria | 920 |
| 287 | Ga0070704_100747081 | 3300005549 | Bacteria | 871 |
| 288 | Ga0068855_100023319 | 3300005563 | Bacteria | 7411 |
| 289 | Ga0068855_100119356 | 3300005563 | Bacteria | 3019 |
| 290 | Ga0068855_100167683 | 3300005563 | Bacteria | 2488 |
| 291 | Ga0068855_100749453 | 3300005563 | Bacteria | 1041 |
| 292 | Ga0068855_101377753 | 3300005563 | Bacteria | 728 |
| 293 | Ga0068855_101713595 | 3300005563 | Bacteria | 640 |
| 294 | Ga0070664_100370331 | 3300005564 | Bacteria | 1306 |
| 295 | Ga0070664_101253071 | 3300005564 | Bacteria | 700 |
| 296 | Ga0068857_100038424 | 3300005577 | Bacteria | 4239 |
| 297 | Ga0068857_100110809 | 3300005577 | Bacteria | 2467 |
| 298 | Ga0068857_100439499 | 3300005577 | Bacteria | 1218 |
| 299 | Ga0068857_101954682 | 3300005577 | Bacteria | 575 |
| 300 | Ga0068854_100315988 | 3300005578 | Bacteria | 1268 |
| 301 | Ga0068854_101426848 | 3300005578 | Bacteria | 627 |
| 302 | Ga0068854_102143692 | 3300005578 | Bacteria | 516 |
| 303 | Ga0068856_100000651 | 3300005614 | Bacteria | 37648 |
| 304 | Ga0068856_100036991 | 3300005614 | Bacteria | 4788 |
| 305 | Ga0068856_100170919 | 3300005614 | Bacteria | 2185 |
| 306 | Ga0068856_100361700 | 3300005614 | Bacteria | 1470 |
| 307 | Ga0068856_100739727 | 3300005614 | Bacteria | 1003 |
| 308 | Ga0068856_100886621 | 3300005614 | Bacteria | 911 |
| 309 | Ga0068856_101005596 | 3300005614 | Bacteria | 852 |
| 310 | Ga0068856_101019078 | 3300005614 | Bacteria | 846 |
| 311 | Ga0068852_100002449 | 3300005616 | Bacteria | 12781 |
| 312 | Ga0068852_100583092 | 3300005616 | Bacteria | 1121 |
| 313 | Ga0068852_100678940 | 3300005616 | Bacteria | 1039 |
| 314 | Ga0068852_100863990 | 3300005616 | Bacteria | 920 |
| 315 | Ga0068852_101991358 | 3300005616 | Bacteria | 603 |
| 316 | Ga0068859_100105112 | 3300005617 | Bacteria | 2883 |
| 317 | Ga0068859_100321492 | 3300005617 | Bacteria | 1641 |
| 318 | Ga0068859_100940427 | 3300005617 | Bacteria | 948 |
| 319 | Ga0068864_100884327 | 3300005618 | Bacteria | 881 |
| 320 | Ga0068864_101023014 | 3300005618 | Bacteria | 820 |
| 321 | Ga0068866_10524739 | 3300005718 | Bacteria | 787 |
| 322 | Ga0068866_10611223 | 3300005718 | Bacteria | 737 |
| 323 | Ga0068861_100152859 | 3300005719 | Bacteria | 1895 |
| 324 | Ga0068861_102158497 | 3300005719 | Bacteria | 557 |
| 325 | Ga0068851_10002569 | 3300005834 | Bacteria | 7987 |
| 326 | Ga0068851_10902872 | 3300005834 | Bacteria | 553 |
| 327 | Ga0068851_10912857 | 3300005834 | Bacteria | 551 |
| 328 | Ga0068870_11343312 | 3300005840 | Bacteria | 522 |
| 329 | Ga0068863_100385697 | 3300005841 | Bacteria | 1369 |
| 330 | Ga0068863_100712823 | 3300005841 | Bacteria | 998 |
| 331 | Ga0068863_101067590 | 3300005841 | Bacteria | 812 |
| 332 | Ga0068858_100059111 | 3300005842 | Bacteria | 3543 |
| 333 | Ga0068858_100156342 | 3300005842 | Bacteria | 2145 |
| 334 | Ga0068858_100565271 | 3300005842 | Bacteria | 1101 |
| 335 | Ga0068858_101235566 | 3300005842 | Bacteria | 735 |
| 336 | Ga0068860_101297974 | 3300005843 | Bacteria | 749 |
| 337 | Ga0068862_100941012 | 3300005844 | Bacteria | 851 |
| 338 | Ga0068862_101166870 | 3300005844 | Bacteria | 767 |
| 339 | Ga0068862_101402027 | 3300005844 | Bacteria | 702 |
| 340 | Ga0068862_101436506 | 3300005844 | Bacteria | 694 |
| 341 | Ga0081455_10371635 | 3300005937 | Bacteria | 1002 |
| 342 | Ga0081538_10039548 | 3300005981 | Bacteria | 3023 |
| 343 | Ga0081540_1234082 | 3300005983 | Bacteria | 647 |
| 344 | Ga0081540_1252620 | 3300005983 | Bacteria | 615 |
| 345 | Ga0081540_1325924 | 3300005983 | Bacteria | 526 |
| 346 | Ga0070717_10226297 | 3300006028 | Bacteria | 1646 |
| 347 | Ga0070717_11084846 | 3300006028 | Bacteria | 729 |
| 348 | Ga0075365_10077588 | 3300006038 | Bacteria | 2244 |
| 349 | Ga0075365_10311375 | 3300006038 | Bacteria | 1108 |
| 350 | Ga0075365_10431488 | 3300006038 | Bacteria | 930 |
| 351 | Ga0075365_10435417 | 3300006038 | Bacteria | 926 |
| 352 | Ga0075365_10441009 | 3300006038 | Bacteria | 919 |
| 353 | Ga0075365_10607957 | 3300006038 | Bacteria | 773 |
| 354 | Ga0075365_10845685 | 3300006038 | Bacteria | 645 |
| 355 | Ga0075365_11018704 | 3300006038 | Bacteria | 583 |
| 356 | Ga0075368_10001274 | 3300006042 | Bacteria | 7977 |
| 357 | Ga0075368_10019912 | 3300006042 | Bacteria | 2536 |
| 358 | Ga0075368_10073329 | 3300006042 | Bacteria | 1385 |
| 359 | Ga0075368_10207272 | 3300006042 | Bacteria | 830 |
| 360 | Ga0075368_10488389 | 3300006042 | Bacteria | 549 |
| 361 | Ga0075363_100006553 | 3300006048 | Bacteria | 5301 |
| 362 | Ga0075363_100045350 | 3300006048 | Bacteria | 2331 |
| 363 | Ga0075363_100341400 | 3300006048 | Bacteria | 873 |
| 364 | Ga0075364_10000320 | 3300006051 | Bacteria | 23654 |
| 365 | Ga0075364_10027644 | 3300006051 | Bacteria | 3625 |
| 366 | Ga0075364_10069975 | 3300006051 | Bacteria | 2309 |
| 367 | Ga0075364_10120941 | 3300006051 | Bacteria | 1752 |
| 368 | Ga0075364_10149731 | 3300006051 | Bacteria | 1572 |
| 369 | Ga0075364_10333638 | 3300006051 | Bacteria | 1033 |
| 370 | Ga0075364_10557811 | 3300006051 | Bacteria | 783 |
| 371 | Ga0075364_10753009 | 3300006051 | Bacteria | 664 |
| 372 | Ga0075364_11207545 | 3300006051 | Bacteria | 512 |
| 373 | Ga0075364_11224085 | 3300006051 | Bacteria | 509 |
| 374 | Ga0075432_10171685 | 3300006058 | Bacteria | 843 |
| 375 | Ga0075432_10380921 | 3300006058 | Bacteria | 605 |
| 376 | Ga0070716_100259803 | 3300006173 | Bacteria | 1188 |
| 377 | Ga0070716_100533230 | 3300006173 | Bacteria | 872 |
| 378 | Ga0070712_100055890 | 3300006175 | Bacteria | 2766 |
| 379 | Ga0070712_100146164 | 3300006175 | Bacteria | 1810 |
| 380 | Ga0075362_10179934 | 3300006177 | Bacteria | 1024 |
| 381 | Ga0075362_10191992 | 3300006177 | Bacteria | 992 |
| 382 | Ga0075362_10339392 | 3300006177 | Bacteria | 750 |
| 383 | Ga0075362_10421840 | 3300006177 | Bacteria | 675 |
| 384 | Ga0075367_10053258 | 3300006178 | Bacteria | 2397 |
| 385 | Ga0075367_10158743 | 3300006178 | Bacteria | 1406 |
| 386 | Ga0075367_10259649 | 3300006178 | Bacteria | 1090 |
| 387 | Ga0075367_10340727 | 3300006178 | Bacteria | 946 |
| 388 | Ga0075367_10415412 | 3300006178 | Bacteria | 851 |
| 389 | Ga0075367_10480755 | 3300006178 | Bacteria | 787 |
| 390 | Ga0075367_10495465 | 3300006178 | Bacteria | 775 |
| 391 | Ga0075367_10914942 | 3300006178 | Bacteria | 559 |
| 392 | Ga0075369_10024521 | 3300006186 | Bacteria | 2500 |
| 393 | Ga0075369_10033975 | 3300006186 | Bacteria | 2163 |
| 394 | Ga0075369_10229622 | 3300006186 | Bacteria | 860 |
| 395 | Ga0075369_10230793 | 3300006186 | Bacteria | 857 |
| 396 | Ga0075369_10347070 | 3300006186 | Bacteria | 696 |
| 397 | Ga0075369_10494535 | 3300006186 | Bacteria | 581 |
| 398 | Ga0075366_10154332 | 3300006195 | Bacteria | 1391 |
| 399 | Ga0075366_10322383 | 3300006195 | Bacteria | 947 |
| 400 | Ga0075366_10367725 | 3300006195 | Bacteria | 883 |
| 401 | Ga0075366_10456368 | 3300006195 | Bacteria | 788 |
| 402 | Ga0075366_10891196 | 3300006195 | Bacteria | 554 |
| 403 | Ga0097621_100993433 | 3300006237 | Bacteria | 785 |
| 404 | Ga0097621_101167118 | 3300006237 | Bacteria | 725 |
| 405 | Ga0075370_10008389 | 3300006353 | Bacteria | 5316 |
| 406 | Ga0075370_10018171 | 3300006353 | Bacteria | 3811 |
| 407 | Ga0075370_10097282 | 3300006353 | Bacteria | 1702 |
| 408 | Ga0075370_10129730 | 3300006353 | Bacteria | 1471 |
| 409 | Ga0075370_10176598 | 3300006353 | Bacteria | 1256 |
| 410 | Ga0075370_10181643 | 3300006353 | Bacteria | 1238 |
| 411 | Ga0075370_10203448 | 3300006353 | Bacteria | 1168 |
| 412 | Ga0075370_10341172 | 3300006353 | Bacteria | 894 |
| 413 | Ga0075370_10476095 | 3300006353 | Bacteria | 752 |
| 414 | Ga0075370_10892697 | 3300006353 | Bacteria | 543 |
| 415 | Ga0075370_10916021 | 3300006353 | Bacteria | 536 |
| 416 | Ga0075370_10946572 | 3300006353 | Bacteria | 527 |
| 417 | Ga0068871_100058693 | 3300006358 | Bacteria | 3133 |
| 418 | Ga0068871_101189418 | 3300006358 | Bacteria | 715 |
| 419 | Ga0068871_101488021 | 3300006358 | Bacteria | 639 |
| 420 | Ga0068871_101854791 | 3300006358 | Bacteria | 573 |
| 421 | Ga0068871_102264715 | 3300006358 | Bacteria | 518 |
| 422 | Ga0075428_101083300 | 3300006844 | Bacteria | 847 |
| 423 | Ga0075430_100938742 | 3300006846 | Bacteria | 713 |
| 424 | Ga0068865_100201405 | 3300006881 | Bacteria | 1545 |
| 425 | Ga0068865_100224699 | 3300006881 | Bacteria | 1469 |
| 426 | Ga0068865_100335828 | 3300006881 | Bacteria | 1220 |
| 427 | Ga0068865_100782959 | 3300006881 | Bacteria | 822 |
| 428 | Ga0068865_100914050 | 3300006881 | Bacteria | 764 |
| 429 | Ga0068865_101963691 | 3300006881 | Bacteria | 530 |
| 430 | Ga0097620_100105110 | 3300006931 | Bacteria | 2883 |
| 431 | Ga0097620_100321510 | 3300006931 | Bacteria | 1641 |
| 432 | Ga0097620_100940446 | 3300006931 | Bacteria | 948 |
| 433 | Ga0079104_1002834 | 3300006946 | Bacteria | 8719 |
| 434 | Ga0079104_1004884 | 3300006946 | Bacteria | 5543 |
| 435 | Ga0099826_10000040 | 3300006948 | Bacteria | 98176 |
| 436 | Ga0099826_10013124 | 3300006948 | Bacteria | 6255 |
| 437 | Ga0099826_10154666 | 3300006948 | Bacteria | 1308 |
| 438 | Ga0099794_10031348 | 3300007265 | Bacteria | 2488 |
| 439 | Ga0099794_10156085 | 3300007265 | Bacteria | 1160 |
| 440 | Ga0099794_10275053 | 3300007265 | Bacteria | 870 |
| 441 | Ga0099795_10047082 | 3300007788 | Bacteria | 1557 |
| 442 | Ga0099795_10071229 | 3300007788 | Bacteria | 1312 |
| 443 | Ga0099795_10314917 | 3300007788 | Bacteria | 691 |
| 444 | Ga0105251_10421297 | 3300009011 | Bacteria | 616 |
| 445 | Ga0105244_10260270 | 3300009036 | Bacteria | 807 |
| 446 | Ga0105250_10038075 | 3300009092 | Bacteria | 1929 |
| 447 | Ga0105250_10051849 | 3300009092 | Bacteria | 1645 |
| 448 | Ga0105250_10195860 | 3300009092 | Bacteria | 851 |
| 449 | Ga0105250_10386922 | 3300009092 | Bacteria | 618 |
| 450 | Ga0105240_10016396 | 3300009093 | Bacteria | 10032 |
| 451 | Ga0105240_10038936 | 3300009093 | Bacteria | 6094 |
| 452 | Ga0105240_10076364 | 3300009093 | Bacteria | 4130 |
| 453 | Ga0105240_10117780 | 3300009093 | Bacteria | 3202 |
| 454 | Ga0105240_10275568 | 3300009093 | Bacteria | 1935 |
| 455 | Ga0105240_11056313 | 3300009093 | Bacteria | 866 |
| 456 | Ga0105240_11119653 | 3300009093 | Bacteria | 837 |
| 457 | Ga0105240_11330344 | 3300009093 | Bacteria | 757 |
| 458 | Ga0105240_11973457 | 3300009093 | Bacteria | 607 |
| 459 | Ga0105240_12603742 | 3300009093 | Bacteria | 523 |
| 460 | Ga0111539_10365680 | 3300009094 | Bacteria | 1679 |
| 461 | Ga0111539_12143718 | 3300009094 | Bacteria | 648 |
| 462 | Ga0105245_10255993 | 3300009098 | Bacteria | 1702 |
| 463 | Ga0105245_10382719 | 3300009098 | Bacteria | 1401 |
| 464 | Ga0105245_10661227 | 3300009098 | Bacteria | 1076 |
| 465 | Ga0105245_11210102 | 3300009098 | Bacteria | 803 |
| 466 | Ga0105245_11390540 | 3300009098 | Bacteria | 752 |
| 467 | Ga0105245_12418004 | 3300009098 | Bacteria | 579 |
| 468 | Ga0105245_13127780 | 3300009098 | Bacteria | 513 |
| 469 | Ga0105247_10083415 | 3300009101 | Bacteria | 2018 |
| 470 | Ga0105247_10406813 | 3300009101 | Bacteria | 971 |
| 471 | Ga0105247_10407874 | 3300009101 | Bacteria | 970 |
| 472 | Ga0105247_10488703 | 3300009101 | Bacteria | 895 |
| 473 | Ga0105247_10823433 | 3300009101 | Bacteria | 710 |
| 474 | Ga0114129_10829415 | 3300009147 | Bacteria | 1177 |
| 475 | Ga0105243_10279507 | 3300009148 | Bacteria | 1503 |
| 476 | Ga0105243_10387961 | 3300009148 | Bacteria | 1294 |
| 477 | Ga0105243_10625283 | 3300009148 | Bacteria | 1040 |
| 478 | Ga0105243_11182451 | 3300009148 | Bacteria | 777 |
| 479 | Ga0105241_10161174 | 3300009174 | Bacteria | 1844 |
| 480 | Ga0105241_10490543 | 3300009174 | Bacteria | 1094 |
| 481 | Ga0105241_10941055 | 3300009174 | Bacteria | 805 |
| 482 | Ga0105241_10974714 | 3300009174 | Bacteria | 792 |
| 483 | Ga0105241_11519992 | 3300009174 | Bacteria | 645 |
| 484 | Ga0105241_11520199 | 3300009174 | Bacteria | 645 |
| 485 | Ga0105241_12035785 | 3300009174 | Bacteria | 566 |
| 486 | Ga0105242_10401881 | 3300009176 | Bacteria | 1279 |
| 487 | Ga0105242_11596121 | 3300009176 | Bacteria | 686 |
| 488 | Ga0105248_10065542 | 3300009177 | Bacteria | 4078 |
| 489 | Ga0105248_10123749 | 3300009177 | Bacteria | 2917 |
| 490 | Ga0105248_10837738 | 3300009177 | Bacteria | 1038 |
| 491 | Ga0105248_11259711 | 3300009177 | Bacteria | 836 |
| 492 | Ga0105248_11528483 | 3300009177 | Bacteria | 756 |
| 493 | Ga0105248_13106904 | 3300009177 | Bacteria | 528 |
| 494 | Ga0105237_10009263 | 3300009545 | Bacteria | 10554 |
| 495 | Ga0105237_10055965 | 3300009545 | Bacteria | 3949 |
| 496 | Ga0105237_10086048 | 3300009545 | Bacteria | 3133 |
| 497 | Ga0105237_10155143 | 3300009545 | Bacteria | 2286 |
| 498 | Ga0105237_10229457 | 3300009545 | Bacteria | 1857 |
| 499 | Ga0105237_10695272 | 3300009545 | Bacteria | 1023 |
| 500 | Ga0105237_11361988 | 3300009545 | Bacteria | 716 |
| 501 | Ga0105237_12543513 | 3300009545 | Bacteria | 522 |
| 502 | Ga0105237_12715303 | 3300009545 | Bacteria | 506 |
| 503 | Ga0105238_10000586 | 3300009551 | Bacteria | 38241 |
| 504 | Ga0105238_10008521 | 3300009551 | Bacteria | 10262 |
| 505 | Ga0105238_10043599 | 3300009551 | Bacteria | 4539 |
| 506 | Ga0105238_10079916 | 3300009551 | Bacteria | 3259 |
| 507 | Ga0105238_10233792 | 3300009551 | Bacteria | 1815 |
| 508 | Ga0105238_10631627 | 3300009551 | Bacteria | 1080 |
| 509 | Ga0105238_10692192 | 3300009551 | Bacteria | 1031 |
| 510 | Ga0105238_10805939 | 3300009551 | Bacteria | 955 |
| 511 | Ga0105238_11913949 | 3300009551 | Bacteria | 626 |
| 512 | Ga0105238_12460429 | 3300009551 | Bacteria | 556 |
| 513 | Ga0105238_13036591 | 3300009551 | Bacteria | 504 |
| 514 | Ga0105249_10628591 | 3300009553 | Bacteria | 1130 |
| 515 | Ga0105249_11183471 | 3300009553 | Bacteria | 835 |
| 516 | Ga0105249_11562792 | 3300009553 | Bacteria | 732 |
| 517 | Ga0105249_13416319 | 3300009553 | Bacteria | 511 |
| 518 | Ga0099796_10154089 | 3300010159 | Bacteria | 907 |
| 519 | Ga0099796_10449343 | 3300010159 | Bacteria | 573 |
| 520 | Ga0099796_10461234 | 3300010159 | Bacteria | 566 |
| 521 | Ga0099796_10465944 | 3300010159 | Bacteria | 564 |
| 522 | Ga0105239_10077487 | 3300010375 | Bacteria | 3658 |
| 523 | Ga0105239_10079462 | 3300010375 | Bacteria | 3609 |
| 524 | Ga0105239_10190814 | 3300010375 | Bacteria | 2293 |
| 525 | Ga0105239_10259657 | 3300010375 | Bacteria | 1952 |
| 526 | Ga0105239_10273508 | 3300010375 | Bacteria | 1900 |
| 527 | Ga0105239_10340603 | 3300010375 | Bacteria | 1692 |
| 528 | Ga0105239_10374440 | 3300010375 | Bacteria | 1610 |
| 529 | Ga0105239_11119395 | 3300010375 | Bacteria | 907 |
| 530 | Ga0105239_11604850 | 3300010375 | Bacteria | 752 |
| 531 | Ga0105239_11929401 | 3300010375 | Bacteria | 685 |
| 532 | Ga0105239_11982474 | 3300010375 | Bacteria | 676 |
| 533 | Ga0105246_10064102 | 3300011119 | Bacteria | 2566 |
| 534 | Ga0105246_10222943 | 3300011119 | Bacteria | 1479 |
| 535 | Ga0105246_10327631 | 3300011119 | Bacteria | 1247 |
| 536 | Ga0105246_10482571 | 3300011119 | Bacteria | 1049 |
| 537 | Ga0105246_11774398 | 3300011119 | Bacteria | 589 |
| 538 | Ga0157319_1023130 | 3300012497 | Bacteria | 620 |
| 539 | Ga0157314_1002158 | 3300012500 | Bacteria | 1361 |
| 540 | Ga0157326_1032763 | 3300012513 | Bacteria | 696 |
| 541 | Ga0157326_1100258 | 3300012513 | Bacteria | 500 |
| 542 | Ga0154010_157882 | 3300013062 | Bacteria | 600 |
| 543 | Ga0157373_10066042 | 3300013100 | Bacteria | 2560 |
| 544 | Ga0157373_10107862 | 3300013100 | Bacteria | 1958 |
| 545 | Ga0157373_10731187 | 3300013100 | Bacteria | 727 |
| 546 | Ga0157373_10813394 | 3300013100 | Bacteria | 690 |
| 547 | Ga0157371_10002849 | 3300013102 | Bacteria | 16156 |
| 548 | Ga0157371_10860734 | 3300013102 | Bacteria | 686 |
| 549 | Ga0157370_10004657 | 3300013104 | Bacteria | 15662 |
| 550 | Ga0157370_10015115 | 3300013104 | Bacteria | 7863 |
| 551 | Ga0157370_10042298 | 3300013104 | Bacteria | 4392 |
| 552 | Ga0157370_10225131 | 3300013104 | Bacteria | 1736 |
| 553 | Ga0157370_11133646 | 3300013104 | Bacteria | 706 |
| 554 | Ga0157370_12055904 | 3300013104 | Bacteria | 512 |
| 555 | Ga0157369_10003351 | 3300013105 | Bacteria | 19026 |
| 556 | Ga0157369_10029343 | 3300013105 | Bacteria | 6079 |
| 557 | Ga0157369_10058855 | 3300013105 | Bacteria | 4144 |
| 558 | Ga0157369_10144676 | 3300013105 | Bacteria | 2514 |
| 559 | Ga0157369_10772610 | 3300013105 | Bacteria | 988 |
| 560 | Ga0157369_10797558 | 3300013105 | Bacteria | 970 |
| 561 | Ga0157369_11200497 | 3300013105 | Bacteria | 774 |
| 562 | Ga0171463_1003 | 3300013249 | Bacteria | 695693 |
| 563 | Ga0157374_10310684 | 3300013296 | Bacteria | 1561 |
| 564 | Ga0157374_10376181 | 3300013296 | Bacteria | 1414 |
| 565 | Ga0157374_10457756 | 3300013296 | Bacteria | 1278 |
| 566 | Ga0157374_11085245 | 3300013296 | Bacteria | 821 |
| 567 | Ga0157374_11336775 | 3300013296 | Bacteria | 739 |
| 568 | Ga0157374_12059028 | 3300013296 | Bacteria | 597 |
| 569 | Ga0157374_12916675 | 3300013296 | Bacteria | 505 |
| 570 | Ga0157378_10014660 | 3300013297 | Bacteria | 6864 |
| 571 | Ga0157378_10911924 | 3300013297 | Bacteria | 910 |
| 572 | Ga0157378_11010873 | 3300013297 | Bacteria | 866 |
| 573 | Ga0157378_11016669 | 3300013297 | Bacteria | 864 |
| 574 | Ga0157378_11725166 | 3300013297 | Bacteria | 673 |
| 575 | Ga0157378_11776161 | 3300013297 | Bacteria | 665 |
| 576 | Ga0157378_12831116 | 3300013297 | Bacteria | 537 |
| 577 | Ga0163162_10060142 | 3300013306 | Bacteria | 3833 |
| 578 | Ga0163162_10202905 | 3300013306 | Bacteria | 2112 |
| 579 | Ga0163162_11102854 | 3300013306 | Bacteria | 899 |
| 580 | Ga0163162_11533273 | 3300013306 | Bacteria | 759 |
| 581 | Ga0163162_11951395 | 3300013306 | Bacteria | 672 |
| 582 | Ga0163162_12300561 | 3300013306 | Bacteria | 619 |
| 583 | Ga0157372_10145791 | 3300013307 | Bacteria | 2730 |
| 584 | Ga0157372_10489221 | 3300013307 | Bacteria | 1434 |
| 585 | Ga0157372_10582434 | 3300013307 | Bacteria | 1304 |
| 586 | Ga0157372_11446328 | 3300013307 | Bacteria | 792 |
| 587 | Ga0157372_12490391 | 3300013307 | Bacteria | 594 |
| 588 | Ga0157372_12902104 | 3300013307 | Bacteria | 549 |
| 589 | Ga0157372_13310479 | 3300013307 | Bacteria | 513 |
| 590 | Ga0157375_11585474 | 3300013308 | Bacteria | 774 |
| 591 | Ga0157375_13464937 | 3300013308 | Bacteria | 525 |
| 592 | Ga0163163_10003826 | 3300014325 | Bacteria | 12814 |
| 593 | Ga0163163_10018613 | 3300014325 | Bacteria | 6506 |
| 594 | Ga0163163_11558662 | 3300014325 | Bacteria | 722 |
| 595 | Ga0163163_13025160 | 3300014325 | Bacteria | 524 |
| 596 | Ga0157380_10192376 | 3300014326 | Bacteria | 1802 |
| 597 | Ga0157380_10748488 | 3300014326 | Bacteria | 988 |
| 598 | Ga0157380_10902202 | 3300014326 | Bacteria | 910 |
| 599 | Ga0182008_10508635 | 3300014497 | Bacteria | 663 |
| 600 | Ga0182008_10830994 | 3300014497 | Bacteria | 538 |
| 601 | Ga0157377_10449732 | 3300014745 | Bacteria | 889 |
| 602 | Ga0157377_11310966 | 3300014745 | Bacteria | 566 |
| 603 | Ga0157379_10161603 | 3300014968 | Bacteria | 2022 |
| 604 | Ga0157379_10194905 | 3300014968 | Bacteria | 1831 |
| 605 | Ga0157379_10205386 | 3300014968 | Bacteria | 1782 |
| 606 | Ga0157379_10235462 | 3300014968 | Bacteria | 1660 |
| 607 | Ga0157376_10290978 | 3300014969 | Bacteria | 1542 |
| 608 | Ga0157376_10578972 | 3300014969 | Bacteria | 1115 |
| 609 | Ga0157376_10792461 | 3300014969 | Bacteria | 960 |
| 610 | Ga0157376_10986277 | 3300014969 | Bacteria | 864 |
| 611 | Ga0157376_11431980 | 3300014969 | Bacteria | 723 |
| 612 | Ga0157376_11944450 | 3300014969 | Bacteria | 625 |
| 613 | Ga0157376_11962462 | 3300014969 | Bacteria | 623 |
| 614 | Ga0183365_11929 | 3300015684 | Bacteria | 748 |
| 615 | Ga0183363_1168 | 3300015690 | Bacteria | 15051 |
| 616 | Ga0163161_10454435 | 3300017792 | Bacteria | 1036 |
| 617 | Ga0184603_100425 | 3300019192 | Bacteria | 527 |
| 618 | Ga0206356_10018687 | 3300020070 | Bacteria | 642 |
| 619 | Ga0206351_10069610 | 3300020077 | Bacteria | 701 |
| 620 | Ga0206354_10465592 | 3300020081 | Bacteria | 859 |
| 621 | Ga0154015_1351868 | 3300020610 | Bacteria | 585 |
| 622 | Ga0214544_1000646 | 3300021320 | Bacteria | 66087 |
| 623 | Ga0214542_1000027 | 3300021321 | Bacteria | 175107 |
| 624 | Ga0214543_1000047 | 3300021327 | Bacteria | 150894 |
| 625 | Ga0214543_1002177 | 3300021327 | Bacteria | 38571 |
| 626 | Ga0213872_10058728 | 3300021361 | Bacteria | 1741 |
| 627 | Ga0213876_10000865 | 3300021384 | Bacteria | 20256 |
| 628 | Ga0213876_10035923 | 3300021384 | Bacteria | 2614 |
| 629 | Ga0213875_10053600 | 3300021388 | Bacteria | 1889 |
| 630 | Ga0213871_10294354 | 3300021441 | Bacteria | 523 |
| 631 | Ga0224712_10615057 | 3300022467 | Bacteria | 531 |
| 632 | Ga0228711_1006836 | 3300022739 | Bacteria | 16770 |
| 633 | Ga0228710_1006916 | 3300022740 | Bacteria | 16965 |
| 634 | Ga0228598_1057208 | 3300024227 | Bacteria | 775 |
| 635 | Ga0209435_100022 | 3300025206 | Bacteria | 207766 |
| 636 | Ga0209435_100086 | 3300025206 | Bacteria | 45054 |
| 637 | Ga0209436_100016 | 3300025208 | Bacteria | 117496 |
| 638 | Ga0209436_134582 | 3300025208 | Bacteria | 508 |
| 639 | Ga0209563_104597 | 3300025230 | Bacteria | 2617 |
| 640 | Ga0209563_106926 | 3300025230 | Bacteria | 1904 |
| 641 | Ga0207427_120023 | 3300025231 | Bacteria | 606 |
| 642 | Ga0209437_100022 | 3300025233 | Bacteria | 625694 |
| 643 | Ga0209437_100067 | 3300025233 | Bacteria | 317685 |
| 644 | Ga0207425_1000012 | 3300025245 | Bacteria | 528324 |
| 645 | Ga0207425_1000032 | 3300025245 | Bacteria | 253689 |
| 646 | Ga0207425_1003086 | 3300025245 | Bacteria | 5507 |
| 647 | Ga0207425_1006874 | 3300025245 | Bacteria | 3070 |
| 648 | Ga0209646_1000078 | 3300025246 | Bacteria | 207766 |
| 649 | Ga0209646_1000279 | 3300025246 | Bacteria | 45163 |
| 650 | Ga0209646_1004843 | 3300025246 | Bacteria | 2414 |
| 651 | Ga0209646_1010572 | 3300025246 | Bacteria | 1444 |
| 652 | Ga0209026_1000065 | 3300025250 | Bacteria | 207766 |
| 653 | Ga0209026_1000089 | 3300025250 | Bacteria | 175907 |
| 654 | Ga0209026_1000341 | 3300025250 | Bacteria | 45163 |
| 655 | Ga0209148_1003572 | 3300025254 | Bacteria | 4204 |
| 656 | Ga0209148_1006083 | 3300025254 | Bacteria | 2659 |
| 657 | Ga0209148_1041685 | 3300025254 | Bacteria | 632 |
| 658 | Ga0209759_1000055 | 3300025256 | Bacteria | 207766 |
| 659 | Ga0209759_1000471 | 3300025256 | Bacteria | 45163 |
| 660 | Ga0209759_1000539 | 3300025256 | Bacteria | 39826 |
| 661 | Ga0209759_1013305 | 3300025256 | Bacteria | 2233 |
| 662 | Ga0209759_1027489 | 3300025256 | Bacteria | 1174 |
| 663 | Ga0209129_1000056 | 3300025258 | Bacteria | 253689 |
| 664 | Ga0209129_1000166 | 3300025258 | Bacteria | 97875 |
| 665 | Ga0209129_1000453 | 3300025258 | Bacteria | 30523 |
| 666 | Ga0209129_1001565 | 3300025258 | Bacteria | 12562 |
| 667 | Ga0209129_1002345 | 3300025258 | Bacteria | 9370 |
| 668 | Ga0209233_1000010 | 3300025261 | Bacteria | 1194329 |
| 669 | Ga0209233_1000031 | 3300025261 | Bacteria | 624646 |
| 670 | Ga0209233_1000088 | 3300025261 | Bacteria | 317980 |
| 671 | Ga0209565_1050572 | 3300025263 | Bacteria | 747 |
| 672 | Ga0209455_1008214 | 3300025272 | Bacteria | 2859 |
| 673 | Ga0209455_1036213 | 3300025272 | Bacteria | 787 |
| 674 | Ga0209673_1001400 | 3300025273 | Bacteria | 23490 |
| 675 | Ga0209673_1002430 | 3300025273 | Bacteria | 12947 |
| 676 | Ga0209673_1005708 | 3300025273 | Bacteria | 6206 |
| 677 | Ga0209673_1007049 | 3300025273 | Bacteria | 5273 |
| 678 | Ga0209673_1017468 | 3300025273 | Bacteria | 2643 |
| 679 | Ga0209673_1047925 | 3300025273 | Bacteria | 1155 |
| 680 | Ga0209130_1000049 | 3300025284 | Bacteria | 226841 |
| 681 | Ga0209130_1000264 | 3300025284 | Bacteria | 65849 |
| 682 | Ga0209130_1001049 | 3300025284 | Bacteria | 20972 |
| 683 | Ga0209675_1001620 | 3300025291 | Bacteria | 12656 |
| 684 | Ga0209676_1002997 | 3300025292 | Bacteria | 10988 |
| 685 | Ga0209025_1000016 | 3300025294 | Bacteria | 770739 |
| 686 | Ga0209025_1000024 | 3300025294 | Bacteria | 528324 |
| 687 | Ga0209025_1000090 | 3300025294 | Bacteria | 253689 |
| 688 | Ga0209025_1000336 | 3300025294 | Bacteria | 103514 |
| 689 | Ga0209025_1000374 | 3300025294 | Bacteria | 93607 |
| 690 | Ga0209025_1000917 | 3300025294 | Bacteria | 45335 |
| 691 | Ga0209025_1001912 | 3300025294 | Bacteria | 24208 |
| 692 | Ga0209025_1003123 | 3300025294 | Bacteria | 16204 |
| 693 | Ga0209025_1059125 | 3300025294 | Bacteria | 1449 |
| 694 | Ga0209025_1060690 | 3300025294 | Bacteria | 1417 |
| 695 | Ga0209564_1000023 | 3300025295 | Bacteria | 555102 |
| 696 | Ga0209564_1000354 | 3300025295 | Bacteria | 85718 |
| 697 | Ga0209564_1000403 | 3300025295 | Bacteria | 76834 |
| 698 | Ga0209564_1002352 | 3300025295 | Bacteria | 15256 |
| 699 | Ga0209564_1002912 | 3300025295 | Bacteria | 12455 |
| 700 | Ga0209758_1000084 | 3300025297 | Bacteria | 256346 |
| 701 | Ga0209758_1000150 | 3300025297 | Bacteria | 163494 |
| 702 | Ga0209758_1000383 | 3300025297 | Bacteria | 76487 |
| 703 | Ga0209758_1000396 | 3300025297 | Bacteria | 75453 |
| 704 | Ga0209758_1001244 | 3300025297 | Bacteria | 31708 |
| 705 | Ga0209758_1001532 | 3300025297 | Bacteria | 26653 |
| 706 | Ga0209758_1018391 | 3300025297 | Bacteria | 3426 |
| 707 | Ga0209758_1023867 | 3300025297 | Bacteria | 2748 |
| 708 | Ga0209050_1006153 | 3300025298 | Bacteria | 7222 |
| 709 | Ga0209256_1000042 | 3300025299 | Bacteria | 341821 |
| 710 | Ga0209256_1000176 | 3300025299 | Bacteria | 126545 |
| 711 | Ga0209256_1000436 | 3300025299 | Bacteria | 64360 |
| 712 | Ga0209256_1001515 | 3300025299 | Bacteria | 23483 |
| 713 | Ga0209256_1001769 | 3300025299 | Bacteria | 20511 |
| 714 | Ga0209256_1029391 | 3300025299 | Bacteria | 1533 |
| 715 | Ga0207426_1000140 | 3300025302 | Bacteria | 195664 |
| 716 | Ga0207426_1003465 | 3300025302 | Bacteria | 8537 |
| 717 | Ga0207426_1008701 | 3300025302 | Bacteria | 4069 |
| 718 | Ga0209051_1000202 | 3300025303 | Bacteria | 106010 |
| 719 | Ga0209051_1002097 | 3300025303 | Bacteria | 14992 |
| 720 | Ga0209051_1002339 | 3300025303 | Bacteria | 13731 |
| 721 | Ga0209051_1047889 | 3300025303 | Bacteria | 1455 |
| 722 | Ga0209257_1002210 | 3300025304 | Bacteria | 20082 |
| 723 | Ga0209257_1026228 | 3300025304 | Bacteria | 1969 |
| 724 | Ga0207697_10469124 | 3300025315 | Bacteria | 557 |
| 725 | Ga0207656_10289265 | 3300025321 | Bacteria | 809 |
| 726 | Ga0207692_10800031 | 3300025898 | Bacteria | 616 |
| 727 | Ga0207642_11108421 | 3300025899 | Bacteria | 512 |
| 728 | Ga0207710_10752476 | 3300025900 | Bacteria | 512 |
| 729 | Ga0207688_10038101 | 3300025901 | Bacteria | 2668 |
| 730 | Ga0207680_10457350 | 3300025903 | Bacteria | 906 |
| 731 | Ga0207647_10020192 | 3300025904 | Bacteria | 4471 |
| 732 | Ga0207647_10787280 | 3300025904 | Bacteria | 512 |
| 733 | Ga0207685_10599264 | 3300025905 | Bacteria | 591 |
| 734 | Ga0207699_10184842 | 3300025906 | Bacteria | 1403 |
| 735 | Ga0207699_11316213 | 3300025906 | Bacteria | 535 |
| 736 | Ga0207645_10124466 | 3300025907 | Bacteria | 1675 |
| 737 | Ga0207645_10314810 | 3300025907 | Bacteria | 1043 |
| 738 | Ga0207643_10366596 | 3300025908 | Bacteria | 906 |
| 739 | Ga0207705_10314146 | 3300025909 | Bacteria | 1203 |
| 740 | Ga0207705_10461712 | 3300025909 | Bacteria | 985 |
| 741 | Ga0207705_10483989 | 3300025909 | Bacteria | 961 |
| 742 | Ga0207684_10540691 | 3300025910 | Bacteria | 997 |
| 743 | Ga0207684_10558079 | 3300025910 | Bacteria | 979 |
| 744 | Ga0207684_10876246 | 3300025910 | Bacteria | 756 |
| 745 | Ga0207654_10122105 | 3300025911 | Bacteria | 1637 |
| 746 | Ga0207707_10001548 | 3300025912 | Bacteria | 21188 |
| 747 | Ga0207695_10026590 | 3300025913 | Bacteria | 6458 |
| 748 | Ga0207695_10031741 | 3300025913 | Bacteria | 5788 |
| 749 | Ga0207695_10234865 | 3300025913 | Bacteria | 1736 |
| 750 | Ga0207695_10360149 | 3300025913 | Bacteria | 1341 |
| 751 | Ga0207671_10128696 | 3300025914 | Bacteria | 1942 |
| 752 | Ga0207671_10253836 | 3300025914 | Bacteria | 1383 |
| 753 | Ga0207671_10321150 | 3300025914 | Bacteria | 1225 |
| 754 | Ga0207671_10376419 | 3300025914 | Bacteria | 1128 |
| 755 | Ga0207663_10472981 | 3300025916 | Bacteria | 970 |
| 756 | Ga0207663_11149460 | 3300025916 | Bacteria | 624 |
| 757 | Ga0207660_10235674 | 3300025917 | Bacteria | 1440 |
| 758 | Ga0207662_10163992 | 3300025918 | Bacteria | 1421 |
| 759 | Ga0207657_10003813 | 3300025919 | Bacteria | 16023 |
| 760 | Ga0207657_10637474 | 3300025919 | Bacteria | 830 |
| 761 | Ga0207649_11587350 | 3300025920 | Bacteria | 518 |
| 762 | Ga0207652_10807821 | 3300025921 | Bacteria | 833 |
| 763 | Ga0207652_10948362 | 3300025921 | Bacteria | 758 |
| 764 | Ga0207646_10052931 | 3300025922 | Bacteria | 3632 |
| 765 | Ga0207681_10895929 | 3300025923 | Bacteria | 743 |
| 766 | Ga0207681_11489412 | 3300025923 | Bacteria | 567 |
| 767 | Ga0207694_10005521 | 3300025924 | Bacteria | 9700 |
| 768 | Ga0207694_10082752 | 3300025924 | Bacteria | 2523 |
| 769 | Ga0207694_11634681 | 3300025924 | Bacteria | 543 |
| 770 | Ga0207650_10413734 | 3300025925 | Bacteria | 1118 |
| 771 | Ga0207659_10729929 | 3300025926 | Bacteria | 849 |
| 772 | Ga0207687_10302241 | 3300025927 | Bacteria | 1289 |
| 773 | Ga0207664_10185455 | 3300025929 | Bacteria | 1788 |
| 774 | Ga0207644_10715100 | 3300025931 | Bacteria | 836 |
| 775 | Ga0207644_11575578 | 3300025931 | Bacteria | 551 |
| 776 | Ga0207690_10230621 | 3300025932 | Bacteria | 1421 |
| 777 | Ga0207690_10782027 | 3300025932 | Bacteria | 788 |
| 778 | Ga0207706_10241537 | 3300025933 | Bacteria | 1579 |
| 779 | Ga0207686_11122443 | 3300025934 | Bacteria | 642 |
| 780 | Ga0207686_11264160 | 3300025934 | Bacteria | 605 |
| 781 | Ga0207709_10038819 | 3300025935 | Bacteria | 2839 |
| 782 | Ga0207670_10177137 | 3300025936 | Bacteria | 1603 |
| 783 | Ga0207670_11308611 | 3300025936 | Bacteria | 615 |
| 784 | Ga0207669_10093822 | 3300025937 | Bacteria | 1962 |
| 785 | Ga0207669_10179754 | 3300025937 | Bacteria | 1515 |
| 786 | Ga0207669_10645044 | 3300025937 | Bacteria | 865 |
| 787 | Ga0207704_10077449 | 3300025938 | Bacteria | 2135 |
| 788 | Ga0207704_10407950 | 3300025938 | Bacteria | 1074 |
| 789 | Ga0207665_10097692 | 3300025939 | Bacteria | 2045 |
| 790 | Ga0207691_10162516 | 3300025940 | Bacteria | 1958 |
| 791 | Ga0207691_10255411 | 3300025940 | Bacteria | 1512 |
| 792 | Ga0207691_10412390 | 3300025940 | Bacteria | 1151 |
| 793 | Ga0207689_10030772 | 3300025942 | Bacteria | 4472 |
| 794 | Ga0207689_10534510 | 3300025942 | Bacteria | 984 |
| 795 | Ga0207661_10137427 | 3300025944 | Bacteria | 2100 |
| 796 | Ga0207679_10374629 | 3300025945 | Bacteria | 1247 |
| 797 | Ga0207667_10086152 | 3300025949 | Bacteria | 3251 |
| 798 | Ga0207667_10593244 | 3300025949 | Bacteria | 1118 |
| 799 | Ga0207667_10806942 | 3300025949 | Bacteria | 935 |
| 800 | Ga0207651_10744256 | 3300025960 | Bacteria | 866 |
| 801 | Ga0207651_10848228 | 3300025960 | Bacteria | 812 |
| 802 | Ga0207651_11090557 | 3300025960 | Bacteria | 715 |
| 803 | Ga0207712_11310577 | 3300025961 | Bacteria | 647 |
| 804 | Ga0207668_10416394 | 3300025972 | Bacteria | 1139 |
| 805 | Ga0207668_10652805 | 3300025972 | Bacteria | 921 |
| 806 | Ga0207668_10667885 | 3300025972 | Bacteria | 911 |
| 807 | Ga0207668_10833030 | 3300025972 | Bacteria | 818 |
| 808 | Ga0207668_10853263 | 3300025972 | Bacteria | 808 |
| 809 | Ga0207668_11609372 | 3300025972 | Bacteria | 586 |
| 810 | Ga0207668_11942410 | 3300025972 | Bacteria | 530 |
| 811 | Ga0207658_10044456 | 3300025986 | Bacteria | 3234 |
| 812 | Ga0207677_12269250 | 3300026023 | Bacteria | 505 |
| 813 | Ga0207677_12285938 | 3300026023 | Bacteria | 503 |
| 814 | Ga0207703_10178567 | 3300026035 | Bacteria | 1872 |
| 815 | Ga0207703_11341514 | 3300026035 | Bacteria | 688 |
| 816 | Ga0207703_11596577 | 3300026035 | Bacteria | 627 |
| 817 | Ga0207703_11942697 | 3300026035 | Bacteria | 565 |
| 818 | Ga0207639_10009172 | 3300026041 | Bacteria | 6818 |
| 819 | Ga0207639_10152599 | 3300026041 | Bacteria | 1936 |
| 820 | Ga0207678_10187943 | 3300026067 | Bacteria | 1765 |
| 821 | Ga0207678_10446427 | 3300026067 | Bacteria | 1124 |
| 822 | Ga0207678_10479257 | 3300026067 | Bacteria | 1083 |
| 823 | Ga0207678_11083002 | 3300026067 | Bacteria | 710 |
| 824 | Ga0207708_10303663 | 3300026075 | Bacteria | 1299 |
| 825 | Ga0207708_10371502 | 3300026075 | Bacteria | 1177 |
| 826 | Ga0207702_10000546 | 3300026078 | Bacteria | 42023 |
| 827 | Ga0207702_10004644 | 3300026078 | Bacteria | 12146 |
| 828 | Ga0207702_10033523 | 3300026078 | Bacteria | 4290 |
| 829 | Ga0207702_11287383 | 3300026078 | Bacteria | 725 |
| 830 | Ga0207702_11878437 | 3300026078 | Bacteria | 590 |
| 831 | Ga0207641_10506513 | 3300026088 | Bacteria | 1173 |
| 832 | Ga0207648_10438622 | 3300026089 | Bacteria | 1188 |
| 833 | Ga0207648_10736609 | 3300026089 | Bacteria | 915 |
| 834 | Ga0207648_12159564 | 3300026089 | Bacteria | 518 |
| 835 | Ga0207674_10030653 | 3300026116 | Bacteria | 5654 |
| 836 | Ga0207674_10268667 | 3300026116 | Bacteria | 1653 |
| 837 | Ga0207674_11154109 | 3300026116 | Bacteria | 744 |
| 838 | Ga0207674_11305657 | 3300026116 | Bacteria | 695 |
| 839 | Ga0207675_100080427 | 3300026118 | Bacteria | 3055 |
| 840 | Ga0207675_100281434 | 3300026118 | Bacteria | 1616 |
| 841 | Ga0207683_10057053 | 3300026121 | Bacteria | 3427 |
| 842 | Ga0207683_10211177 | 3300026121 | Bacteria | 1767 |
| 843 | Ga0207698_10053786 | 3300026142 | Bacteria | 3093 |
| 844 | Ga0207698_10520190 | 3300026142 | Bacteria | 1161 |
| 845 | Ga0207698_10568603 | 3300026142 | Bacteria | 1114 |
| 846 | Ga0207698_11418138 | 3300026142 | Bacteria | 710 |
| 847 | Ga0209281_1000106 | 3300027111 | Bacteria | 219666 |
| 848 | Ga0209281_1000426 | 3300027111 | Bacteria | 62651 |
| 849 | Ga0209371_1000003 | 3300027312 | Bacteria | 1122971 |
| 850 | Ga0209371_1000990 | 3300027312 | Bacteria | 21859 |
| 851 | Ga0209371_1008618 | 3300027312 | Bacteria | 3356 |
| 852 | Ga0209179_1100768 | 3300027512 | Bacteria | 643 |
| 853 | Ga0209282_1000083 | 3300027666 | Bacteria | 70247 |
| 854 | Ga0209282_1000167 | 3300027666 | Bacteria | 37134 |
| 855 | Ga0209282_1044704 | 3300027666 | Bacteria | 2596 |
| 856 | Ga0209588_1016674 | 3300027671 | Bacteria | 2271 |
| 857 | Ga0209588_1067862 | 3300027671 | Bacteria | 1152 |
| 858 | Ga0209813_10183950 | 3300027866 | Bacteria | 766 |
| 859 | Ga0207428_10087187 | 3300027907 | Bacteria | 2429 |
| 860 | Ga0268266_10011520 | 3300028379 | Bacteria | 7678 |
| 861 | Ga0268266_10021951 | 3300028379 | Bacteria | 5440 |
| 862 | Ga0268266_10041638 | 3300028379 | Bacteria | 3920 |
| 863 | Ga0268266_10232819 | 3300028379 | Bacteria | 1697 |
| 864 | Ga0268266_10242298 | 3300028379 | Bacteria | 1665 |
| 865 | Ga0268266_10297658 | 3300028379 | Bacteria | 1504 |
| 866 | Ga0268266_10442705 | 3300028379 | Bacteria | 1234 |
| 867 | Ga0268266_10649621 | 3300028379 | Bacteria | 1015 |
| 868 | Ga0268266_11502122 | 3300028379 | Bacteria | 649 |
| 869 | Ga0268265_10200832 | 3300028380 | Bacteria | 1729 |
| 870 | Ga0268265_10643265 | 3300028380 | Bacteria | 1018 |
| 871 | Ga0268265_12427940 | 3300028380 | Bacteria | 530 |
| 872 | Ga0268264_11514417 | 3300028381 | Bacteria | 681 |
| 873 | Ga0265334_10065282 | 3300028573 | Bacteria | 1365 |
| 874 | Ga0307517_10289775 | 3300028786 | Bacteria | 926 |
| 875 | Ga0307515_10002180 | 3300028794 | Bacteria | 42989 |
| 876 | Ga0307515_10162439 | 3300028794 | Bacteria | 2270 |
| 877 | Ga0307515_10189868 | 3300028794 | Bacteria | 1969 |
| 878 | Ga0268256_1000004 | 3300030500 | Bacteria | 1122967 |
| 879 | Ga0268256_1000571 | 3300030500 | Bacteria | 29712 |
| 880 | Ga0268256_1009027 | 3300030500 | Bacteria | 3356 |
| 881 | Ga0316181_1012064 | 3300030744 | Bacteria | 4601 |
| 882 | Ga0265762_1056251 | 3300030760 | Bacteria | 800 |
| 883 | Ga0265763_1020674 | 3300030763 | Bacteria | 690 |
| 884 | Ga0265764_116286 | 3300030882 | Bacteria | 515 |
| 885 | Ga0265761_105536 | 3300030889 | Bacteria | 662 |
| 886 | Ga0265760_10035293 | 3300031090 | Bacteria | 1480 |
| 887 | Ga0265760_10091973 | 3300031090 | Bacteria | 950 |
| 888 | Ga0265760_10209769 | 3300031090 | Bacteria | 661 |
| 889 | Ga0265760_10355728 | 3300031090 | Bacteria | 524 |
| 890 | Ga0265330_10040535 | 3300031235 | Bacteria | 2068 |
| 891 | Ga0265330_10069394 | 3300031235 | Bacteria | 1526 |
| 892 | Ga0265332_10219582 | 3300031238 | Bacteria | 788 |
| 893 | Ga0265328_10072620 | 3300031239 | Bacteria | 1265 |
| 894 | Ga0265320_10148836 | 3300031240 | Bacteria | 1058 |
| 895 | Ga0265325_10476155 | 3300031241 | Bacteria | 542 |
| 896 | Ga0265329_10144457 | 3300031242 | Bacteria | 769 |
| 897 | Ga0265340_10004702 | 3300031247 | Bacteria | 7593 |
| 898 | Ga0265339_10002135 | 3300031249 | Bacteria | 14404 |
| 899 | Ga0265316_10047181 | 3300031344 | Bacteria | 3408 |
| 900 | Ga0265316_10384691 | 3300031344 | Bacteria | 1012 |
| 901 | Ga0307513_10953235 | 3300031456 | Bacteria | 567 |
| 902 | Ga0307408_100275327 | 3300031548 | Bacteria | 1399 |
| 903 | Ga0265313_10005700 | 3300031595 | Bacteria | 9082 |
| 904 | Ga0265313_10052844 | 3300031595 | Bacteria | 1937 |
| 905 | Ga0265342_10006876 | 3300031712 | Bacteria | 8406 |
| 906 | Ga0307516_10140743 | 3300031730 | Bacteria | 2183 |
| 907 | Ga0307516_10243085 | 3300031730 | Bacteria | 1498 |
| 908 | Ga0307405_10000482 | 3300031731 | Bacteria | 14958 |
| 909 | Ga0307405_10072659 | 3300031731 | Bacteria | 2218 |
| 910 | Ga0307405_10193704 | 3300031731 | Bacteria | 1470 |
| 911 | Ga0307405_12050864 | 3300031731 | Bacteria | 513 |
| 912 | Ga0307413_10644764 | 3300031824 | Bacteria | 873 |
| 913 | Ga0307406_10114120 | 3300031901 | Bacteria | 1865 |
| 914 | Ga0307406_10361519 | 3300031901 | Bacteria | 1138 |
| 915 | Ga0307406_11194383 | 3300031901 | Bacteria | 660 |
| 916 | Ga0307406_11327832 | 3300031901 | Bacteria | 628 |
| 917 | Ga0307407_11138994 | 3300031903 | Bacteria | 608 |
| 918 | Ga0307412_10165722 | 3300031911 | Bacteria | 1647 |
| 919 | Ga0307412_10465998 | 3300031911 | Bacteria | 1044 |
| 920 | Ga0307412_11425315 | 3300031911 | Bacteria | 628 |
| 921 | Ga0307412_11928336 | 3300031911 | Bacteria | 546 |
| 922 | Ga0315914_1002550 | 3300031967 | Bacteria | 27863 |
| 923 | Ga0307409_100794824 | 3300031995 | Bacteria | 953 |
| 924 | Ga0307409_101436686 | 3300031995 | Bacteria | 716 |
| 925 | Ga0307416_100247550 | 3300032002 | Bacteria | 1732 |
| 926 | Ga0307416_100515546 | 3300032002 | Bacteria | 1263 |
| 927 | Ga0307416_102907326 | 3300032002 | Bacteria | 573 |
| 928 | Ga0307414_10588713 | 3300032004 | Bacteria | 996 |
| 929 | Ga0307414_12178587 | 3300032004 | Bacteria | 518 |
| 930 | Ga0307415_100305987 | 3300032126 | Bacteria | 1319 |
| 931 | Ga0307415_100857311 | 3300032126 | Bacteria | 834 |
| 932 | Ga0307510_10000908 | 3300033180 | Bacteria | 31266 |
| 933 | Ga0315913_1001274 | 3300033430 | Bacteria | 27225 |
| 934 | Ga0315915_1000010 | 3300033464 | Bacteria | 240214 |
| 935 | Ga0316592_1108090 | 3300033524 | Bacteria | 642 |
| 936 | Ga0316586_1102401 | 3300033527 | Bacteria | 548 |
| 937 | Ga0373926_0195151 | 3300035083 | Bacteria | 778 |
| 938 | Ga0373929_0268048 | 3300035085 | Bacteria | 501 |
| 939 | Ga0373934_0003991 | 3300035086 | Bacteria | 5432 |
| 940 | Ga0373934_0195445 | 3300035086 | Bacteria | 832 |
| 941 | Ga0373934_0238184 | 3300035086 | Bacteria | 751 |
| 942 | Ga0373944_0448344 | 3300035089 | Bacteria | 503 |
| 943 | Ga0373923_0032731 | 3300035111 | Bacteria | 2101 |
| 944 | Ga0373923_0033929 | 3300035111 | Bacteria | 2069 |
| 945 | Ga0373936_0009309 | 3300035113 | Bacteria | 3700 |
| 946 | Ga0373936_0041934 | 3300035113 | Bacteria | 1836 |
| 947 | Ga0373936_0177635 | 3300035113 | Bacteria | 933 |
| 948 | Ga0373936_0324084 | 3300035113 | Bacteria | 698 |
| 949 | Ga0373941_0540805 | 3300035115 | Bacteria | 500 |
| 950 | Ga0373945_0011814 | 3300035116 | Bacteria | 2892 |
| 951 | Ga0373945_0179700 | 3300035116 | Bacteria | 870 |
| 952 | Ga0373945_0564359 | 3300035116 | Bacteria | 512 |
| 953 | Ga0373953_0000428 | 3300035117 | Bacteria | 11481 |
| 954 | Ga0373953_0002249 | 3300035117 | Bacteria | 5794 |
| 955 | Ga0373954_0000096 | 3300035118 | Bacteria | 29585 |
| 956 | Ga0373954_0001427 | 3300035118 | Bacteria | 9689 |
| 957 | Ga0373954_0101679 | 3300035118 | Bacteria | 1387 |
| 958 | Ga0373956_0000452 | 3300035119 | Bacteria | 16781 |
| 959 | Ga0373956_0010045 | 3300035119 | Bacteria | 3863 |
| 960 | Ga0373957_0000472 | 3300035120 | Bacteria | 10170 |
| 961 | Ga0373957_0004660 | 3300035120 | Bacteria | 4190 |
| 962 | Ga0373957_0152452 | 3300035120 | Bacteria | 949 |
| 963 | Ga0373943_0000777 | 3300035170 | Bacteria | 13945 |
| 964 | Ga0373943_0054685 | 3300035170 | Bacteria | 1975 |
| 965 | Ga0373946_0189125 | 3300035171 | Bacteria | 981 |
| 966 | Ga0373955_0004288 | 3300035172 | Bacteria | 6298 |
| 967 | Ga0373955_0020206 | 3300035172 | Bacteria | 3345 |
| 968 | Ga0373955_0020557 | 3300035172 | Bacteria | 3320 |
| 969 | Ga0373955_0048964 | 3300035172 | Bacteria | 2293 |
| 970 | Ga0373924_0017494 | 3300035410 | Bacteria | 2751 |
| 971 | Ga0373924_0027795 | 3300035410 | Bacteria | 2251 |
| 972 | Ga0373924_0029306 | 3300035410 | Bacteria | 2199 |
| 973 | Ga0373924_0407551 | 3300035410 | Bacteria | 608 |
| 974 | Ga0373935_0000251 | 3300035692 | Bacteria | 26431 |
| 975 | Ga0373935_0034983 | 3300035692 | Bacteria | 3134 |
| 976 | Ga0373935_0124310 | 3300035692 | Bacteria | 1727 |
| 977 | Ga0373935_0195258 | 3300035692 | Bacteria | 1396 |
| 978 | Ga0373935_0375420 | 3300035692 | Bacteria | 1017 |
| 979 | Ga0373927_0000074 | 3300035695 | Bacteria | 72943 |
| 980 | Ga0373927_0005560 | 3300035695 | Bacteria | 8667 |
| 981 | Ga0373927_0007493 | 3300035695 | Bacteria | 7380 |
| 982 | Ga0373927_0015747 | 3300035695 | Bacteria | 4991 |
| 983 | Ga0373927_0272776 | 3300035695 | Bacteria | 1112 |
| 984 | Ga0373927_0742355 | 3300035695 | Bacteria | 648 |
| 985 | Ga0373933_0014530 | 3300035724 | Bacteria | 4381 |
| 986 | Ga0373933_0016964 | 3300035724 | Bacteria | 4081 |
| 987 | Ga0373933_0513331 | 3300035724 | Bacteria | 785 |
| 988 | Ga0373947_0001064 | 3300035725 | Bacteria | 16792 |
| 989 | Ga0373947_0016295 | 3300035725 | Bacteria | 4272 |
| 990 | Ga0373947_0083971 | 3300035725 | Bacteria | 1976 |
| 991 | Ga0373947_0403375 | 3300035725 | Bacteria | 922 |
| 992 | Ga0373937_0006552 | 3300036401 | Bacteria | 10058 |
| 993 | Ga0373937_0021873 | 3300036401 | Bacteria | 5742 |
| 994 | Ga0373937_0083215 | 3300036401 | Bacteria | 2960 |
| 995 | Ga0373937_0200728 | 3300036401 | Bacteria | 1875 |
| 996 | Ga0373937_1082155 | 3300036401 | Bacteria | 750 |
| 997 | Ga0373925_0001364 | 3300037068 | Bacteria | 21294 |
| 998 | Ga0373925_0002665 | 3300037068 | Bacteria | 14170 |
| 999 | Ga0373925_0112710 | 3300037068 | Bacteria | 2103 |
| 1000 | Ga0373925_0860384 | 3300037068 | Bacteria | 747 |
| 1001 | Ga0395899_0000217 | 3300037312 | Bacteria | 80044 |
| 1002 | Ga0395900_0000270 | 3300037418 | Bacteria | 80046 |
| 1003 | Ga0395900_0245470 | 3300037418 | Bacteria | 1794 |
| 1004 | Ga0395900_0303078 | 3300037418 | Bacteria | 1583 |
| 1005 | Ga0395900_0414198 | 3300037418 | Bacteria | 1309 |
| 1006 | Ga0395900_0979486 | 3300037418 | Bacteria | 766 |
| 1007 | Ga0395898_0000470 | 3300037466 | Bacteria | 80783 |
| 1008 | Ga0395898_0101804 | 3300037466 | Bacteria | 2758 |
| 1009 | Ga0395905_0000253 | 3300037471 | Bacteria | 80046 |
| 1010 | Ga0395905_0048715 | 3300037471 | Bacteria | 3970 |
| 1011 | Ga0395905_0290864 | 3300037471 | Bacteria | 1520 |
| 1012 | Ga0395905_0722324 | 3300037471 | Bacteria | 898 |
| 1013 | Ga0395905_1215535 | 3300037471 | Bacteria | 657 |
| 1014 | Ga0436364_0651817 | 3300037853 | Bacteria | 2612 |
| 1015 | Ga0395901_0002922 | 3300038443 | Bacteria | 17251 |
| 1016 | Ga0395901_0023878 | 3300038443 | Bacteria | 6271 |
| 1017 | Ga0395901_0419545 | 3300038443 | Bacteria | 1372 |
| 1018 | Ga0395901_0578115 | 3300038443 | Bacteria | 1135 |
| 1019 | Ga0400483_048591 | 3300039062 | Bacteria | 1716 |
| 1020 | Ga0400483_170970 | 3300039062 | Bacteria | 18881 |
| 1021 | Ga0400483_241924 | 3300039062 | Bacteria | 1826 |
| 1022 | Ga0436365_1865485 | 3300039437 | Bacteria | 3146 |
| 1023 | Ga0436365_1892130 | 3300039437 | Bacteria | 1190 |
| 1024 | Ga0436360_0012434 | 3300039438 | Bacteria | 685 |
| 1025 | Ga0436361_1090572 | 3300039447 | Bacteria | 3438 |
| 1026 | Ga0439465_0039012 | 3300041413 | Bacteria | 1532 |
| 1027 | Ga0439465_0079945 | 3300041413 | Bacteria | 1107 |
| 1028 | Ga0439465_0124953 | 3300041413 | Bacteria | 904 |
| 1029 | Ga0439465_0165409 | 3300041413 | Bacteria | 795 |
| 1030 | Ga0451787_496701 | 3300041441 | Bacteria | 1203 |
| 1031 | Ga0451801_03670 | 3300041455 | Bacteria | 549 |
| 1032 | Ga0451800_0127875 | 3300041459 | Bacteria | 573 |
| 1033 | Ga0451800_0697454 | 3300041459 | Bacteria | 541 |
| 1034 | Ga0451802_1735530 | 3300041460 | Bacteria | 502 |
| 1035 | Ga0451833_0730984 | 3300041491 | Bacteria | 726 |
| 1036 | Ga0451835_0230868 | 3300041492 | Bacteria | 501 |
| 1037 | Ga0451849_1043510 | 3300041505 | Bacteria | 630 |
| 1038 | Ga0451855_0029132 | 3300041511 | Bacteria | 586 |
| 1039 | Ga0451853_1360697 | 3300041512 | Bacteria | 535 |
| 1040 | Ga0451853_2612147 | 3300041512 | Bacteria | 661 |
| 1041 | Ga0452268_09526 | 3300041907 | Bacteria | 522 |
| 1042 | Ga0439431_0149061 | 3300041997 | Bacteria | 664 |
| 1043 | Ga0439445_0207797 | 3300042004 | Bacteria | 579 |
| 1044 | Ga0439445_0231528 | 3300042004 | Bacteria | 550 |
| 1045 | Ga0439432_051122 | 3300042006 | Bacteria | 1289 |
| 1046 | Ga0439462_0149295 | 3300042015 | Bacteria | 657 |
| 1047 | Ga0450923_088673 | 3300042125 | Bacteria | 703 |
| 1048 | Ga0450900_080592 | 3300042136 | Bacteria | 523 |
| 1049 | Ga0450902_070321 | 3300042137 | Bacteria | 610 |
| 1050 | Ga0439434_0080586 | 3300042435 | Bacteria | 1033 |
| 1051 | Ga0439434_0207908 | 3300042435 | Bacteria | 661 |
| 1052 | Ga0466972_0027947 | 3300044658 | Bacteria | 2787 |
| 1053 | Ga0466965_0618337 | 3300044683 | Bacteria | 616 |
| 1054 | Ga0466968_0078165 | 3300044735 | Bacteria | 1450 |
| 1055 | Ga0466968_0085724 | 3300044735 | Bacteria | 1390 |
| 1056 | Ga0466970_0770781 | 3300044765 | Bacteria | 563 |
| 1057 | Ga0466960_0063323 | 3300044901 | Bacteria | 1820 |
| 1058 | Ga0495617_009338 | 3300046452 | Bacteria | 3366 |
| 1059 | Ga0495592_0012453 | 3300046454 | Bacteria | 6460 |
| 1060 | Ga0495592_0026565 | 3300046454 | Bacteria | 4388 |
| 1061 | Ga0495592_0129265 | 3300046454 | Bacteria | 1768 |
| 1062 | Ga0495592_0631062 | 3300046454 | Bacteria | 651 |
| 1063 | Ga0495603_0000208 | 3300046455 | Bacteria | 30287 |
| 1064 | Ga0495603_0002458 | 3300046455 | Bacteria | 10897 |
| 1065 | Ga0495603_0030037 | 3300046455 | Bacteria | 3274 |
| 1066 | Ga0495590_0038159 | 3300046457 | Bacteria | 1674 |
| 1067 | Ga0495590_0337127 | 3300046457 | Bacteria | 571 |
| 1068 | Ga0495629_0000216 | 3300046459 | Bacteria | 51517 |
| 1069 | Ga0495629_0001181 | 3300046459 | Bacteria | 20620 |
| 1070 | Ga0495629_0017800 | 3300046459 | Bacteria | 5093 |
| 1071 | Ga0495638_0003832 | 3300046460 | Bacteria | 11675 |
| 1072 | Ga0495638_0017927 | 3300046460 | Bacteria | 4711 |
| 1073 | Ga0495638_0081801 | 3300046460 | Bacteria | 1959 |
| 1074 | Ga0495638_0584049 | 3300046460 | Bacteria | 551 |
| 1075 | Ga0495641_0001151 | 3300046461 | Bacteria | 22739 |
| 1076 | Ga0495641_0050675 | 3300046461 | Bacteria | 1897 |
| 1077 | Ga0495651_0022957 | 3300046462 | Bacteria | 4851 |
| 1078 | Ga0495651_0087175 | 3300046462 | Bacteria | 2348 |
| 1079 | Ga0495651_0090122 | 3300046462 | Bacteria | 2300 |
| 1080 | Ga0495653_0001775 | 3300046463 | Bacteria | 17020 |
| 1081 | Ga0495653_0052490 | 3300046463 | Bacteria | 3124 |
| 1082 | Ga0495650_0027634 | 3300046471 | Bacteria | 2618 |
| 1083 | Ga0495650_0034475 | 3300046471 | Bacteria | 2240 |
| 1084 | Ga0495650_0040206 | 3300046471 | Bacteria | 2011 |
| 1085 | Ga0495580_0003553 | 3300046472 | Bacteria | 13243 |
| 1086 | Ga0495580_0419342 | 3300046472 | Bacteria | 901 |
| 1087 | Ga0495582_0000311 | 3300046473 | Bacteria | 26740 |
| 1088 | Ga0495582_0082986 | 3300046473 | Bacteria | 1781 |
| 1089 | Ga0495605_0134183 | 3300046474 | Bacteria | 1114 |
| 1090 | Ga0495639_0000395 | 3300046475 | Bacteria | 20621 |
| 1091 | Ga0495639_0031163 | 3300046475 | Bacteria | 2373 |
| 1092 | Ga0495662_0000259 | 3300046476 | Bacteria | 22394 |
| 1093 | Ga0495662_0522403 | 3300046476 | Bacteria | 582 |
| 1094 | Ga0495664_0007806 | 3300046477 | Bacteria | 5955 |
| 1095 | Ga0495664_0090710 | 3300046477 | Bacteria | 1837 |
| 1096 | Ga0495664_0574492 | 3300046477 | Bacteria | 671 |
| 1097 | Ga0495664_0784699 | 3300046477 | Bacteria | 560 |
| 1098 | Ga0495584_0096587 | 3300046491 | Bacteria | 1492 |
| 1099 | Ga0495584_0330744 | 3300046491 | Bacteria | 774 |
| 1100 | Ga0495585_0110883 | 3300046492 | Bacteria | 1459 |
| 1101 | Ga0495585_0155899 | 3300046492 | Bacteria | 1188 |
| 1102 | Ga0495594_0000272 | 3300046499 | Bacteria | 25431 |
| 1103 | Ga0495594_0031294 | 3300046499 | Bacteria | 2884 |
| 1104 | Ga0495594_0055421 | 3300046499 | Bacteria | 2186 |
| 1105 | Ga0495596_0070770 | 3300046500 | Bacteria | 1355 |
| 1106 | Ga0495607_0101871 | 3300046501 | Bacteria | 1537 |
| 1107 | Ga0495606_0030274 | 3300046507 | Bacteria | 3784 |
| 1108 | Ga0495606_0468081 | 3300046507 | Bacteria | 642 |
| 1109 | Ga0495606_0524117 | 3300046507 | Bacteria | 594 |
| 1110 | Ga0495608_0001705 | 3300046511 | Bacteria | 15778 |
| 1111 | Ga0495608_0143472 | 3300046511 | Bacteria | 1523 |
| 1112 | Ga0495608_0200299 | 3300046511 | Bacteria | 1258 |
| 1113 | Ga0495610_0002231 | 3300046512 | Bacteria | 16389 |
| 1114 | Ga0495610_0002393 | 3300046512 | Bacteria | 15800 |
| 1115 | Ga0495616_0073369 | 3300046513 | Bacteria | 1651 |
| 1116 | Ga0495618_0002323 | 3300046514 | Bacteria | 12311 |
| 1117 | Ga0495618_0081179 | 3300046514 | Bacteria | 2070 |
| 1118 | Ga0495620_0232938 | 3300046515 | Bacteria | 704 |
| 1119 | Ga0495628_0044858 | 3300046516 | Bacteria | 3515 |
| 1120 | Ga0495628_0068594 | 3300046516 | Bacteria | 2766 |
| 1121 | Ga0495628_0140726 | 3300046516 | Bacteria | 1841 |
| 1122 | Ga0495628_0462694 | 3300046516 | Bacteria | 920 |
| 1123 | Ga0495630_0000820 | 3300046517 | Bacteria | 21887 |
| 1124 | Ga0495630_0052865 | 3300046517 | Bacteria | 3041 |
| 1125 | Ga0495630_0188804 | 3300046517 | Bacteria | 1572 |
| 1126 | Ga0495630_1445099 | 3300046517 | Bacteria | 517 |
| 1127 | Ga0495631_0042096 | 3300046518 | Bacteria | 2019 |
| 1128 | Ga0495631_0098942 | 3300046518 | Bacteria | 1255 |
| 1129 | Ga0495631_0384483 | 3300046518 | Bacteria | 597 |
| 1130 | Ga0495632_0002224 | 3300046519 | Bacteria | 14967 |
| 1131 | Ga0495632_0016291 | 3300046519 | Bacteria | 4141 |
| 1132 | Ga0495632_0259824 | 3300046519 | Bacteria | 777 |
| 1133 | Ga0495637_0145697 | 3300046520 | Bacteria | 896 |
| 1134 | Ga0495643_0040480 | 3300046522 | Bacteria | 2546 |
| 1135 | Ga0495643_0156057 | 3300046522 | Bacteria | 1126 |
| 1136 | Ga0495644_0080056 | 3300046523 | Bacteria | 1231 |
| 1137 | Ga0495648_0006515 | 3300046524 | Bacteria | 9516 |
| 1138 | Ga0495648_0065290 | 3300046524 | Bacteria | 2140 |
| 1139 | Ga0495648_0084732 | 3300046524 | Bacteria | 1793 |
| 1140 | Ga0495663_0014069 | 3300046525 | Bacteria | 2241 |
| 1141 | Ga0495663_0019623 | 3300046525 | Bacteria | 1937 |
| 1142 | Ga0495663_0057692 | 3300046525 | Bacteria | 1215 |
| 1143 | Ga0495666_0188905 | 3300046526 | Bacteria | 949 |
| 1144 | Ga0495642_0381141 | 3300046528 | Bacteria | 621 |
| 1145 | Ga0495652_0010856 | 3300046529 | Bacteria | 8252 |
| 1146 | Ga0495652_0038453 | 3300046529 | Bacteria | 4145 |
| 1147 | Ga0495652_0627066 | 3300046529 | Bacteria | 730 |
| 1148 | Ga0495654_0001294 | 3300046530 | Bacteria | 17558 |
| 1149 | Ga0495654_0074371 | 3300046530 | Bacteria | 1605 |
| 1150 | Ga0495654_0357306 | 3300046530 | Bacteria | 586 |
| 1151 | Ga0495665_0006722 | 3300046531 | Bacteria | 6200 |
| 1152 | Ga0495665_0393296 | 3300046531 | Bacteria | 703 |
| 1153 | Ga0495640_0012590 | 3300046533 | Bacteria | 6458 |
| 1154 | Ga0495640_0022779 | 3300046533 | Bacteria | 4574 |
| 1155 | Ga0495640_0028987 | 3300046533 | Bacteria | 3979 |
| 1156 | Ga0495586_0066223 | 3300046535 | Bacteria | 1970 |
| 1157 | Ga0495586_0436771 | 3300046535 | Bacteria | 754 |
| 1158 | Ga0495587_0001236 | 3300046536 | Bacteria | 16943 |
| 1159 | Ga0495587_0016699 | 3300046536 | Bacteria | 4565 |
| 1160 | Ga0495598_0015362 | 3300046537 | Bacteria | 1932 |
| 1161 | Ga0495598_0019716 | 3300046537 | Bacteria | 1772 |
| 1162 | Ga0495609_0055515 | 3300046538 | Bacteria | 1757 |
| 1163 | Ga0495609_0239193 | 3300046538 | Bacteria | 750 |
| 1164 | Ga0495621_0008718 | 3300046539 | Bacteria | 3050 |
| 1165 | Ga0495597_0014017 | 3300046542 | Bacteria | 3828 |
| 1166 | Ga0495597_0159731 | 3300046542 | Bacteria | 920 |
| 1167 | Ga0495645_0028470 | 3300046543 | Bacteria | 4060 |
| 1168 | Ga0495645_0051544 | 3300046543 | Bacteria | 2994 |
| 1169 | Ga0495622_0003774 | 3300046557 | Bacteria | 7085 |
| 1170 | Ga0495622_0022348 | 3300046557 | Bacteria | 2947 |
| 1171 | Ga0495633_0058244 | 3300046558 | Bacteria | 1813 |
| 1172 | Ga0495633_0192950 | 3300046558 | Bacteria | 936 |
| 1173 | Ga0495667_0021654 | 3300046559 | Bacteria | 4338 |
| 1174 | Ga0495667_0057976 | 3300046559 | Bacteria | 2544 |
| 1175 | Ga0495667_0205769 | 3300046559 | Bacteria | 1258 |
| 1176 | Ga0495656_0002847 | 3300046615 | Bacteria | 5795 |
| 1177 | Ga0495656_0012766 | 3300046615 | Bacteria | 3108 |
| 1178 | Ga0495656_0099730 | 3300046615 | Bacteria | 1341 |
| 1179 | Ga0495668_0013820 | 3300046616 | Bacteria | 4748 |
| 1180 | Ga0495668_0075775 | 3300046616 | Bacteria | 1847 |
| 1181 | Ga0495668_0212800 | 3300046616 | Bacteria | 1058 |
| 1182 | Ga0495634_0001816 | 3300046642 | Bacteria | 18416 |
| 1183 | Ga0495634_0022564 | 3300046642 | Bacteria | 4434 |
| 1184 | Ga0495634_0046348 | 3300046642 | Bacteria | 2934 |
| 1185 | Ga0495611_0393796 | 3300046648 | Bacteria | 633 |
| 1186 | Ga0495625_0061712 | 3300046660 | Bacteria | 2652 |
| 1187 | Ga0495625_0148119 | 3300046660 | Bacteria | 1579 |
| 1188 | Ga0495625_0189866 | 3300046660 | Bacteria | 1362 |
| 1189 | Ga0495625_0335331 | 3300046660 | Bacteria | 959 |
| 1190 | Ga0495625_0655067 | 3300046660 | Bacteria | 625 |
| 1191 | Ga0495625_0885160 | 3300046660 | Bacteria | 513 |
| 1192 | Ga0495635_0000392 | 3300046663 | Bacteria | 27895 |
| 1193 | Ga0495635_0000913 | 3300046663 | Bacteria | 19383 |
| 1194 | Ga0495635_0013724 | 3300046663 | Bacteria | 5669 |
| 1195 | Ga0495635_0890859 | 3300046663 | Bacteria | 570 |
| 1196 | Ga0495659_0010639 | 3300046664 | Bacteria | 2958 |
| 1197 | Ga0495661_0191126 | 3300046665 | Bacteria | 1078 |
| 1198 | Ga0495588_0012713 | 3300046674 | Bacteria | 3987 |
| 1199 | Ga0495588_0025063 | 3300046674 | Bacteria | 2969 |
| 1200 | Ga0495588_0131282 | 3300046674 | Bacteria | 1321 |
| 1201 | Ga0495588_0145658 | 3300046674 | Bacteria | 1252 |
| 1202 | Ga0495588_0672244 | 3300046674 | Bacteria | 542 |
| 1203 | Ga0495657_0017255 | 3300046675 | Bacteria | 5244 |
| 1204 | Ga0495657_0057220 | 3300046675 | Bacteria | 2593 |
| 1205 | Ga0495657_0264147 | 3300046675 | Bacteria | 1033 |
| 1206 | Ga0495599_0022199 | 3300046678 | Bacteria | 3961 |
| 1207 | Ga0495599_0039450 | 3300046678 | Bacteria | 2967 |
| 1208 | Ga0495599_0687111 | 3300046678 | Bacteria | 591 |
| 1209 | Ga0495623_0005202 | 3300046679 | Bacteria | 8535 |
| 1210 | Ga0495623_0143454 | 3300046679 | Bacteria | 1418 |
| 1211 | Ga0495646_0011455 | 3300046680 | Bacteria | 5629 |
| 1212 | Ga0495646_0011689 | 3300046680 | Bacteria | 5581 |
| 1213 | Ga0495647_0000430 | 3300046681 | Bacteria | 12037 |
| 1214 | Ga0495658_0001021 | 3300046683 | Bacteria | 14800 |
| 1215 | Ga0495613_0021060 | 3300046689 | Bacteria | 4860 |
| 1216 | Ga0495613_0046810 | 3300046689 | Bacteria | 3197 |
| 1217 | Ga0495613_0595391 | 3300046689 | Bacteria | 736 |
| 1218 | Ga0495624_0001716 | 3300046690 | Bacteria | 16747 |
| 1219 | Ga0495624_0246670 | 3300046690 | Bacteria | 1080 |
| 1220 | Ga0495624_0625971 | 3300046690 | Bacteria | 641 |
| 1221 | Ga0495624_0704503 | 3300046690 | Bacteria | 599 |
| 1222 | Ga0495670_0046299 | 3300046691 | Bacteria | 2172 |
| 1223 | Ga0495670_0101183 | 3300046691 | Bacteria | 1484 |
| 1224 | Ga0495671_0135119 | 3300046692 | Bacteria | 1202 |
| 1225 | Ga0495671_0212299 | 3300046692 | Bacteria | 938 |
| 1226 | Ga0495649_0161965 | 3300046694 | Bacteria | 1172 |
| 1227 | Ga0495589_0090919 | 3300046794 | Bacteria | 1482 |
| 1228 | Ga0495600_0013868 | 3300046809 | Bacteria | 5075 |
| 1229 | Ga0495600_0054637 | 3300046809 | Bacteria | 2608 |
| 1230 | Ga0495600_0064160 | 3300046809 | Bacteria | 2401 |
| 1231 | Ga0495660_0178542 | 3300046810 | Bacteria | 1029 |
| 1232 | Ga0495581_0000559 | 3300047315 | Bacteria | 19297 |
| 1233 | Ga0495581_0297773 | 3300047315 | Bacteria | 943 |
| 1234 | Ga0495604_0010363 | 3300047317 | Bacteria | 7382 |
| 1235 | Ga0495604_0011190 | 3300047317 | Bacteria | 7124 |
| 1236 | Ga0495636_0124834 | 3300047318 | Bacteria | 1141 |
| 1237 | Ga0495674_0001216 | 3300047319 | Bacteria | 24946 |
| 1238 | Ga0495674_0012665 | 3300047319 | Bacteria | 7949 |
| 1239 | Ga0495674_0070782 | 3300047319 | Bacteria | 3013 |
| 1240 | Ga0495674_0476187 | 3300047319 | Bacteria | 1001 |
| 1241 | Ga0495674_1054639 | 3300047319 | Bacteria | 621 |
| 1242 | Ga0495674_1485784 | 3300047319 | Bacteria | 502 |
| 1243 | Ga0495672_0256285 | 3300047320 | Bacteria | 846 |
| 1244 | Ga0495672_0527303 | 3300047320 | Bacteria | 521 |
| 1245 | Ga0495676_0013658 | 3300047321 | Bacteria | 7288 |
| 1246 | Ga0495676_0056178 | 3300047321 | Bacteria | 3115 |
| 1247 | Ga0495680_0041225 | 3300047322 | Bacteria | 3672 |
| 1248 | Ga0495680_0252145 | 3300047322 | Bacteria | 1250 |
| 1249 | Ga0495675_0005490 | 3300047444 | Bacteria | 7736 |
| 1250 | Ga0495675_0544420 | 3300047444 | Bacteria | 662 |
| 1251 | Ga0495677_0085011 | 3300047445 | Bacteria | 1188 |
| 1252 | Ga0495677_0169532 | 3300047445 | Bacteria | 844 |
| 1253 | Ga0495685_040561 | 3300047447 | Bacteria | 1592 |
| 1254 | Ga0495673_0048086 | 3300047469 | Bacteria | 1882 |
| 1255 | Ga0495673_0055147 | 3300047469 | Bacteria | 1725 |
| 1256 | Ga0495673_0152210 | 3300047469 | Bacteria | 893 |
| 1257 | Ga0495673_0202116 | 3300047469 | Bacteria | 743 |
| 1258 | Ga0495673_0209976 | 3300047469 | Bacteria | 725 |
| 1259 | Ga0495681_0244518 | 3300047470 | Bacteria | 711 |
| 1260 | Ga0495681_0247833 | 3300047470 | Bacteria | 704 |
| 1261 | Ga0495684_0002174 | 3300047471 | Bacteria | 15708 |
| 1262 | Ga0495684_0012372 | 3300047471 | Bacteria | 6582 |
| 1263 | Ga0495684_0070557 | 3300047471 | Bacteria | 2656 |
| 1264 | Ga0495686_0003677 | 3300047472 | Bacteria | 13109 |
| 1265 | Ga0495686_0025883 | 3300047472 | Bacteria | 3842 |
| 1266 | Ga0495686_0026151 | 3300047472 | Bacteria | 3819 |
| 1267 | Ga0495686_0328385 | 3300047472 | Bacteria | 837 |
| 1268 | Ga0495593_0000100 | 3300047673 | Bacteria | 39337 |
| 1269 | Ga0495593_0000132 | 3300047673 | Bacteria | 35973 |
| 1270 | Ga0495602_0013942 | 3300048088 | Bacteria | 8189 |
| 1271 | Ga0495602_0027269 | 3300048088 | Bacteria | 5492 |
| 1272 | Ga0495602_0175408 | 3300048088 | Bacteria | 1659 |
| 1273 | Ga0495614_0022088 | 3300048089 | Bacteria | 2747 |
| 1274 | Ga0495615_0114452 | 3300048090 | Bacteria | 775 |
| 1275 | Ga0495615_0313995 | 3300048090 | Bacteria | 510 |
| 1276 | Ga0495626_0132922 | 3300048091 | Bacteria | 1061 |
| 1277 | Ga0496100_0228189 | 3300048903 | Bacteria | 1369 |
| 1278 | Ga0496100_0298806 | 3300048903 | Bacteria | 1205 |
| 1279 | Ga0496100_0992456 | 3300048903 | Bacteria | 661 |
| 1280 | Ga0496101_0587486 | 3300048904 | Bacteria | 881 |
| 1281 | Ga0496102_0561544 | 3300048905 | Bacteria | 1064 |
| 1282 | Ga0496102_0709223 | 3300048905 | Bacteria | 929 |
| 1283 | Ga0496102_1202640 | 3300048905 | Bacteria | 677 |
| 1284 | Ga0496103_0118156 | 3300048906 | Bacteria | 1688 |
| 1285 | Ga0496103_1057417 | 3300048906 | Bacteria | 503 |
| 1286 | Ga0496104_0650771 | 3300048907 | Bacteria | 963 |
| 1287 | Ga0496106_0113204 | 3300048909 | Bacteria | 2115 |
| 1288 | Ga0496107_0761783 | 3300048910 | Bacteria | 710 |
| 1289 | Ga0496108_0327470 | 3300048911 | Bacteria | 1336 |
| 1290 | Ga0496108_1410217 | 3300048911 | Bacteria | 582 |
| 1291 | Ga0496109_0599125 | 3300048912 | Bacteria | 1038 |
| 1292 | Ga0496110_0380724 | 3300048913 | Bacteria | 1286 |
| 1293 | Ga0496110_0438288 | 3300048913 | Bacteria | 1191 |
| 1294 | Ga0496110_1024342 | 3300048913 | Bacteria | 733 |
| 1295 | Ga0496112_0537352 | 3300048915 | Bacteria | 1103 |
| 1296 | Ga0496113_0079189 | 3300048916 | Bacteria | 2515 |
| 1297 | Ga0496114_1052057 | 3300048917 | Bacteria | 698 |
| 1298 | Ga0496114_1070575 | 3300048917 | Bacteria | 691 |
| 1299 | Ga0496115_0088436 | 3300048918 | Bacteria | 2529 |
| 1300 | Ga0496115_0153163 | 3300048918 | Bacteria | 1904 |
| 1301 | Ga0496115_0188888 | 3300048918 | Bacteria | 1702 |
| 1302 | Ga0496115_0504776 | 3300048918 | Bacteria | 971 |
| 1303 | Ga0496115_0640362 | 3300048918 | Bacteria | 841 |
| 1304 | Ga0496115_1110982 | 3300048918 | Bacteria | 599 |
| 1305 | Ga0496116_0000036 | 3300048919 | Bacteria | 388508 |
| 1306 | Ga0496116_0002794 | 3300048919 | Bacteria | 17923 |
| 1307 | Ga0496116_0007250 | 3300048919 | Bacteria | 9881 |
| 1308 | Ga0496116_0021310 | 3300048919 | Bacteria | 4892 |
| 1309 | Ga0496116_0174178 | 3300048919 | Bacteria | 1161 |
| 1310 | Ga0496116_0321765 | 3300048919 | Bacteria | 724 |
| 1311 | Ga0496117_0010131 | 3300048920 | Bacteria | 8654 |
| 1312 | Ga0496117_0013726 | 3300048920 | Bacteria | 7039 |
| 1313 | Ga0496117_0054538 | 3300048920 | Bacteria | 2800 |
| 1314 | Ga0496117_0104782 | 3300048920 | Bacteria | 1779 |
| 1315 | Ga0496117_0123294 | 3300048920 | Bacteria | 1587 |
| 1316 | Ga0496117_0149818 | 3300048920 | Bacteria | 1383 |
| 1317 | Ga0496117_0170664 | 3300048920 | Bacteria | 1263 |
| 1318 | Ga0496117_0376488 | 3300048920 | Bacteria | 724 |
| 1319 | Ga0496118_0007062 | 3300048921 | Bacteria | 12070 |
| 1320 | Ga0496118_0023486 | 3300048921 | Bacteria | 5354 |
| 1321 | Ga0496118_0038896 | 3300048921 | Bacteria | 3805 |
| 1322 | Ga0496118_0113625 | 3300048921 | Bacteria | 1788 |
| 1323 | Ga0496118_0226790 | 3300048921 | Bacteria | 1082 |
| 1324 | Ga0496118_0465007 | 3300048921 | Bacteria | 638 |
| 1325 | Ga0496118_0571167 | 3300048921 | Bacteria | 547 |
| 1326 | Ga0496119_0005479 | 3300048922 | Bacteria | 12138 |
| 1327 | Ga0496119_0021490 | 3300048922 | Bacteria | 4664 |
| 1328 | Ga0496119_0027654 | 3300048922 | Bacteria | 3892 |
| 1329 | Ga0496119_0034617 | 3300048922 | Bacteria | 3322 |
| 1330 | Ga0496119_0043581 | 3300048922 | Bacteria | 2833 |
| 1331 | Ga0496119_0051300 | 3300048922 | Bacteria | 2536 |
| 1332 | Ga0496119_0072593 | 3300048922 | Bacteria | 2010 |
| 1333 | Ga0496119_0078576 | 3300048922 | Bacteria | 1908 |
| 1334 | Ga0496119_0217818 | 3300048922 | Bacteria | 978 |
| 1335 | Ga0496119_0328292 | 3300048922 | Bacteria | 747 |
| 1336 | Ga0496119_0400113 | 3300048922 | Bacteria | 655 |
| 1337 | Ga0496119_0408209 | 3300048922 | Bacteria | 647 |
| 1338 | Ga0496120_0025241 | 3300048923 | Bacteria | 3691 |
| 1339 | Ga0496120_0097482 | 3300048923 | Bacteria | 1560 |
| 1340 | Ga0496120_0133494 | 3300048923 | Bacteria | 1268 |
| 1341 | Ga0496120_0321289 | 3300048923 | Bacteria | 703 |
| 1342 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 1343 | Ga0496121_0010678 | 3300048924 | Bacteria | 10307 |
| 1344 | Ga0496121_0015359 | 3300048924 | Bacteria | 8031 |
| 1345 | Ga0496121_0071104 | 3300048924 | Bacteria | 2799 |
| 1346 | Ga0496121_0196002 | 3300048924 | Bacteria | 1444 |
| 1347 | Ga0496121_0246527 | 3300048924 | Bacteria | 1241 |
| 1348 | Ga0496121_0383911 | 3300048924 | Bacteria | 925 |
| 1349 | Ga0496121_0399908 | 3300048924 | Bacteria | 900 |
| 1350 | Ga0496121_0418989 | 3300048924 | Bacteria | 872 |
| 1351 | Ga0496121_0784536 | 3300048924 | Bacteria | 562 |
| 1352 | Ga0496122_0000172 | 3300048925 | Bacteria | 153862 |
| 1353 | Ga0496122_0001281 | 3300048925 | Bacteria | 41818 |
| 1354 | Ga0496122_0004854 | 3300048925 | Bacteria | 16371 |
| 1355 | Ga0496122_0010659 | 3300048925 | Bacteria | 9438 |
| 1356 | Ga0496122_0043395 | 3300048925 | Bacteria | 3524 |
| 1357 | Ga0496122_0083059 | 3300048925 | Bacteria | 2222 |
| 1358 | Ga0496122_0115276 | 3300048925 | Bacteria | 1751 |
| 1359 | Ga0496122_0115381 | 3300048925 | Bacteria | 1750 |
| 1360 | Ga0496122_0171571 | 3300048925 | Bacteria | 1306 |
| 1361 | Ga0496122_0195488 | 3300048925 | Bacteria | 1188 |
| 1362 | Ga0496122_0226094 | 3300048925 | Bacteria | 1069 |
| 1363 | Ga0496122_0395121 | 3300048925 | Bacteria | 704 |
| 1364 | Ga0496122_0527716 | 3300048925 | Bacteria | 567 |
| 1365 | Ga0496123_0000132 | 3300048926 | Bacteria | 153568 |
| 1366 | Ga0496123_0001497 | 3300048926 | Bacteria | 32439 |
| 1367 | Ga0496123_0006065 | 3300048926 | Bacteria | 11861 |
| 1368 | Ga0496123_0009982 | 3300048926 | Bacteria | 8463 |
| 1369 | Ga0496123_0016524 | 3300048926 | Bacteria | 5986 |
| 1370 | Ga0496123_0044522 | 3300048926 | Bacteria | 3034 |
| 1371 | Ga0496123_0065064 | 3300048926 | Bacteria | 2320 |
| 1372 | Ga0496123_0103894 | 3300048926 | Bacteria | 1644 |
| 1373 | Ga0496123_0225584 | 3300048926 | Bacteria | 941 |
| 1374 | Ga0496123_0357678 | 3300048926 | Bacteria | 677 |
| 1375 | Ga0496123_0370822 | 3300048926 | Bacteria | 660 |
| 1376 | Ga0496123_0378917 | 3300048926 | Bacteria | 649 |
| 1377 | Ga0496124_0006047 | 3300048927 | Bacteria | 13334 |
| 1378 | Ga0496124_0011220 | 3300048927 | Bacteria | 8981 |
| 1379 | Ga0496124_0024032 | 3300048927 | Bacteria | 5548 |
| 1380 | Ga0496124_0048640 | 3300048927 | Bacteria | 3622 |
| 1381 | Ga0496124_0060917 | 3300048927 | Bacteria | 3164 |
| 1382 | Ga0496124_0066786 | 3300048927 | Bacteria | 2994 |
| 1383 | Ga0496124_0085685 | 3300048927 | Bacteria | 2581 |
| 1384 | Ga0496124_0087923 | 3300048927 | Bacteria | 2541 |
| 1385 | Ga0496124_0127317 | 3300048927 | Bacteria | 2027 |
| 1386 | Ga0496124_0207469 | 3300048927 | Bacteria | 1485 |
| 1387 | Ga0496124_0277966 | 3300048927 | Bacteria | 1222 |
| 1388 | Ga0496124_0678953 | 3300048927 | Bacteria | 656 |
| 1389 | Ga0496124_0715194 | 3300048927 | Bacteria | 633 |
| 1390 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 1391 | Ga0496125_0060025 | 3300048928 | Bacteria | 3060 |
| 1392 | Ga0496125_0061181 | 3300048928 | Bacteria | 3021 |
| 1393 | Ga0496125_0068188 | 3300048928 | Bacteria | 2799 |
| 1394 | Ga0496125_0095573 | 3300048928 | Bacteria | 2210 |
| 1395 | Ga0496125_0124377 | 3300048928 | Bacteria | 1831 |
| 1396 | Ga0496125_0142145 | 3300048928 | Bacteria | 1666 |
| 1397 | Ga0496125_0147367 | 3300048928 | Bacteria | 1624 |
| 1398 | Ga0496126_0000597 | 3300048929 | Bacteria | 68119 |
| 1399 | Ga0496126_0005070 | 3300048929 | Bacteria | 15280 |
| 1400 | Ga0496126_0008753 | 3300048929 | Bacteria | 10867 |
| 1401 | Ga0496126_0018683 | 3300048929 | Bacteria | 6859 |
| 1402 | Ga0496126_0049320 | 3300048929 | Bacteria | 3844 |
| 1403 | Ga0496126_0052371 | 3300048929 | Bacteria | 3710 |
| 1404 | Ga0496126_0052478 | 3300048929 | Bacteria | 3705 |
| 1405 | Ga0496126_0064532 | 3300048929 | Bacteria | 3280 |
| 1406 | Ga0496126_0334951 | 3300048929 | Bacteria | 1241 |
| 1407 | Ga0496126_0589479 | 3300048929 | Bacteria | 877 |
| 1408 | Ga0496126_0765118 | 3300048929 | Bacteria | 744 |
| 1409 | Ga0496126_1030425 | 3300048929 | Bacteria | 616 |
| 1410 | Ga0496126_1130527 | 3300048929 | Bacteria | 580 |
| 1411 | Ga0501305_121133 | 3300049161 | Bacteria | 502 |
| 1412 | Ga0495678_005943 | 3300049459 | Bacteria | 6598 |
| 1413 | Ga0495678_048764 | 3300049459 | Bacteria | 1650 |
| 1414 | Ga0495678_120106 | 3300049459 | Bacteria | 884 |
| 1415 | Ga0501317_023130 | 3300049533 | Bacteria | 856 |
| 1416 | Ga0501031_0779037 | 3300049568 | Bacteria | 613 |
| 1417 | Ga0501032_0105612 | 3300049569 | Bacteria | 1866 |
| 1418 | Ga0501032_0415889 | 3300049569 | Bacteria | 863 |
| 1419 | Ga0501032_0645451 | 3300049569 | Bacteria | 672 |
| 1420 | Ga0501032_0680297 | 3300049569 | Bacteria | 653 |
| 1421 | Ga0501033_0000050 | 3300049570 | Bacteria | 111819 |
| 1422 | Ga0501033_0052194 | 3300049570 | Bacteria | 3030 |
| 1423 | Ga0501033_0075543 | 3300049570 | Bacteria | 2473 |
| 1424 | Ga0501033_0385568 | 3300049570 | Bacteria | 979 |
| 1425 | Ga0501034_0005317 | 3300049571 | Bacteria | 14111 |
| 1426 | Ga0501034_0021763 | 3300049571 | Bacteria | 6533 |
| 1427 | Ga0501034_0074864 | 3300049571 | Bacteria | 3393 |
| 1428 | Ga0501034_1424141 | 3300049571 | Bacteria | 568 |
| 1429 | Ga0501036_0103938 | 3300049572 | Bacteria | 2402 |
| 1430 | Ga0501036_0180955 | 3300049572 | Bacteria | 1775 |
| 1431 | Ga0501037_0087849 | 3300049573 | Bacteria | 2250 |
| 1432 | Ga0501038_0722907 | 3300049574 | Bacteria | 744 |
| 1433 | Ga0501040_0047475 | 3300049576 | Bacteria | 2932 |
| 1434 | Ga0501041_0200954 | 3300049577 | Bacteria | 1249 |
| 1435 | Ga0501041_0911947 | 3300049577 | Bacteria | 565 |
| 1436 | Ga0501043_0809665 | 3300049579 | Bacteria | 677 |
| 1437 | Ga0501043_0810294 | 3300049579 | Bacteria | 677 |
| 1438 | Ga0501043_1194948 | 3300049579 | Bacteria | 534 |
| 1439 | Ga0501046_0281833 | 3300049580 | Bacteria | 1217 |
| 1440 | Ga0501046_0735240 | 3300049580 | Bacteria | 694 |
| 1441 | Ga0501046_0970742 | 3300049580 | Bacteria | 590 |
| 1442 | Ga0501047_0088252 | 3300049581 | Bacteria | 2978 |
| 1443 | Ga0501047_0094313 | 3300049581 | Bacteria | 2872 |
| 1444 | Ga0501047_0314097 | 3300049581 | Bacteria | 1407 |
| 1445 | Ga0501047_0548393 | 3300049581 | Bacteria | 981 |
| 1446 | Ga0501048_0061003 | 3300049582 | Bacteria | 2671 |
| 1447 | Ga0501067_0061270 | 3300049583 | Bacteria | 2083 |
| 1448 | Ga0501067_0520388 | 3300049583 | Bacteria | 666 |
| 1449 | Ga0501068_0072553 | 3300049584 | Bacteria | 2102 |
| 1450 | Ga0501068_0319965 | 3300049584 | Bacteria | 994 |
| 1451 | Ga0501069_0200304 | 3300049585 | Bacteria | 1157 |
| 1452 | Ga0501070_0913173 | 3300049586 | Bacteria | 684 |
| 1453 | Ga0501070_1307874 | 3300049586 | Bacteria | 553 |
| 1454 | Ga0501073_1134278 | 3300049589 | Bacteria | 537 |
| 1455 | Ga0501074_0179781 | 3300049590 | Bacteria | 1509 |
| 1456 | Ga0501074_1153973 | 3300049590 | Bacteria | 544 |
| 1457 | Ga0501238_007369 | 3300049671 | Bacteria | 1429 |
| 1458 | Ga0501253_134140 | 3300049683 | Bacteria | 611 |
| 1459 | Ga0501079_0343952 | 3300049741 | Bacteria | 1168 |
| 1460 | Ga0501080_0153318 | 3300049742 | Bacteria | 2129 |
| 1461 | Ga0501080_0597821 | 3300049742 | Bacteria | 980 |
| 1462 | Ga0501080_1400354 | 3300049742 | Bacteria | 596 |
| 1463 | Ga0501083_0092804 | 3300049744 | Bacteria | 1993 |
| 1464 | Ga0501083_0092920 | 3300049744 | Bacteria | 1991 |
| 1465 | Ga0501241_011950 | 3300049758 | Bacteria | 1577 |
| 1466 | Ga0501241_135822 | 3300049758 | Bacteria | 557 |
| 1467 | Ga0501035_0001982 | 3300049822 | Bacteria | 20487 |
| 1468 | Ga0501035_0003519 | 3300049822 | Bacteria | 14970 |
| 1469 | Ga0501035_0569761 | 3300049822 | Bacteria | 926 |
| 1470 | Ga0501035_1553312 | 3300049822 | Bacteria | 503 |
| 1471 | Ga0501044_0382637 | 3300049823 | Bacteria | 1322 |
| 1472 | Ga0501044_0508275 | 3300049823 | Bacteria | 1105 |
| 1473 | Ga0501044_1263587 | 3300049823 | Bacteria | 605 |
| 1474 | Ga0501044_1331652 | 3300049823 | Bacteria | 584 |
| 1475 | nmdc:mga03683_16528_c1 | 3300050489 | Bacteria | 2773 |
| 1476 | nmdc:mga03683_169159_c1 | 3300050489 | Bacteria | 992 |
| 1477 | nmdc:mga03n38_48732_c1 | 3300050490 | Bacteria | 1881 |
| 1478 | nmdc:mga03n38_905166_c1 | 3300050490 | Bacteria | 519 |
| 1479 | nmdc:mga00v17_1052520_c1 | 3300050491 | Bacteria | 511 |
| 1480 | nmdc:mga00v17_119083_c1 | 3300050491 | Bacteria | 1680 |
| 1481 | nmdc:mga00v17_63187_c1 | 3300050491 | Bacteria | 2280 |
| 1482 | nmdc:mga00v17_725596_c1 | 3300050491 | Bacteria | 636 |
| 1483 | nmdc:mga00v17_728_c1 | 3300050491 | Bacteria | 17963 |
| 1484 | nmdc:mga00v17_84260_c1 | 3300050491 | Bacteria | 1989 |
| 1485 | nmdc:mga00v17_886430_c1 | 3300050491 | Bacteria | 565 |
| 1486 | nmdc:mga0yw44_1143200_c1 | 3300050492 | Bacteria | 526 |
| 1487 | nmdc:mga0yw44_1180437_c1 | 3300050492 | Bacteria | 516 |
| 1488 | nmdc:mga0yw44_231721_c1 | 3300050492 | Bacteria | 1226 |
| 1489 | nmdc:mga0yw44_5416_c1 | 3300050492 | Bacteria | 6026 |
| 1490 | nmdc:mga0yw44_546422_c1 | 3300050492 | Bacteria | 787 |
| 1491 | nmdc:mga0yw44_79540_c1 | 3300050492 | Bacteria | 2051 |
| 1492 | nmdc:mga0yw44_985723_c1 | 3300050492 | Bacteria | 571 |
| 1493 | nmdc:mga0k408_151925_c1 | 3300050493 | Bacteria | 1379 |
| 1494 | nmdc:mga0k408_558834_c1 | 3300050493 | Bacteria | 676 |
| 1495 | nmdc:mga0k408_789108_c1 | 3300050493 | Bacteria | 554 |
| 1496 | nmdc:mga06z11_309373_c1 | 3300050494 | Bacteria | 941 |
| 1497 | nmdc:mga06z11_345327_c1 | 3300050494 | Bacteria | 890 |
| 1498 | nmdc:mga06z11_59652_c1 | 3300050494 | Bacteria | 1984 |
| 1499 | nmdc:mga06z11_713135_c1 | 3300050494 | Bacteria | 611 |
| 1500 | nmdc:mga04h51_48624_c1 | 3300050495 | Bacteria | 1414 |
| 1501 | nmdc:mga07m45_167727_c1 | 3300050496 | Unclassified | 1275 |
| 1502 | nmdc:mga07m45_24802_c1 | 3300050496 | Bacteria | 3287 |
| 1503 | nmdc:mga07m45_443576_c1 | 3300050496 | Bacteria | 753 |
| 1504 | nmdc:mga07m45_544878_c1 | 3300050496 | Bacteria | 671 |
| 1505 | nmdc:mga07m45_71443_c1 | 3300050496 | Bacteria | 1975 |
| 1506 | nmdc:mga05p37_833956_c1 | 3300050507 | Bacteria | 1004 |
| 1507 | nmdc:mga06r32_1862570_c1 | 3300050510 | Bacteria | 536 |
| 1508 | nmdc:mga08y16_695244_c1 | 3300050511 | Bacteria | 1017 |
| 1509 | nmdc:mga08y16_701951_c1 | 3300050511 | Bacteria | 1011 |
| 1510 | nmdc:mga0sz30_170331_c1 | 3300050516 | Bacteria | 965 |
| 1511 | nmdc:mga0sz30_20504_c1 | 3300050516 | Bacteria | 2667 |
| 1512 | nmdc:mga0sz30_216534_c1 | 3300050516 | Bacteria | 851 |
| 1513 | nmdc:mga0sz30_443335_c1 | 3300050516 | Bacteria | 583 |
| 1514 | nmdc:mga0sz30_541268_c1 | 3300050516 | Bacteria | 525 |
| 1515 | nmdc:mga0sz30_568279_c1 | 3300050516 | Bacteria | 512 |
| 1516 | nmdc:mga0sz30_99662_c1 | 3300050516 | Bacteria | 1268 |
| 1517 | Ga0495601_0044623 | 3300053077 | Bacteria | 2786 |
| 1518 | Ga0495601_0140646 | 3300053077 | Bacteria | 1574 |
| 1519 | Ga0495601_0294647 | 3300053077 | Bacteria | 1057 |
| 1520 | Ga0495612_0030474 | 3300053078 | Bacteria | 2172 |
| 1521 | Ga0495612_0344559 | 3300053078 | Bacteria | 672 |
| 1522 | Ga0495655_0051043 | 3300053083 | Bacteria | 1095 |
| 1523 | Ga0495595_0000874 | 3300053084 | Bacteria | 11553 |
| 1524 | Ga0495595_0086754 | 3300053084 | Bacteria | 1497 |
| 1525 | Ga0495619_0040923 | 3300053085 | Bacteria | 3029 |
| 1526 | Ga0495619_0086850 | 3300053085 | Bacteria | 2114 |
| 1527 | Ga0495619_0240304 | 3300053085 | Bacteria | 1255 |
| 1528 | Ga0495619_0705386 | 3300053085 | Bacteria | 686 |
| 1529 | Ga0500578_0206785 | 3300053086 | Bacteria | 1199 |
| 1530 | Ga0500643_059261 | 3300053087 | Bacteria | 1078 |
| 1531 | Ga0500644_0069871 | 3300053088 | Bacteria | 1263 |
| 1532 | Ga0500581_234965 | 3300053089 | Bacteria | 783 |
| 1533 | Ga0500646_0389680 | 3300053090 | Bacteria | 513 |
| 1534 | Ga0500647_0389411 | 3300053091 | Bacteria | 568 |
| 1535 | Ga0500660_238462 | 3300053100 | Bacteria | 575 |
| 1536 | Ga0500555_079236 | 3300053103 | Bacteria | 857 |
| 1537 | Ga0500556_0151922 | 3300053104 | Bacteria | 913 |
| 1538 | Ga0500572_221805 | 3300053111 | Bacteria | 618 |
| 1539 | Ga0500572_234648 | 3300053111 | Bacteria | 599 |
| 1540 | Ga0500592_081115 | 3300053116 | Bacteria | 539 |
| 1541 | Ga0500607_275720 | 3300053121 | Bacteria | 645 |
| 1542 | Ga0500618_000560 | 3300053125 | Bacteria | 23031 |
| 1543 | Ga0500618_010534 | 3300053125 | Bacteria | 2478 |
| 1544 | Ga0500628_164554 | 3300053129 | Bacteria | 627 |
| 1545 | Ga0500642_0205541 | 3300053130 | Bacteria | 915 |
| 1546 | Ga0500559_0075911 | 3300053136 | Bacteria | 1521 |
| 1547 | Ga0500577_0280266 | 3300053142 | Bacteria | 726 |
| 1548 | Ga0500586_163893 | 3300053145 | Bacteria | 752 |
| 1549 | Ga0500588_0142048 | 3300053146 | Bacteria | 863 |
| 1550 | Ga0500604_0113727 | 3300053151 | Bacteria | 900 |
| 1551 | Ga0500616_0001686 | 3300053153 | Bacteria | 20346 |
| 1552 | Ga0500616_0041654 | 3300053153 | Bacteria | 2463 |
| 1553 | Ga0500616_0188181 | 3300053153 | Bacteria | 924 |
| 1554 | Ga0500622_0026143 | 3300053156 | Bacteria | 3082 |
| 1555 | Ga0500622_0082165 | 3300053156 | Bacteria | 1612 |
| 1556 | Ga0500627_0059149 | 3300053158 | Bacteria | 1683 |
| 1557 | Ga0500627_0130792 | 3300053158 | Bacteria | 1133 |
| 1558 | Ga0500627_0139126 | 3300053158 | Bacteria | 1097 |
| 1559 | Ga0500627_0267933 | 3300053158 | Bacteria | 752 |
| 1560 | Ga0500633_0053860 | 3300053160 | Bacteria | 1397 |
| 1561 | Ga0500638_342658 | 3300053162 | Bacteria | 558 |
| 1562 | Ga0500611_032595 | 3300053727 | Bacteria | 1091 |
| 1563 | Ga0500645_107824 | 3300053730 | Bacteria | 783 |
| 1564 | Ga0501084_0401350 | 3300054114 | Bacteria | 1159 |
| 1565 | Ga0587084_032264 | 3300059477 | Bacteria | 850 |
| 1566 | Ga0587084_122147 | 3300059477 | Bacteria | 549 |
| 1567 | Ga0587066_003392 | 3300059490 | Bacteria | 1867 |
| 1568 | Ga0587066_075045 | 3300059490 | Bacteria | 720 |
| 1569 | Ga0587073_0070342 | 3300059492 | Bacteria | 844 |
| 1570 | Ga0587080_112850 | 3300059503 | Bacteria | 594 |
| 1571 | Ga0587082_073323 | 3300059504 | Bacteria | 700 |
| 1572 | Ga0587083_0265568 | 3300059505 | Bacteria | 517 |
| 1573 | Ga0587085_051183 | 3300059506 | Bacteria | 753 |
| 1574 | Ga0587088_053930 | 3300059508 | Bacteria | 796 |
| 1575 | Ga0587088_177784 | 3300059508 | Bacteria | 531 |
| 1576 | Ga0587089_081117 | 3300059509 | Bacteria | 565 |
| 1577 | Ga0587089_094271 | 3300059509 | Bacteria | 536 |
| 1578 | Ga0587090_156438 | 3300059510 | Bacteria | 520 |
| 1579 | Ga0587091_120787 | 3300059511 | Bacteria | 636 |
| 1580 | Ga0587092_144234 | 3300059512 | Bacteria | 527 |
| 1581 | Ga0587094_067450 | 3300059513 | Bacteria | 638 |
| 1582 | Ga0587098_057932 | 3300059604 | Bacteria | 602 |
| 1583 | Ga0587106_093114 | 3300059605 | Bacteria | 605 |
| 1584 | Ga0587106_117048 | 3300059605 | Bacteria | 561 |
| 1585 | Ga0587125_081280 | 3300059607 | Bacteria | 504 |
| 1586 | Ga0587129_012337 | 3300059608 | Bacteria | 682 |
| 1587 | Ga0587099_038709 | 3300059622 | Bacteria | 604 |
| 1588 | Ga0587101_152743 | 3300059623 | Bacteria | 501 |
| 1589 | Ga0587109_110315 | 3300059624 | Bacteria | 642 |
| 1590 | Ga0587109_141068 | 3300059624 | Bacteria | 588 |
| 1591 | Ga0587109_172366 | 3300059624 | Bacteria | 548 |
| 1592 | Ga0587113_020044 | 3300059625 | Bacteria | 697 |
| 1593 | Ga0587113_053499 | 3300059625 | Bacteria | 509 |
| 1594 | Ga0587122_052835 | 3300059628 | Bacteria | 531 |
| 1595 | Ga0587122_055920 | 3300059628 | Bacteria | 521 |
| 1596 | Ga0587128_062583 | 3300059630 | Bacteria | 706 |
| 1597 | Ga0587128_065140 | 3300059630 | Bacteria | 697 |
| 1598 | Ga0587067_107281 | 3300059640 | Bacteria | 654 |
| 1599 | Ga0587067_190785 | 3300059640 | Bacteria | 539 |
| 1600 | Ga0587068_102435 | 3300059641 | Bacteria | 603 |
| 1601 | Ga0587072_197399 | 3300059643 | Bacteria | 510 |
| 1602 | Ga0587076_004448 | 3300059645 | Bacteria | 1750 |
| 1603 | Ga0587076_025539 | 3300059645 | Bacteria | 1011 |
| 1604 | Ga0587078_078213 | 3300059646 | Bacteria | 527 |
| 1605 | Ga0587079_092152 | 3300059647 | Bacteria | 711 |
| 1606 | Ga0587102_070864 | 3300059649 | Bacteria | 502 |
| 1607 | Ga0587107_142623 | 3300059652 | Bacteria | 513 |
| 1608 | Ga0587110_028814 | 3300059654 | Bacteria | 668 |
| 1609 | Ga0587110_054836 | 3300059654 | Bacteria | 540 |
| 1610 | Ga0587114_119261 | 3300059655 | Bacteria | 532 |
| 1611 | Ga0587116_18054 | 3300059656 | Bacteria | 525 |
| 1612 | Ga0587120_035344 | 3300059659 | Bacteria | 523 |
| 1613 | Ga0587065_09177 | 3300060245 | Bacteria | 614 |
| 1614 | Ga0587111_0097279 | 3300060346 | Bacteria | 728 |
| 1615 | Ga0587111_0130142 | 3300060346 | Bacteria | 657 |
| 1616 | Ga0587111_0256972 | 3300060346 | Bacteria | 519 |
| 1617 | Ga0501082_0129966 | 3300060353 | Bacteria | 2185 |
| 1618 | Ga0501082_0335152 | 3300060353 | Bacteria | 1318 |
| 1619 | Ga0501082_0370725 | 3300060353 | Bacteria | 1249 |
| 1620 | Ga0530510_0018821 | 3300061734 | Bacteria | 4897 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300001976 | JGI24752J21851_1010252 | JGI24752J21851_10102523 | 67 |
| 2 | 3300001979 | JGI24740J21852_10132098 | JGI24740J21852_101320982 | 67 |
| 3 | 3300001989 | JGI24739J22299_10032005 | JGI24739J22299_100320053 | 67 |
| 4 | 3300001989 | JGI24739J22299_10116097 | JGI24739J22299_101160972 | 67 |
| 5 | 3300002074 | JGI24748J21848_1043570 | JGI24748J21848_10435701 | 67 |
| 6 | 3300002075 | JGI24738J21930_10024573 | JGI24738J21930_100245732 | 67 |
| 7 | 3300003373 | JGI25407J50210_10167016 | JGI25407J50210_101670161 | 67 |
| 8 | 3300003752 | Ga0055539_1003524 | Ga0055539_10035243 | 67 |
| 9 | 3300003794 | Ga0055531_10091833 | Ga0055531_100918331 | 67 |
| 10 | 3300004798 | Ga0058859_11782138 | Ga0058859_117821382 | 67 |
| 11 | 3300005335 | Ga0070666_10121615 | Ga0070666_101216153 | 67 |
| 12 | 3300005336 | Ga0070680_100062215 | Ga0070680_1000622152 | 67 |
| 13 | 3300005337 | Ga0070682_100021284 | Ga0070682_1000212842 | 67 |
| 14 | 3300005340 | Ga0070689_100294893 | Ga0070689_1002948933 | 67 |
| 15 | 3300005347 | Ga0070668_100022443 | Ga0070668_1000224433 | 67 |
| 16 | 3300005353 | Ga0070669_100410468 | Ga0070669_1004104682 | 67 |
| 17 | 3300005355 | Ga0070671_100209677 | Ga0070671_1002096773 | 67 |
| 18 | 3300005365 | Ga0070688_100206308 | Ga0070688_1002063081 | 67 |
| 19 | 3300005366 | Ga0070659_100322412 | Ga0070659_1003224122 | 67 |
| 20 | 3300005366 | Ga0070659_101135034 | Ga0070659_1011350341 | 67 |
| 21 | 3300005367 | Ga0070667_101218124 | Ga0070667_1012181241 | 67 |
| 22 | 3300005434 | Ga0070709_10016520 | Ga0070709_100165203 | 67 |
| 23 | 3300005434 | Ga0070709_10035902 | Ga0070709_100359022 | 67 |
| 24 | 3300005434 | Ga0070709_10063889 | Ga0070709_100638894 | 67 |
| 25 | 3300005434 | Ga0070709_10156008 | Ga0070709_101560083 | 67 |
| 26 | 3300005434 | Ga0070709_10179578 | Ga0070709_101795781 | 67 |
| 27 | 3300005435 | Ga0070714_100024895 | Ga0070714_1000248955 | 67 |
| 28 | 3300005435 | Ga0070714_100102121 | Ga0070714_1001021214 | 67 |
| 29 | 3300005435 | Ga0070714_100130483 | Ga0070714_1001304833 | 67 |
| 30 | 3300005436 | Ga0070713_100003931 | Ga0070713_10000393112 | 67 |
| 31 | 3300005436 | Ga0070713_100017989 | Ga0070713_1000179895 | 67 |
| 32 | 3300005436 | Ga0070713_100090069 | Ga0070713_1000900694 | 67 |
| 33 | 3300005437 | Ga0070710_10001221 | Ga0070710_1000122112 | 67 |
| 34 | 3300005437 | Ga0070710_10006078 | Ga0070710_100060785 | 67 |
| 35 | 3300005437 | Ga0070710_10011233 | Ga0070710_100112333 | 67 |
| 36 | 3300005437 | Ga0070710_10302347 | Ga0070710_103023472 | 67 |
| 37 | 3300005439 | Ga0070711_100002618 | Ga0070711_1000026187 | 67 |
| 38 | 3300005439 | Ga0070711_100074580 | Ga0070711_1000745802 | 67 |
| 39 | 3300005439 | Ga0070711_100167066 | Ga0070711_1001670662 | 67 |
| 40 | 3300005455 | Ga0070663_100417081 | Ga0070663_1004170812 | 67 |
| 41 | 3300005455 | Ga0070663_100889103 | Ga0070663_1008891031 | 67 |
| 42 | 3300005455 | Ga0070663_100896973 | Ga0070663_1008969732 | 67 |
| 43 | 3300005455 | Ga0070663_101545680 | Ga0070663_1015456802 | 67 |
| 44 | 3300005456 | Ga0070678_100774144 | Ga0070678_1007741442 | 67 |
| 45 | 3300005457 | Ga0070662_100063389 | Ga0070662_1000633892 | 67 |
| 46 | 3300005457 | Ga0070662_100137147 | Ga0070662_1001371472 | 67 |
| 47 | 3300005458 | Ga0070681_10014949 | Ga0070681_100149495 | 67 |
| 48 | 3300005471 | Ga0070698_100091164 | Ga0070698_1000911645 | 67 |
| 49 | 3300005530 | Ga0070679_100075690 | Ga0070679_1000756902 | 67 |
| 50 | 3300005535 | Ga0070684_100607120 | Ga0070684_1006071202 | 67 |
| 51 | 3300005539 | Ga0068853_100111118 | Ga0068853_1001111183 | 67 |
| 52 | 3300005548 | Ga0070665_100885572 | Ga0070665_1008855722 | 67 |
| 53 | 3300005563 | Ga0068855_100119356 | Ga0068855_1001193563 | 67 |
| 54 | 3300005563 | Ga0068855_101377753 | Ga0068855_1013777532 | 67 |
| 55 | 3300005577 | Ga0068857_100110809 | Ga0068857_1001108092 | 67 |
| 56 | 3300005578 | Ga0068854_102143692 | Ga0068854_1021436921 | 67 |
| 57 | 3300005614 | Ga0068856_100170919 | Ga0068856_1001709193 | 67 |
| 58 | 3300005614 | Ga0068856_100361700 | Ga0068856_1003617001 | 67 |
| 59 | 3300005616 | Ga0068852_100863990 | Ga0068852_1008639902 | 67 |
| 60 | 3300005617 | Ga0068859_100105112 | Ga0068859_1001051123 | 67 |
| 61 | 3300005841 | Ga0068863_100712823 | Ga0068863_1007128232 | 67 |
| 62 | 3300005841 | Ga0068863_101067590 | Ga0068863_1010675901 | 67 |
| 63 | 3300005842 | Ga0068858_100059111 | Ga0068858_1000591112 | 67 |
| 64 | 3300005842 | Ga0068858_100156342 | Ga0068858_1001563423 | 67 |
| 65 | 3300005937 | Ga0081455_10371635 | Ga0081455_103716352 | 67 |
| 66 | 3300005981 | Ga0081538_10039548 | Ga0081538_100395485 | 67 |
| 67 | 3300005983 | Ga0081540_1234082 | Ga0081540_12340822 | 67 |
| 68 | 3300005983 | Ga0081540_1252620 | Ga0081540_12526201 | 67 |
| 69 | 3300005983 | Ga0081540_1325924 | Ga0081540_13259242 | 67 |
| 70 | 3300006028 | Ga0070717_11084846 | Ga0070717_110848462 | 67 |
| 71 | 3300006038 | Ga0075365_10431488 | Ga0075365_104314881 | 67 |
| 72 | 3300006042 | Ga0075368_10001274 | Ga0075368_1000127410 | 67 |
| 73 | 3300006042 | Ga0075368_10073329 | Ga0075368_100733292 | 67 |
| 74 | 3300006042 | Ga0075368_10207272 | Ga0075368_102072723 | 67 |
| 75 | 3300006048 | Ga0075363_100006553 | Ga0075363_1000065534 | 67 |
| 76 | 3300006051 | Ga0075364_10027644 | Ga0075364_100276442 | 67 |
| 77 | 3300006051 | Ga0075364_11207545 | Ga0075364_112075451 | 67 |
| 78 | 3300006173 | Ga0070716_100259803 | Ga0070716_1002598032 | 67 |
| 79 | 3300006175 | Ga0070712_100055890 | Ga0070712_1000558901 | 67 |
| 80 | 3300006175 | Ga0070712_100146164 | Ga0070712_1001461643 | 67 |
| 81 | 3300006177 | Ga0075362_10421840 | Ga0075362_104218402 | 67 |
| 82 | 3300006178 | Ga0075367_10480755 | Ga0075367_104807552 | 67 |
| 83 | 3300006178 | Ga0075367_10914942 | Ga0075367_109149421 | 67 |
| 84 | 3300006186 | Ga0075369_10024521 | Ga0075369_100245212 | 67 |
| 85 | 3300006195 | Ga0075366_10154332 | Ga0075366_101543321 | 67 |
| 86 | 3300006195 | Ga0075366_10456368 | Ga0075366_104563682 | 67 |
| 87 | 3300006353 | Ga0075370_10008389 | Ga0075370_100083895 | 67 |
| 88 | 3300006353 | Ga0075370_10176598 | Ga0075370_101765982 | 67 |
| 89 | 3300006931 | Ga0097620_100105110 | Ga0097620_1001051103 | 67 |
| 90 | 3300007788 | Ga0099795_10047082 | Ga0099795_100470823 | 67 |
| 91 | 3300009011 | Ga0105251_10421297 | Ga0105251_104212972 | 67 |
| 92 | 3300009092 | Ga0105250_10038075 | Ga0105250_100380751 | 67 |
| 93 | 3300009092 | Ga0105250_10051849 | Ga0105250_100518493 | 67 |
| 94 | 3300009092 | Ga0105250_10386922 | Ga0105250_103869221 | 67 |
| 95 | 3300009093 | Ga0105240_11119653 | Ga0105240_111196532 | 67 |
| 96 | 3300009093 | Ga0105240_11973457 | Ga0105240_119734571 | 67 |
| 97 | 3300009093 | Ga0105240_12603742 | Ga0105240_126037421 | 67 |
| 98 | 3300009098 | Ga0105245_10382719 | Ga0105245_103827192 | 67 |
| 99 | 3300009098 | Ga0105245_10661227 | Ga0105245_106612272 | 67 |
| 100 | 3300009101 | Ga0105247_10083415 | Ga0105247_100834153 | 67 |
| 101 | 3300009101 | Ga0105247_10488703 | Ga0105247_104887031 | 67 |
| 102 | 3300009148 | Ga0105243_10279507 | Ga0105243_102795072 | 67 |
| 103 | 3300009174 | Ga0105241_10490543 | Ga0105241_104905431 | 67 |
| 104 | 3300009174 | Ga0105241_10941055 | Ga0105241_109410552 | 67 |
| 105 | 3300009174 | Ga0105241_11520199 | Ga0105241_115201992 | 67 |
| 106 | 3300009177 | Ga0105248_10065542 | Ga0105248_100655426 | 67 |
| 107 | 3300009177 | Ga0105248_10837738 | Ga0105248_108377381 | 67 |
| 108 | 3300009177 | Ga0105248_11528483 | Ga0105248_115284833 | 67 |
| 109 | 3300009545 | Ga0105237_10055965 | Ga0105237_100559653 | 67 |
| 110 | 3300009545 | Ga0105237_10155143 | Ga0105237_101551432 | 67 |
| 111 | 3300009545 | Ga0105237_12543513 | Ga0105237_125435131 | 67 |
| 112 | 3300009551 | Ga0105238_10043599 | Ga0105238_100435996 | 67 |
| 113 | 3300009551 | Ga0105238_10233792 | Ga0105238_102337923 | 67 |
| 114 | 3300009551 | Ga0105238_10631627 | Ga0105238_106316271 | 67 |
| 115 | 3300009553 | Ga0105249_13416319 | Ga0105249_134163192 | 67 |
| 116 | 3300010159 | Ga0099796_10154089 | Ga0099796_101540891 | 67 |
| 117 | 3300010375 | Ga0105239_10079462 | Ga0105239_100794624 | 67 |
| 118 | 3300010375 | Ga0105239_10273508 | Ga0105239_102735083 | 67 |
| 119 | 3300010375 | Ga0105239_10340603 | Ga0105239_103406032 | 67 |
| 120 | 3300010375 | Ga0105239_10374440 | Ga0105239_103744401 | 67 |
| 121 | 3300010375 | Ga0105239_11119395 | Ga0105239_111193952 | 67 |
| 122 | 3300011119 | Ga0105246_10064102 | Ga0105246_100641023 | 67 |
| 123 | 3300011119 | Ga0105246_10222943 | Ga0105246_102229431 | 67 |
| 124 | 3300011119 | Ga0105246_10327631 | Ga0105246_103276313 | 67 |
| 125 | 3300012497 | Ga0157319_1023130 | Ga0157319_10231302 | 67 |
| 126 | 3300012513 | Ga0157326_1032763 | Ga0157326_10327631 | 67 |
| 127 | 3300012513 | Ga0157326_1100258 | Ga0157326_11002582 | 67 |
| 128 | 3300013062 | Ga0154010_157882 | Ga0154010_1578821 | 67 |
| 129 | 3300013102 | Ga0157371_10860734 | Ga0157371_108607342 | 67 |
| 130 | 3300013104 | Ga0157370_12055904 | Ga0157370_120559041 | 67 |
| 131 | 3300013105 | Ga0157369_10003351 | Ga0157369_100033514 | 67 |
| 132 | 3300013105 | Ga0157369_10772610 | Ga0157369_107726101 | 67 |
| 133 | 3300013105 | Ga0157369_10797558 | Ga0157369_107975581 | 67 |
| 134 | 3300013296 | Ga0157374_10310684 | Ga0157374_103106842 | 67 |
| 135 | 3300013296 | Ga0157374_12059028 | Ga0157374_120590282 | 67 |
| 136 | 3300013297 | Ga0157378_10911924 | Ga0157378_109119242 | 67 |
| 137 | 3300013297 | Ga0157378_11725166 | Ga0157378_117251661 | 67 |
| 138 | 3300013306 | Ga0163162_10202905 | Ga0163162_102029053 | 67 |
| 139 | 3300013306 | Ga0163162_11102854 | Ga0163162_111028541 | 67 |
| 140 | 3300013307 | Ga0157372_10145791 | Ga0157372_101457913 | 67 |
| 141 | 3300013307 | Ga0157372_11446328 | Ga0157372_114463281 | 67 |
| 142 | 3300013307 | Ga0157372_12490391 | Ga0157372_124903911 | 67 |
| 143 | 3300013307 | Ga0157372_13310479 | Ga0157372_133104791 | 67 |
| 144 | 3300014325 | Ga0163163_10003826 | Ga0163163_1000382615 | 67 |
| 145 | 3300014325 | Ga0163163_10018613 | Ga0163163_100186137 | 67 |
| 146 | 3300014745 | Ga0157377_11310966 | Ga0157377_113109661 | 67 |
| 147 | 3300014968 | Ga0157379_10161603 | Ga0157379_101616032 | 67 |
| 148 | 3300014968 | Ga0157379_10194905 | Ga0157379_101949053 | 67 |
| 149 | 3300014968 | Ga0157379_10235462 | Ga0157379_102354623 | 67 |
| 150 | 3300014969 | Ga0157376_10578972 | Ga0157376_105789723 | 67 |
| 151 | 3300021441 | Ga0213871_10294354 | Ga0213871_102943541 | 67 |
| 152 | 3300048918 | Ga0496115_0188888 | Ga0496115_0188888_141_350 | 67 |
| 153 | 3300005327 | Ga0070658_10118807 | Ga0070658_101188072 | 68 |
| 154 | 3300005329 | Ga0070683_101343506 | Ga0070683_1013435062 | 68 |
| 155 | 3300005330 | Ga0070690_100637002 | Ga0070690_1006370021 | 68 |
| 156 | 3300005331 | Ga0070670_101915433 | Ga0070670_1019154331 | 68 |
| 157 | 3300005336 | Ga0070680_100005174 | Ga0070680_1000051749 | 68 |
| 158 | 3300005336 | Ga0070680_100068383 | Ga0070680_1000683833 | 68 |
| 159 | 3300005337 | Ga0070682_101505544 | Ga0070682_1015055442 | 68 |
| 160 | 3300005338 | Ga0068868_100234537 | Ga0068868_1002345371 | 68 |
| 161 | 3300005347 | Ga0070668_100828021 | Ga0070668_1008280212 | 68 |
| 162 | 3300005364 | Ga0070673_101925350 | Ga0070673_1019253501 | 68 |
| 163 | 3300005367 | Ga0070667_100602799 | Ga0070667_1006027992 | 68 |
| 164 | 3300005367 | Ga0070667_100897904 | Ga0070667_1008979042 | 68 |
| 165 | 3300005455 | Ga0070663_102045993 | Ga0070663_1020459932 | 68 |
| 166 | 3300005456 | Ga0070678_101417730 | Ga0070678_1014177302 | 68 |
| 167 | 3300005458 | Ga0070681_10010435 | Ga0070681_100104358 | 68 |
| 168 | 3300005458 | Ga0070681_10101039 | Ga0070681_101010392 | 68 |
| 169 | 3300005530 | Ga0070679_100000584 | Ga0070679_10000058420 | 68 |
| 170 | 3300005530 | Ga0070679_100101247 | Ga0070679_1001012472 | 68 |
| 171 | 3300005535 | Ga0070684_101609607 | Ga0070684_1016096072 | 68 |
| 172 | 3300005539 | Ga0068853_102286243 | Ga0068853_1022862431 | 68 |
| 173 | 3300005543 | Ga0070672_101142100 | Ga0070672_1011421002 | 68 |
| 174 | 3300005548 | Ga0070665_100627161 | Ga0070665_1006271613 | 68 |
| 175 | 3300005549 | Ga0070704_100747081 | Ga0070704_1007470811 | 68 |
| 176 | 3300005563 | Ga0068855_100023319 | Ga0068855_1000233194 | 68 |
| 177 | 3300005578 | Ga0068854_100315988 | Ga0068854_1003159883 | 68 |
| 178 | 3300005614 | Ga0068856_101005596 | Ga0068856_1010055962 | 68 |
| 179 | 3300005614 | Ga0068856_101019078 | Ga0068856_1010190782 | 68 |
| 180 | 3300005618 | Ga0068864_101023014 | Ga0068864_1010230141 | 68 |
| 181 | 3300005834 | Ga0068851_10902872 | Ga0068851_109028721 | 68 |
| 182 | 3300005844 | Ga0068862_101402027 | Ga0068862_1014020271 | 68 |
| 183 | 3300006173 | Ga0070716_100533230 | Ga0070716_1005332302 | 68 |
| 184 | 3300006237 | Ga0097621_100993433 | Ga0097621_1009934332 | 68 |
| 185 | 3300006358 | Ga0068871_100058693 | Ga0068871_1000586937 | 68 |
| 186 | 3300006358 | Ga0068871_102264715 | Ga0068871_1022647152 | 68 |
| 187 | 3300006881 | Ga0068865_100914050 | Ga0068865_1009140502 | 68 |
| 188 | 3300007265 | Ga0099794_10275053 | Ga0099794_102750531 | 68 |
| 189 | 3300009093 | Ga0105240_10117780 | Ga0105240_101177802 | 68 |
| 190 | 3300009093 | Ga0105240_10275568 | Ga0105240_102755683 | 68 |
| 191 | 3300009098 | Ga0105245_11210102 | Ga0105245_112101022 | 68 |
| 192 | 3300009098 | Ga0105245_11390540 | Ga0105245_113905402 | 68 |
| 193 | 3300009148 | Ga0105243_11182451 | Ga0105243_111824511 | 68 |
| 194 | 3300009177 | Ga0105248_10123749 | Ga0105248_101237496 | 68 |
| 195 | 3300009177 | Ga0105248_11259711 | Ga0105248_112597112 | 68 |
| 196 | 3300009545 | Ga0105237_10695272 | Ga0105237_106952721 | 68 |
| 197 | 3300009545 | Ga0105237_11361988 | Ga0105237_113619881 | 68 |
| 198 | 3300009551 | Ga0105238_10000586 | Ga0105238_1000058617 | 68 |
| 199 | 3300009551 | Ga0105238_10692192 | Ga0105238_106921922 | 68 |
| 200 | 3300009551 | Ga0105238_13036591 | Ga0105238_130365912 | 68 |
| 201 | 3300010375 | Ga0105239_11604850 | Ga0105239_116048501 | 68 |
| 202 | 3300011119 | Ga0105246_11774398 | Ga0105246_117743981 | 68 |
| 203 | 3300013104 | Ga0157370_10004657 | Ga0157370_100046578 | 68 |
| 204 | 3300013104 | Ga0157370_10015115 | Ga0157370_100151153 | 68 |
| 205 | 3300013296 | Ga0157374_10457756 | Ga0157374_104577562 | 68 |
| 206 | 3300013296 | Ga0157374_12916675 | Ga0157374_129166752 | 68 |
| 207 | 3300013297 | Ga0157378_10014660 | Ga0157378_100146603 | 68 |
| 208 | 3300013297 | Ga0157378_11010873 | Ga0157378_110108732 | 68 |
| 209 | 3300013306 | Ga0163162_11951395 | Ga0163162_119513952 | 68 |
| 210 | 3300013307 | Ga0157372_10489221 | Ga0157372_104892213 | 68 |
| 211 | 3300013307 | Ga0157372_12902104 | Ga0157372_129021041 | 68 |
| 212 | 3300013308 | Ga0157375_13464937 | Ga0157375_134649372 | 68 |
| 213 | 3300014969 | Ga0157376_11962462 | Ga0157376_119624622 | 68 |
| 214 | 3300033524 | Ga0316592_1108090 | Ga0316592_11080901 | 68 |
| 215 | 3300033527 | Ga0316586_1102401 | Ga0316586_11024011 | 68 |
| 216 | 3300035113 | Ga0373936_0177635 | Ga0373936_0177635_609_818 | 68 |
| 217 | 3300039062 | Ga0400483_048591 | Ga0400483_048591_788_1015 | 68 |
| 218 | 3300039062 | Ga0400483_170970 | Ga0400483_170970_5594_5809 | 68 |
| 219 | 3300039062 | Ga0400483_241924 | Ga0400483_241924_1191_1418 | 68 |
| 220 | 3300049569 | Ga0501032_0105612 | Ga0501032_0105612_409_618 | 68 |
| 221 | 3300049570 | Ga0501033_0075543 | Ga0501033_0075543_234_443 | 68 |
| 222 | 3300049576 | Ga0501040_0047475 | Ga0501040_0047475_730_939 | 68 |
| 223 | 3300049580 | Ga0501046_0281833 | Ga0501046_0281833_965_1174 | 68 |
| 224 | 3300049580 | Ga0501046_0735240 | Ga0501046_0735240_261_470 | 68 |
| 225 | 3300049581 | Ga0501047_0088252 | Ga0501047_0088252_2287_2496 | 68 |
| 226 | 3300049582 | Ga0501048_0061003 | Ga0501048_0061003_618_827 | 68 |
| 227 | 3300049584 | Ga0501068_0072553 | Ga0501068_0072553_30_239 | 68 |
| 228 | 3300049585 | Ga0501069_0200304 | Ga0501069_0200304_771_980 | 68 |
| 229 | 3300049586 | Ga0501070_1307874 | Ga0501070_1307874_90_299 | 68 |
| 230 | 3300049741 | Ga0501079_0343952 | Ga0501079_0343952_429_638 | 68 |
| 231 | 3300049742 | Ga0501080_0153318 | Ga0501080_0153318_1746_1955 | 68 |
| 232 | 3300049823 | Ga0501044_0382637 | Ga0501044_0382637_982_1191 | 68 |
| 233 | 3300060353 | Ga0501082_0129966 | Ga0501082_0129966_1574_1783 | 68 |
| 234 | 3300061734 | Ga0530510_0018821 | Ga0530510_0018821_2907_3116 | 68 |
| 235 | 3300000549 | LJQas_1008199 | LJQas_10081992 | 69 |
| 236 | 3300001979 | JGI24740J21852_10079157 | JGI24740J21852_100791571 | 69 |
| 237 | 3300001979 | JGI24740J21852_10129760 | JGI24740J21852_101297601 | 69 |
| 238 | 3300001989 | JGI24739J22299_10045697 | JGI24739J22299_100456973 | 69 |
| 239 | 3300001989 | JGI24739J22299_10085716 | JGI24739J22299_100857161 | 69 |
| 240 | 3300001990 | JGI24737J22298_10187079 | JGI24737J22298_101870792 | 69 |
| 241 | 3300001990 | JGI24737J22298_10189199 | JGI24737J22298_101891993 | 69 |
| 242 | 3300002067 | JGI24735J21928_10101112 | JGI24735J21928_101011123 | 69 |
| 243 | 3300002067 | JGI24735J21928_10163373 | JGI24735J21928_101633732 | 69 |
| 244 | 3300002075 | JGI24738J21930_10107785 | JGI24738J21930_101077852 | 69 |
| 245 | 3300002704 | JGI25155J39150_1000011 | JGI25155J39150_1000011205 | 69 |
| 246 | 3300002704 | JGI25155J39150_1000330 | JGI25155J39150_10003303 | 69 |
| 247 | 3300002705 | JGI25156J39149_1000030 | JGI25156J39149_1000030119 | 69 |
| 248 | 3300002705 | JGI25156J39149_1000795 | JGI25156J39149_100079516 | 69 |
| 249 | 3300002705 | JGI25156J39149_1002222 | JGI25156J39149_10022223 | 69 |
| 250 | 3300002705 | JGI25156J39149_1051441 | JGI25156J39149_10514411 | 69 |
| 251 | 3300002737 | JGI25162J39368_1000069 | JGI25162J39368_100006938 | 69 |
| 252 | 3300002737 | JGI25162J39368_1000476 | JGI25162J39368_100047630 | 69 |
| 253 | 3300002738 | JGI25154J39366_1000289 | JGI25154J39366_100028927 | 69 |
| 254 | 3300002738 | JGI25154J39366_1000696 | JGI25154J39366_100069616 | 69 |
| 255 | 3300002738 | JGI25154J39366_1020412 | JGI25154J39366_10204121 | 69 |
| 256 | 3300002739 | JGI25158J39367_1000188 | JGI25158J39367_100018819 | 69 |
| 257 | 3300002741 | JGI25157J39369_1000010 | JGI25157J39369_10000107 | 69 |
| 258 | 3300002741 | JGI25157J39369_1000786 | JGI25157J39369_10007865 | 69 |
| 259 | 3300002741 | JGI25157J39369_1002208 | JGI25157J39369_10022084 | 69 |
| 260 | 3300002773 | JGI25152J39213_1000001 | JGI25152J39213_10000011 | 69 |
| 261 | 3300002773 | JGI25152J39213_1000013 | JGI25152J39213_1000013126 | 69 |
| 262 | 3300002773 | JGI25152J39213_1000015 | JGI25152J39213_1000015108 | 69 |
| 263 | 3300002773 | JGI25152J39213_1000301 | JGI25152J39213_100030114 | 69 |
| 264 | 3300002773 | JGI25152J39213_1004424 | JGI25152J39213_10044244 | 69 |
| 265 | 3300002774 | JGI25150J39212_1000007 | JGI25150J39212_1000007231 | 69 |
| 266 | 3300002774 | JGI25150J39212_1000810 | JGI25150J39212_10008103 | 69 |
| 267 | 3300002868 | Ga0006767J43181_101308 | Ga0006767J43181_1013081 | 69 |
| 268 | 3300002870 | Ga0006763J43179_100527 | Ga0006763J43179_1005271 | 69 |
| 269 | 3300002987 | JGI25159J45721_1000133 | JGI25159J45721_10001335 | 69 |
| 270 | 3300002987 | JGI25159J45721_1001957 | JGI25159J45721_10019577 | 69 |
| 271 | 3300002987 | JGI25159J45721_1002071 | JGI25159J45721_10020711 | 69 |
| 272 | 3300003163 | Ga0006759J45824_1001793 | Ga0006759J45824_10017931 | 69 |
| 273 | 3300003187 | JGI25151J46595_10000013 | JGI25151J46595_10000013234 | 69 |
| 274 | 3300003187 | JGI25151J46595_10000110 | JGI25151J46595_100001108 | 69 |
| 275 | 3300003187 | JGI25151J46595_10005211 | JGI25151J46595_100052112 | 69 |
| 276 | 3300003187 | JGI25151J46595_10022787 | JGI25151J46595_100227877 | 69 |
| 277 | 3300003187 | JGI25151J46595_10053839 | JGI25151J46595_100538393 | 69 |
| 278 | 3300003214 | JGI25165J46597_1000006 | JGI25165J46597_1000006247 | 69 |
| 279 | 3300003214 | JGI25165J46597_1000018 | JGI25165J46597_1000018112 | 69 |
| 280 | 3300003214 | JGI25165J46597_1000068 | JGI25165J46597_100006865 | 69 |
| 281 | 3300003215 | JGI25153J46596_10000378 | JGI25153J46596_1000037828 | 69 |
| 282 | 3300003215 | JGI25153J46596_10000437 | JGI25153J46596_1000043732 | 69 |
| 283 | 3300003215 | JGI25153J46596_10001081 | JGI25153J46596_100010814 | 69 |
| 284 | 3300003215 | JGI25153J46596_10047561 | JGI25153J46596_100475611 | 69 |
| 285 | 3300003300 | Ga0006758J48902_1000593 | Ga0006758J48902_10005931 | 69 |
| 286 | 3300003308 | Ga0006777J48905_1004194 | Ga0006777J48905_10041941 | 69 |
| 287 | 3300003316 | rootH1_10061686 | rootH1_100616863 | 69 |
| 288 | 3300003320 | rootH2_10039599 | rootH2_1003959914 | 69 |
| 289 | 3300003320 | rootH2_10130185 | rootH2_101301856 | 69 |
| 290 | 3300003322 | rootL2_10002287 | rootL2_100022871 | 69 |
| 291 | 3300003322 | rootL2_10149362 | rootL2_101493626 | 69 |
| 292 | 3300003323 | rootH1_10078983 | rootH1_100789836 | 69 |
| 293 | 3300003354 | JGI25160J50197_1000300 | JGI25160J50197_100030037 | 69 |
| 294 | 3300003354 | JGI25160J50197_1067736 | JGI25160J50197_10677361 | 69 |
| 295 | 3300003374 | JGI25161J50226_1000026 | JGI25161J50226_100002622 | 69 |
| 296 | 3300003559 | Ga0007427J51700_100616 | Ga0007427J51700_1006161 | 69 |
| 297 | 3300003578 | Ga0006562J51391_1000820 | Ga0006562J51391_10008204 | 69 |
| 298 | 3300003693 | Ga0032354_1014652 | Ga0032354_10146521 | 69 |
| 299 | 3300003693 | Ga0032354_1023888 | Ga0032354_10238881 | 69 |
| 300 | 3300003693 | Ga0032354_1032325 | Ga0032354_10323251 | 69 |
| 301 | 3300003717 | Ga0006766_105963 | Ga0006766_1059631 | 69 |
| 302 | 3300003735 | Ga0006780_1010778 | Ga0006780_10107781 | 69 |
| 303 | 3300003771 | Ga0055526_1000385 | Ga0055526_100038524 | 69 |
| 304 | 3300003771 | Ga0055526_1000755 | Ga0055526_10007554 | 69 |
| 305 | 3300003771 | Ga0055526_1000922 | Ga0055526_100092230 | 69 |
| 306 | 3300003771 | Ga0055526_1014497 | Ga0055526_10144971 | 69 |
| 307 | 3300003771 | Ga0055526_1022880 | Ga0055526_10228802 | 69 |
| 308 | 3300003771 | Ga0055526_1040784 | Ga0055526_10407841 | 69 |
| 309 | 3300003775 | Ga0055524_1000208 | Ga0055524_100020861 | 69 |
| 310 | 3300003775 | Ga0055524_1002743 | Ga0055524_10027432 | 69 |
| 311 | 3300003775 | Ga0055524_1002804 | Ga0055524_10028047 | 69 |
| 312 | 3300003775 | Ga0055524_1005658 | Ga0055524_10056583 | 69 |
| 313 | 3300003775 | Ga0055524_1043618 | Ga0055524_10436182 | 69 |
| 314 | 3300003781 | Ga0055536_1008548 | Ga0055536_10085484 | 69 |
| 315 | 3300003784 | Ga0055534_1016321 | Ga0055534_10163212 | 69 |
| 316 | 3300003790 | Ga0055528_1000716 | Ga0055528_10007162 | 69 |
| 317 | 3300003790 | Ga0055528_1001208 | Ga0055528_100120816 | 69 |
| 318 | 3300003790 | Ga0055528_1005621 | Ga0055528_10056214 | 69 |
| 319 | 3300003790 | Ga0055528_1011838 | Ga0055528_10118385 | 69 |
| 320 | 3300003790 | Ga0055528_1011997 | Ga0055528_10119977 | 69 |
| 321 | 3300003791 | Ga0055530_10009766 | Ga0055530_100097664 | 69 |
| 322 | 3300003792 | Ga0055540_1001255 | Ga0055540_10012555 | 69 |
| 323 | 3300003792 | Ga0055540_1001932 | Ga0055540_100193216 | 69 |
| 324 | 3300003792 | Ga0055540_1001991 | Ga0055540_10019912 | 69 |
| 325 | 3300003792 | Ga0055540_1090854 | Ga0055540_10908541 | 69 |
| 326 | 3300003794 | Ga0055531_10008208 | Ga0055531_100082087 | 69 |
| 327 | 3300003794 | Ga0055531_10064848 | Ga0055531_100648483 | 69 |
| 328 | 3300003856 | Ga0058692_1001660 | Ga0058692_10016607 | 69 |
| 329 | 3300003856 | Ga0058692_1002829 | Ga0058692_10028294 | 69 |
| 330 | 3300003856 | Ga0058692_1050931 | Ga0058692_10509311 | 69 |
| 331 | 3300004625 | Ga0055543_1000085 | Ga0055543_100008582 | 69 |
| 332 | 3300004625 | Ga0055543_1006378 | Ga0055543_10063784 | 69 |
| 333 | 3300004625 | Ga0055543_1020485 | Ga0055543_10204853 | 69 |
| 334 | 3300005262 | Ga0065165_1000777 | Ga0065165_100077718 | 69 |
| 335 | 3300005262 | Ga0065165_1001054 | Ga0065165_100105416 | 69 |
| 336 | 3300005262 | Ga0065165_1001529 | Ga0065165_100152917 | 69 |
| 337 | 3300005262 | Ga0065165_1003064 | Ga0065165_100306415 | 69 |
| 338 | 3300005262 | Ga0065165_1006194 | Ga0065165_10061944 | 69 |
| 339 | 3300005289 | Ga0065704_10006703 | Ga0065704_100067037 | 69 |
| 340 | 3300005327 | Ga0070658_10039686 | Ga0070658_100396864 | 69 |
| 341 | 3300005327 | Ga0070658_10272484 | Ga0070658_102724843 | 69 |
| 342 | 3300005328 | Ga0070676_10233713 | Ga0070676_102337131 | 69 |
| 343 | 3300005328 | Ga0070676_10657123 | Ga0070676_106571232 | 69 |
| 344 | 3300005329 | Ga0070683_100061536 | Ga0070683_1000615362 | 69 |
| 345 | 3300005331 | Ga0070670_100327420 | Ga0070670_1003274202 | 69 |
| 346 | 3300005331 | Ga0070670_100492354 | Ga0070670_1004923542 | 69 |
| 347 | 3300005334 | Ga0068869_100780617 | Ga0068869_1007806172 | 69 |
| 348 | 3300005335 | Ga0070666_10488704 | Ga0070666_104887042 | 69 |
| 349 | 3300005335 | Ga0070666_10666486 | Ga0070666_106664862 | 69 |
| 350 | 3300005336 | Ga0070680_100025420 | Ga0070680_1000254205 | 69 |
| 351 | 3300005337 | Ga0070682_100158227 | Ga0070682_1001582271 | 69 |
| 352 | 3300005337 | Ga0070682_100459445 | Ga0070682_1004594452 | 69 |
| 353 | 3300005337 | Ga0070682_100577631 | Ga0070682_1005776312 | 69 |
| 354 | 3300005337 | Ga0070682_100697167 | Ga0070682_1006971672 | 69 |
| 355 | 3300005337 | Ga0070682_100865942 | Ga0070682_1008659421 | 69 |
| 356 | 3300005337 | Ga0070682_101211643 | Ga0070682_1012116432 | 69 |
| 357 | 3300005338 | Ga0068868_101114712 | Ga0068868_1011147122 | 69 |
| 358 | 3300005339 | Ga0070660_100004682 | Ga0070660_1000046829 | 69 |
| 359 | 3300005339 | Ga0070660_100411100 | Ga0070660_1004111001 | 69 |
| 360 | 3300005341 | Ga0070691_10423161 | Ga0070691_104231611 | 69 |
| 361 | 3300005341 | Ga0070691_10912275 | Ga0070691_109122752 | 69 |
| 362 | 3300005344 | Ga0070661_100090662 | Ga0070661_1000906622 | 69 |
| 363 | 3300005344 | Ga0070661_101296377 | Ga0070661_1012963771 | 69 |
| 364 | 3300005344 | Ga0070661_101786598 | Ga0070661_1017865981 | 69 |
| 365 | 3300005345 | Ga0070692_10829648 | Ga0070692_108296481 | 69 |
| 366 | 3300005347 | Ga0070668_100336439 | Ga0070668_1003364392 | 69 |
| 367 | 3300005347 | Ga0070668_100549735 | Ga0070668_1005497351 | 69 |
| 368 | 3300005347 | Ga0070668_100757294 | Ga0070668_1007572942 | 69 |
| 369 | 3300005347 | Ga0070668_100996973 | Ga0070668_1009969731 | 69 |
| 370 | 3300005347 | Ga0070668_101503784 | Ga0070668_1015037842 | 69 |
| 371 | 3300005347 | Ga0070668_101809691 | Ga0070668_1018096911 | 69 |
| 372 | 3300005353 | Ga0070669_101031725 | Ga0070669_1010317252 | 69 |
| 373 | 3300005353 | Ga0070669_101102288 | Ga0070669_1011022882 | 69 |
| 374 | 3300005353 | Ga0070669_101622792 | Ga0070669_1016227921 | 69 |
| 375 | 3300005355 | Ga0070671_101754663 | Ga0070671_1017546631 | 69 |
| 376 | 3300005355 | Ga0070671_101777485 | Ga0070671_1017774851 | 69 |
| 377 | 3300005356 | Ga0070674_100228616 | Ga0070674_1002286162 | 69 |
| 378 | 3300005356 | Ga0070674_100902288 | Ga0070674_1009022881 | 69 |
| 379 | 3300005356 | Ga0070674_101104155 | Ga0070674_1011041552 | 69 |
| 380 | 3300005356 | Ga0070674_101274462 | Ga0070674_1012744622 | 69 |
| 381 | 3300005364 | Ga0070673_100189893 | Ga0070673_1001898932 | 69 |
| 382 | 3300005365 | Ga0070688_100406709 | Ga0070688_1004067092 | 69 |
| 383 | 3300005365 | Ga0070688_100591804 | Ga0070688_1005918042 | 69 |
| 384 | 3300005365 | Ga0070688_101487784 | Ga0070688_1014877841 | 69 |
| 385 | 3300005366 | Ga0070659_100115257 | Ga0070659_1001152572 | 69 |
| 386 | 3300005366 | Ga0070659_100927678 | Ga0070659_1009276782 | 69 |
| 387 | 3300005366 | Ga0070659_101113855 | Ga0070659_1011138551 | 69 |
| 388 | 3300005367 | Ga0070667_100842051 | Ga0070667_1008420511 | 69 |
| 389 | 3300005434 | Ga0070709_10134473 | Ga0070709_101344732 | 69 |
| 390 | 3300005435 | Ga0070714_100030577 | Ga0070714_1000305773 | 69 |
| 391 | 3300005436 | Ga0070713_101698664 | Ga0070713_1016986641 | 69 |
| 392 | 3300005437 | Ga0070710_11253951 | Ga0070710_112539511 | 69 |
| 393 | 3300005438 | Ga0070701_10508213 | Ga0070701_105082132 | 69 |
| 394 | 3300005439 | Ga0070711_100476977 | Ga0070711_1004769771 | 69 |
| 395 | 3300005439 | Ga0070711_100599482 | Ga0070711_1005994821 | 69 |
| 396 | 3300005440 | Ga0070705_100366232 | Ga0070705_1003662322 | 69 |
| 397 | 3300005440 | Ga0070705_101254736 | Ga0070705_1012547361 | 69 |
| 398 | 3300005441 | Ga0070700_100306874 | Ga0070700_1003068742 | 69 |
| 399 | 3300005441 | Ga0070700_100347399 | Ga0070700_1003473992 | 69 |
| 400 | 3300005441 | Ga0070700_101144688 | Ga0070700_1011446881 | 69 |
| 401 | 3300005444 | Ga0070694_101700448 | Ga0070694_1017004481 | 69 |
| 402 | 3300005445 | Ga0070708_100063270 | Ga0070708_1000632702 | 69 |
| 403 | 3300005455 | Ga0070663_100164844 | Ga0070663_1001648441 | 69 |
| 404 | 3300005455 | Ga0070663_100521433 | Ga0070663_1005214332 | 69 |
| 405 | 3300005455 | Ga0070663_101061914 | Ga0070663_1010619142 | 69 |
| 406 | 3300005455 | Ga0070663_101086581 | Ga0070663_1010865811 | 69 |
| 407 | 3300005455 | Ga0070663_101215199 | Ga0070663_1012151992 | 69 |
| 408 | 3300005456 | Ga0070678_100317287 | Ga0070678_1003172871 | 69 |
| 409 | 3300005456 | Ga0070678_100687664 | Ga0070678_1006876641 | 69 |
| 410 | 3300005456 | Ga0070678_100791054 | Ga0070678_1007910542 | 69 |
| 411 | 3300005457 | Ga0070662_100590274 | Ga0070662_1005902742 | 69 |
| 412 | 3300005457 | Ga0070662_100819153 | Ga0070662_1008191532 | 69 |
| 413 | 3300005459 | Ga0068867_100076157 | Ga0068867_1000761571 | 69 |
| 414 | 3300005459 | Ga0068867_100872840 | Ga0068867_1008728402 | 69 |
| 415 | 3300005459 | Ga0068867_102342585 | Ga0068867_1023425851 | 69 |
| 416 | 3300005467 | Ga0070706_100848581 | Ga0070706_1008485811 | 69 |
| 417 | 3300005467 | Ga0070706_101684089 | Ga0070706_1016840891 | 69 |
| 418 | 3300005468 | Ga0070707_100057080 | Ga0070707_1000570804 | 69 |
| 419 | 3300005468 | Ga0070707_102201363 | Ga0070707_1022013631 | 69 |
| 420 | 3300005471 | Ga0070698_100313544 | Ga0070698_1003135442 | 69 |
| 421 | 3300005471 | Ga0070698_100496052 | Ga0070698_1004960521 | 69 |
| 422 | 3300005518 | Ga0070699_100142677 | Ga0070699_1001426771 | 69 |
| 423 | 3300005530 | Ga0070679_100346942 | Ga0070679_1003469422 | 69 |
| 424 | 3300005530 | Ga0070679_100777677 | Ga0070679_1007776772 | 69 |
| 425 | 3300005530 | Ga0070679_101969212 | Ga0070679_1019692121 | 69 |
| 426 | 3300005535 | Ga0070684_100043633 | Ga0070684_1000436332 | 69 |
| 427 | 3300005536 | Ga0070697_100338087 | Ga0070697_1003380872 | 69 |
| 428 | 3300005536 | Ga0070697_100866005 | Ga0070697_1008660051 | 69 |
| 429 | 3300005539 | Ga0068853_100007383 | Ga0068853_1000073839 | 69 |
| 430 | 3300005539 | Ga0068853_100150401 | Ga0068853_1001504013 | 69 |
| 431 | 3300005539 | Ga0068853_100232122 | Ga0068853_1002321222 | 69 |
| 432 | 3300005539 | Ga0068853_100473679 | Ga0068853_1004736793 | 69 |
| 433 | 3300005543 | Ga0070672_100434179 | Ga0070672_1004341793 | 69 |
| 434 | 3300005543 | Ga0070672_101108436 | Ga0070672_1011084362 | 69 |
| 435 | 3300005543 | Ga0070672_101912571 | Ga0070672_1019125712 | 69 |
| 436 | 3300005546 | Ga0070696_101009071 | Ga0070696_1010090711 | 69 |
| 437 | 3300005548 | Ga0070665_100010030 | Ga0070665_1000100307 | 69 |
| 438 | 3300005548 | Ga0070665_100011730 | Ga0070665_1000117309 | 69 |
| 439 | 3300005548 | Ga0070665_100129470 | Ga0070665_1001294705 | 69 |
| 440 | 3300005548 | Ga0070665_100171160 | Ga0070665_1001711605 | 69 |
| 441 | 3300005548 | Ga0070665_100275615 | Ga0070665_1002756152 | 69 |
| 442 | 3300005548 | Ga0070665_100430736 | Ga0070665_1004307362 | 69 |
| 443 | 3300005548 | Ga0070665_101051388 | Ga0070665_1010513882 | 69 |
| 444 | 3300005548 | Ga0070665_101066579 | Ga0070665_1010665791 | 69 |
| 445 | 3300005548 | Ga0070665_101092863 | Ga0070665_1010928632 | 69 |
| 446 | 3300005549 | Ga0070704_100666717 | Ga0070704_1006667172 | 69 |
| 447 | 3300005563 | Ga0068855_100167683 | Ga0068855_1001676833 | 69 |
| 448 | 3300005563 | Ga0068855_100749453 | Ga0068855_1007494532 | 69 |
| 449 | 3300005563 | Ga0068855_101713595 | Ga0068855_1017135951 | 69 |
| 450 | 3300005564 | Ga0070664_100370331 | Ga0070664_1003703313 | 69 |
| 451 | 3300005564 | Ga0070664_101253071 | Ga0070664_1012530712 | 69 |
| 452 | 3300005577 | Ga0068857_100038424 | Ga0068857_1000384245 | 69 |
| 453 | 3300005577 | Ga0068857_100439499 | Ga0068857_1004394991 | 69 |
| 454 | 3300005577 | Ga0068857_101954682 | Ga0068857_1019546821 | 69 |
| 455 | 3300005578 | Ga0068854_101426848 | Ga0068854_1014268481 | 69 |
| 456 | 3300005614 | Ga0068856_100000651 | Ga0068856_10000065110 | 69 |
| 457 | 3300005614 | Ga0068856_100036991 | Ga0068856_1000369914 | 69 |
| 458 | 3300005614 | Ga0068856_100739727 | Ga0068856_1007397272 | 69 |
| 459 | 3300005614 | Ga0068856_100886621 | Ga0068856_1008866212 | 69 |
| 460 | 3300005616 | Ga0068852_100002449 | Ga0068852_1000024495 | 69 |
| 461 | 3300005616 | Ga0068852_100583092 | Ga0068852_1005830922 | 69 |
| 462 | 3300005616 | Ga0068852_100678940 | Ga0068852_1006789402 | 69 |
| 463 | 3300005616 | Ga0068852_101991358 | Ga0068852_1019913581 | 69 |
| 464 | 3300005617 | Ga0068859_100321492 | Ga0068859_1003214921 | 69 |
| 465 | 3300005617 | Ga0068859_100940427 | Ga0068859_1009404272 | 69 |
| 466 | 3300005618 | Ga0068864_100884327 | Ga0068864_1008843272 | 69 |
| 467 | 3300005718 | Ga0068866_10524739 | Ga0068866_105247392 | 69 |
| 468 | 3300005718 | Ga0068866_10611223 | Ga0068866_106112232 | 69 |
| 469 | 3300005719 | Ga0068861_100152859 | Ga0068861_1001528592 | 69 |
| 470 | 3300005719 | Ga0068861_102158497 | Ga0068861_1021584972 | 69 |
| 471 | 3300005834 | Ga0068851_10002569 | Ga0068851_100025692 | 69 |
| 472 | 3300005834 | Ga0068851_10912857 | Ga0068851_109128571 | 69 |
| 473 | 3300005840 | Ga0068870_11343312 | Ga0068870_113433122 | 69 |
| 474 | 3300005841 | Ga0068863_100385697 | Ga0068863_1003856972 | 69 |
| 475 | 3300005842 | Ga0068858_100565271 | Ga0068858_1005652712 | 69 |
| 476 | 3300005842 | Ga0068858_101235566 | Ga0068858_1012355662 | 69 |
| 477 | 3300005843 | Ga0068860_101297974 | Ga0068860_1012979742 | 69 |
| 478 | 3300005844 | Ga0068862_100941012 | Ga0068862_1009410121 | 69 |
| 479 | 3300005844 | Ga0068862_101166870 | Ga0068862_1011668702 | 69 |
| 480 | 3300005844 | Ga0068862_101436506 | Ga0068862_1014365062 | 69 |
| 481 | 3300006028 | Ga0070717_10226297 | Ga0070717_102262972 | 69 |
| 482 | 3300006038 | Ga0075365_10077588 | Ga0075365_100775882 | 69 |
| 483 | 3300006038 | Ga0075365_10311375 | Ga0075365_103113752 | 69 |
| 484 | 3300006038 | Ga0075365_10435417 | Ga0075365_104354172 | 69 |
| 485 | 3300006038 | Ga0075365_10441009 | Ga0075365_104410091 | 69 |
| 486 | 3300006038 | Ga0075365_10607957 | Ga0075365_106079571 | 69 |
| 487 | 3300006038 | Ga0075365_10845685 | Ga0075365_108456852 | 69 |
| 488 | 3300006038 | Ga0075365_11018704 | Ga0075365_110187042 | 69 |
| 489 | 3300006042 | Ga0075368_10019912 | Ga0075368_100199124 | 69 |
| 490 | 3300006042 | Ga0075368_10488389 | Ga0075368_104883892 | 69 |
| 491 | 3300006048 | Ga0075363_100045350 | Ga0075363_1000453504 | 69 |
| 492 | 3300006048 | Ga0075363_100341400 | Ga0075363_1003414001 | 69 |
| 493 | 3300006051 | Ga0075364_10000320 | Ga0075364_100003207 | 69 |
| 494 | 3300006051 | Ga0075364_10069975 | Ga0075364_100699752 | 69 |
| 495 | 3300006051 | Ga0075364_10120941 | Ga0075364_101209412 | 69 |
| 496 | 3300006051 | Ga0075364_10149731 | Ga0075364_101497313 | 69 |
| 497 | 3300006051 | Ga0075364_10333638 | Ga0075364_103336382 | 69 |
| 498 | 3300006051 | Ga0075364_10557811 | Ga0075364_105578112 | 69 |
| 499 | 3300006051 | Ga0075364_10753009 | Ga0075364_107530091 | 69 |
| 500 | 3300006051 | Ga0075364_11224085 | Ga0075364_112240851 | 69 |
| 501 | 3300006058 | Ga0075432_10171685 | Ga0075432_101716851 | 69 |
| 502 | 3300006058 | Ga0075432_10380921 | Ga0075432_103809211 | 69 |
| 503 | 3300006177 | Ga0075362_10179934 | Ga0075362_101799342 | 69 |
| 504 | 3300006177 | Ga0075362_10191992 | Ga0075362_101919922 | 69 |
| 505 | 3300006177 | Ga0075362_10339392 | Ga0075362_103393922 | 69 |
| 506 | 3300006178 | Ga0075367_10053258 | Ga0075367_100532584 | 69 |
| 507 | 3300006178 | Ga0075367_10158743 | Ga0075367_101587432 | 69 |
| 508 | 3300006178 | Ga0075367_10259649 | Ga0075367_102596491 | 69 |
| 509 | 3300006178 | Ga0075367_10340727 | Ga0075367_103407272 | 69 |
| 510 | 3300006178 | Ga0075367_10415412 | Ga0075367_104154122 | 69 |
| 511 | 3300006178 | Ga0075367_10495465 | Ga0075367_104954652 | 69 |
| 512 | 3300006186 | Ga0075369_10033975 | Ga0075369_100339753 | 69 |
| 513 | 3300006186 | Ga0075369_10229622 | Ga0075369_102296221 | 69 |
| 514 | 3300006186 | Ga0075369_10230793 | Ga0075369_102307932 | 69 |
| 515 | 3300006186 | Ga0075369_10347070 | Ga0075369_103470702 | 69 |
| 516 | 3300006186 | Ga0075369_10494535 | Ga0075369_104945352 | 69 |
| 517 | 3300006195 | Ga0075366_10322383 | Ga0075366_103223832 | 69 |
| 518 | 3300006195 | Ga0075366_10367725 | Ga0075366_103677252 | 69 |
| 519 | 3300006195 | Ga0075366_10891196 | Ga0075366_108911962 | 69 |
| 520 | 3300006237 | Ga0097621_101167118 | Ga0097621_1011671182 | 69 |
| 521 | 3300006353 | Ga0075370_10018171 | Ga0075370_100181715 | 69 |
| 522 | 3300006353 | Ga0075370_10097282 | Ga0075370_100972826 | 69 |
| 523 | 3300006353 | Ga0075370_10129730 | Ga0075370_101297301 | 69 |
| 524 | 3300006353 | Ga0075370_10181643 | Ga0075370_101816432 | 69 |
| 525 | 3300006353 | Ga0075370_10203448 | Ga0075370_102034482 | 69 |
| 526 | 3300006353 | Ga0075370_10341172 | Ga0075370_103411722 | 69 |
| 527 | 3300006353 | Ga0075370_10476095 | Ga0075370_104760952 | 69 |
| 528 | 3300006353 | Ga0075370_10892697 | Ga0075370_108926971 | 69 |
| 529 | 3300006353 | Ga0075370_10916021 | Ga0075370_109160211 | 69 |
| 530 | 3300006353 | Ga0075370_10946572 | Ga0075370_109465721 | 69 |
| 531 | 3300006358 | Ga0068871_101189418 | Ga0068871_1011894181 | 69 |
| 532 | 3300006358 | Ga0068871_101488021 | Ga0068871_1014880212 | 69 |
| 533 | 3300006358 | Ga0068871_101854791 | Ga0068871_1018547912 | 69 |
| 534 | 3300006844 | Ga0075428_101083300 | Ga0075428_1010833002 | 69 |
| 535 | 3300006846 | Ga0075430_100938742 | Ga0075430_1009387421 | 69 |
| 536 | 3300006881 | Ga0068865_100201405 | Ga0068865_1002014052 | 69 |
| 537 | 3300006881 | Ga0068865_100224699 | Ga0068865_1002246993 | 69 |
| 538 | 3300006881 | Ga0068865_100335828 | Ga0068865_1003358282 | 69 |
| 539 | 3300006881 | Ga0068865_100782959 | Ga0068865_1007829592 | 69 |
| 540 | 3300006881 | Ga0068865_101963691 | Ga0068865_1019636911 | 69 |
| 541 | 3300006931 | Ga0097620_100321510 | Ga0097620_1003215102 | 69 |
| 542 | 3300006931 | Ga0097620_100940446 | Ga0097620_1009404462 | 69 |
| 543 | 3300006946 | Ga0079104_1002834 | Ga0079104_10028347 | 69 |
| 544 | 3300006946 | Ga0079104_1004884 | Ga0079104_10048843 | 69 |
| 545 | 3300006948 | Ga0099826_10000040 | Ga0099826_1000004063 | 69 |
| 546 | 3300006948 | Ga0099826_10013124 | Ga0099826_100131248 | 69 |
| 547 | 3300006948 | Ga0099826_10154666 | Ga0099826_101546661 | 69 |
| 548 | 3300007265 | Ga0099794_10031348 | Ga0099794_100313483 | 69 |
| 549 | 3300007265 | Ga0099794_10156085 | Ga0099794_101560851 | 69 |
| 550 | 3300007788 | Ga0099795_10071229 | Ga0099795_100712292 | 69 |
| 551 | 3300007788 | Ga0099795_10314917 | Ga0099795_103149172 | 69 |
| 552 | 3300009036 | Ga0105244_10260270 | Ga0105244_102602702 | 69 |
| 553 | 3300009092 | Ga0105250_10195860 | Ga0105250_101958602 | 69 |
| 554 | 3300009093 | Ga0105240_10016396 | Ga0105240_100163964 | 69 |
| 555 | 3300009093 | Ga0105240_10038936 | Ga0105240_100389363 | 69 |
| 556 | 3300009093 | Ga0105240_10076364 | Ga0105240_100763645 | 69 |
| 557 | 3300009093 | Ga0105240_11056313 | Ga0105240_110563132 | 69 |
| 558 | 3300009093 | Ga0105240_11330344 | Ga0105240_113303442 | 69 |
| 559 | 3300009094 | Ga0111539_10365680 | Ga0111539_103656802 | 69 |
| 560 | 3300009094 | Ga0111539_12143718 | Ga0111539_121437182 | 69 |
| 561 | 3300009098 | Ga0105245_10255993 | Ga0105245_102559932 | 69 |
| 562 | 3300009098 | Ga0105245_12418004 | Ga0105245_124180042 | 69 |
| 563 | 3300009098 | Ga0105245_13127780 | Ga0105245_131277801 | 69 |
| 564 | 3300009101 | Ga0105247_10406813 | Ga0105247_104068132 | 69 |
| 565 | 3300009101 | Ga0105247_10407874 | Ga0105247_104078742 | 69 |
| 566 | 3300009101 | Ga0105247_10823433 | Ga0105247_108234333 | 69 |
| 567 | 3300009147 | Ga0114129_10829415 | Ga0114129_108294152 | 69 |
| 568 | 3300009148 | Ga0105243_10387961 | Ga0105243_103879612 | 69 |
| 569 | 3300009148 | Ga0105243_10625283 | Ga0105243_106252831 | 69 |
| 570 | 3300009174 | Ga0105241_10161174 | Ga0105241_101611742 | 69 |
| 571 | 3300009174 | Ga0105241_10974714 | Ga0105241_109747141 | 69 |
| 572 | 3300009174 | Ga0105241_11519992 | Ga0105241_115199922 | 69 |
| 573 | 3300009174 | Ga0105241_12035785 | Ga0105241_120357851 | 69 |
| 574 | 3300009176 | Ga0105242_10401881 | Ga0105242_104018812 | 69 |
| 575 | 3300009176 | Ga0105242_11596121 | Ga0105242_115961211 | 69 |
| 576 | 3300009177 | Ga0105248_13106904 | Ga0105248_131069041 | 69 |
| 577 | 3300009545 | Ga0105237_10009263 | Ga0105237_100092639 | 69 |
| 578 | 3300009545 | Ga0105237_10086048 | Ga0105237_100860483 | 69 |
| 579 | 3300009545 | Ga0105237_10229457 | Ga0105237_102294574 | 69 |
| 580 | 3300009545 | Ga0105237_12715303 | Ga0105237_127153031 | 69 |
| 581 | 3300009551 | Ga0105238_10008521 | Ga0105238_100085215 | 69 |
| 582 | 3300009551 | Ga0105238_10079916 | Ga0105238_100799162 | 69 |
| 583 | 3300009551 | Ga0105238_10805939 | Ga0105238_108059392 | 69 |
| 584 | 3300009551 | Ga0105238_11913949 | Ga0105238_119139491 | 69 |
| 585 | 3300009551 | Ga0105238_12460429 | Ga0105238_124604291 | 69 |
| 586 | 3300009553 | Ga0105249_10628591 | Ga0105249_106285911 | 69 |
| 587 | 3300009553 | Ga0105249_11183471 | Ga0105249_111834711 | 69 |
| 588 | 3300009553 | Ga0105249_11562792 | Ga0105249_115627922 | 69 |
| 589 | 3300010159 | Ga0099796_10449343 | Ga0099796_104493431 | 69 |
| 590 | 3300010159 | Ga0099796_10461234 | Ga0099796_104612341 | 69 |
| 591 | 3300010159 | Ga0099796_10465944 | Ga0099796_104659442 | 69 |
| 592 | 3300010375 | Ga0105239_10077487 | Ga0105239_100774874 | 69 |
| 593 | 3300010375 | Ga0105239_10190814 | Ga0105239_101908141 | 69 |
| 594 | 3300010375 | Ga0105239_10259657 | Ga0105239_102596572 | 69 |
| 595 | 3300010375 | Ga0105239_11929401 | Ga0105239_119294011 | 69 |
| 596 | 3300010375 | Ga0105239_11982474 | Ga0105239_119824741 | 69 |
| 597 | 3300011119 | Ga0105246_10482571 | Ga0105246_104825712 | 69 |
| 598 | 3300012500 | Ga0157314_1002158 | Ga0157314_10021583 | 69 |
| 599 | 3300013100 | Ga0157373_10066042 | Ga0157373_100660423 | 69 |
| 600 | 3300013100 | Ga0157373_10107862 | Ga0157373_101078621 | 69 |
| 601 | 3300013100 | Ga0157373_10731187 | Ga0157373_107311872 | 69 |
| 602 | 3300013100 | Ga0157373_10813394 | Ga0157373_108133942 | 69 |
| 603 | 3300013102 | Ga0157371_10002849 | Ga0157371_1000284910 | 69 |
| 604 | 3300013104 | Ga0157370_10042298 | Ga0157370_100422983 | 69 |
| 605 | 3300013104 | Ga0157370_10225131 | Ga0157370_102251312 | 69 |
| 606 | 3300013104 | Ga0157370_11133646 | Ga0157370_111336462 | 69 |
| 607 | 3300013105 | Ga0157369_10029343 | Ga0157369_100293437 | 69 |
| 608 | 3300013105 | Ga0157369_10058855 | Ga0157369_100588553 | 69 |
| 609 | 3300013105 | Ga0157369_10144676 | Ga0157369_101446764 | 69 |
| 610 | 3300013105 | Ga0157369_11200497 | Ga0157369_112004972 | 69 |
| 611 | 3300013249 | Ga0171463_1003 | Ga0171463_1003306 | 69 |
| 612 | 3300013296 | Ga0157374_10376181 | Ga0157374_103761811 | 69 |
| 613 | 3300013296 | Ga0157374_11085245 | Ga0157374_110852452 | 69 |
| 614 | 3300013296 | Ga0157374_11336775 | Ga0157374_113367752 | 69 |
| 615 | 3300013297 | Ga0157378_11016669 | Ga0157378_110166692 | 69 |
| 616 | 3300013297 | Ga0157378_11776161 | Ga0157378_117761612 | 69 |
| 617 | 3300013297 | Ga0157378_12831116 | Ga0157378_128311161 | 69 |
| 618 | 3300013306 | Ga0163162_10060142 | Ga0163162_100601422 | 69 |
| 619 | 3300013306 | Ga0163162_11533273 | Ga0163162_115332732 | 69 |
| 620 | 3300013306 | Ga0163162_12300561 | Ga0163162_123005611 | 69 |
| 621 | 3300013307 | Ga0157372_10582434 | Ga0157372_105824341 | 69 |
| 622 | 3300013308 | Ga0157375_11585474 | Ga0157375_115854741 | 69 |
| 623 | 3300014325 | Ga0163163_11558662 | Ga0163163_115586622 | 69 |
| 624 | 3300014325 | Ga0163163_13025160 | Ga0163163_130251601 | 69 |
| 625 | 3300014326 | Ga0157380_10192376 | Ga0157380_101923762 | 69 |
| 626 | 3300014326 | Ga0157380_10748488 | Ga0157380_107484882 | 69 |
| 627 | 3300014326 | Ga0157380_10902202 | Ga0157380_109022022 | 69 |
| 628 | 3300014497 | Ga0182008_10508635 | Ga0182008_105086351 | 69 |
| 629 | 3300014497 | Ga0182008_10830994 | Ga0182008_108309941 | 69 |
| 630 | 3300014745 | Ga0157377_10449732 | Ga0157377_104497322 | 69 |
| 631 | 3300014968 | Ga0157379_10205386 | Ga0157379_102053863 | 69 |
| 632 | 3300014969 | Ga0157376_10290978 | Ga0157376_102909782 | 69 |
| 633 | 3300014969 | Ga0157376_10792461 | Ga0157376_107924612 | 69 |
| 634 | 3300014969 | Ga0157376_10986277 | Ga0157376_109862772 | 69 |
| 635 | 3300014969 | Ga0157376_11431980 | Ga0157376_114319801 | 69 |
| 636 | 3300014969 | Ga0157376_11944450 | Ga0157376_119444502 | 69 |
| 637 | 3300015684 | Ga0183365_11929 | Ga0183365_119291 | 69 |
| 638 | 3300015690 | Ga0183363_1168 | Ga0183363_116810 | 69 |
| 639 | 3300017792 | Ga0163161_10454435 | Ga0163161_104544352 | 69 |
| 640 | 3300019192 | Ga0184603_100425 | Ga0184603_1004252 | 69 |
| 641 | 3300020070 | Ga0206356_10018687 | Ga0206356_100186871 | 69 |
| 642 | 3300020077 | Ga0206351_10069610 | Ga0206351_100696101 | 69 |
| 643 | 3300020081 | Ga0206354_10465592 | Ga0206354_104655923 | 69 |
| 644 | 3300020610 | Ga0154015_1351868 | Ga0154015_13518682 | 69 |
| 645 | 3300021320 | Ga0214544_1000646 | Ga0214544_100064642 | 69 |
| 646 | 3300021321 | Ga0214542_1000027 | Ga0214542_100002748 | 69 |
| 647 | 3300021327 | Ga0214543_1000047 | Ga0214543_100004722 | 69 |
| 648 | 3300021327 | Ga0214543_1002177 | Ga0214543_100217727 | 69 |
| 649 | 3300021361 | Ga0213872_10058728 | Ga0213872_100587281 | 69 |
| 650 | 3300021384 | Ga0213876_10000865 | Ga0213876_100008655 | 69 |
| 651 | 3300021384 | Ga0213876_10035923 | Ga0213876_100359233 | 69 |
| 652 | 3300021388 | Ga0213875_10053600 | Ga0213875_100536002 | 69 |
| 653 | 3300022467 | Ga0224712_10615057 | Ga0224712_106150572 | 69 |
| 654 | 3300022739 | Ga0228711_1006836 | Ga0228711_100683618 | 69 |
| 655 | 3300022740 | Ga0228710_1006916 | Ga0228710_100691618 | 69 |
| 656 | 3300024227 | Ga0228598_1057208 | Ga0228598_10572081 | 69 |
| 657 | 3300025206 | Ga0209435_100022 | Ga0209435_1000225 | 69 |
| 658 | 3300025206 | Ga0209435_100086 | Ga0209435_10008627 | 69 |
| 659 | 3300025208 | Ga0209436_100016 | Ga0209436_10001618 | 69 |
| 660 | 3300025208 | Ga0209436_134582 | Ga0209436_1345822 | 69 |
| 661 | 3300025230 | Ga0209563_104597 | Ga0209563_1045972 | 69 |
| 662 | 3300025230 | Ga0209563_106926 | Ga0209563_1069261 | 69 |
| 663 | 3300025231 | Ga0207427_120023 | Ga0207427_1200231 | 69 |
| 664 | 3300025233 | Ga0209437_100022 | Ga0209437_100022174 | 69 |
| 665 | 3300025233 | Ga0209437_100067 | Ga0209437_100067141 | 69 |
| 666 | 3300025245 | Ga0207425_1000012 | Ga0207425_1000012157 | 69 |
| 667 | 3300025245 | Ga0207425_1000032 | Ga0207425_1000032231 | 69 |
| 668 | 3300025245 | Ga0207425_1003086 | Ga0207425_10030868 | 69 |
| 669 | 3300025245 | Ga0207425_1006874 | Ga0207425_10068748 | 69 |
| 670 | 3300025246 | Ga0209646_1000078 | Ga0209646_10000785 | 69 |
| 671 | 3300025246 | Ga0209646_1000279 | Ga0209646_100027927 | 69 |
| 672 | 3300025246 | Ga0209646_1004843 | Ga0209646_10048432 | 69 |
| 673 | 3300025246 | Ga0209646_1010572 | Ga0209646_10105721 | 69 |
| 674 | 3300025250 | Ga0209026_1000065 | Ga0209026_10000655 | 69 |
| 675 | 3300025250 | Ga0209026_1000089 | Ga0209026_1000089173 | 69 |
| 676 | 3300025250 | Ga0209026_1000341 | Ga0209026_100034127 | 69 |
| 677 | 3300025254 | Ga0209148_1003572 | Ga0209148_10035721 | 69 |
| 678 | 3300025254 | Ga0209148_1006083 | Ga0209148_10060832 | 69 |
| 679 | 3300025254 | Ga0209148_1041685 | Ga0209148_10416851 | 69 |
| 680 | 3300025256 | Ga0209759_1000055 | Ga0209759_10000555 | 69 |
| 681 | 3300025256 | Ga0209759_1000471 | Ga0209759_100047127 | 69 |
| 682 | 3300025256 | Ga0209759_1000539 | Ga0209759_100053933 | 69 |
| 683 | 3300025256 | Ga0209759_1013305 | Ga0209759_10133055 | 69 |
| 684 | 3300025256 | Ga0209759_1027489 | Ga0209759_10274892 | 69 |
| 685 | 3300025258 | Ga0209129_1000056 | Ga0209129_1000056231 | 69 |
| 686 | 3300025258 | Ga0209129_1000166 | Ga0209129_100016698 | 69 |
| 687 | 3300025258 | Ga0209129_1000453 | Ga0209129_100045328 | 69 |
| 688 | 3300025258 | Ga0209129_1001565 | Ga0209129_10015653 | 69 |
| 689 | 3300025258 | Ga0209129_1002345 | Ga0209129_10023455 | 69 |
| 690 | 3300025261 | Ga0209233_1000010 | Ga0209233_1000010828 | 69 |
| 691 | 3300025261 | Ga0209233_1000031 | Ga0209233_1000031174 | 69 |
| 692 | 3300025261 | Ga0209233_1000088 | Ga0209233_1000088141 | 69 |
| 693 | 3300025263 | Ga0209565_1050572 | Ga0209565_10505721 | 69 |
| 694 | 3300025272 | Ga0209455_1008214 | Ga0209455_10082144 | 69 |
| 695 | 3300025272 | Ga0209455_1036213 | Ga0209455_10362131 | 69 |
| 696 | 3300025273 | Ga0209673_1001400 | Ga0209673_10014002 | 69 |
| 697 | 3300025273 | Ga0209673_1002430 | Ga0209673_100243021 | 69 |
| 698 | 3300025273 | Ga0209673_1005708 | Ga0209673_10057088 | 69 |
| 699 | 3300025273 | Ga0209673_1007049 | Ga0209673_10070494 | 69 |
| 700 | 3300025273 | Ga0209673_1017468 | Ga0209673_10174681 | 69 |
| 701 | 3300025273 | Ga0209673_1047925 | Ga0209673_10479252 | 69 |
| 702 | 3300025284 | Ga0209130_1000049 | Ga0209130_1000049220 | 69 |
| 703 | 3300025284 | Ga0209130_1000264 | Ga0209130_100026437 | 69 |
| 704 | 3300025284 | Ga0209130_1001049 | Ga0209130_10010498 | 69 |
| 705 | 3300025291 | Ga0209675_1001620 | Ga0209675_100162015 | 69 |
| 706 | 3300025292 | Ga0209676_1002997 | Ga0209676_10029978 | 69 |
| 707 | 3300025294 | Ga0209025_1000016 | Ga0209025_1000016288 | 69 |
| 708 | 3300025294 | Ga0209025_1000024 | Ga0209025_1000024157 | 69 |
| 709 | 3300025294 | Ga0209025_1000090 | Ga0209025_1000090231 | 69 |
| 710 | 3300025294 | Ga0209025_1000336 | Ga0209025_1000336100 | 69 |
| 711 | 3300025294 | Ga0209025_1000374 | Ga0209025_100037465 | 69 |
| 712 | 3300025294 | Ga0209025_1000917 | Ga0209025_100091713 | 69 |
| 713 | 3300025294 | Ga0209025_1001912 | Ga0209025_100191225 | 69 |
| 714 | 3300025294 | Ga0209025_1003123 | Ga0209025_10031239 | 69 |
| 715 | 3300025294 | Ga0209025_1059125 | Ga0209025_10591252 | 69 |
| 716 | 3300025294 | Ga0209025_1060690 | Ga0209025_10606903 | 69 |
| 717 | 3300025295 | Ga0209564_1000023 | Ga0209564_1000023341 | 69 |
| 718 | 3300025295 | Ga0209564_1000354 | Ga0209564_100035487 | 69 |
| 719 | 3300025295 | Ga0209564_1000403 | Ga0209564_100040321 | 69 |
| 720 | 3300025295 | Ga0209564_1002352 | Ga0209564_10023523 | 69 |
| 721 | 3300025295 | Ga0209564_1002912 | Ga0209564_100291213 | 69 |
| 722 | 3300025297 | Ga0209758_1000084 | Ga0209758_1000084231 | 69 |
| 723 | 3300025297 | Ga0209758_1000150 | Ga0209758_10001508 | 69 |
| 724 | 3300025297 | Ga0209758_1000383 | Ga0209758_100038321 | 69 |
| 725 | 3300025297 | Ga0209758_1000396 | Ga0209758_100039645 | 69 |
| 726 | 3300025297 | Ga0209758_1001244 | Ga0209758_100124430 | 69 |
| 727 | 3300025297 | Ga0209758_1001532 | Ga0209758_10015323 | 69 |
| 728 | 3300025297 | Ga0209758_1018391 | Ga0209758_10183911 | 69 |
| 729 | 3300025297 | Ga0209758_1023867 | Ga0209758_10238672 | 69 |
| 730 | 3300025298 | Ga0209050_1006153 | Ga0209050_10061532 | 69 |
| 731 | 3300025299 | Ga0209256_1000042 | Ga0209256_1000042370 | 69 |
| 732 | 3300025299 | Ga0209256_1000176 | Ga0209256_100017666 | 69 |
| 733 | 3300025299 | Ga0209256_1000436 | Ga0209256_10004369 | 69 |
| 734 | 3300025299 | Ga0209256_1001515 | Ga0209256_10015152 | 69 |
| 735 | 3300025299 | Ga0209256_1001769 | Ga0209256_100176915 | 69 |
| 736 | 3300025299 | Ga0209256_1029391 | Ga0209256_10293912 | 69 |
| 737 | 3300025302 | Ga0207426_1000140 | Ga0207426_100014016 | 69 |
| 738 | 3300025302 | Ga0207426_1003465 | Ga0207426_10034659 | 69 |
| 739 | 3300025302 | Ga0207426_1008701 | Ga0207426_10087015 | 69 |
| 740 | 3300025303 | Ga0209051_1000202 | Ga0209051_100020250 | 69 |
| 741 | 3300025303 | Ga0209051_1002097 | Ga0209051_100209720 | 69 |
| 742 | 3300025303 | Ga0209051_1002339 | Ga0209051_10023394 | 69 |
| 743 | 3300025303 | Ga0209051_1047889 | Ga0209051_10478892 | 69 |
| 744 | 3300025304 | Ga0209257_1002210 | Ga0209257_10022108 | 69 |
| 745 | 3300025304 | Ga0209257_1026228 | Ga0209257_10262283 | 69 |
| 746 | 3300025315 | Ga0207697_10469124 | Ga0207697_104691242 | 69 |
| 747 | 3300025321 | Ga0207656_10289265 | Ga0207656_102892651 | 69 |
| 748 | 3300025898 | Ga0207692_10800031 | Ga0207692_108000311 | 69 |
| 749 | 3300025899 | Ga0207642_11108421 | Ga0207642_111084212 | 69 |
| 750 | 3300025900 | Ga0207710_10752476 | Ga0207710_107524762 | 69 |
| 751 | 3300025901 | Ga0207688_10038101 | Ga0207688_100381012 | 69 |
| 752 | 3300025903 | Ga0207680_10457350 | Ga0207680_104573502 | 69 |
| 753 | 3300025904 | Ga0207647_10020192 | Ga0207647_100201923 | 69 |
| 754 | 3300025904 | Ga0207647_10787280 | Ga0207647_107872803 | 69 |
| 755 | 3300025905 | Ga0207685_10599264 | Ga0207685_105992642 | 69 |
| 756 | 3300025906 | Ga0207699_10184842 | Ga0207699_101848423 | 69 |
| 757 | 3300025906 | Ga0207699_11316213 | Ga0207699_113162131 | 69 |
| 758 | 3300025907 | Ga0207645_10124466 | Ga0207645_101244663 | 69 |
| 759 | 3300025907 | Ga0207645_10314810 | Ga0207645_103148102 | 69 |
| 760 | 3300025908 | Ga0207643_10366596 | Ga0207643_103665961 | 69 |
| 761 | 3300025909 | Ga0207705_10314146 | Ga0207705_103141462 | 69 |
| 762 | 3300025909 | Ga0207705_10461712 | Ga0207705_104617121 | 69 |
| 763 | 3300025909 | Ga0207705_10483989 | Ga0207705_104839892 | 69 |
| 764 | 3300025910 | Ga0207684_10540691 | Ga0207684_105406912 | 69 |
| 765 | 3300025910 | Ga0207684_10558079 | Ga0207684_105580792 | 69 |
| 766 | 3300025910 | Ga0207684_10876246 | Ga0207684_108762461 | 69 |
| 767 | 3300025911 | Ga0207654_10122105 | Ga0207654_101221052 | 69 |
| 768 | 3300025912 | Ga0207707_10001548 | Ga0207707_100015485 | 69 |
| 769 | 3300025913 | Ga0207695_10026590 | Ga0207695_100265904 | 69 |
| 770 | 3300025913 | Ga0207695_10031741 | Ga0207695_100317415 | 69 |
| 771 | 3300025913 | Ga0207695_10234865 | Ga0207695_102348653 | 69 |
| 772 | 3300025913 | Ga0207695_10360149 | Ga0207695_103601492 | 69 |
| 773 | 3300025914 | Ga0207671_10128696 | Ga0207671_101286963 | 69 |
| 774 | 3300025914 | Ga0207671_10253836 | Ga0207671_102538361 | 69 |
| 775 | 3300025914 | Ga0207671_10321150 | Ga0207671_103211501 | 69 |
| 776 | 3300025914 | Ga0207671_10376419 | Ga0207671_103764191 | 69 |
| 777 | 3300025916 | Ga0207663_10472981 | Ga0207663_104729812 | 69 |
| 778 | 3300025916 | Ga0207663_11149460 | Ga0207663_111494602 | 69 |
| 779 | 3300025917 | Ga0207660_10235674 | Ga0207660_102356742 | 69 |
| 780 | 3300025918 | Ga0207662_10163992 | Ga0207662_101639922 | 69 |
| 781 | 3300025919 | Ga0207657_10003813 | Ga0207657_1000381316 | 69 |
| 782 | 3300025919 | Ga0207657_10637474 | Ga0207657_106374742 | 69 |
| 783 | 3300025920 | Ga0207649_11587350 | Ga0207649_115873501 | 69 |
| 784 | 3300025921 | Ga0207652_10807821 | Ga0207652_108078212 | 69 |
| 785 | 3300025921 | Ga0207652_10948362 | Ga0207652_109483621 | 69 |
| 786 | 3300025922 | Ga0207646_10052931 | Ga0207646_100529314 | 69 |
| 787 | 3300025923 | Ga0207681_10895929 | Ga0207681_108959292 | 69 |
| 788 | 3300025923 | Ga0207681_11489412 | Ga0207681_114894121 | 69 |
| 789 | 3300025924 | Ga0207694_10005521 | Ga0207694_100055215 | 69 |
| 790 | 3300025924 | Ga0207694_10082752 | Ga0207694_100827523 | 69 |
| 791 | 3300025924 | Ga0207694_11634681 | Ga0207694_116346811 | 69 |
| 792 | 3300025925 | Ga0207650_10413734 | Ga0207650_104137342 | 69 |
| 793 | 3300025926 | Ga0207659_10729929 | Ga0207659_107299292 | 69 |
| 794 | 3300025927 | Ga0207687_10302241 | Ga0207687_103022412 | 69 |
| 795 | 3300025929 | Ga0207664_10185455 | Ga0207664_101854552 | 69 |
| 796 | 3300025931 | Ga0207644_10715100 | Ga0207644_107151002 | 69 |
| 797 | 3300025931 | Ga0207644_11575578 | Ga0207644_115755781 | 69 |
| 798 | 3300025932 | Ga0207690_10230621 | Ga0207690_102306213 | 69 |
| 799 | 3300025932 | Ga0207690_10782027 | Ga0207690_107820271 | 69 |
| 800 | 3300025933 | Ga0207706_10241537 | Ga0207706_102415372 | 69 |
| 801 | 3300025934 | Ga0207686_11122443 | Ga0207686_111224433 | 69 |
| 802 | 3300025934 | Ga0207686_11264160 | Ga0207686_112641601 | 69 |
| 803 | 3300025935 | Ga0207709_10038819 | Ga0207709_100388194 | 69 |
| 804 | 3300025936 | Ga0207670_10177137 | Ga0207670_101771372 | 69 |
| 805 | 3300025936 | Ga0207670_11308611 | Ga0207670_113086111 | 69 |
| 806 | 3300025937 | Ga0207669_10093822 | Ga0207669_100938223 | 69 |
| 807 | 3300025937 | Ga0207669_10179754 | Ga0207669_101797541 | 69 |
| 808 | 3300025937 | Ga0207669_10645044 | Ga0207669_106450442 | 69 |
| 809 | 3300025938 | Ga0207704_10077449 | Ga0207704_100774492 | 69 |
| 810 | 3300025938 | Ga0207704_10407950 | Ga0207704_104079502 | 69 |
| 811 | 3300025939 | Ga0207665_10097692 | Ga0207665_100976922 | 69 |
| 812 | 3300025940 | Ga0207691_10162516 | Ga0207691_101625162 | 69 |
| 813 | 3300025940 | Ga0207691_10255411 | Ga0207691_102554112 | 69 |
| 814 | 3300025940 | Ga0207691_10412390 | Ga0207691_104123901 | 69 |
| 815 | 3300025942 | Ga0207689_10030772 | Ga0207689_100307723 | 69 |
| 816 | 3300025942 | Ga0207689_10534510 | Ga0207689_105345101 | 69 |
| 817 | 3300025944 | Ga0207661_10137427 | Ga0207661_101374272 | 69 |
| 818 | 3300025945 | Ga0207679_10374629 | Ga0207679_103746293 | 69 |
| 819 | 3300025949 | Ga0207667_10086152 | Ga0207667_100861523 | 69 |
| 820 | 3300025949 | Ga0207667_10593244 | Ga0207667_105932442 | 69 |
| 821 | 3300025949 | Ga0207667_10806942 | Ga0207667_108069421 | 69 |
| 822 | 3300025960 | Ga0207651_10744256 | Ga0207651_107442561 | 69 |
| 823 | 3300025960 | Ga0207651_10848228 | Ga0207651_108482282 | 69 |
| 824 | 3300025960 | Ga0207651_11090557 | Ga0207651_110905572 | 69 |
| 825 | 3300025961 | Ga0207712_11310577 | Ga0207712_113105771 | 69 |
| 826 | 3300025972 | Ga0207668_10416394 | Ga0207668_104163942 | 69 |
| 827 | 3300025972 | Ga0207668_10652805 | Ga0207668_106528052 | 69 |
| 828 | 3300025972 | Ga0207668_10667885 | Ga0207668_106678852 | 69 |
| 829 | 3300025972 | Ga0207668_10833030 | Ga0207668_108330302 | 69 |
| 830 | 3300025972 | Ga0207668_10853263 | Ga0207668_108532631 | 69 |
| 831 | 3300025972 | Ga0207668_11609372 | Ga0207668_116093722 | 69 |
| 832 | 3300025972 | Ga0207668_11942410 | Ga0207668_119424102 | 69 |
| 833 | 3300025986 | Ga0207658_10044456 | Ga0207658_100444561 | 69 |
| 834 | 3300026023 | Ga0207677_12269250 | Ga0207677_122692502 | 69 |
| 835 | 3300026023 | Ga0207677_12285938 | Ga0207677_122859382 | 69 |
| 836 | 3300026035 | Ga0207703_10178567 | Ga0207703_101785673 | 69 |
| 837 | 3300026035 | Ga0207703_11341514 | Ga0207703_113415142 | 69 |
| 838 | 3300026035 | Ga0207703_11596577 | Ga0207703_115965771 | 69 |
| 839 | 3300026035 | Ga0207703_11942697 | Ga0207703_119426972 | 69 |
| 840 | 3300026041 | Ga0207639_10009172 | Ga0207639_100091725 | 69 |
| 841 | 3300026041 | Ga0207639_10152599 | Ga0207639_101525992 | 69 |
| 842 | 3300026067 | Ga0207678_10187943 | Ga0207678_101879431 | 69 |
| 843 | 3300026067 | Ga0207678_10446427 | Ga0207678_104464273 | 69 |
| 844 | 3300026067 | Ga0207678_10479257 | Ga0207678_104792572 | 69 |
| 845 | 3300026067 | Ga0207678_11083002 | Ga0207678_110830021 | 69 |
| 846 | 3300026075 | Ga0207708_10303663 | Ga0207708_103036632 | 69 |
| 847 | 3300026075 | Ga0207708_10371502 | Ga0207708_103715022 | 69 |
| 848 | 3300026078 | Ga0207702_10000546 | Ga0207702_1000054610 | 69 |
| 849 | 3300026078 | Ga0207702_10004644 | Ga0207702_1000464415 | 69 |
| 850 | 3300026078 | Ga0207702_10033523 | Ga0207702_100335235 | 69 |
| 851 | 3300026078 | Ga0207702_11287383 | Ga0207702_112873831 | 69 |
| 852 | 3300026078 | Ga0207702_11878437 | Ga0207702_118784371 | 69 |
| 853 | 3300026088 | Ga0207641_10506513 | Ga0207641_105065132 | 69 |
| 854 | 3300026089 | Ga0207648_10438622 | Ga0207648_104386221 | 69 |
| 855 | 3300026089 | Ga0207648_10736609 | Ga0207648_107366092 | 69 |
| 856 | 3300026089 | Ga0207648_12159564 | Ga0207648_121595641 | 69 |
| 857 | 3300026116 | Ga0207674_10030653 | Ga0207674_100306534 | 69 |
| 858 | 3300026116 | Ga0207674_10268667 | Ga0207674_102686672 | 69 |
| 859 | 3300026116 | Ga0207674_11154109 | Ga0207674_111541092 | 69 |
| 860 | 3300026116 | Ga0207674_11305657 | Ga0207674_113056572 | 69 |
| 861 | 3300026118 | Ga0207675_100080427 | Ga0207675_1000804273 | 69 |
| 862 | 3300026118 | Ga0207675_100281434 | Ga0207675_1002814342 | 69 |
| 863 | 3300026121 | Ga0207683_10057053 | Ga0207683_100570532 | 69 |
| 864 | 3300026121 | Ga0207683_10211177 | Ga0207683_102111772 | 69 |
| 865 | 3300026142 | Ga0207698_10053786 | Ga0207698_100537863 | 69 |
| 866 | 3300026142 | Ga0207698_10520190 | Ga0207698_105201902 | 69 |
| 867 | 3300026142 | Ga0207698_10568603 | Ga0207698_105686032 | 69 |
| 868 | 3300026142 | Ga0207698_11418138 | Ga0207698_114181382 | 69 |
| 869 | 3300027111 | Ga0209281_1000106 | Ga0209281_100010652 | 69 |
| 870 | 3300027111 | Ga0209281_1000426 | Ga0209281_10004267 | 69 |
| 871 | 3300027312 | Ga0209371_1000003 | Ga0209371_1000003155 | 69 |
| 872 | 3300027312 | Ga0209371_1000990 | Ga0209371_100099026 | 69 |
| 873 | 3300027312 | Ga0209371_1008618 | Ga0209371_10086185 | 69 |
| 874 | 3300027512 | Ga0209179_1100768 | Ga0209179_11007681 | 69 |
| 875 | 3300027666 | Ga0209282_1000083 | Ga0209282_100008319 | 69 |
| 876 | 3300027666 | Ga0209282_1000167 | Ga0209282_100016732 | 69 |
| 877 | 3300027666 | Ga0209282_1044704 | Ga0209282_10447042 | 69 |
| 878 | 3300027671 | Ga0209588_1016674 | Ga0209588_10166741 | 69 |
| 879 | 3300027671 | Ga0209588_1067862 | Ga0209588_10678623 | 69 |
| 880 | 3300027866 | Ga0209813_10183950 | Ga0209813_101839501 | 69 |
| 881 | 3300027907 | Ga0207428_10087187 | Ga0207428_100871873 | 69 |
| 882 | 3300028379 | Ga0268266_10011520 | Ga0268266_1001152012 | 69 |
| 883 | 3300028379 | Ga0268266_10021951 | Ga0268266_100219515 | 69 |
| 884 | 3300028379 | Ga0268266_10041638 | Ga0268266_100416381 | 69 |
| 885 | 3300028379 | Ga0268266_10232819 | Ga0268266_102328192 | 69 |
| 886 | 3300028379 | Ga0268266_10242298 | Ga0268266_102422982 | 69 |
| 887 | 3300028379 | Ga0268266_10297658 | Ga0268266_102976581 | 69 |
| 888 | 3300028379 | Ga0268266_10442705 | Ga0268266_104427053 | 69 |
| 889 | 3300028379 | Ga0268266_10649621 | Ga0268266_106496212 | 69 |
| 890 | 3300028379 | Ga0268266_11502122 | Ga0268266_115021222 | 69 |
| 891 | 3300028380 | Ga0268265_10200832 | Ga0268265_102008322 | 69 |
| 892 | 3300028380 | Ga0268265_10643265 | Ga0268265_106432652 | 69 |
| 893 | 3300028380 | Ga0268265_12427940 | Ga0268265_124279402 | 69 |
| 894 | 3300028381 | Ga0268264_11514417 | Ga0268264_115144171 | 69 |
| 895 | 3300028573 | Ga0265334_10065282 | Ga0265334_100652822 | 69 |
| 896 | 3300028786 | Ga0307517_10289775 | Ga0307517_102897751 | 69 |
| 897 | 3300028794 | Ga0307515_10002180 | Ga0307515_1000218012 | 69 |
| 898 | 3300028794 | Ga0307515_10162439 | Ga0307515_101624392 | 69 |
| 899 | 3300028794 | Ga0307515_10189868 | Ga0307515_101898682 | 69 |
| 900 | 3300030500 | Ga0268256_1000004 | Ga0268256_1000004896 | 69 |
| 901 | 3300030500 | Ga0268256_1000571 | Ga0268256_100057127 | 69 |
| 902 | 3300030500 | Ga0268256_1009027 | Ga0268256_10090275 | 69 |
| 903 | 3300030744 | Ga0316181_1012064 | Ga0316181_10120644 | 69 |
| 904 | 3300030760 | Ga0265762_1056251 | Ga0265762_10562512 | 69 |
| 905 | 3300030763 | Ga0265763_1020674 | Ga0265763_10206742 | 69 |
| 906 | 3300030882 | Ga0265764_116286 | Ga0265764_1162861 | 69 |
| 907 | 3300030889 | Ga0265761_105536 | Ga0265761_1055362 | 69 |
| 908 | 3300031090 | Ga0265760_10035293 | Ga0265760_100352934 | 69 |
| 909 | 3300031090 | Ga0265760_10091973 | Ga0265760_100919732 | 69 |
| 910 | 3300031090 | Ga0265760_10209769 | Ga0265760_102097691 | 69 |
| 911 | 3300031090 | Ga0265760_10355728 | Ga0265760_103557281 | 69 |
| 912 | 3300031235 | Ga0265330_10040535 | Ga0265330_100405352 | 69 |
| 913 | 3300031235 | Ga0265330_10069394 | Ga0265330_100693942 | 69 |
| 914 | 3300031238 | Ga0265332_10219582 | Ga0265332_102195821 | 69 |
| 915 | 3300031239 | Ga0265328_10072620 | Ga0265328_100726202 | 69 |
| 916 | 3300031240 | Ga0265320_10148836 | Ga0265320_101488363 | 69 |
| 917 | 3300031241 | Ga0265325_10476155 | Ga0265325_104761551 | 69 |
| 918 | 3300031242 | Ga0265329_10144457 | Ga0265329_101444571 | 69 |
| 919 | 3300031247 | Ga0265340_10004702 | Ga0265340_100047027 | 69 |
| 920 | 3300031249 | Ga0265339_10002135 | Ga0265339_100021353 | 69 |
| 921 | 3300031344 | Ga0265316_10047181 | Ga0265316_100471815 | 69 |
| 922 | 3300031344 | Ga0265316_10384691 | Ga0265316_103846913 | 69 |
| 923 | 3300031456 | Ga0307513_10953235 | Ga0307513_109532352 | 69 |
| 924 | 3300031548 | Ga0307408_100275327 | Ga0307408_1002753274 | 69 |
| 925 | 3300031595 | Ga0265313_10005700 | Ga0265313_100057003 | 69 |
| 926 | 3300031595 | Ga0265313_10052844 | Ga0265313_100528441 | 69 |
| 927 | 3300031712 | Ga0265342_10006876 | Ga0265342_100068769 | 69 |
| 928 | 3300031730 | Ga0307516_10140743 | Ga0307516_101407432 | 69 |
| 929 | 3300031730 | Ga0307516_10243085 | Ga0307516_102430851 | 69 |
| 930 | 3300031731 | Ga0307405_10000482 | Ga0307405_100004828 | 69 |
| 931 | 3300031731 | Ga0307405_10072659 | Ga0307405_100726595 | 69 |
| 932 | 3300031731 | Ga0307405_10193704 | Ga0307405_101937045 | 69 |
| 933 | 3300031731 | Ga0307405_12050864 | Ga0307405_120508641 | 69 |
| 934 | 3300031824 | Ga0307413_10644764 | Ga0307413_106447642 | 69 |
| 935 | 3300031901 | Ga0307406_10114120 | Ga0307406_101141202 | 69 |
| 936 | 3300031901 | Ga0307406_10361519 | Ga0307406_103615191 | 69 |
| 937 | 3300031901 | Ga0307406_11194383 | Ga0307406_111943831 | 69 |
| 938 | 3300031901 | Ga0307406_11327832 | Ga0307406_113278322 | 69 |
| 939 | 3300031903 | Ga0307407_11138994 | Ga0307407_111389942 | 69 |
| 940 | 3300031911 | Ga0307412_10165722 | Ga0307412_101657222 | 69 |
| 941 | 3300031911 | Ga0307412_10465998 | Ga0307412_104659983 | 69 |
| 942 | 3300031911 | Ga0307412_11425315 | Ga0307412_114253151 | 69 |
| 943 | 3300031911 | Ga0307412_11928336 | Ga0307412_119283362 | 69 |
| 944 | 3300031967 | Ga0315914_1002550 | Ga0315914_100255019 | 69 |
| 945 | 3300031995 | Ga0307409_100794824 | Ga0307409_1007948241 | 69 |
| 946 | 3300031995 | Ga0307409_101436686 | Ga0307409_1014366862 | 69 |
| 947 | 3300032002 | Ga0307416_100247550 | Ga0307416_1002475502 | 69 |
| 948 | 3300032002 | Ga0307416_100515546 | Ga0307416_1005155461 | 69 |
| 949 | 3300032002 | Ga0307416_102907326 | Ga0307416_1029073261 | 69 |
| 950 | 3300032004 | Ga0307414_10588713 | Ga0307414_105887133 | 69 |
| 951 | 3300032004 | Ga0307414_12178587 | Ga0307414_121785871 | 69 |
| 952 | 3300032126 | Ga0307415_100305987 | Ga0307415_1003059873 | 69 |
| 953 | 3300032126 | Ga0307415_100857311 | Ga0307415_1008573111 | 69 |
| 954 | 3300033180 | Ga0307510_10000908 | Ga0307510_1000090827 | 69 |
| 955 | 3300033430 | Ga0315913_1001274 | Ga0315913_100127418 | 69 |
| 956 | 3300033464 | Ga0315915_1000010 | Ga0315915_100001085 | 69 |
| 957 | 3300035083 | Ga0373926_0195151 | Ga0373926_0195151_302_511 | 69 |
| 958 | 3300035085 | Ga0373929_0268048 | Ga0373929_0268048_38_247 | 69 |
| 959 | 3300035086 | Ga0373934_0003991 | Ga0373934_0003991_2025_2234 | 69 |
| 960 | 3300035086 | Ga0373934_0195445 | Ga0373934_0195445_305_514 | 69 |
| 961 | 3300035086 | Ga0373934_0238184 | Ga0373934_0238184_394_603 | 69 |
| 962 | 3300035089 | Ga0373944_0448344 | Ga0373944_0448344_257_466 | 69 |
| 963 | 3300035111 | Ga0373923_0032731 | Ga0373923_0032731_389_598 | 69 |
| 964 | 3300035111 | Ga0373923_0033929 | Ga0373923_0033929_717_926 | 69 |
| 965 | 3300035113 | Ga0373936_0009309 | Ga0373936_0009309_2088_2297 | 69 |
| 966 | 3300035113 | Ga0373936_0041934 | Ga0373936_0041934_1324_1533 | 69 |
| 967 | 3300035113 | Ga0373936_0324084 | Ga0373936_0324084_67_276 | 69 |
| 968 | 3300035115 | Ga0373941_0540805 | Ga0373941_0540805_94_306 | 69 |
| 969 | 3300035116 | Ga0373945_0011814 | Ga0373945_0011814_1766_1975 | 69 |
| 970 | 3300035116 | Ga0373945_0179700 | Ga0373945_0179700_503_712 | 69 |
| 971 | 3300035116 | Ga0373945_0564359 | Ga0373945_0564359_114_323 | 69 |
| 972 | 3300035117 | Ga0373953_0000428 | Ga0373953_0000428_7483_7692 | 69 |
| 973 | 3300035117 | Ga0373953_0002249 | Ga0373953_0002249_1511_1720 | 69 |
| 974 | 3300035118 | Ga0373954_0000096 | Ga0373954_0000096_3283_3492 | 69 |
| 975 | 3300035118 | Ga0373954_0001427 | Ga0373954_0001427_3314_3523 | 69 |
| 976 | 3300035118 | Ga0373954_0101679 | Ga0373954_0101679_159_368 | 69 |
| 977 | 3300035119 | Ga0373956_0000452 | Ga0373956_0000452_10860_11069 | 69 |
| 978 | 3300035119 | Ga0373956_0010045 | Ga0373956_0010045_997_1206 | 69 |
| 979 | 3300035120 | Ga0373957_0000472 | Ga0373957_0000472_5272_5481 | 69 |
| 980 | 3300035120 | Ga0373957_0004660 | Ga0373957_0004660_659_868 | 69 |
| 981 | 3300035120 | Ga0373957_0152452 | Ga0373957_0152452_586_795 | 69 |
| 982 | 3300035170 | Ga0373943_0000777 | Ga0373943_0000777_8905_9114 | 69 |
| 983 | 3300035170 | Ga0373943_0054685 | Ga0373943_0054685_344_553 | 69 |
| 984 | 3300035171 | Ga0373946_0189125 | Ga0373946_0189125_276_485 | 69 |
| 985 | 3300035172 | Ga0373955_0004288 | Ga0373955_0004288_2191_2400 | 69 |
| 986 | 3300035172 | Ga0373955_0020206 | Ga0373955_0020206_2827_3036 | 69 |
| 987 | 3300035172 | Ga0373955_0020557 | Ga0373955_0020557_392_601 | 69 |
| 988 | 3300035172 | Ga0373955_0048964 | Ga0373955_0048964_1814_2023 | 69 |
| 989 | 3300035410 | Ga0373924_0017494 | Ga0373924_0017494_391_600 | 69 |
| 990 | 3300035410 | Ga0373924_0027795 | Ga0373924_0027795_1038_1247 | 69 |
| 991 | 3300035410 | Ga0373924_0029306 | Ga0373924_0029306_1069_1278 | 69 |
| 992 | 3300035410 | Ga0373924_0407551 | Ga0373924_0407551_343_552 | 69 |
| 993 | 3300035692 | Ga0373935_0000251 | Ga0373935_0000251_17158_17367 | 69 |
| 994 | 3300035692 | Ga0373935_0034983 | Ga0373935_0034983_2780_2989 | 69 |
| 995 | 3300035692 | Ga0373935_0124310 | Ga0373935_0124310_856_1065 | 69 |
| 996 | 3300035692 | Ga0373935_0195258 | Ga0373935_0195258_131_340 | 69 |
| 997 | 3300035692 | Ga0373935_0375420 | Ga0373935_0375420_206_442 | 69 |
| 998 | 3300035695 | Ga0373927_0000074 | Ga0373927_0000074_8339_8548 | 69 |
| 999 | 3300035695 | Ga0373927_0005560 | Ga0373927_0005560_4326_4535 | 69 |
| 1000 | 3300035695 | Ga0373927_0007493 | Ga0373927_0007493_3149_3358 | 69 |
| 1001 | 3300035695 | Ga0373927_0015747 | Ga0373927_0015747_3413_3622 | 69 |
| 1002 | 3300035695 | Ga0373927_0272776 | Ga0373927_0272776_207_416 | 69 |
| 1003 | 3300035695 | Ga0373927_0742355 | Ga0373927_0742355_288_497 | 69 |
| 1004 | 3300035724 | Ga0373933_0014530 | Ga0373933_0014530_698_907 | 69 |
| 1005 | 3300035724 | Ga0373933_0016964 | Ga0373933_0016964_2340_2549 | 69 |
| 1006 | 3300035724 | Ga0373933_0513331 | Ga0373933_0513331_265_474 | 69 |
| 1007 | 3300035725 | Ga0373947_0001064 | Ga0373947_0001064_8511_8720 | 69 |
| 1008 | 3300035725 | Ga0373947_0016295 | Ga0373947_0016295_774_983 | 69 |
| 1009 | 3300035725 | Ga0373947_0083971 | Ga0373947_0083971_1244_1453 | 69 |
| 1010 | 3300035725 | Ga0373947_0403375 | Ga0373947_0403375_95_304 | 69 |
| 1011 | 3300036401 | Ga0373937_0006552 | Ga0373937_0006552_1490_1699 | 69 |
| 1012 | 3300036401 | Ga0373937_0021873 | Ga0373937_0021873_2299_2508 | 69 |
| 1013 | 3300036401 | Ga0373937_0083215 | Ga0373937_0083215_2394_2603 | 69 |
| 1014 | 3300036401 | Ga0373937_0200728 | Ga0373937_0200728_336_548 | 69 |
| 1015 | 3300036401 | Ga0373937_1082155 | Ga0373937_1082155_272_481 | 69 |
| 1016 | 3300037068 | Ga0373925_0001364 | Ga0373925_0001364_15872_16081 | 69 |
| 1017 | 3300037068 | Ga0373925_0002665 | Ga0373925_0002665_4001_4210 | 69 |
| 1018 | 3300037068 | Ga0373925_0112710 | Ga0373925_0112710_1066_1275 | 69 |
| 1019 | 3300037068 | Ga0373925_0860384 | Ga0373925_0860384_438_647 | 69 |
| 1020 | 3300037312 | Ga0395899_0000217 | Ga0395899_0000217_69047_69256 | 69 |
| 1021 | 3300037418 | Ga0395900_0000270 | Ga0395900_0000270_69047_69256 | 69 |
| 1022 | 3300037418 | Ga0395900_0245470 | Ga0395900_0245470_1202_1414 | 69 |
| 1023 | 3300037418 | Ga0395900_0303078 | Ga0395900_0303078_140_352 | 69 |
| 1024 | 3300037418 | Ga0395900_0414198 | Ga0395900_0414198_714_926 | 69 |
| 1025 | 3300037418 | Ga0395900_0979486 | Ga0395900_0979486_387_599 | 69 |
| 1026 | 3300037466 | Ga0395898_0000470 | Ga0395898_0000470_69784_69993 | 69 |
| 1027 | 3300037466 | Ga0395898_0101804 | Ga0395898_0101804_2216_2428 | 69 |
| 1028 | 3300037471 | Ga0395905_0000253 | Ga0395905_0000253_10791_11000 | 69 |
| 1029 | 3300037471 | Ga0395905_0048715 | Ga0395905_0048715_2241_2453 | 69 |
| 1030 | 3300037471 | Ga0395905_0290864 | Ga0395905_0290864_693_905 | 69 |
| 1031 | 3300037471 | Ga0395905_0722324 | Ga0395905_0722324_183_395 | 69 |
| 1032 | 3300037471 | Ga0395905_1215535 | Ga0395905_1215535_137_349 | 69 |
| 1033 | 3300037853 | Ga0436364_0651817 | Ga0436364_0651817_475_684 | 69 |
| 1034 | 3300038443 | Ga0395901_0002922 | Ga0395901_0002922_6252_6461 | 69 |
| 1035 | 3300038443 | Ga0395901_0023878 | Ga0395901_0023878_5890_6102 | 69 |
| 1036 | 3300038443 | Ga0395901_0419545 | Ga0395901_0419545_361_573 | 69 |
| 1037 | 3300038443 | Ga0395901_0578115 | Ga0395901_0578115_577_789 | 69 |
| 1038 | 3300039437 | Ga0436365_1865485 | Ga0436365_1865485_555_764 | 69 |
| 1039 | 3300039437 | Ga0436365_1892130 | Ga0436365_1892130_752_961 | 69 |
| 1040 | 3300039438 | Ga0436360_0012434 | Ga0436360_0012434_136_345 | 69 |
| 1041 | 3300039447 | Ga0436361_1090572 | Ga0436361_1090572_2776_2985 | 69 |
| 1042 | 3300041413 | Ga0439465_0039012 | Ga0439465_0039012_598_807 | 69 |
| 1043 | 3300041413 | Ga0439465_0079945 | Ga0439465_0079945_272_484 | 69 |
| 1044 | 3300041413 | Ga0439465_0124953 | Ga0439465_0124953_188_400 | 69 |
| 1045 | 3300041413 | Ga0439465_0165409 | Ga0439465_0165409_424_633 | 69 |
| 1046 | 3300041441 | Ga0451787_496701 | Ga0451787_496701_834_1046 | 69 |
| 1047 | 3300041455 | Ga0451801_03670 | Ga0451801_03670_85_297 | 69 |
| 1048 | 3300041459 | Ga0451800_0127875 | Ga0451800_0127875_43_252 | 69 |
| 1049 | 3300041459 | Ga0451800_0697454 | Ga0451800_0697454_26_238 | 69 |
| 1050 | 3300041460 | Ga0451802_1735530 | Ga0451802_1735530_32_244 | 69 |
| 1051 | 3300041491 | Ga0451833_0730984 | Ga0451833_0730984_226_435 | 69 |
| 1052 | 3300041492 | Ga0451835_0230868 | Ga0451835_0230868_13_225 | 69 |
| 1053 | 3300041505 | Ga0451849_1043510 | Ga0451849_1043510_386_598 | 69 |
| 1054 | 3300041511 | Ga0451855_0029132 | Ga0451855_0029132_265_477 | 69 |
| 1055 | 3300041512 | Ga0451853_1360697 | Ga0451853_1360697_198_407 | 69 |
| 1056 | 3300041512 | Ga0451853_2612147 | Ga0451853_2612147_348_560 | 69 |
| 1057 | 3300041907 | Ga0452268_09526 | Ga0452268_09526_152_364 | 69 |
| 1058 | 3300041997 | Ga0439431_0149061 | Ga0439431_0149061_153_365 | 69 |
| 1059 | 3300042004 | Ga0439445_0207797 | Ga0439445_0207797_20_229 | 69 |
| 1060 | 3300042004 | Ga0439445_0231528 | Ga0439445_0231528_85_297 | 69 |
| 1061 | 3300042006 | Ga0439432_051122 | Ga0439432_051122_825_1037 | 69 |
| 1062 | 3300042015 | Ga0439462_0149295 | Ga0439462_0149295_315_527 | 69 |
| 1063 | 3300042125 | Ga0450923_088673 | Ga0450923_088673_129_341 | 69 |
| 1064 | 3300042136 | Ga0450900_080592 | Ga0450900_080592_263_472 | 69 |
| 1065 | 3300042137 | Ga0450902_070321 | Ga0450902_070321_319_531 | 69 |
| 1066 | 3300042435 | Ga0439434_0080586 | Ga0439434_0080586_313_525 | 69 |
| 1067 | 3300042435 | Ga0439434_0207908 | Ga0439434_0207908_118_327 | 69 |
| 1068 | 3300044658 | Ga0466972_0027947 | Ga0466972_0027947_692_904 | 69 |
| 1069 | 3300044683 | Ga0466965_0618337 | Ga0466965_0618337_333_545 | 69 |
| 1070 | 3300044735 | Ga0466968_0078165 | Ga0466968_0078165_224_436 | 69 |
| 1071 | 3300044735 | Ga0466968_0085724 | Ga0466968_0085724_856_1080 | 69 |
| 1072 | 3300044765 | Ga0466970_0770781 | Ga0466970_0770781_214_426 | 69 |
| 1073 | 3300044901 | Ga0466960_0063323 | Ga0466960_0063323_60_272 | 69 |
| 1074 | 3300046452 | Ga0495617_009338 | Ga0495617_009338_56_265 | 69 |
| 1075 | 3300046454 | Ga0495592_0012453 | Ga0495592_0012453_951_1160 | 69 |
| 1076 | 3300046454 | Ga0495592_0026565 | Ga0495592_0026565_392_601 | 69 |
| 1077 | 3300046454 | Ga0495592_0129265 | Ga0495592_0129265_874_1083 | 69 |
| 1078 | 3300046454 | Ga0495592_0631062 | Ga0495592_0631062_419_628 | 69 |
| 1079 | 3300046455 | Ga0495603_0000208 | Ga0495603_0000208_8912_9121 | 69 |
| 1080 | 3300046455 | Ga0495603_0002458 | Ga0495603_0002458_1601_1810 | 69 |
| 1081 | 3300046455 | Ga0495603_0030037 | Ga0495603_0030037_2258_2467 | 69 |
| 1082 | 3300046457 | Ga0495590_0038159 | Ga0495590_0038159_322_531 | 69 |
| 1083 | 3300046457 | Ga0495590_0337127 | Ga0495590_0337127_244_453 | 69 |
| 1084 | 3300046459 | Ga0495629_0000216 | Ga0495629_0000216_13817_14026 | 69 |
| 1085 | 3300046459 | Ga0495629_0001181 | Ga0495629_0001181_4128_4337 | 69 |
| 1086 | 3300046459 | Ga0495629_0017800 | Ga0495629_0017800_1947_2156 | 69 |
| 1087 | 3300046460 | Ga0495638_0003832 | Ga0495638_0003832_7090_7302 | 69 |
| 1088 | 3300046460 | Ga0495638_0017927 | Ga0495638_0017927_179_391 | 69 |
| 1089 | 3300046460 | Ga0495638_0081801 | Ga0495638_0081801_1331_1540 | 69 |
| 1090 | 3300046460 | Ga0495638_0584049 | Ga0495638_0584049_101_313 | 69 |
| 1091 | 3300046461 | Ga0495641_0001151 | Ga0495641_0001151_13376_13585 | 69 |
| 1092 | 3300046461 | Ga0495641_0050675 | Ga0495641_0050675_1107_1316 | 69 |
| 1093 | 3300046462 | Ga0495651_0022957 | Ga0495651_0022957_264_473 | 69 |
| 1094 | 3300046462 | Ga0495651_0087175 | Ga0495651_0087175_970_1179 | 69 |
| 1095 | 3300046462 | Ga0495651_0090122 | Ga0495651_0090122_1740_1949 | 69 |
| 1096 | 3300046463 | Ga0495653_0001775 | Ga0495653_0001775_15944_16153 | 69 |
| 1097 | 3300046463 | Ga0495653_0052490 | Ga0495653_0052490_2522_2731 | 69 |
| 1098 | 3300046471 | Ga0495650_0027634 | Ga0495650_0027634_1779_1988 | 69 |
| 1099 | 3300046471 | Ga0495650_0034475 | Ga0495650_0034475_992_1201 | 69 |
| 1100 | 3300046471 | Ga0495650_0040206 | Ga0495650_0040206_1675_1884 | 69 |
| 1101 | 3300046472 | Ga0495580_0003553 | Ga0495580_0003553_7540_7749 | 69 |
| 1102 | 3300046472 | Ga0495580_0419342 | Ga0495580_0419342_490_699 | 69 |
| 1103 | 3300046473 | Ga0495582_0000311 | Ga0495582_0000311_16211_16420 | 69 |
| 1104 | 3300046473 | Ga0495582_0082986 | Ga0495582_0082986_162_371 | 69 |
| 1105 | 3300046474 | Ga0495605_0134183 | Ga0495605_0134183_430_639 | 69 |
| 1106 | 3300046475 | Ga0495639_0000395 | Ga0495639_0000395_4129_4338 | 69 |
| 1107 | 3300046475 | Ga0495639_0031163 | Ga0495639_0031163_1724_1933 | 69 |
| 1108 | 3300046476 | Ga0495662_0000259 | Ga0495662_0000259_5339_5548 | 69 |
| 1109 | 3300046476 | Ga0495662_0522403 | Ga0495662_0522403_75_284 | 69 |
| 1110 | 3300046477 | Ga0495664_0007806 | Ga0495664_0007806_3523_3732 | 69 |
| 1111 | 3300046477 | Ga0495664_0090710 | Ga0495664_0090710_488_697 | 69 |
| 1112 | 3300046477 | Ga0495664_0574492 | Ga0495664_0574492_422_631 | 69 |
| 1113 | 3300046477 | Ga0495664_0784699 | Ga0495664_0784699_115_324 | 69 |
| 1114 | 3300046491 | Ga0495584_0096587 | Ga0495584_0096587_905_1114 | 69 |
| 1115 | 3300046491 | Ga0495584_0330744 | Ga0495584_0330744_345_554 | 69 |
| 1116 | 3300046492 | Ga0495585_0110883 | Ga0495585_0110883_999_1208 | 69 |
| 1117 | 3300046492 | Ga0495585_0155899 | Ga0495585_0155899_582_791 | 69 |
| 1118 | 3300046499 | Ga0495594_0000272 | Ga0495594_0000272_16256_16465 | 69 |
| 1119 | 3300046499 | Ga0495594_0031294 | Ga0495594_0031294_2607_2816 | 69 |
| 1120 | 3300046499 | Ga0495594_0055421 | Ga0495594_0055421_1584_1793 | 69 |
| 1121 | 3300046500 | Ga0495596_0070770 | Ga0495596_0070770_410_619 | 69 |
| 1122 | 3300046501 | Ga0495607_0101871 | Ga0495607_0101871_999_1208 | 69 |
| 1123 | 3300046507 | Ga0495606_0030274 | Ga0495606_0030274_394_603 | 69 |
| 1124 | 3300046507 | Ga0495606_0468081 | Ga0495606_0468081_109_318 | 69 |
| 1125 | 3300046507 | Ga0495606_0524117 | Ga0495606_0524117_51_260 | 69 |
| 1126 | 3300046511 | Ga0495608_0001705 | Ga0495608_0001705_13098_13307 | 69 |
| 1127 | 3300046511 | Ga0495608_0143472 | Ga0495608_0143472_772_981 | 69 |
| 1128 | 3300046511 | Ga0495608_0200299 | Ga0495608_0200299_756_965 | 69 |
| 1129 | 3300046512 | Ga0495610_0002231 | Ga0495610_0002231_9470_9679 | 69 |
| 1130 | 3300046512 | Ga0495610_0002393 | Ga0495610_0002393_13870_14079 | 69 |
| 1131 | 3300046513 | Ga0495616_0073369 | Ga0495616_0073369_1254_1463 | 69 |
| 1132 | 3300046514 | Ga0495618_0002323 | Ga0495618_0002323_2277_2486 | 69 |
| 1133 | 3300046514 | Ga0495618_0081179 | Ga0495618_0081179_1702_1911 | 69 |
| 1134 | 3300046515 | Ga0495620_0232938 | Ga0495620_0232938_408_617 | 69 |
| 1135 | 3300046516 | Ga0495628_0044858 | Ga0495628_0044858_2468_2677 | 69 |
| 1136 | 3300046516 | Ga0495628_0068594 | Ga0495628_0068594_2370_2579 | 69 |
| 1137 | 3300046516 | Ga0495628_0140726 | Ga0495628_0140726_1175_1384 | 69 |
| 1138 | 3300046516 | Ga0495628_0462694 | Ga0495628_0462694_241_450 | 69 |
| 1139 | 3300046517 | Ga0495630_0000820 | Ga0495630_0000820_5685_5894 | 69 |
| 1140 | 3300046517 | Ga0495630_0052865 | Ga0495630_0052865_1836_2045 | 69 |
| 1141 | 3300046517 | Ga0495630_0188804 | Ga0495630_0188804_1135_1344 | 69 |
| 1142 | 3300046517 | Ga0495630_1445099 | Ga0495630_1445099_126_335 | 69 |
| 1143 | 3300046518 | Ga0495631_0042096 | Ga0495631_0042096_1449_1658 | 69 |
| 1144 | 3300046518 | Ga0495631_0098942 | Ga0495631_0098942_70_279 | 69 |
| 1145 | 3300046518 | Ga0495631_0384483 | Ga0495631_0384483_40_249 | 69 |
| 1146 | 3300046519 | Ga0495632_0002224 | Ga0495632_0002224_14745_14954 | 69 |
| 1147 | 3300046519 | Ga0495632_0016291 | Ga0495632_0016291_1714_1923 | 69 |
| 1148 | 3300046519 | Ga0495632_0259824 | Ga0495632_0259824_551_760 | 69 |
| 1149 | 3300046520 | Ga0495637_0145697 | Ga0495637_0145697_109_318 | 69 |
| 1150 | 3300046522 | Ga0495643_0040480 | Ga0495643_0040480_1451_1660 | 69 |
| 1151 | 3300046522 | Ga0495643_0156057 | Ga0495643_0156057_142_351 | 69 |
| 1152 | 3300046523 | Ga0495644_0080056 | Ga0495644_0080056_1010_1219 | 69 |
| 1153 | 3300046524 | Ga0495648_0006515 | Ga0495648_0006515_8436_8645 | 69 |
| 1154 | 3300046524 | Ga0495648_0065290 | Ga0495648_0065290_615_824 | 69 |
| 1155 | 3300046524 | Ga0495648_0084732 | Ga0495648_0084732_342_551 | 69 |
| 1156 | 3300046525 | Ga0495663_0014069 | Ga0495663_0014069_1613_1822 | 69 |
| 1157 | 3300046525 | Ga0495663_0019623 | Ga0495663_0019623_699_908 | 69 |
| 1158 | 3300046525 | Ga0495663_0057692 | Ga0495663_0057692_854_1063 | 69 |
| 1159 | 3300046526 | Ga0495666_0188905 | Ga0495666_0188905_111_320 | 69 |
| 1160 | 3300046528 | Ga0495642_0381141 | Ga0495642_0381141_66_275 | 69 |
| 1161 | 3300046529 | Ga0495652_0010856 | Ga0495652_0010856_2327_2536 | 69 |
| 1162 | 3300046529 | Ga0495652_0038453 | Ga0495652_0038453_2122_2331 | 69 |
| 1163 | 3300046529 | Ga0495652_0627066 | Ga0495652_0627066_338_547 | 69 |
| 1164 | 3300046530 | Ga0495654_0001294 | Ga0495654_0001294_16348_16557 | 69 |
| 1165 | 3300046530 | Ga0495654_0074371 | Ga0495654_0074371_112_321 | 69 |
| 1166 | 3300046530 | Ga0495654_0357306 | Ga0495654_0357306_77_286 | 69 |
| 1167 | 3300046531 | Ga0495665_0006722 | Ga0495665_0006722_1865_2074 | 69 |
| 1168 | 3300046531 | Ga0495665_0393296 | Ga0495665_0393296_30_239 | 69 |
| 1169 | 3300046533 | Ga0495640_0012590 | Ga0495640_0012590_589_798 | 69 |
| 1170 | 3300046533 | Ga0495640_0022779 | Ga0495640_0022779_1487_1696 | 69 |
| 1171 | 3300046533 | Ga0495640_0028987 | Ga0495640_0028987_2780_2989 | 69 |
| 1172 | 3300046535 | Ga0495586_0066223 | Ga0495586_0066223_266_475 | 69 |
| 1173 | 3300046535 | Ga0495586_0436771 | Ga0495586_0436771_458_667 | 69 |
| 1174 | 3300046536 | Ga0495587_0001236 | Ga0495587_0001236_16345_16554 | 69 |
| 1175 | 3300046536 | Ga0495587_0016699 | Ga0495587_0016699_1203_1412 | 69 |
| 1176 | 3300046537 | Ga0495598_0015362 | Ga0495598_0015362_998_1207 | 69 |
| 1177 | 3300046537 | Ga0495598_0019716 | Ga0495598_0019716_151_360 | 69 |
| 1178 | 3300046538 | Ga0495609_0055515 | Ga0495609_0055515_904_1113 | 69 |
| 1179 | 3300046538 | Ga0495609_0239193 | Ga0495609_0239193_483_692 | 69 |
| 1180 | 3300046539 | Ga0495621_0008718 | Ga0495621_0008718_1987_2196 | 69 |
| 1181 | 3300046542 | Ga0495597_0014017 | Ga0495597_0014017_1304_1513 | 69 |
| 1182 | 3300046542 | Ga0495597_0159731 | Ga0495597_0159731_238_447 | 69 |
| 1183 | 3300046543 | Ga0495645_0028470 | Ga0495645_0028470_3559_3768 | 69 |
| 1184 | 3300046543 | Ga0495645_0051544 | Ga0495645_0051544_639_848 | 69 |
| 1185 | 3300046557 | Ga0495622_0003774 | Ga0495622_0003774_5378_5587 | 69 |
| 1186 | 3300046557 | Ga0495622_0022348 | Ga0495622_0022348_1036_1245 | 69 |
| 1187 | 3300046558 | Ga0495633_0058244 | Ga0495633_0058244_1491_1700 | 69 |
| 1188 | 3300046558 | Ga0495633_0192950 | Ga0495633_0192950_615_824 | 69 |
| 1189 | 3300046559 | Ga0495667_0021654 | Ga0495667_0021654_1526_1735 | 69 |
| 1190 | 3300046559 | Ga0495667_0057976 | Ga0495667_0057976_1957_2166 | 69 |
| 1191 | 3300046559 | Ga0495667_0205769 | Ga0495667_0205769_390_599 | 69 |
| 1192 | 3300046615 | Ga0495656_0002847 | Ga0495656_0002847_2143_2352 | 69 |
| 1193 | 3300046615 | Ga0495656_0012766 | Ga0495656_0012766_197_406 | 69 |
| 1194 | 3300046615 | Ga0495656_0099730 | Ga0495656_0099730_580_789 | 69 |
| 1195 | 3300046616 | Ga0495668_0013820 | Ga0495668_0013820_3779_3988 | 69 |
| 1196 | 3300046616 | Ga0495668_0075775 | Ga0495668_0075775_150_359 | 69 |
| 1197 | 3300046616 | Ga0495668_0212800 | Ga0495668_0212800_175_384 | 69 |
| 1198 | 3300046642 | Ga0495634_0001816 | Ga0495634_0001816_8947_9156 | 69 |
| 1199 | 3300046642 | Ga0495634_0022564 | Ga0495634_0022564_2008_2217 | 69 |
| 1200 | 3300046642 | Ga0495634_0046348 | Ga0495634_0046348_2274_2483 | 69 |
| 1201 | 3300046648 | Ga0495611_0393796 | Ga0495611_0393796_14_223 | 69 |
| 1202 | 3300046660 | Ga0495625_0061712 | Ga0495625_0061712_2053_2262 | 69 |
| 1203 | 3300046660 | Ga0495625_0148119 | Ga0495625_0148119_983_1192 | 69 |
| 1204 | 3300046660 | Ga0495625_0189866 | Ga0495625_0189866_291_500 | 69 |
| 1205 | 3300046660 | Ga0495625_0335331 | Ga0495625_0335331_438_647 | 69 |
| 1206 | 3300046660 | Ga0495625_0655067 | Ga0495625_0655067_173_382 | 69 |
| 1207 | 3300046660 | Ga0495625_0885160 | Ga0495625_0885160_275_484 | 69 |
| 1208 | 3300046663 | Ga0495635_0000392 | Ga0495635_0000392_8649_8858 | 69 |
| 1209 | 3300046663 | Ga0495635_0000913 | Ga0495635_0000913_1516_1725 | 69 |
| 1210 | 3300046663 | Ga0495635_0013724 | Ga0495635_0013724_5222_5431 | 69 |
| 1211 | 3300046663 | Ga0495635_0890859 | Ga0495635_0890859_323_532 | 69 |
| 1212 | 3300046664 | Ga0495659_0010639 | Ga0495659_0010639_2532_2741 | 69 |
| 1213 | 3300046665 | Ga0495661_0191126 | Ga0495661_0191126_98_307 | 69 |
| 1214 | 3300046674 | Ga0495588_0012713 | Ga0495588_0012713_820_1029 | 69 |
| 1215 | 3300046674 | Ga0495588_0025063 | Ga0495588_0025063_2473_2682 | 69 |
| 1216 | 3300046674 | Ga0495588_0131282 | Ga0495588_0131282_1095_1304 | 69 |
| 1217 | 3300046674 | Ga0495588_0145658 | Ga0495588_0145658_451_660 | 69 |
| 1218 | 3300046674 | Ga0495588_0672244 | Ga0495588_0672244_34_243 | 69 |
| 1219 | 3300046675 | Ga0495657_0017255 | Ga0495657_0017255_2210_2419 | 69 |
| 1220 | 3300046675 | Ga0495657_0057220 | Ga0495657_0057220_518_727 | 69 |
| 1221 | 3300046675 | Ga0495657_0264147 | Ga0495657_0264147_46_255 | 69 |
| 1222 | 3300046678 | Ga0495599_0022199 | Ga0495599_0022199_2472_2681 | 69 |
| 1223 | 3300046678 | Ga0495599_0039450 | Ga0495599_0039450_2194_2403 | 69 |
| 1224 | 3300046678 | Ga0495599_0687111 | Ga0495599_0687111_235_447 | 69 |
| 1225 | 3300046679 | Ga0495623_0005202 | Ga0495623_0005202_392_601 | 69 |
| 1226 | 3300046679 | Ga0495623_0143454 | Ga0495623_0143454_991_1200 | 69 |
| 1227 | 3300046680 | Ga0495646_0011455 | Ga0495646_0011455_719_928 | 69 |
| 1228 | 3300046680 | Ga0495646_0011689 | Ga0495646_0011689_1838_2047 | 69 |
| 1229 | 3300046681 | Ga0495647_0000430 | Ga0495647_0000430_7702_7911 | 69 |
| 1230 | 3300046683 | Ga0495658_0001021 | Ga0495658_0001021_7302_7511 | 69 |
| 1231 | 3300046689 | Ga0495613_0021060 | Ga0495613_0021060_1263_1472 | 69 |
| 1232 | 3300046689 | Ga0495613_0046810 | Ga0495613_0046810_930_1139 | 69 |
| 1233 | 3300046689 | Ga0495613_0595391 | Ga0495613_0595391_406_615 | 69 |
| 1234 | 3300046690 | Ga0495624_0001716 | Ga0495624_0001716_75_284 | 69 |
| 1235 | 3300046690 | Ga0495624_0246670 | Ga0495624_0246670_763_972 | 69 |
| 1236 | 3300046690 | Ga0495624_0625971 | Ga0495624_0625971_263_472 | 69 |
| 1237 | 3300046690 | Ga0495624_0704503 | Ga0495624_0704503_185_394 | 69 |
| 1238 | 3300046691 | Ga0495670_0046299 | Ga0495670_0046299_1932_2141 | 69 |
| 1239 | 3300046691 | Ga0495670_0101183 | Ga0495670_0101183_890_1099 | 69 |
| 1240 | 3300046692 | Ga0495671_0135119 | Ga0495671_0135119_50_259 | 69 |
| 1241 | 3300046692 | Ga0495671_0212299 | Ga0495671_0212299_527_736 | 69 |
| 1242 | 3300046694 | Ga0495649_0161965 | Ga0495649_0161965_610_819 | 69 |
| 1243 | 3300046794 | Ga0495589_0090919 | Ga0495589_0090919_1118_1327 | 69 |
| 1244 | 3300046809 | Ga0495600_0013868 | Ga0495600_0013868_2681_2890 | 69 |
| 1245 | 3300046809 | Ga0495600_0054637 | Ga0495600_0054637_1325_1534 | 69 |
| 1246 | 3300046809 | Ga0495600_0064160 | Ga0495600_0064160_1890_2099 | 69 |
| 1247 | 3300046810 | Ga0495660_0178542 | Ga0495660_0178542_395_604 | 69 |
| 1248 | 3300047315 | Ga0495581_0000559 | Ga0495581_0000559_18464_18673 | 69 |
| 1249 | 3300047315 | Ga0495581_0297773 | Ga0495581_0297773_124_333 | 69 |
| 1250 | 3300047317 | Ga0495604_0010363 | Ga0495604_0010363_4312_4521 | 69 |
| 1251 | 3300047317 | Ga0495604_0011190 | Ga0495604_0011190_1075_1284 | 69 |
| 1252 | 3300047318 | Ga0495636_0124834 | Ga0495636_0124834_43_252 | 69 |
| 1253 | 3300047319 | Ga0495674_0001216 | Ga0495674_0001216_9328_9537 | 69 |
| 1254 | 3300047319 | Ga0495674_0012665 | Ga0495674_0012665_5413_5622 | 69 |
| 1255 | 3300047319 | Ga0495674_0070782 | Ga0495674_0070782_2540_2749 | 69 |
| 1256 | 3300047319 | Ga0495674_0476187 | Ga0495674_0476187_347_556 | 69 |
| 1257 | 3300047319 | Ga0495674_1054639 | Ga0495674_1054639_140_349 | 69 |
| 1258 | 3300047319 | Ga0495674_1485784 | Ga0495674_1485784_269_478 | 69 |
| 1259 | 3300047320 | Ga0495672_0256285 | Ga0495672_0256285_112_321 | 69 |
| 1260 | 3300047320 | Ga0495672_0527303 | Ga0495672_0527303_242_451 | 69 |
| 1261 | 3300047321 | Ga0495676_0013658 | Ga0495676_0013658_6754_6963 | 69 |
| 1262 | 3300047321 | Ga0495676_0056178 | Ga0495676_0056178_1710_1919 | 69 |
| 1263 | 3300047322 | Ga0495680_0041225 | Ga0495680_0041225_1725_1934 | 69 |
| 1264 | 3300047322 | Ga0495680_0252145 | Ga0495680_0252145_178_387 | 69 |
| 1265 | 3300047444 | Ga0495675_0005490 | Ga0495675_0005490_5056_5265 | 69 |
| 1266 | 3300047444 | Ga0495675_0544420 | Ga0495675_0544420_302_511 | 69 |
| 1267 | 3300047445 | Ga0495677_0085011 | Ga0495677_0085011_137_346 | 69 |
| 1268 | 3300047445 | Ga0495677_0169532 | Ga0495677_0169532_86_295 | 69 |
| 1269 | 3300047447 | Ga0495685_040561 | Ga0495685_040561_207_416 | 69 |
| 1270 | 3300047469 | Ga0495673_0048086 | Ga0495673_0048086_608_817 | 69 |
| 1271 | 3300047469 | Ga0495673_0055147 | Ga0495673_0055147_949_1158 | 69 |
| 1272 | 3300047469 | Ga0495673_0152210 | Ga0495673_0152210_536_745 | 69 |
| 1273 | 3300047469 | Ga0495673_0202116 | Ga0495673_0202116_511_720 | 69 |
| 1274 | 3300047469 | Ga0495673_0209976 | Ga0495673_0209976_64_273 | 69 |
| 1275 | 3300047470 | Ga0495681_0244518 | Ga0495681_0244518_31_240 | 69 |
| 1276 | 3300047470 | Ga0495681_0247833 | Ga0495681_0247833_408_617 | 69 |
| 1277 | 3300047471 | Ga0495684_0002174 | Ga0495684_0002174_13761_13970 | 69 |
| 1278 | 3300047471 | Ga0495684_0012372 | Ga0495684_0012372_1891_2100 | 69 |
| 1279 | 3300047471 | Ga0495684_0070557 | Ga0495684_0070557_177_386 | 69 |
| 1280 | 3300047472 | Ga0495686_0003677 | Ga0495686_0003677_6716_6925 | 69 |
| 1281 | 3300047472 | Ga0495686_0025883 | Ga0495686_0025883_1140_1352 | 69 |
| 1282 | 3300047472 | Ga0495686_0026151 | Ga0495686_0026151_1777_1986 | 69 |
| 1283 | 3300047472 | Ga0495686_0328385 | Ga0495686_0328385_429_638 | 69 |
| 1284 | 3300047673 | Ga0495593_0000100 | Ga0495593_0000100_36999_37208 | 69 |
| 1285 | 3300047673 | Ga0495593_0000132 | Ga0495593_0000132_15662_15871 | 69 |
| 1286 | 3300048088 | Ga0495602_0013942 | Ga0495602_0013942_6576_6785 | 69 |
| 1287 | 3300048088 | Ga0495602_0027269 | Ga0495602_0027269_3838_4047 | 69 |
| 1288 | 3300048088 | Ga0495602_0175408 | Ga0495602_0175408_567_776 | 69 |
| 1289 | 3300048089 | Ga0495614_0022088 | Ga0495614_0022088_2295_2504 | 69 |
| 1290 | 3300048090 | Ga0495615_0114452 | Ga0495615_0114452_459_668 | 69 |
| 1291 | 3300048090 | Ga0495615_0313995 | Ga0495615_0313995_256_465 | 69 |
| 1292 | 3300048091 | Ga0495626_0132922 | Ga0495626_0132922_121_330 | 69 |
| 1293 | 3300048903 | Ga0496100_0228189 | Ga0496100_0228189_563_772 | 69 |
| 1294 | 3300048903 | Ga0496100_0298806 | Ga0496100_0298806_486_695 | 69 |
| 1295 | 3300048903 | Ga0496100_0992456 | Ga0496100_0992456_245_457 | 69 |
| 1296 | 3300048904 | Ga0496101_0587486 | Ga0496101_0587486_121_330 | 69 |
| 1297 | 3300048905 | Ga0496102_0561544 | Ga0496102_0561544_399_611 | 69 |
| 1298 | 3300048905 | Ga0496102_0709223 | Ga0496102_0709223_102_311 | 69 |
| 1299 | 3300048905 | Ga0496102_1202640 | Ga0496102_1202640_223_435 | 69 |
| 1300 | 3300048906 | Ga0496103_0118156 | Ga0496103_0118156_597_809 | 69 |
| 1301 | 3300048906 | Ga0496103_1057417 | Ga0496103_1057417_271_483 | 69 |
| 1302 | 3300048907 | Ga0496104_0650771 | Ga0496104_0650771_269_478 | 69 |
| 1303 | 3300048909 | Ga0496106_0113204 | Ga0496106_0113204_902_1111 | 69 |
| 1304 | 3300048910 | Ga0496107_0761783 | Ga0496107_0761783_412_621 | 69 |
| 1305 | 3300048911 | Ga0496108_0327470 | Ga0496108_0327470_826_1035 | 69 |
| 1306 | 3300048911 | Ga0496108_1410217 | Ga0496108_1410217_19_228 | 69 |
| 1307 | 3300048912 | Ga0496109_0599125 | Ga0496109_0599125_272_481 | 69 |
| 1308 | 3300048913 | Ga0496110_0380724 | Ga0496110_0380724_877_1086 | 69 |
| 1309 | 3300048913 | Ga0496110_0438288 | Ga0496110_0438288_709_918 | 69 |
| 1310 | 3300048913 | Ga0496110_1024342 | Ga0496110_1024342_126_335 | 69 |
| 1311 | 3300048915 | Ga0496112_0537352 | Ga0496112_0537352_415_627 | 69 |
| 1312 | 3300048916 | Ga0496113_0079189 | Ga0496113_0079189_1235_1444 | 69 |
| 1313 | 3300048917 | Ga0496114_1052057 | Ga0496114_1052057_227_439 | 69 |
| 1314 | 3300048917 | Ga0496114_1070575 | Ga0496114_1070575_225_434 | 69 |
| 1315 | 3300048918 | Ga0496115_0088436 | Ga0496115_0088436_2045_2254 | 69 |
| 1316 | 3300048918 | Ga0496115_0153163 | Ga0496115_0153163_1122_1331 | 69 |
| 1317 | 3300048918 | Ga0496115_0504776 | Ga0496115_0504776_610_822 | 69 |
| 1318 | 3300048918 | Ga0496115_0640362 | Ga0496115_0640362_331_540 | 69 |
| 1319 | 3300048918 | Ga0496115_1110982 | Ga0496115_1110982_277_486 | 69 |
| 1320 | 3300048919 | Ga0496116_0000036 | Ga0496116_0000036_191289_191498 | 69 |
| 1321 | 3300048919 | Ga0496116_0002794 | Ga0496116_0002794_4024_4233 | 69 |
| 1322 | 3300048919 | Ga0496116_0007250 | Ga0496116_0007250_9435_9644 | 69 |
| 1323 | 3300048919 | Ga0496116_0021310 | Ga0496116_0021310_13_222 | 69 |
| 1324 | 3300048919 | Ga0496116_0174178 | Ga0496116_0174178_779_988 | 69 |
| 1325 | 3300048919 | Ga0496116_0321765 | Ga0496116_0321765_48_257 | 69 |
| 1326 | 3300048920 | Ga0496117_0010131 | Ga0496117_0010131_7085_7294 | 69 |
| 1327 | 3300048920 | Ga0496117_0013726 | Ga0496117_0013726_59_268 | 69 |
| 1328 | 3300048920 | Ga0496117_0054538 | Ga0496117_0054538_1350_1559 | 69 |
| 1329 | 3300048920 | Ga0496117_0104782 | Ga0496117_0104782_1107_1316 | 69 |
| 1330 | 3300048920 | Ga0496117_0123294 | Ga0496117_0123294_348_557 | 69 |
| 1331 | 3300048920 | Ga0496117_0149818 | Ga0496117_0149818_219_431 | 69 |
| 1332 | 3300048920 | Ga0496117_0170664 | Ga0496117_0170664_76_285 | 69 |
| 1333 | 3300048920 | Ga0496117_0376488 | Ga0496117_0376488_323_532 | 69 |
| 1334 | 3300048921 | Ga0496118_0007062 | Ga0496118_0007062_6341_6550 | 69 |
| 1335 | 3300048921 | Ga0496118_0023486 | Ga0496118_0023486_1773_1982 | 69 |
| 1336 | 3300048921 | Ga0496118_0038896 | Ga0496118_0038896_3455_3664 | 69 |
| 1337 | 3300048921 | Ga0496118_0113625 | Ga0496118_0113625_446_655 | 69 |
| 1338 | 3300048921 | Ga0496118_0226790 | Ga0496118_0226790_81_290 | 69 |
| 1339 | 3300048921 | Ga0496118_0465007 | Ga0496118_0465007_238_447 | 69 |
| 1340 | 3300048921 | Ga0496118_0571167 | Ga0496118_0571167_63_272 | 69 |
| 1341 | 3300048922 | Ga0496119_0005479 | Ga0496119_0005479_752_961 | 69 |
| 1342 | 3300048922 | Ga0496119_0021490 | Ga0496119_0021490_2534_2743 | 69 |
| 1343 | 3300048922 | Ga0496119_0027654 | Ga0496119_0027654_2292_2501 | 69 |
| 1344 | 3300048922 | Ga0496119_0034617 | Ga0496119_0034617_741_953 | 69 |
| 1345 | 3300048922 | Ga0496119_0043581 | Ga0496119_0043581_2461_2670 | 69 |
| 1346 | 3300048922 | Ga0496119_0051300 | Ga0496119_0051300_2180_2389 | 69 |
| 1347 | 3300048922 | Ga0496119_0072593 | Ga0496119_0072593_890_1102 | 69 |
| 1348 | 3300048922 | Ga0496119_0078576 | Ga0496119_0078576_1342_1551 | 69 |
| 1349 | 3300048922 | Ga0496119_0217818 | Ga0496119_0217818_353_562 | 69 |
| 1350 | 3300048922 | Ga0496119_0328292 | Ga0496119_0328292_19_228 | 69 |
| 1351 | 3300048922 | Ga0496119_0400113 | Ga0496119_0400113_17_226 | 69 |
| 1352 | 3300048922 | Ga0496119_0408209 | Ga0496119_0408209_85_294 | 69 |
| 1353 | 3300048923 | Ga0496120_0025241 | Ga0496120_0025241_3175_3387 | 69 |
| 1354 | 3300048923 | Ga0496120_0097482 | Ga0496120_0097482_618_827 | 69 |
| 1355 | 3300048923 | Ga0496120_0133494 | Ga0496120_0133494_406_615 | 69 |
| 1356 | 3300048923 | Ga0496120_0321289 | Ga0496120_0321289_273_482 | 69 |
| 1357 | 3300048924 | Ga0496121_0000001 | Ga0496121_0000001_1364332_1364541 | 69 |
| 1358 | 3300048924 | Ga0496121_0010678 | Ga0496121_0010678_4303_4512 | 69 |
| 1359 | 3300048924 | Ga0496121_0015359 | Ga0496121_0015359_4330_4539 | 69 |
| 1360 | 3300048924 | Ga0496121_0071104 | Ga0496121_0071104_270_479 | 69 |
| 1361 | 3300048924 | Ga0496121_0196002 | Ga0496121_0196002_918_1127 | 69 |
| 1362 | 3300048924 | Ga0496121_0246527 | Ga0496121_0246527_367_576 | 69 |
| 1363 | 3300048924 | Ga0496121_0383911 | Ga0496121_0383911_668_877 | 69 |
| 1364 | 3300048924 | Ga0496121_0399908 | Ga0496121_0399908_241_453 | 69 |
| 1365 | 3300048924 | Ga0496121_0418989 | Ga0496121_0418989_451_660 | 69 |
| 1366 | 3300048924 | Ga0496121_0784536 | Ga0496121_0784536_245_454 | 69 |
| 1367 | 3300048925 | Ga0496122_0000172 | Ga0496122_0000172_119252_119461 | 69 |
| 1368 | 3300048925 | Ga0496122_0001281 | Ga0496122_0001281_3779_3988 | 69 |
| 1369 | 3300048925 | Ga0496122_0004854 | Ga0496122_0004854_14579_14788 | 69 |
| 1370 | 3300048925 | Ga0496122_0010659 | Ga0496122_0010659_7001_7210 | 69 |
| 1371 | 3300048925 | Ga0496122_0043395 | Ga0496122_0043395_1703_1912 | 69 |
| 1372 | 3300048925 | Ga0496122_0083059 | Ga0496122_0083059_2001_2210 | 69 |
| 1373 | 3300048925 | Ga0496122_0115276 | Ga0496122_0115276_516_725 | 69 |
| 1374 | 3300048925 | Ga0496122_0115381 | Ga0496122_0115381_535_744 | 69 |
| 1375 | 3300048925 | Ga0496122_0171571 | Ga0496122_0171571_924_1133 | 69 |
| 1376 | 3300048925 | Ga0496122_0195488 | Ga0496122_0195488_942_1151 | 69 |
| 1377 | 3300048925 | Ga0496122_0226094 | Ga0496122_0226094_816_1025 | 69 |
| 1378 | 3300048925 | Ga0496122_0395121 | Ga0496122_0395121_20_229 | 69 |
| 1379 | 3300048925 | Ga0496122_0527716 | Ga0496122_0527716_34_243 | 69 |
| 1380 | 3300048926 | Ga0496123_0000132 | Ga0496123_0000132_119300_119509 | 69 |
| 1381 | 3300048926 | Ga0496123_0001497 | Ga0496123_0001497_4499_4708 | 69 |
| 1382 | 3300048926 | Ga0496123_0006065 | Ga0496123_0006065_7610_7819 | 69 |
| 1383 | 3300048926 | Ga0496123_0009982 | Ga0496123_0009982_3733_3942 | 69 |
| 1384 | 3300048926 | Ga0496123_0016524 | Ga0496123_0016524_2004_2213 | 69 |
| 1385 | 3300048926 | Ga0496123_0044522 | Ga0496123_0044522_706_915 | 69 |
| 1386 | 3300048926 | Ga0496123_0065064 | Ga0496123_0065064_988_1197 | 69 |
| 1387 | 3300048926 | Ga0496123_0103894 | Ga0496123_0103894_134_343 | 69 |
| 1388 | 3300048926 | Ga0496123_0225584 | Ga0496123_0225584_720_929 | 69 |
| 1389 | 3300048926 | Ga0496123_0357678 | Ga0496123_0357678_218_427 | 69 |
| 1390 | 3300048926 | Ga0496123_0370822 | Ga0496123_0370822_432_641 | 69 |
| 1391 | 3300048926 | Ga0496123_0378917 | Ga0496123_0378917_267_476 | 69 |
| 1392 | 3300048927 | Ga0496124_0006047 | Ga0496124_0006047_5796_6005 | 69 |
| 1393 | 3300048927 | Ga0496124_0011220 | Ga0496124_0011220_7124_7333 | 69 |
| 1394 | 3300048927 | Ga0496124_0024032 | Ga0496124_0024032_4326_4535 | 69 |
| 1395 | 3300048927 | Ga0496124_0048640 | Ga0496124_0048640_2911_3120 | 69 |
| 1396 | 3300048927 | Ga0496124_0060917 | Ga0496124_0060917_963_1172 | 69 |
| 1397 | 3300048927 | Ga0496124_0066786 | Ga0496124_0066786_2470_2679 | 69 |
| 1398 | 3300048927 | Ga0496124_0085685 | Ga0496124_0085685_1877_2086 | 69 |
| 1399 | 3300048927 | Ga0496124_0087923 | Ga0496124_0087923_39_248 | 69 |
| 1400 | 3300048927 | Ga0496124_0127317 | Ga0496124_0127317_1774_1983 | 69 |
| 1401 | 3300048927 | Ga0496124_0207469 | Ga0496124_0207469_324_533 | 69 |
| 1402 | 3300048927 | Ga0496124_0277966 | Ga0496124_0277966_754_963 | 69 |
| 1403 | 3300048927 | Ga0496124_0678953 | Ga0496124_0678953_306_515 | 69 |
| 1404 | 3300048927 | Ga0496124_0715194 | Ga0496124_0715194_67_276 | 69 |
| 1405 | 3300048928 | Ga0496125_0000001 | Ga0496125_0000001_1524038_1524247 | 69 |
| 1406 | 3300048928 | Ga0496125_0060025 | Ga0496125_0060025_1998_2207 | 69 |
| 1407 | 3300048928 | Ga0496125_0061181 | Ga0496125_0061181_320_529 | 69 |
| 1408 | 3300048928 | Ga0496125_0068188 | Ga0496125_0068188_2321_2530 | 69 |
| 1409 | 3300048928 | Ga0496125_0095573 | Ga0496125_0095573_1391_1600 | 69 |
| 1410 | 3300048928 | Ga0496125_0124377 | Ga0496125_0124377_949_1158 | 69 |
| 1411 | 3300048928 | Ga0496125_0142145 | Ga0496125_0142145_1362_1571 | 69 |
| 1412 | 3300048928 | Ga0496125_0147367 | Ga0496125_0147367_1276_1488 | 69 |
| 1413 | 3300048929 | Ga0496126_0000597 | Ga0496126_0000597_25602_25811 | 69 |
| 1414 | 3300048929 | Ga0496126_0005070 | Ga0496126_0005070_2918_3127 | 69 |
| 1415 | 3300048929 | Ga0496126_0008753 | Ga0496126_0008753_5696_5905 | 69 |
| 1416 | 3300048929 | Ga0496126_0018683 | Ga0496126_0018683_6258_6467 | 69 |
| 1417 | 3300048929 | Ga0496126_0049320 | Ga0496126_0049320_1553_1762 | 69 |
| 1418 | 3300048929 | Ga0496126_0052371 | Ga0496126_0052371_1755_1967 | 69 |
| 1419 | 3300048929 | Ga0496126_0052478 | Ga0496126_0052478_635_844 | 69 |
| 1420 | 3300048929 | Ga0496126_0064532 | Ga0496126_0064532_1676_1885 | 69 |
| 1421 | 3300048929 | Ga0496126_0334951 | Ga0496126_0334951_552_761 | 69 |
| 1422 | 3300048929 | Ga0496126_0589479 | Ga0496126_0589479_238_447 | 69 |
| 1423 | 3300048929 | Ga0496126_0765118 | Ga0496126_0765118_205_414 | 69 |
| 1424 | 3300048929 | Ga0496126_1030425 | Ga0496126_1030425_391_600 | 69 |
| 1425 | 3300048929 | Ga0496126_1130527 | Ga0496126_1130527_318_533 | 69 |
| 1426 | 3300049161 | Ga0501305_121133 | Ga0501305_121133_120_332 | 69 |
| 1427 | 3300049459 | Ga0495678_005943 | Ga0495678_005943_5422_5631 | 69 |
| 1428 | 3300049459 | Ga0495678_048764 | Ga0495678_048764_1045_1254 | 69 |
| 1429 | 3300049459 | Ga0495678_120106 | Ga0495678_120106_158_367 | 69 |
| 1430 | 3300049533 | Ga0501317_023130 | Ga0501317_023130_109_318 | 69 |
| 1431 | 3300049568 | Ga0501031_0779037 | Ga0501031_0779037_185_394 | 69 |
| 1432 | 3300049569 | Ga0501032_0415889 | Ga0501032_0415889_449_664 | 69 |
| 1433 | 3300049569 | Ga0501032_0645451 | Ga0501032_0645451_214_423 | 69 |
| 1434 | 3300049569 | Ga0501032_0680297 | Ga0501032_0680297_46_255 | 69 |
| 1435 | 3300049570 | Ga0501033_0000050 | Ga0501033_0000050_5222_5431 | 69 |
| 1436 | 3300049570 | Ga0501033_0052194 | Ga0501033_0052194_1167_1376 | 69 |
| 1437 | 3300049570 | Ga0501033_0385568 | Ga0501033_0385568_558_770 | 69 |
| 1438 | 3300049571 | Ga0501034_0005317 | Ga0501034_0005317_4117_4326 | 69 |
| 1439 | 3300049571 | Ga0501034_0021763 | Ga0501034_0021763_6262_6474 | 69 |
| 1440 | 3300049571 | Ga0501034_0074864 | Ga0501034_0074864_552_767 | 69 |
| 1441 | 3300049571 | Ga0501034_1424141 | Ga0501034_1424141_102_311 | 69 |
| 1442 | 3300049572 | Ga0501036_0103938 | Ga0501036_0103938_400_615 | 69 |
| 1443 | 3300049572 | Ga0501036_0180955 | Ga0501036_0180955_693_902 | 69 |
| 1444 | 3300049573 | Ga0501037_0087849 | Ga0501037_0087849_551_760 | 69 |
| 1445 | 3300049574 | Ga0501038_0722907 | Ga0501038_0722907_383_598 | 69 |
| 1446 | 3300049577 | Ga0501041_0200954 | Ga0501041_0200954_876_1085 | 69 |
| 1447 | 3300049577 | Ga0501041_0911947 | Ga0501041_0911947_36_248 | 69 |
| 1448 | 3300049579 | Ga0501043_0809665 | Ga0501043_0809665_325_540 | 69 |
| 1449 | 3300049579 | Ga0501043_0810294 | Ga0501043_0810294_371_580 | 69 |
| 1450 | 3300049579 | Ga0501043_1194948 | Ga0501043_1194948_60_272 | 69 |
| 1451 | 3300049580 | Ga0501046_0970742 | Ga0501046_0970742_222_431 | 69 |
| 1452 | 3300049581 | Ga0501047_0094313 | Ga0501047_0094313_472_687 | 69 |
| 1453 | 3300049581 | Ga0501047_0314097 | Ga0501047_0314097_226_435 | 69 |
| 1454 | 3300049581 | Ga0501047_0548393 | Ga0501047_0548393_173_385 | 69 |
| 1455 | 3300049583 | Ga0501067_0061270 | Ga0501067_0061270_1755_1967 | 69 |
| 1456 | 3300049583 | Ga0501067_0520388 | Ga0501067_0520388_221_430 | 69 |
| 1457 | 3300049584 | Ga0501068_0319965 | Ga0501068_0319965_265_474 | 69 |
| 1458 | 3300049586 | Ga0501070_0913173 | Ga0501070_0913173_261_476 | 69 |
| 1459 | 3300049589 | Ga0501073_1134278 | Ga0501073_1134278_161_373 | 69 |
| 1460 | 3300049590 | Ga0501074_0179781 | Ga0501074_0179781_1262_1477 | 69 |
| 1461 | 3300049590 | Ga0501074_1153973 | Ga0501074_1153973_187_399 | 69 |
| 1462 | 3300049671 | Ga0501238_007369 | Ga0501238_007369_836_1045 | 69 |
| 1463 | 3300049683 | Ga0501253_134140 | Ga0501253_134140_192_401 | 69 |
| 1464 | 3300049742 | Ga0501080_0597821 | Ga0501080_0597821_398_607 | 69 |
| 1465 | 3300049742 | Ga0501080_1400354 | Ga0501080_1400354_167_382 | 69 |
| 1466 | 3300049744 | Ga0501083_0092804 | Ga0501083_0092804_21_230 | 69 |
| 1467 | 3300049744 | Ga0501083_0092920 | Ga0501083_0092920_1647_1856 | 69 |
| 1468 | 3300049758 | Ga0501241_011950 | Ga0501241_011950_474_683 | 69 |
| 1469 | 3300049758 | Ga0501241_135822 | Ga0501241_135822_127_336 | 69 |
| 1470 | 3300049822 | Ga0501035_0001982 | Ga0501035_0001982_9845_10054 | 69 |
| 1471 | 3300049822 | Ga0501035_0003519 | Ga0501035_0003519_7626_7835 | 69 |
| 1472 | 3300049822 | Ga0501035_0569761 | Ga0501035_0569761_167_376 | 69 |
| 1473 | 3300049822 | Ga0501035_1553312 | Ga0501035_1553312_77_292 | 69 |
| 1474 | 3300049823 | Ga0501044_0508275 | Ga0501044_0508275_707_922 | 69 |
| 1475 | 3300049823 | Ga0501044_1263587 | Ga0501044_1263587_176_385 | 69 |
| 1476 | 3300049823 | Ga0501044_1331652 | Ga0501044_1331652_167_376 | 69 |
| 1477 | 3300050489 | nmdc:mga03683_16528_c1 | nmdc:mga03683_16528_c1_1851_2063 | 69 |
| 1478 | 3300050489 | nmdc:mga03683_169159_c1 | nmdc:mga03683_169159_c1_432_641 | 69 |
| 1479 | 3300050490 | nmdc:mga03n38_48732_c1 | nmdc:mga03n38_48732_c1_374_586 | 69 |
| 1480 | 3300050490 | nmdc:mga03n38_905166_c1 | nmdc:mga03n38_905166_c1_99_308 | 69 |
| 1481 | 3300050491 | nmdc:mga00v17_1052520_c1 | nmdc:mga00v17_1052520_c1_39_248 | 69 |
| 1482 | 3300050491 | nmdc:mga00v17_119083_c1 | nmdc:mga00v17_119083_c1_345_554 | 69 |
| 1483 | 3300050491 | nmdc:mga00v17_63187_c1 | nmdc:mga00v17_63187_c1_660_869 | 69 |
| 1484 | 3300050491 | nmdc:mga00v17_725596_c1 | nmdc:mga00v17_725596_c1_309_518 | 69 |
| 1485 | 3300050491 | nmdc:mga00v17_728_c1 | nmdc:mga00v17_728_c1_2172_2381 | 69 |
| 1486 | 3300050491 | nmdc:mga00v17_84260_c1 | nmdc:mga00v17_84260_c1_1251_1463 | 69 |
| 1487 | 3300050491 | nmdc:mga00v17_886430_c1 | nmdc:mga00v17_886430_c1_194_403 | 69 |
| 1488 | 3300050492 | nmdc:mga0yw44_1143200_c1 | nmdc:mga0yw44_1143200_c1_144_353 | 69 |
| 1489 | 3300050492 | nmdc:mga0yw44_1180437_c1 | nmdc:mga0yw44_1180437_c1_236_445 | 69 |
| 1490 | 3300050492 | nmdc:mga0yw44_231721_c1 | nmdc:mga0yw44_231721_c1_995_1204 | 69 |
| 1491 | 3300050492 | nmdc:mga0yw44_5416_c1 | nmdc:mga0yw44_5416_c1_4327_4536 | 69 |
| 1492 | 3300050492 | nmdc:mga0yw44_546422_c1 | nmdc:mga0yw44_546422_c1_483_692 | 69 |
| 1493 | 3300050492 | nmdc:mga0yw44_79540_c1 | nmdc:mga0yw44_79540_c1_1156_1365 | 69 |
| 1494 | 3300050492 | nmdc:mga0yw44_985723_c1 | nmdc:mga0yw44_985723_c1_127_339 | 69 |
| 1495 | 3300050493 | nmdc:mga0k408_151925_c1 | nmdc:mga0k408_151925_c1_800_1009 | 69 |
| 1496 | 3300050493 | nmdc:mga0k408_558834_c1 | nmdc:mga0k408_558834_c1_95_304 | 69 |
| 1497 | 3300050493 | nmdc:mga0k408_789108_c1 | nmdc:mga0k408_789108_c1_276_485 | 69 |
| 1498 | 3300050494 | nmdc:mga06z11_309373_c1 | nmdc:mga06z11_309373_c1_636_848 | 69 |
| 1499 | 3300050494 | nmdc:mga06z11_345327_c1 | nmdc:mga06z11_345327_c1_350_559 | 69 |
| 1500 | 3300050494 | nmdc:mga06z11_59652_c1 | nmdc:mga06z11_59652_c1_703_915 | 69 |
| 1501 | 3300050494 | nmdc:mga06z11_713135_c1 | nmdc:mga06z11_713135_c1_135_344 | 69 |
| 1502 | 3300050495 | nmdc:mga04h51_48624_c1 | nmdc:mga04h51_48624_c1_788_1000 | 69 |
| 1503 | 3300050496 | nmdc:mga07m45_167727_c1 | nmdc:mga07m45_167727_c1_1038_1247 | 69 |
| 1504 | 3300050496 | nmdc:mga07m45_24802_c1 | nmdc:mga07m45_24802_c1_754_963 | 69 |
| 1505 | 3300050496 | nmdc:mga07m45_443576_c1 | nmdc:mga07m45_443576_c1_512_721 | 69 |
| 1506 | 3300050496 | nmdc:mga07m45_544878_c1 | nmdc:mga07m45_544878_c1_240_449 | 69 |
| 1507 | 3300050496 | nmdc:mga07m45_71443_c1 | nmdc:mga07m45_71443_c1_831_1043 | 69 |
| 1508 | 3300050507 | nmdc:mga05p37_833956_c1 | nmdc:mga05p37_833956_c1_662_871 | 69 |
| 1509 | 3300050510 | nmdc:mga06r32_1862570_c1 | nmdc:mga06r32_1862570_c1_33_242 | 69 |
| 1510 | 3300050511 | nmdc:mga08y16_695244_c1 | nmdc:mga08y16_695244_c1_421_630 | 69 |
| 1511 | 3300050511 | nmdc:mga08y16_701951_c1 | nmdc:mga08y16_701951_c1_140_352 | 69 |
| 1512 | 3300050516 | nmdc:mga0sz30_170331_c1 | nmdc:mga0sz30_170331_c1_600_812 | 69 |
| 1513 | 3300050516 | nmdc:mga0sz30_20504_c1 | nmdc:mga0sz30_20504_c1_42_251 | 69 |
| 1514 | 3300050516 | nmdc:mga0sz30_216534_c1 | nmdc:mga0sz30_216534_c1_574_783 | 69 |
| 1515 | 3300050516 | nmdc:mga0sz30_443335_c1 | nmdc:mga0sz30_443335_c1_74_283 | 69 |
| 1516 | 3300050516 | nmdc:mga0sz30_541268_c1 | nmdc:mga0sz30_541268_c1_92_301 | 69 |
| 1517 | 3300050516 | nmdc:mga0sz30_568279_c1 | nmdc:mga0sz30_568279_c1_196_405 | 69 |
| 1518 | 3300050516 | nmdc:mga0sz30_99662_c1 | nmdc:mga0sz30_99662_c1_284_493 | 69 |
| 1519 | 3300053077 | Ga0495601_0044623 | Ga0495601_0044623_998_1207 | 69 |
| 1520 | 3300053077 | Ga0495601_0140646 | Ga0495601_0140646_1133_1342 | 69 |
| 1521 | 3300053077 | Ga0495601_0294647 | Ga0495601_0294647_531_740 | 69 |
| 1522 | 3300053078 | Ga0495612_0030474 | Ga0495612_0030474_1654_1863 | 69 |
| 1523 | 3300053078 | Ga0495612_0344559 | Ga0495612_0344559_13_222 | 69 |
| 1524 | 3300053083 | Ga0495655_0051043 | Ga0495655_0051043_648_857 | 69 |
| 1525 | 3300053084 | Ga0495595_0000874 | Ga0495595_0000874_2260_2469 | 69 |
| 1526 | 3300053084 | Ga0495595_0086754 | Ga0495595_0086754_991_1200 | 69 |
| 1527 | 3300053085 | Ga0495619_0040923 | Ga0495619_0040923_2545_2754 | 69 |
| 1528 | 3300053085 | Ga0495619_0086850 | Ga0495619_0086850_390_599 | 69 |
| 1529 | 3300053085 | Ga0495619_0240304 | Ga0495619_0240304_205_414 | 69 |
| 1530 | 3300053085 | Ga0495619_0705386 | Ga0495619_0705386_182_391 | 69 |
| 1531 | 3300053086 | Ga0500578_0206785 | Ga0500578_0206785_878_1087 | 69 |
| 1532 | 3300053087 | Ga0500643_059261 | Ga0500643_059261_822_1031 | 69 |
| 1533 | 3300053088 | Ga0500644_0069871 | Ga0500644_0069871_689_898 | 69 |
| 1534 | 3300053089 | Ga0500581_234965 | Ga0500581_234965_262_471 | 69 |
| 1535 | 3300053090 | Ga0500646_0389680 | Ga0500646_0389680_128_337 | 69 |
| 1536 | 3300053091 | Ga0500647_0389411 | Ga0500647_0389411_320_529 | 69 |
| 1537 | 3300053100 | Ga0500660_238462 | Ga0500660_238462_147_356 | 69 |
| 1538 | 3300053103 | Ga0500555_079236 | Ga0500555_079236_27_236 | 69 |
| 1539 | 3300053104 | Ga0500556_0151922 | Ga0500556_0151922_202_411 | 69 |
| 1540 | 3300053111 | Ga0500572_221805 | Ga0500572_221805_101_310 | 69 |
| 1541 | 3300053111 | Ga0500572_234648 | Ga0500572_234648_271_480 | 69 |
| 1542 | 3300053116 | Ga0500592_081115 | Ga0500592_081115_152_364 | 69 |
| 1543 | 3300053121 | Ga0500607_275720 | Ga0500607_275720_30_239 | 69 |
| 1544 | 3300053125 | Ga0500618_000560 | Ga0500618_000560_1261_1470 | 69 |
| 1545 | 3300053125 | Ga0500618_010534 | Ga0500618_010534_703_912 | 69 |
| 1546 | 3300053129 | Ga0500628_164554 | Ga0500628_164554_151_363 | 69 |
| 1547 | 3300053130 | Ga0500642_0205541 | Ga0500642_0205541_592_801 | 69 |
| 1548 | 3300053136 | Ga0500559_0075911 | Ga0500559_0075911_645_854 | 69 |
| 1549 | 3300053142 | Ga0500577_0280266 | Ga0500577_0280266_36_245 | 69 |
| 1550 | 3300053145 | Ga0500586_163893 | Ga0500586_163893_325_534 | 69 |
| 1551 | 3300053146 | Ga0500588_0142048 | Ga0500588_0142048_446_658 | 69 |
| 1552 | 3300053151 | Ga0500604_0113727 | Ga0500604_0113727_266_478 | 69 |
| 1553 | 3300053153 | Ga0500616_0001686 | Ga0500616_0001686_10160_10369 | 69 |
| 1554 | 3300053153 | Ga0500616_0041654 | Ga0500616_0041654_394_606 | 69 |
| 1555 | 3300053153 | Ga0500616_0188181 | Ga0500616_0188181_45_257 | 69 |
| 1556 | 3300053156 | Ga0500622_0026143 | Ga0500622_0026143_2744_2953 | 69 |
| 1557 | 3300053156 | Ga0500622_0082165 | Ga0500622_0082165_874_1083 | 69 |
| 1558 | 3300053158 | Ga0500627_0059149 | Ga0500627_0059149_1275_1484 | 69 |
| 1559 | 3300053158 | Ga0500627_0130792 | Ga0500627_0130792_656_868 | 69 |
| 1560 | 3300053158 | Ga0500627_0139126 | Ga0500627_0139126_370_579 | 69 |
| 1561 | 3300053158 | Ga0500627_0267933 | Ga0500627_0267933_252_461 | 69 |
| 1562 | 3300053160 | Ga0500633_0053860 | Ga0500633_0053860_1133_1342 | 69 |
| 1563 | 3300053162 | Ga0500638_342658 | Ga0500638_342658_158_367 | 69 |
| 1564 | 3300053727 | Ga0500611_032595 | Ga0500611_032595_248_460 | 69 |
| 1565 | 3300053730 | Ga0500645_107824 | Ga0500645_107824_102_311 | 69 |
| 1566 | 3300054114 | Ga0501084_0401350 | Ga0501084_0401350_288_500 | 69 |
| 1567 | 3300059477 | Ga0587084_032264 | Ga0587084_032264_531_740 | 69 |
| 1568 | 3300059477 | Ga0587084_122147 | Ga0587084_122147_235_444 | 69 |
| 1569 | 3300059490 | Ga0587066_003392 | Ga0587066_003392_1411_1620 | 69 |
| 1570 | 3300059490 | Ga0587066_075045 | Ga0587066_075045_397_606 | 69 |
| 1571 | 3300059492 | Ga0587073_0070342 | Ga0587073_0070342_528_737 | 69 |
| 1572 | 3300059503 | Ga0587080_112850 | Ga0587080_112850_185_394 | 69 |
| 1573 | 3300059504 | Ga0587082_073323 | Ga0587082_073323_381_590 | 69 |
| 1574 | 3300059505 | Ga0587083_0265568 | Ga0587083_0265568_192_404 | 69 |
| 1575 | 3300059506 | Ga0587085_051183 | Ga0587085_051183_254_463 | 69 |
| 1576 | 3300059508 | Ga0587088_053930 | Ga0587088_053930_106_315 | 69 |
| 1577 | 3300059508 | Ga0587088_177784 | Ga0587088_177784_114_326 | 69 |
| 1578 | 3300059509 | Ga0587089_081117 | Ga0587089_081117_105_314 | 69 |
| 1579 | 3300059509 | Ga0587089_094271 | Ga0587089_094271_212_424 | 69 |
| 1580 | 3300059510 | Ga0587090_156438 | Ga0587090_156438_102_311 | 69 |
| 1581 | 3300059511 | Ga0587091_120787 | Ga0587091_120787_95_304 | 69 |
| 1582 | 3300059512 | Ga0587092_144234 | Ga0587092_144234_208_420 | 69 |
| 1583 | 3300059513 | Ga0587094_067450 | Ga0587094_067450_106_315 | 69 |
| 1584 | 3300059604 | Ga0587098_057932 | Ga0587098_057932_116_325 | 69 |
| 1585 | 3300059605 | Ga0587106_093114 | Ga0587106_093114_69_281 | 69 |
| 1586 | 3300059605 | Ga0587106_117048 | Ga0587106_117048_251_460 | 69 |
| 1587 | 3300059607 | Ga0587125_081280 | Ga0587125_081280_108_320 | 69 |
| 1588 | 3300059608 | Ga0587129_012337 | Ga0587129_012337_297_506 | 69 |
| 1589 | 3300059622 | Ga0587099_038709 | Ga0587099_038709_222_434 | 69 |
| 1590 | 3300059623 | Ga0587101_152743 | Ga0587101_152743_180_392 | 69 |
| 1591 | 3300059624 | Ga0587109_110315 | Ga0587109_110315_323_532 | 69 |
| 1592 | 3300059624 | Ga0587109_141068 | Ga0587109_141068_109_321 | 69 |
| 1593 | 3300059624 | Ga0587109_172366 | Ga0587109_172366_120_329 | 69 |
| 1594 | 3300059625 | Ga0587113_020044 | Ga0587113_020044_374_583 | 69 |
| 1595 | 3300059625 | Ga0587113_053499 | Ga0587113_053499_190_402 | 69 |
| 1596 | 3300059628 | Ga0587122_052835 | Ga0587122_052835_113_325 | 69 |
| 1597 | 3300059628 | Ga0587122_055920 | Ga0587122_055920_206_415 | 69 |
| 1598 | 3300059630 | Ga0587128_062583 | Ga0587128_062583_382_591 | 69 |
| 1599 | 3300059630 | Ga0587128_065140 | Ga0587128_065140_382_591 | 69 |
| 1600 | 3300059640 | Ga0587067_107281 | Ga0587067_107281_104_313 | 69 |
| 1601 | 3300059640 | Ga0587067_190785 | Ga0587067_190785_205_414 | 69 |
| 1602 | 3300059641 | Ga0587068_102435 | Ga0587068_102435_284_496 | 69 |
| 1603 | 3300059643 | Ga0587072_197399 | Ga0587072_197399_166_378 | 69 |
| 1604 | 3300059645 | Ga0587076_004448 | Ga0587076_004448_1311_1520 | 69 |
| 1605 | 3300059645 | Ga0587076_025539 | Ga0587076_025539_139_348 | 69 |
| 1606 | 3300059646 | Ga0587078_078213 | Ga0587078_078213_201_413 | 69 |
| 1607 | 3300059647 | Ga0587079_092152 | Ga0587079_092152_299_511 | 69 |
| 1608 | 3300059649 | Ga0587102_070864 | Ga0587102_070864_192_404 | 69 |
| 1609 | 3300059652 | Ga0587107_142623 | Ga0587107_142623_189_401 | 69 |
| 1610 | 3300059654 | Ga0587110_028814 | Ga0587110_028814_110_319 | 69 |
| 1611 | 3300059654 | Ga0587110_054836 | Ga0587110_054836_116_328 | 69 |
| 1612 | 3300059655 | Ga0587114_119261 | Ga0587114_119261_208_420 | 69 |
| 1613 | 3300059656 | Ga0587116_18054 | Ga0587116_18054_208_420 | 69 |
| 1614 | 3300059659 | Ga0587120_035344 | Ga0587120_035344_104_316 | 69 |
| 1615 | 3300060245 | Ga0587065_09177 | Ga0587065_09177_174_383 | 69 |
| 1616 | 3300060346 | Ga0587111_0097279 | Ga0587111_0097279_104_313 | 69 |
| 1617 | 3300060346 | Ga0587111_0130142 | Ga0587111_0130142_106_315 | 69 |
| 1618 | 3300060346 | Ga0587111_0256972 | Ga0587111_0256972_199_408 | 69 |
| 1619 | 3300060353 | Ga0501082_0335152 | Ga0501082_0335152_203_412 | 69 |
| 1620 | 3300060353 | Ga0501082_0370725 | Ga0501082_0370725_734_943 | 69 |
| 1621 | iso_pu_bacteria | 2958064165 | 2958070758 | 69 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8h1i-assembly1.cif.gz_B | crystal structure of plygrcs, a bacteriophage endolysin in complex with cold shock protein c | 0.8989 | 2 | 69 |
| 1mjc-assembly1.cif.gz_A | crystal structure of cspa, the major cold shock protein of escherichia coli | 0.8907 | 2 | 69 |
| 3i2z-assembly3.cif.gz_A | structure of cold shock protein e from salmonella typhimurium | 0.8787 | 2 | 69 |
| 3i2z-assembly2.cif.gz_B | structure of cold shock protein e from salmonella typhimurium | 0.8709 | 1 | 69 |
| 1hza-assembly1.cif.gz_B | bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability | 0.8701 | 1 | 69 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1LPN7_1_82_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9036 | 2 | 66 | 2.40.50.140 |
| af_Q94C69_1_75_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8858 | 2 | 66 | 2.40.50.140 |
| af_Q9VRN5_36_116_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8854 | 2 | 69 | 2.40.50.140 |
| af_P92186_48_133_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8553 | 2 | 66 | 2.40.50.140 |
| af_Q4DCA9_18_92_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8492 | 3 | 68 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D7IW85-F1-model_v4 | Cold-shock protein | 0.9912 | 1 | 51 |
GO:0003676
|
| AF-A0A7W6W2S8-F1-model_v4 | deleted | 0.9852 | 1 | 68 |
|
| AF-A0A4Q7DKD5-F1-model_v4 | Cold-shock protein | 0.9837 | 1 | 67 |
GO:0003676
GO:0005829 |
| AF-A0A2S6U6G3-F1-model_v4 | Cold shock protein CspA | 0.9816 | 1 | 69 |
GO:0003676
GO:0005829 |
| AF-A0A7D5MY86-F1-model_v4 | Cold shock domain-containing protein | 0.9797 | 2 | 69 |
GO:0003676
GO:0005829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar