F495083

General Info

Members Datasets Scaffolds Average Seq Length
1621 475 3242 380

Family's Representative Sequence

Representative Sequence 3300048909|Ga0496106_0004331|Ga0496106_0004331_5791_7104
Length 437
Sequence MFDDAGLVIITMASHHPAKAGKRPLGVFFDAGFPVPRLSSGGSFMTGVRFGELDAASPTRIARIETFIVPPRWLFVRVETRDGAVGWGEASLEGHAEAVEGAFASLRERFVGADPDNIEDIWQVAYRGGFYRGGPVLMSALSGLDQALWDLKGRRLGVPVWQLLGGRVRDRVPVYAWIGGDRPHEVVEAAKARMDQGFKAVKMNATGETHWLDGTRVFDEALERVAAVKALGLDVAVDFHGRLHKPMAKQLAVALQLLEPLFIEEPLLSENIEAIVQLSRLTSVPIALGERLYSRWDFKPFFEAAAVDVIQPDLSHAGGLSECRRIAAMAEAYDVAIAPHCPLGPLALGACMQLALTTPNFVIQEMSLGIHYNVGHDLLSYMRNPEVFDVRDGMVDTLRGPGLGVEIDEDMVRAAAKDAPTWRNPIWRGEDGSVREW

Samples

Sample ID Description Type Environment
1 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
20 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
70 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
90 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
91 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
135 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
136 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
137 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
138 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
143 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
144 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
145 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
210 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
214 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
215 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
216 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
217 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
218 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
219 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
220 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
221 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
222 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
223 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
224 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
225 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
226 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
227 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
228 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
229 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
230 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
231 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
232 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
235 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
236 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
237 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
238 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
239 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
240 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
241 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
242 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
243 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
244 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
245 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
246 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
247 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
249 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
250 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
251 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
254 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
255 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
256 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
257 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
258 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
259 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
260 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
261 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
262 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
263 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
264 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
265 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
266 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
267 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
268 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
269 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
270 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
271 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
272 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
273 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
274 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
275 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
276 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
277 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
278 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
279 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
280 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
281 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
282 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
283 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
284 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
285 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
286 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
287 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
288 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
289 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
290 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
291 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
292 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
293 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
294 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
295 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
296 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
297 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
298 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
299 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
300 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
301 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
302 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
303 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
304 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
305 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
306 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
307 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
308 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
309 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
310 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
311 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
312 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
313 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
314 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
315 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
316 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
317 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
318 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
319 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
320 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
321 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
322 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
323 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
324 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
325 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
326 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
327 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
328 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
329 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
330 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
331 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
332 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
333 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
334 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
335 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
336 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
337 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
338 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
339 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
340 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
341 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
351 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
352 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
353 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
354 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
355 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
356 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
357 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
358 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
359 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
360 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
361 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
362 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
363 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
365 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
366 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
367 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
368 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
369 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
370 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
371 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
372 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
373 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
374 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
375 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
376 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
377 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
378 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
379 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
380 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
381 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
382 2512875024
383 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
384 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
385 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
386 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
387 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
388 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
389 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
390 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
391 2643221647 Streptomyces sp. Root369 Isolate Unclassified
392 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
393 2643221731 Bacillus sp. Root147 Isolate Unclassified
394 2643221732 Bacillus sp. Root239 Isolate Unclassified
395 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
396 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
397 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
398 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
399 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
400 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
401 2818991441 Niallia circulans 3243 Isolate Rhizosphere
402 2818991459 Paenibacillus sp. 597 Isolate Unclassified
403 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
404 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
405 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
406 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
407 2849560528 Caulobacter zeae 410 Isolate Unclassified
408 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
409 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
410 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
411 2857472729 Cohnella sp. R-74144 Isolate Unclassified
412 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
413 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
414 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
415 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
416 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
417 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
418 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
419 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
420 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
421 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
422 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
423 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
424 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
425 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
426 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
427 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
428 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
429 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
430 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
431 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
432 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
433 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
434 2919720352 Priestia megaterium 4340 Isolate Unclassified
435 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
436 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
437 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
438 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
439 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
440 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
441 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
442 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
443 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
444 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
445 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
446 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
447 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
448 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
449 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
450 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
451 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
452 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
453 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
454 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
455 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
456 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
457 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
458 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
459 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
460 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
461 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
462 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
463 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
464 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
465 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
466 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
467 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
468 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
469 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
470 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
471 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
472 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
473 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
474 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere
475 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.77
Metatranscriptomes 0.37
Isolates 5.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.48
Nodule 1.97
Rhizoplane 5.12
Rhizosphere 85.19
Stem 0
Stem Tuber 0
Unclassified 0.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496106_0004331 3300048909 Bacteria 10539
2 LJQas_1007542 3300000549 Bacteria 1336
3 JGI24752J21851_1000015 3300001976 Bacteria 19272
4 JGI24740J21852_10001942 3300001979 Bacteria 9463
5 JGI24740J21852_10002481 3300001979 Bacteria 8344
6 JGI24740J21852_10030586 3300001979 Bacteria 1749
7 JGI24739J22299_10000129 3300001989 Bacteria 23885
8 JGI24739J22299_10001243 3300001989 Bacteria 9585
9 JGI24739J22299_10010594 3300001989 Bacteria 3420
10 JGI24737J22298_10000357 3300001990 Bacteria 15471
11 JGI24735J21928_10003791 3300002067 Bacteria 5127
12 JGI24735J21928_10004250 3300002067 Bacteria 4831
13 JGI24750J21931_1000434 3300002070 Bacteria 6806
14 JGI24748J21848_1000013 3300002074 Bacteria 149648
15 JGI24738J21930_10001003 3300002075 Bacteria 8082
16 JGI24034J26672_10000011 3300002239 Bacteria 148169
17 JGI25152J39213_1000138 3300002773 Bacteria 50113
18 JGI25406J46586_10023598 3300003203 Bacteria 2429
19 JGI25165J46597_1000210 3300003214 Bacteria 83572
20 rootH2_10050297 3300003320 Bacteria 7719
21 rootH2_10150611 3300003320 Bacteria 5362
22 rootL2_10101515 3300003322 Bacteria 5323
23 rootH1_10031917 3300003323 Bacteria 6022
24 rootH1_10148928 3300003323 Bacteria 4042
25 Ga0006562J51391_1009051 3300003578 Bacteria 3878
26 Ga0055538_1000322 3300003751 Bacteria 22149
27 Ga0055541_1003007 3300003841 Bacteria 3244
28 Ga0055541_1007684 3300003841 Bacteria 1757
29 Ga0065714_10004129 3300005288 Bacteria 6178
30 Ga0065704_10000326 3300005289 Bacteria 76230
31 Ga0065712_10075748 3300005290 Bacteria 3797
32 Ga0065707_10081772 3300005295 Bacteria 43824
33 Ga0070658_10000029 3300005327 Bacteria 156910
34 Ga0070658_10015513 3300005327 Bacteria 6093
35 Ga0070658_10019049 3300005327 Bacteria 5497
36 Ga0070658_10035022 3300005327 Bacteria 4042
37 Ga0070658_10046977 3300005327 Bacteria 3493
38 Ga0070658_10050553 3300005327 Bacteria 3369
39 Ga0070658_10056234 3300005327 Bacteria 3197
40 Ga0070658_10093432 3300005327 Bacteria 2481
41 Ga0070658_10134521 3300005327 Bacteria 2062
42 Ga0070658_10136067 3300005327 Bacteria 2050
43 Ga0070658_10168122 3300005327 Bacteria 1842
44 Ga0070676_10013130 3300005328 Bacteria 4538
45 Ga0070676_10048337 3300005328 Bacteria 2487
46 Ga0070676_10095230 3300005328 Bacteria 1830
47 Ga0070676_10103857 3300005328 Bacteria 1760
48 Ga0070683_100000209 3300005329 Bacteria 39666
49 Ga0070683_100054521 3300005329 Bacteria 3707
50 Ga0070690_100000015 3300005330 Bacteria 86483
51 Ga0070690_100012081 3300005330 Bacteria 5071
52 Ga0070670_100000265 3300005331 Bacteria 46560
53 Ga0070670_100000333 3300005331 Bacteria 39598
54 Ga0070670_100010774 3300005331 Bacteria 7810
55 Ga0070670_100011548 3300005331 Bacteria 7552
56 Ga0070670_100014114 3300005331 Bacteria 6852
57 Ga0070670_100056692 3300005331 Bacteria 3363
58 Ga0070670_100066739 3300005331 Bacteria 3087
59 Ga0070670_100098713 3300005331 Bacteria 2513
60 Ga0070670_100116628 3300005331 Bacteria 2302
61 Ga0070670_100201606 3300005331 Bacteria 1729
62 Ga0070677_10044276 3300005333 Bacteria 1770
63 Ga0068869_100000331 3300005334 Bacteria 25170
64 Ga0070666_10000059 3300005335 Bacteria 86483
65 Ga0070666_10000822 3300005335 Bacteria 18838
66 Ga0070666_10000924 3300005335 Bacteria 17819
67 Ga0070666_10001749 3300005335 Bacteria 13256
68 Ga0070666_10026371 3300005335 Bacteria 3796
69 Ga0070666_10026417 3300005335 Bacteria 3793
70 Ga0070666_10056586 3300005335 Bacteria 2649
71 Ga0070666_10090125 3300005335 Bacteria 2106
72 Ga0070680_100001008 3300005336 Bacteria 20096
73 Ga0070680_100001026 3300005336 Bacteria 19977
74 Ga0070680_100013601 3300005336 Bacteria 6343
75 Ga0070680_100041386 3300005336 Bacteria 3736
76 Ga0070680_100123252 3300005336 Bacteria 2165
77 Ga0070680_100208480 3300005336 Bacteria 1649
78 Ga0070682_100000911 3300005337 Bacteria 17294
79 Ga0070682_100006572 3300005337 Bacteria 6522
80 Ga0070682_100056759 3300005337 Bacteria 2464
81 Ga0070682_100132525 3300005337 Bacteria 1688
82 Ga0068868_100000156 3300005338 Bacteria 44526
83 Ga0068868_100002559 3300005338 Bacteria 12640
84 Ga0068868_100044269 3300005338 Bacteria 3480
85 Ga0068868_100124156 3300005338 Bacteria 2107
86 Ga0070660_100002984 3300005339 Bacteria 11653
87 Ga0070660_100002991 3300005339 Bacteria 11638
88 Ga0070660_100004528 3300005339 Bacteria 9606
89 Ga0070660_100011417 3300005339 Bacteria 6308
90 Ga0070660_100012339 3300005339 Bacteria 6099
91 Ga0070660_100018362 3300005339 Bacteria 5109
92 Ga0070660_100019062 3300005339 Bacteria 5023
93 Ga0070660_100026651 3300005339 Bacteria 4306
94 Ga0070660_100034110 3300005339 Bacteria 3843
95 Ga0070660_100046442 3300005339 Bacteria 3329
96 Ga0070660_100068479 3300005339 Bacteria 2767
97 Ga0070660_100071425 3300005339 Bacteria 2710
98 Ga0070660_100075563 3300005339 Bacteria 2638
99 Ga0070660_100082431 3300005339 Bacteria 2525
100 Ga0070660_100108282 3300005339 Bacteria 2208
101 Ga0070660_100185182 3300005339 Bacteria 1686
102 Ga0070660_100245582 3300005339 Bacteria 1459
103 Ga0070691_10004057 3300005341 Bacteria 6635
104 Ga0070691_10043237 3300005341 Bacteria 2134
105 Ga0070661_100000055 3300005344 Bacteria 88266
106 Ga0070661_100000452 3300005344 Bacteria 31380
107 Ga0070661_100003453 3300005344 Bacteria 10905
108 Ga0070661_100005269 3300005344 Bacteria 8906
109 Ga0070661_100007519 3300005344 Bacteria 7515
110 Ga0070661_100032834 3300005344 Bacteria 3758
111 Ga0070661_100041781 3300005344 Bacteria 3346
112 Ga0070661_100060605 3300005344 Bacteria 2776
113 Ga0070661_100067281 3300005344 Bacteria 2632
114 Ga0070661_100072538 3300005344 Bacteria 2533
115 Ga0070661_100091640 3300005344 Bacteria 2251
116 Ga0070661_100107098 3300005344 Bacteria 2084
117 Ga0070661_100142069 3300005344 Bacteria 1809
118 Ga0070692_10001859 3300005345 Bacteria 7937
119 Ga0070692_10003716 3300005345 Bacteria 6261
120 Ga0070692_10006583 3300005345 Bacteria 5054
121 Ga0070692_10011780 3300005345 Bacteria 4028
122 Ga0070692_10016014 3300005345 Bacteria 3559
123 Ga0070692_10027252 3300005345 Bacteria 2831
124 Ga0070692_10028647 3300005345 Bacteria 2770
125 Ga0070668_100000208 3300005347 Bacteria 38503
126 Ga0070668_100000591 3300005347 Bacteria 24275
127 Ga0070668_100007660 3300005347 Bacteria 8014
128 Ga0070668_100036966 3300005347 Bacteria 3727
129 Ga0070668_100116817 3300005347 Bacteria 2128
130 Ga0070669_100000014 3300005353 Bacteria 206875
131 Ga0070669_100000018 3300005353 Bacteria 195789
132 Ga0070669_100000383 3300005353 Bacteria 33931
133 Ga0070669_100000547 3300005353 Bacteria 27940
134 Ga0070669_100025265 3300005353 Bacteria 4266
135 Ga0070669_100037421 3300005353 Bacteria 3520
136 Ga0070669_100165980 3300005353 Bacteria 1719
137 Ga0070675_100025854 3300005354 Bacteria 4707
138 Ga0070675_100051525 3300005354 Bacteria 3382
139 Ga0070675_100147595 3300005354 Bacteria 2015
140 Ga0070675_100244746 3300005354 Bacteria 1568
141 Ga0070671_100000011 3300005355 Bacteria 202057
142 Ga0070671_100000138 3300005355 Bacteria 46941
143 Ga0070671_100002540 3300005355 Bacteria 14140
144 Ga0070671_100003224 3300005355 Bacteria 12714
145 Ga0070671_100003249 3300005355 Bacteria 12681
146 Ga0070671_100003781 3300005355 Bacteria 11876
147 Ga0070671_100008552 3300005355 Bacteria 8206
148 Ga0070671_100022349 3300005355 Bacteria 5165
149 Ga0070671_100023574 3300005355 Bacteria 5038
150 Ga0070671_100025830 3300005355 Bacteria 4822
151 Ga0070671_100042370 3300005355 Bacteria 3783
152 Ga0070671_100125996 3300005355 Bacteria 2156
153 Ga0070671_100151273 3300005355 Bacteria 1960
154 Ga0070674_100004496 3300005356 Bacteria 7955
155 Ga0070674_100059472 3300005356 Bacteria 2660
156 Ga0070673_100000249 3300005364 Bacteria 27281
157 Ga0070673_100003351 3300005364 Bacteria 9957
158 Ga0070673_100004608 3300005364 Bacteria 8741
159 Ga0070673_100006422 3300005364 Bacteria 7641
160 Ga0070673_100011717 3300005364 Bacteria 5995
161 Ga0070673_100016074 3300005364 Bacteria 5281
162 Ga0070673_100020978 3300005364 Bacteria 4724
163 Ga0070673_100050456 3300005364 Bacteria 3254
164 Ga0070673_100155268 3300005364 Bacteria 1942
165 Ga0070673_100180969 3300005364 Bacteria 1805
166 Ga0070688_100001575 3300005365 Bacteria 11401
167 Ga0070659_100000138 3300005366 Bacteria 56073
168 Ga0070659_100000814 3300005366 Bacteria 22773
169 Ga0070659_100001062 3300005366 Bacteria 20090
170 Ga0070659_100001635 3300005366 Bacteria 16140
171 Ga0070659_100003157 3300005366 Bacteria 11739
172 Ga0070659_100043899 3300005366 Bacteria 3497
173 Ga0070659_100064535 3300005366 Bacteria 2898
174 Ga0070659_100085565 3300005366 Bacteria 2522
175 Ga0070659_100104108 3300005366 Bacteria 2286
176 Ga0070659_100135631 3300005366 Bacteria 2001
177 Ga0070667_100001760 3300005367 Bacteria 19301
178 Ga0070667_100001996 3300005367 Bacteria 18084
179 Ga0070667_100003528 3300005367 Bacteria 13330
180 Ga0070667_100005828 3300005367 Bacteria 10276
181 Ga0070667_100006388 3300005367 Bacteria 9794
182 Ga0070667_100014945 3300005367 Bacteria 6413
183 Ga0070667_100026953 3300005367 Bacteria 4780
184 Ga0070667_100035104 3300005367 Bacteria 4200
185 Ga0070667_100059501 3300005367 Bacteria 3232
186 Ga0070667_100061428 3300005367 Bacteria 3181
187 Ga0070667_100080608 3300005367 Bacteria 2784
188 Ga0070667_100089958 3300005367 Bacteria 2637
189 Ga0070667_100097262 3300005367 Bacteria 2539
190 Ga0070667_100235258 3300005367 Bacteria 1634
191 Ga0070714_100139803 3300005435 Bacteria 2172
192 Ga0070714_100267670 3300005435 Bacteria 1584
193 Ga0070714_100318743 3300005435 Bacteria 1453
194 Ga0070713_100005721 3300005436 Bacteria 8537
195 Ga0070713_100033460 3300005436 Bacteria 4118
196 Ga0070713_100139352 3300005436 Bacteria 2147
197 Ga0070710_10016872 3300005437 Bacteria 3727
198 Ga0070705_100016857 3300005440 Bacteria 3804
199 Ga0070694_100003977 3300005444 Bacteria 8844
200 Ga0070694_100018841 3300005444 Bacteria 4385
201 Ga0070708_100019568 3300005445 Bacteria 5692
202 Ga0070663_100001943 3300005455 Bacteria 11539
203 Ga0070663_100005160 3300005455 Bacteria 7733
204 Ga0070663_100009792 3300005455 Bacteria 5953
205 Ga0070663_100015781 3300005455 Bacteria 4886
206 Ga0070663_100070917 3300005455 Bacteria 2534
207 Ga0070663_100085961 3300005455 Bacteria 2322
208 Ga0070663_100111925 3300005455 Bacteria 2052
209 Ga0070663_100163391 3300005455 Bacteria 1716
210 Ga0070678_100002527 3300005456 Bacteria 10025
211 Ga0070678_100040203 3300005456 Bacteria 3307
212 Ga0070662_100000410 3300005457 Bacteria 25434
213 Ga0070662_100001186 3300005457 Bacteria 15980
214 Ga0070662_100001575 3300005457 Bacteria 14101
215 Ga0070662_100005039 3300005457 Bacteria 8406
216 Ga0070662_100017550 3300005457 Bacteria 4827
217 Ga0070662_100034654 3300005457 Bacteria 3561
218 Ga0070662_100167063 3300005457 Bacteria 1725
219 Ga0070662_100215002 3300005457 Bacteria 1531
220 Ga0070681_10001014 3300005458 Bacteria 23751
221 Ga0070681_10010375 3300005458 Bacteria 9199
222 Ga0070681_10102557 3300005458 Bacteria 2806
223 Ga0070681_10124855 3300005458 Bacteria 2506
224 Ga0068867_100007188 3300005459 Bacteria 7869
225 Ga0068867_100014158 3300005459 Bacteria 5649
226 Ga0068867_100028424 3300005459 Bacteria 4026
227 Ga0070685_10000034 3300005466 Bacteria 81799
228 Ga0070706_100000486 3300005467 Bacteria 46746
229 Ga0070706_100061886 3300005467 Bacteria 3457
230 Ga0070698_100027244 3300005471 Bacteria 5946
231 Ga0070698_100215516 3300005471 Bacteria 1854
232 Ga0070699_100215973 3300005518 Unclassified 1708
233 Ga0070679_100000027 3300005530 Bacteria 114873
234 Ga0070679_100016295 3300005530 Bacteria 7162
235 Ga0070679_100035208 3300005530 Bacteria 4967
236 Ga0070679_100037121 3300005530 Bacteria 4838
237 Ga0070679_100072968 3300005530 Bacteria 3424
238 Ga0070684_100004466 3300005535 Bacteria 10652
239 Ga0070697_100155128 3300005536 Bacteria 1932
240 Ga0068853_100000479 3300005539 Bacteria 27267
241 Ga0068853_100001793 3300005539 Bacteria 15788
242 Ga0068853_100015391 3300005539 Bacteria 6283
243 Ga0068853_100015680 3300005539 Bacteria 6223
244 Ga0068853_100023329 3300005539 Bacteria 5178
245 Ga0068853_100027977 3300005539 Bacteria 4741
246 Ga0068853_100099081 3300005539 Bacteria 2574
247 Ga0068853_100166964 3300005539 Bacteria 1989
248 Ga0068853_100267374 3300005539 Bacteria 1574
249 Ga0070672_100006526 3300005543 Bacteria 7843
250 Ga0070672_100016187 3300005543 Bacteria 5334
251 Ga0070672_100055472 3300005543 Bacteria 3104
252 Ga0070672_100077915 3300005543 Bacteria 2651
253 Ga0070672_100129659 3300005543 Bacteria 2072
254 Ga0070672_100216691 3300005543 Bacteria 1605
255 Ga0070686_100000023 3300005544 Bacteria 130174
256 Ga0070695_100116778 3300005545 Bacteria 1820
257 Ga0070696_100006403 3300005546 Bacteria 7881
258 Ga0070693_100019343 3300005547 Bacteria 3567
259 Ga0070693_100088625 3300005547 Bacteria 1861
260 Ga0070693_100112654 3300005547 Bacteria 1676
261 Ga0070665_100000019 3300005548 Bacteria 413972
262 Ga0070665_100011777 3300005548 Bacteria 8833
263 Ga0070665_100014723 3300005548 Bacteria 7847
264 Ga0070665_100016127 3300005548 Bacteria 7497
265 Ga0070665_100046267 3300005548 Bacteria 4371
266 Ga0070665_100063123 3300005548 Bacteria 3714
267 Ga0070665_100065942 3300005548 Bacteria 3631
268 Ga0070665_100068081 3300005548 Bacteria 3569
269 Ga0070665_100153459 3300005548 Bacteria 2305
270 Ga0070665_100168006 3300005548 Bacteria 2195
271 Ga0070665_100205763 3300005548 Bacteria 1969
272 Ga0070665_100344960 3300005548 Bacteria 1494
273 Ga0068855_100000163 3300005563 Bacteria 85587
274 Ga0068855_100004220 3300005563 Bacteria 17542
275 Ga0068855_100014035 3300005563 Bacteria 9657
276 Ga0068855_100017460 3300005563 Bacteria 8631
277 Ga0068855_100035645 3300005563 Bacteria 5926
278 Ga0068855_100058082 3300005563 Bacteria 4532
279 Ga0068855_100133095 3300005563 Bacteria 2838
280 Ga0068855_100154414 3300005563 Bacteria 2609
281 Ga0068855_100449656 3300005563 Bacteria 1406
282 Ga0068855_100472127 3300005563 Bacteria 1366
283 Ga0070664_100000544 3300005564 Bacteria 28761
284 Ga0070664_100001299 3300005564 Bacteria 19974
285 Ga0070664_100002185 3300005564 Bacteria 15712
286 Ga0070664_100009697 3300005564 Bacteria 7811
287 Ga0070664_100013307 3300005564 Bacteria 6700
288 Ga0070664_100014974 3300005564 Bacteria 6329
289 Ga0070664_100025960 3300005564 Bacteria 4856
290 Ga0070664_100026091 3300005564 Bacteria 4844
291 Ga0070664_100062360 3300005564 Bacteria 3178
292 Ga0070664_100069993 3300005564 Bacteria 3003
293 Ga0070664_100152282 3300005564 Bacteria 2042
294 Ga0068857_100000282 3300005577 Bacteria 34844
295 Ga0068857_100002754 3300005577 Bacteria 14445
296 Ga0068857_100002765 3300005577 Bacteria 14412
297 Ga0068857_100010471 3300005577 Bacteria 8060
298 Ga0068857_100017928 3300005577 Bacteria 6209
299 Ga0068857_100027407 3300005577 Bacteria 5026
300 Ga0068857_100055403 3300005577 Bacteria 3519
301 Ga0068857_100081064 3300005577 Bacteria 2898
302 Ga0068854_100001188 3300005578 Bacteria 15628
303 Ga0068854_100001438 3300005578 Bacteria 14407
304 Ga0068854_100004579 3300005578 Bacteria 8720
305 Ga0068854_100005135 3300005578 Bacteria 8253
306 Ga0068854_100007835 3300005578 Bacteria 6834
307 Ga0068854_100034460 3300005578 Bacteria 3536
308 Ga0068854_100039635 3300005578 Bacteria 3320
309 Ga0068854_100052257 3300005578 Bacteria 2930
310 Ga0068854_100057710 3300005578 Bacteria 2800
311 Ga0068856_100000829 3300005614 Bacteria 33313
312 Ga0068856_100008781 3300005614 Bacteria 9830
313 Ga0068856_100015666 3300005614 Bacteria 7329
314 Ga0068856_100258308 3300005614 Bacteria 1757
315 Ga0068852_100001212 3300005616 Bacteria 17137
316 Ga0068852_100005039 3300005616 Bacteria 9392
317 Ga0068852_100022025 3300005616 Bacteria 5101
318 Ga0068852_100042999 3300005616 Bacteria 3829
319 Ga0068852_100045754 3300005616 Bacteria 3725
320 Ga0068852_100114387 3300005616 Bacteria 2458
321 Ga0068852_100120257 3300005616 Bacteria 2403
322 Ga0068852_100204035 3300005616 Bacteria 1872
323 Ga0068852_100235157 3300005616 Bacteria 1748
324 Ga0068859_100003915 3300005617 Bacteria 15202
325 Ga0068859_100005794 3300005617 Bacteria 12552
326 Ga0068859_100023456 3300005617 Bacteria 6192
327 Ga0068859_100036132 3300005617 Bacteria 4959
328 Ga0068859_100046411 3300005617 Bacteria 4362
329 Ga0068859_100093009 3300005617 Bacteria 3067
330 Ga0068859_100134443 3300005617 Bacteria 2545
331 Ga0068859_100140264 3300005617 Bacteria 2491
332 Ga0068859_100206557 3300005617 Bacteria 2049
333 Ga0068859_100424013 3300005617 Bacteria 1427
334 Ga0068864_100000173 3300005618 Bacteria 59516
335 Ga0068864_100001720 3300005618 Bacteria 17993
336 Ga0068864_100006305 3300005618 Bacteria 9731
337 Ga0068864_100006342 3300005618 Bacteria 9700
338 Ga0068864_100006905 3300005618 Bacteria 9309
339 Ga0068864_100012818 3300005618 Bacteria 6932
340 Ga0068864_100031578 3300005618 Bacteria 4495
341 Ga0068864_100077173 3300005618 Bacteria 2913
342 Ga0068864_100114965 3300005618 Bacteria 2400
343 Ga0068864_100230990 3300005618 Bacteria 1711
344 Ga0068866_10009444 3300005718 Bacteria 4142
345 Ga0068861_100002173 3300005719 Bacteria 12731
346 Ga0068861_100002954 3300005719 Bacteria 11229
347 Ga0068861_100327675 3300005719 Bacteria 1336
348 Ga0068851_10013555 3300005834 Bacteria 3858
349 Ga0068851_10019101 3300005834 Bacteria 3310
350 Ga0068851_10020603 3300005834 Bacteria 3194
351 Ga0068851_10098791 3300005834 Bacteria 1546
352 Ga0068863_100000044 3300005841 Bacteria 149959
353 Ga0068863_100000131 3300005841 Bacteria 79059
354 Ga0068863_100000816 3300005841 Bacteria 31200
355 Ga0068863_100000921 3300005841 Bacteria 29492
356 Ga0068863_100003770 3300005841 Bacteria 14990
357 Ga0068863_100010883 3300005841 Bacteria 8821
358 Ga0068863_100055996 3300005841 Bacteria 3733
359 Ga0068863_100056031 3300005841 Bacteria 3732
360 Ga0068863_100093128 3300005841 Bacteria 2860
361 Ga0068863_100098332 3300005841 Bacteria 2779
362 Ga0068858_100001349 3300005842 Bacteria 25309
363 Ga0068858_100002655 3300005842 Bacteria 18004
364 Ga0068858_100003690 3300005842 Bacteria 15171
365 Ga0068858_100003884 3300005842 Bacteria 14758
366 Ga0068858_100005521 3300005842 Bacteria 12381
367 Ga0068858_100009461 3300005842 Bacteria 9296
368 Ga0068858_100017613 3300005842 Bacteria 6696
369 Ga0068858_100045120 3300005842 Bacteria 4084
370 Ga0068858_100048457 3300005842 Bacteria 3937
371 Ga0068858_100060194 3300005842 Bacteria 3510
372 Ga0068858_100069382 3300005842 Bacteria 3267
373 Ga0068858_100104431 3300005842 Bacteria 2643
374 Ga0068858_100118044 3300005842 Bacteria 2480
375 Ga0068860_100000229 3300005843 Bacteria 86483
376 Ga0068860_100001926 3300005843 Bacteria 21977
377 Ga0068860_100003370 3300005843 Bacteria 16440
378 Ga0068860_100006472 3300005843 Bacteria 11762
379 Ga0068860_100009386 3300005843 Bacteria 9725
380 Ga0068860_100014106 3300005843 Bacteria 7840
381 Ga0068860_100017319 3300005843 Bacteria 7020
382 Ga0068860_100042596 3300005843 Bacteria 4334
383 Ga0068860_100056062 3300005843 Bacteria 3747
384 Ga0068860_100189540 3300005843 Bacteria 1990
385 Ga0068860_100228587 3300005843 Bacteria 1808
386 Ga0068860_100411876 3300005843 Bacteria 1339
387 Ga0068862_100000097 3300005844 Bacteria 104686
388 Ga0068862_100001102 3300005844 Bacteria 25644
389 Ga0068862_100001850 3300005844 Bacteria 19179
390 Ga0068862_100022798 3300005844 Bacteria 5239
391 Ga0068862_100038167 3300005844 Bacteria 4073
392 Ga0068862_100039098 3300005844 Bacteria 4027
393 Ga0068862_100048277 3300005844 Bacteria 3634
394 Ga0068862_100052452 3300005844 Bacteria 3489
395 Ga0068862_100072551 3300005844 Bacteria 2974
396 Ga0068862_100177959 3300005844 Bacteria 1908
397 Ga0068862_100374489 3300005844 Bacteria 1326
398 Ga0081455_10000675 3300005937 Bacteria 44142
399 Ga0081539_10004604 3300005985 Bacteria 15046
400 Ga0081539_10005951 3300005985 Bacteria 12026
401 Ga0081539_10040287 3300005985 Bacteria 2743
402 Ga0070717_10123685 3300006028 Bacteria 2219
403 Ga0070712_100022944 3300006175 Bacteria 4115
404 Ga0097621_100002177 3300006237 Bacteria 13408
405 Ga0097621_100161811 3300006237 Bacteria 1924
406 Ga0097621_100280209 3300006237 Bacteria 1467
407 Ga0068871_100012935 3300006358 Bacteria 6180
408 Ga0068871_100027524 3300006358 Bacteria 4448
409 Ga0068871_100150555 3300006358 Bacteria 1984
410 Ga0068871_100192329 3300006358 Bacteria 1758
411 Ga0075428_100301389 3300006844 Bacteria 1723
412 Ga0075428_100522712 3300006844 Unclassified 1269
413 Ga0075431_100007044 3300006847 Bacteria 11168
414 Ga0068865_100016371 3300006881 Bacteria 4744
415 Ga0068865_100016787 3300006881 Bacteria 4692
416 Ga0068865_100035927 3300006881 Bacteria 3336
417 Ga0075436_100267541 3300006914 Bacteria 1220
418 Ga0097620_100003915 3300006931 Bacteria 15202
419 Ga0097620_100005794 3300006931 Bacteria 12552
420 Ga0097620_100023456 3300006931 Bacteria 6192
421 Ga0097620_100036130 3300006931 Bacteria 4959
422 Ga0097620_100046410 3300006931 Bacteria 4362
423 Ga0097620_100093006 3300006931 Bacteria 3067
424 Ga0097620_100134449 3300006931 Bacteria 2545
425 Ga0097620_100140269 3300006931 Bacteria 2491
426 Ga0097620_100206567 3300006931 Bacteria 2049
427 Ga0097620_100423982 3300006931 Bacteria 1427
428 Ga0099795_10000020 3300007788 Bacteria 59011
429 Ga0099795_10000692 3300007788 Bacteria 6512
430 Ga0105240_10000022 3300009093 Bacteria 387911
431 Ga0105240_10000078 3300009093 Bacteria 196646
432 Ga0105240_10007481 3300009093 Bacteria 15848
433 Ga0105240_10010752 3300009093 Bacteria 12836
434 Ga0105240_10020736 3300009093 Bacteria 8756
435 Ga0105240_10056203 3300009093 Bacteria 4925
436 Ga0105240_10065379 3300009093 Bacteria 4515
437 Ga0105240_10134814 3300009093 Bacteria 2958
438 Ga0105240_10148929 3300009093 Bacteria 2789
439 Ga0105240_10430218 3300009093 Bacteria 1481
440 Ga0111539_10006409 3300009094 Bacteria 15174
441 Ga0111539_10008489 3300009094 Bacteria 13056
442 Ga0111539_10225985 3300009094 Bacteria 2180
443 Ga0111539_10311352 3300009094 Bacteria 1832
444 Ga0111539_10364437 3300009094 Unclassified 1682
445 Ga0105245_10000326 3300009098 Bacteria 44899
446 Ga0105245_10024639 3300009098 Bacteria 5285
447 Ga0105245_10166850 3300009098 Bacteria 2093
448 Ga0105245_10291403 3300009098 Bacteria 1599
449 Ga0105247_10000542 3300009101 Bacteria 30686
450 Ga0105247_10009282 3300009101 Bacteria 5975
451 Ga0105247_10020569 3300009101 Bacteria 3967
452 Ga0114129_10535955 3300009147 Bacteria 1524
453 Ga0105243_10039135 3300009148 Bacteria 3696
454 Ga0105243_10095518 3300009148 Bacteria 2457
455 Ga0105243_10097864 3300009148 Bacteria 2429
456 Ga0105241_10086910 3300009174 Bacteria 2460
457 Ga0105242_10007725 3300009176 Bacteria 8273
458 Ga0105242_10023363 3300009176 Bacteria 4871
459 Ga0105248_10000123 3300009177 Bacteria 89301
460 Ga0105248_10000159 3300009177 Bacteria 78504
461 Ga0105248_10000516 3300009177 Bacteria 43895
462 Ga0105248_10002100 3300009177 Bacteria 22075
463 Ga0105248_10003349 3300009177 Bacteria 17812
464 Ga0105248_10005569 3300009177 Bacteria 13842
465 Ga0105248_10024334 3300009177 Bacteria 6733
466 Ga0105248_10027345 3300009177 Bacteria 6349
467 Ga0105248_10027972 3300009177 Bacteria 6279
468 Ga0105248_10047942 3300009177 Bacteria 4791
469 Ga0105248_10059878 3300009177 Bacteria 4277
470 Ga0105248_10088061 3300009177 Bacteria 3494
471 Ga0105248_10092200 3300009177 Bacteria 3412
472 Ga0105248_10094165 3300009177 Bacteria 3373
473 Ga0105248_10099492 3300009177 Bacteria 3277
474 Ga0105248_10120666 3300009177 Bacteria 2958
475 Ga0105237_10000135 3300009545 Bacteria 103384
476 Ga0105237_10004469 3300009545 Bacteria 16167
477 Ga0105237_10004941 3300009545 Bacteria 15231
478 Ga0105237_10007089 3300009545 Bacteria 12323
479 Ga0105237_10009195 3300009545 Bacteria 10606
480 Ga0105237_10097071 3300009545 Bacteria 2937
481 Ga0105237_10132866 3300009545 Bacteria 2483
482 Ga0105237_10336500 3300009545 Bacteria 1514
483 Ga0105238_10011703 3300009551 Bacteria 8844
484 Ga0105238_10013560 3300009551 Bacteria 8229
485 Ga0105238_10066511 3300009551 Bacteria 3606
486 Ga0105238_10080446 3300009551 Bacteria 3248
487 Ga0105238_10158169 3300009551 Bacteria 2241
488 Ga0105238_10187212 3300009551 Bacteria 2046
489 Ga0105249_10000153 3300009553 Bacteria 86563
490 Ga0105249_10016978 3300009553 Bacteria 6458
491 Ga0105249_10020199 3300009553 Bacteria 5953
492 Ga0105249_10029974 3300009553 Bacteria 4915
493 Ga0105249_10053810 3300009553 Bacteria 3680
494 Ga0105249_10090407 3300009553 Bacteria 2862
495 Ga0105249_10416107 3300009553 Bacteria 1377
496 Ga0099796_10000070 3300010159 Bacteria 18048
497 Ga0099796_10000802 3300010159 Bacteria 5694
498 Ga0105239_10000524 3300010375 Bacteria 55447
499 Ga0105239_10007408 3300010375 Bacteria 12590
500 Ga0105239_10054164 3300010375 Bacteria 4399
501 Ga0105239_10056053 3300010375 Bacteria 4323
502 Ga0105239_10159582 3300010375 Bacteria 2519
503 Ga0105239_10162157 3300010375 Bacteria 2498
504 Ga0105246_10043877 3300011119 Bacteria 3036
505 Ga0105246_10175373 3300011119 Bacteria 1646
506 Ga0157373_10003162 3300013100 Bacteria 12438
507 Ga0157373_10036632 3300013100 Bacteria 3520
508 Ga0157373_10041283 3300013100 Bacteria 3300
509 Ga0157373_10052037 3300013100 Bacteria 2915
510 Ga0157373_10069239 3300013100 Bacteria 2495
511 Ga0157371_10000784 3300013102 Bacteria 36573
512 Ga0157371_10016692 3300013102 Bacteria 5471
513 Ga0157370_10025359 3300013104 Bacteria 5869
514 Ga0157370_10124617 3300013104 Bacteria 2405
515 Ga0157369_10001983 3300013105 Bacteria 24647
516 Ga0157369_10014639 3300013105 Bacteria 8849
517 Ga0157369_10015070 3300013105 Bacteria 8727
518 Ga0157369_10092231 3300013105 Bacteria 3232
519 Ga0157369_10133424 3300013105 Bacteria 2630
520 Ga0157369_10291505 3300013105 Bacteria 1699
521 Ga0157369_10306261 3300013105 Bacteria 1652
522 Ga0157374_10017801 3300013296 Bacteria 6260
523 Ga0157374_10024724 3300013296 Bacteria 5385
524 Ga0157374_10071031 3300013296 Bacteria 3282
525 Ga0157374_10100360 3300013296 Bacteria 2774
526 Ga0157378_10054398 3300013297 Bacteria 3564
527 Ga0157378_10057561 3300013297 Bacteria 3464
528 Ga0157378_10135898 3300013297 Bacteria 2280
529 Ga0163162_10000839 3300013306 Bacteria 28555
530 Ga0163162_10001101 3300013306 Bacteria 25084
531 Ga0163162_10005580 3300013306 Bacteria 12174
532 Ga0163162_10015905 3300013306 Bacteria 7353
533 Ga0163162_10024415 3300013306 Bacteria 5967
534 Ga0163162_10035863 3300013306 Bacteria 4941
535 Ga0163162_10099221 3300013306 Bacteria 3003
536 Ga0163162_10218967 3300013306 Bacteria 2034
537 Ga0157372_10008989 3300013307 Bacteria 10620
538 Ga0157372_10031832 3300013307 Bacteria 5780
539 Ga0157372_10063213 3300013307 Bacteria 4150
540 Ga0157372_10129234 3300013307 Bacteria 2906
541 Ga0157372_10210723 3300013307 Bacteria 2252
542 Ga0157372_10462526 3300013307 Bacteria 1478
543 Ga0157372_10518107 3300013307 Bacteria 1390
544 Ga0157375_10003764 3300013308 Bacteria 13151
545 Ga0157375_10030040 3300013308 Bacteria 5118
546 Ga0157375_10070892 3300013308 Bacteria 3497
547 Ga0163163_10006126 3300014325 Bacteria 10476
548 Ga0163163_10090908 3300014325 Bacteria 3066
549 Ga0163163_10094372 3300014325 Bacteria 3010
550 Ga0163163_10128307 3300014325 Bacteria 2575
551 Ga0157380_10000123 3300014326 Bacteria 43134
552 Ga0157380_10000671 3300014326 Bacteria 21193
553 Ga0182008_10015296 3300014497 Bacteria 4005
554 Ga0182008_10020642 3300014497 Bacteria 3389
555 Ga0157379_10000867 3300014968 Bacteria 24465
556 Ga0157379_10001552 3300014968 Bacteria 18894
557 Ga0157379_10002249 3300014968 Bacteria 16076
558 Ga0157379_10014455 3300014968 Bacteria 6927
559 Ga0157379_10141285 3300014968 Bacteria 2170
560 Ga0157379_10158189 3300014968 Bacteria 2044
561 Ga0157379_10230079 3300014968 Bacteria 1680
562 Ga0157376_10144587 3300014969 Bacteria 2137
563 Ga0157376_10443936 3300014969 Bacteria 1264
564 Ga0182006_1008348 3300015261 Bacteria 4693
565 Ga0163161_10000096 3300017792 Bacteria 86993
566 Ga0163161_10004455 3300017792 Bacteria 9757
567 Ga0206356_10423425 3300020070 Bacteria 1484
568 Ga0206356_11302048 3300020070 Bacteria 4031
569 Ga0206353_10148542 3300020082 Bacteria 3068
570 Ga0213873_10000006 3300021358 Bacteria 408723
571 Ga0213872_10003007 3300021361 Bacteria 9531
572 Ga0213876_10000004 3300021384 Bacteria 943822
573 Ga0213876_10001088 3300021384 Bacteria 17439
574 Ga0213876_10001093 3300021384 Bacteria 17409
575 Ga0213876_10012133 3300021384 Bacteria 4591
576 Ga0213876_10081864 3300021384 Bacteria 1708
577 Ga0213875_10000061 3300021388 Bacteria 133623
578 Ga0213875_10000398 3300021388 Bacteria 38328
579 Ga0213875_10002425 3300021388 Bacteria 11172
580 Ga0213875_10010098 3300021388 Bacteria 4746
581 Ga0213875_10012927 3300021388 Bacteria 4111
582 Ga0224712_10003352 3300022467 Bacteria 4150
583 Ga0209784_100335 3300025224 Bacteria 23545
584 Ga0209566_100046 3300025225 Bacteria 247053
585 Ga0209566_100166 3300025225 Bacteria 71875
586 Ga0209674_100975 3300025226 Bacteria 8945
587 Ga0209026_1000050 3300025250 Bacteria 254994
588 Ga0209026_1000214 3300025250 Bacteria 80595
589 Ga0209026_1001506 3300025250 Bacteria 10204
590 Ga0209759_1000229 3300025256 Bacteria 83575
591 Ga0209759_1007916 3300025256 Bacteria 3364
592 Ga0209233_1000003 3300025261 Bacteria 1607366
593 Ga0209676_1001179 3300025292 Bacteria 28285
594 Ga0209025_1012628 3300025294 Bacteria 5394
595 Ga0209025_1033697 3300025294 Bacteria 2360
596 Ga0209257_1000245 3300025304 Bacteria 125987
597 Ga0207697_10000219 3300025315 Bacteria 30831
598 Ga0207697_10000584 3300025315 Bacteria 20797
599 Ga0207656_10006275 3300025321 Bacteria 4260
600 Ga0207656_10010407 3300025321 Bacteria 3484
601 Ga0207656_10029709 3300025321 Bacteria 2253
602 Ga0207656_10082146 3300025321 Bacteria 1450
603 Ga0207682_10002744 3300025893 Bacteria 7798
604 Ga0207682_10033762 3300025893 Bacteria 2061
605 Ga0207642_10004027 3300025899 Bacteria 4701
606 Ga0207710_10001754 3300025900 Bacteria 10467
607 Ga0207710_10011152 3300025900 Bacteria 3785
608 Ga0207688_10001613 3300025901 Bacteria 11897
609 Ga0207688_10007152 3300025901 Bacteria 6069
610 Ga0207680_10000020 3300025903 Bacteria 89630
611 Ga0207680_10000027 3300025903 Bacteria 79852
612 Ga0207680_10001404 3300025903 Bacteria 11397
613 Ga0207680_10003774 3300025903 Bacteria 7133
614 Ga0207680_10010476 3300025903 Bacteria 4639
615 Ga0207680_10013386 3300025903 Bacteria 4212
616 Ga0207680_10026060 3300025903 Bacteria 3235
617 Ga0207680_10074110 3300025903 Bacteria 2119
618 Ga0207647_10000575 3300025904 Bacteria 28658
619 Ga0207647_10002145 3300025904 Bacteria 15075
620 Ga0207647_10007590 3300025904 Bacteria 7816
621 Ga0207647_10019789 3300025904 Bacteria 4520
622 Ga0207647_10032408 3300025904 Bacteria 3357
623 Ga0207647_10071623 3300025904 Bacteria 2091
624 Ga0207647_10092157 3300025904 Bacteria 1806
625 Ga0207699_10024944 3300025906 Bacteria 3277
626 Ga0207645_10001233 3300025907 Bacteria 21061
627 Ga0207645_10023613 3300025907 Bacteria 3993
628 Ga0207645_10085526 3300025907 Bacteria 2025
629 Ga0207705_10000002 3300025909 Bacteria 2046852
630 Ga0207705_10000260 3300025909 Bacteria 51366
631 Ga0207705_10000673 3300025909 Bacteria 28381
632 Ga0207705_10004275 3300025909 Bacteria 10816
633 Ga0207705_10005171 3300025909 Bacteria 9780
634 Ga0207705_10006422 3300025909 Bacteria 8707
635 Ga0207705_10007630 3300025909 Bacteria 7956
636 Ga0207705_10016552 3300025909 Bacteria 5283
637 Ga0207705_10016829 3300025909 Bacteria 5236
638 Ga0207705_10019940 3300025909 Bacteria 4796
639 Ga0207705_10024723 3300025909 Bacteria 4286
640 Ga0207705_10040672 3300025909 Bacteria 3335
641 Ga0207705_10042478 3300025909 Bacteria 3264
642 Ga0207705_10043677 3300025909 Bacteria 3220
643 Ga0207705_10061232 3300025909 Bacteria 2719
644 Ga0207705_10067128 3300025909 Bacteria 2595
645 Ga0207705_10068045 3300025909 Bacteria 2578
646 Ga0207705_10097094 3300025909 Bacteria 2163
647 Ga0207705_10121203 3300025909 Bacteria 1941
648 Ga0207705_10153453 3300025909 Bacteria 1727
649 Ga0207705_10153878 3300025909 Bacteria 1724
650 Ga0207684_10000732 3300025910 Bacteria 38532
651 Ga0207684_10100166 3300025910 Unclassified 2476
652 Ga0207654_10000540 3300025911 Bacteria 21648
653 Ga0207707_10004278 3300025912 Bacteria 12632
654 Ga0207707_10033033 3300025912 Bacteria 4529
655 Ga0207695_10000022 3300025913 Bacteria 659090
656 Ga0207695_10000064 3300025913 Bacteria 346010
657 Ga0207695_10029739 3300025913 Bacteria 6028
658 Ga0207695_10042320 3300025913 Bacteria 4866
659 Ga0207695_10052908 3300025913 Bacteria 4251
660 Ga0207695_10118832 3300025913 Bacteria 2614
661 Ga0207695_10247946 3300025913 Bacteria 1681
662 Ga0207671_10000089 3300025914 Bacteria 140114
663 Ga0207671_10005075 3300025914 Bacteria 12297
664 Ga0207671_10005664 3300025914 Bacteria 11427
665 Ga0207671_10016587 3300025914 Bacteria 5719
666 Ga0207671_10028364 3300025914 Bacteria 4182
667 Ga0207671_10030779 3300025914 Bacteria 4000
668 Ga0207671_10033487 3300025914 Bacteria 3822
669 Ga0207693_10053329 3300025915 Bacteria 3173
670 Ga0207693_10060938 3300025915 Bacteria 2956
671 Ga0207660_10000787 3300025917 Bacteria 21077
672 Ga0207660_10001023 3300025917 Bacteria 18531
673 Ga0207660_10007267 3300025917 Bacteria 7167
674 Ga0207660_10137346 3300025917 Bacteria 1866
675 Ga0207657_10000031 3300025919 Bacteria 132167
676 Ga0207657_10000267 3300025919 Bacteria 55426
677 Ga0207657_10000625 3300025919 Bacteria 37604
678 Ga0207657_10002051 3300025919 Bacteria 21802
679 Ga0207657_10003334 3300025919 Bacteria 17170
680 Ga0207657_10003748 3300025919 Bacteria 16154
681 Ga0207657_10003760 3300025919 Bacteria 16129
682 Ga0207657_10006383 3300025919 Bacteria 12243
683 Ga0207657_10006861 3300025919 Bacteria 11748
684 Ga0207657_10007939 3300025919 Bacteria 10823
685 Ga0207657_10018947 3300025919 Bacteria 6551
686 Ga0207657_10052752 3300025919 Bacteria 3528
687 Ga0207657_10060914 3300025919 Bacteria 3238
688 Ga0207657_10070000 3300025919 Bacteria 2974
689 Ga0207657_10094032 3300025919 Bacteria 2496
690 Ga0207657_10105581 3300025919 Bacteria 2331
691 Ga0207657_10108643 3300025919 Bacteria 2293
692 Ga0207657_10134143 3300025919 Bacteria 2027
693 Ga0207657_10172243 3300025919 Bacteria 1753
694 Ga0207649_10000103 3300025920 Bacteria 69885
695 Ga0207649_10000394 3300025920 Bacteria 32788
696 Ga0207649_10008644 3300025920 Bacteria 5561
697 Ga0207649_10009140 3300025920 Bacteria 5420
698 Ga0207649_10012162 3300025920 Bacteria 4766
699 Ga0207649_10027244 3300025920 Bacteria 3352
700 Ga0207652_10000001 3300025921 Bacteria 1006643
701 Ga0207652_10014570 3300025921 Bacteria 6373
702 Ga0207652_10017973 3300025921 Bacteria 5793
703 Ga0207652_10053697 3300025921 Bacteria 3461
704 Ga0207652_10090491 3300025921 Bacteria 2689
705 Ga0207652_10108075 3300025921 Bacteria 2464
706 Ga0207652_10126353 3300025921 Bacteria 2278
707 Ga0207681_10000008 3300025923 Bacteria 414329
708 Ga0207681_10000082 3300025923 Bacteria 84963
709 Ga0207681_10000528 3300025923 Bacteria 26417
710 Ga0207681_10001333 3300025923 Bacteria 15917
711 Ga0207681_10004527 3300025923 Bacteria 8560
712 Ga0207681_10029309 3300025923 Bacteria 3573
713 Ga0207694_10003458 3300025924 Bacteria 12548
714 Ga0207694_10014139 3300025924 Bacteria 6017
715 Ga0207694_10071498 3300025924 Bacteria 2711
716 Ga0207694_10208302 3300025924 Bacteria 1592
717 Ga0207650_10001366 3300025925 Bacteria 17614
718 Ga0207650_10007278 3300025925 Bacteria 7536
719 Ga0207650_10008924 3300025925 Bacteria 6851
720 Ga0207650_10040021 3300025925 Bacteria 3428
721 Ga0207650_10068709 3300025925 Bacteria 2661
722 Ga0207650_10088225 3300025925 Bacteria 2365
723 Ga0207650_10122566 3300025925 Bacteria 2026
724 Ga0207650_10206569 3300025925 Bacteria 1576
725 Ga0207659_10007983 3300025926 Bacteria 6542
726 Ga0207659_10034085 3300025926 Bacteria 3509
727 Ga0207687_10002526 3300025927 Bacteria 12416
728 Ga0207687_10143672 3300025927 Bacteria 1813
729 Ga0207700_10028720 3300025928 Bacteria 3916
730 Ga0207700_10074976 3300025928 Bacteria 2620
731 Ga0207664_10000041 3300025929 Bacteria 154806
732 Ga0207664_10021648 3300025929 Bacteria 4786
733 Ga0207644_10000005 3300025931 Bacteria 441948
734 Ga0207644_10000006 3300025931 Bacteria 408793
735 Ga0207644_10000153 3300025931 Bacteria 49585
736 Ga0207644_10000220 3300025931 Bacteria 39427
737 Ga0207644_10000593 3300025931 Bacteria 23108
738 Ga0207644_10000941 3300025931 Bacteria 18539
739 Ga0207644_10002867 3300025931 Bacteria 11114
740 Ga0207644_10004200 3300025931 Bacteria 9349
741 Ga0207644_10018705 3300025931 Bacteria 4689
742 Ga0207644_10040253 3300025931 Bacteria 3303
743 Ga0207644_10250097 3300025931 Bacteria 1414
744 Ga0207690_10000382 3300025932 Bacteria 29300
745 Ga0207690_10002417 3300025932 Bacteria 11291
746 Ga0207690_10003206 3300025932 Bacteria 9816
747 Ga0207690_10003550 3300025932 Bacteria 9290
748 Ga0207690_10016632 3300025932 Bacteria 4481
749 Ga0207690_10035870 3300025932 Bacteria 3208
750 Ga0207690_10051785 3300025932 Bacteria 2747
751 Ga0207690_10067190 3300025932 Bacteria 2458
752 Ga0207690_10135662 3300025932 Bacteria 1806
753 Ga0207690_10138240 3300025932 Bacteria 1792
754 Ga0207706_10000028 3300025933 Bacteria 149092
755 Ga0207706_10000171 3300025933 Bacteria 72122
756 Ga0207706_10000285 3300025933 Bacteria 55179
757 Ga0207706_10000475 3300025933 Bacteria 42955
758 Ga0207706_10004574 3300025933 Bacteria 12984
759 Ga0207706_10005076 3300025933 Bacteria 12297
760 Ga0207706_10006857 3300025933 Bacteria 10531
761 Ga0207706_10010395 3300025933 Bacteria 8502
762 Ga0207706_10023541 3300025933 Bacteria 5529
763 Ga0207706_10027086 3300025933 Bacteria 5127
764 Ga0207706_10040257 3300025933 Bacteria 4141
765 Ga0207706_10062849 3300025933 Bacteria 3270
766 Ga0207706_10064292 3300025933 Bacteria 3230
767 Ga0207706_10169145 3300025933 Bacteria 1921
768 Ga0207706_10237757 3300025933 Bacteria 1593
769 Ga0207706_10268345 3300025933 Bacteria 1489
770 Ga0207709_10118340 3300025935 Bacteria 1784
771 Ga0207670_10101115 3300025936 Bacteria 2059
772 Ga0207669_10025408 3300025937 Bacteria 3201
773 Ga0207669_10030752 3300025937 Bacteria 2988
774 Ga0207704_10033427 3300025938 Bacteria 2924
775 Ga0207704_10068058 3300025938 Bacteria 2243
776 Ga0207704_10152191 3300025938 Bacteria 1634
777 Ga0207665_10023959 3300025939 Bacteria 4022
778 Ga0207691_10003885 3300025940 Bacteria 14507
779 Ga0207691_10004037 3300025940 Bacteria 14227
780 Ga0207691_10007857 3300025940 Bacteria 10275
781 Ga0207691_10013013 3300025940 Bacteria 7967
782 Ga0207691_10073175 3300025940 Bacteria 3091
783 Ga0207691_10127774 3300025940 Bacteria 2247
784 Ga0207691_10230668 3300025940 Bacteria 1603
785 Ga0207691_10307923 3300025940 Unclassified 1360
786 Ga0207711_10000100 3300025941 Bacteria 91024
787 Ga0207711_10000500 3300025941 Bacteria 40435
788 Ga0207711_10001375 3300025941 Bacteria 22908
789 Ga0207711_10001810 3300025941 Bacteria 19532
790 Ga0207711_10002836 3300025941 Bacteria 15230
791 Ga0207711_10005966 3300025941 Bacteria 10298
792 Ga0207711_10006042 3300025941 Bacteria 10232
793 Ga0207711_10009820 3300025941 Bacteria 7960
794 Ga0207711_10014697 3300025941 Bacteria 6505
795 Ga0207711_10017324 3300025941 Bacteria 5986
796 Ga0207711_10044099 3300025941 Bacteria 3806
797 Ga0207711_10048152 3300025941 Bacteria 3647
798 Ga0207711_10048787 3300025941 Bacteria 3622
799 Ga0207711_10049600 3300025941 Bacteria 3594
800 Ga0207711_10101010 3300025941 Bacteria 2552
801 Ga0207711_10353204 3300025941 Bacteria 1361
802 Ga0207689_10000092 3300025942 Bacteria 73254
803 Ga0207689_10023842 3300025942 Bacteria 5133
804 Ga0207661_10003597 3300025944 Bacteria 10780
805 Ga0207661_10107187 3300025944 Bacteria 2356
806 Ga0207679_10000129 3300025945 Bacteria 61477
807 Ga0207679_10004617 3300025945 Bacteria 8575
808 Ga0207679_10007146 3300025945 Bacteria 7071
809 Ga0207679_10007159 3300025945 Bacteria 7065
810 Ga0207679_10045221 3300025945 Bacteria 3183
811 Ga0207679_10301087 3300025945 Bacteria 1382
812 Ga0207667_10000357 3300025949 Bacteria 62034
813 Ga0207667_10007813 3300025949 Bacteria 12784
814 Ga0207667_10019487 3300025949 Bacteria 7571
815 Ga0207667_10020146 3300025949 Bacteria 7426
816 Ga0207667_10025870 3300025949 Bacteria 6420
817 Ga0207667_10039064 3300025949 Bacteria 5060
818 Ga0207667_10042463 3300025949 Bacteria 4833
819 Ga0207667_10123085 3300025949 Bacteria 2672
820 Ga0207667_10130473 3300025949 Bacteria 2589
821 Ga0207667_10238040 3300025949 Bacteria 1863
822 Ga0207651_10000176 3300025960 Bacteria 27858
823 Ga0207651_10006875 3300025960 Bacteria 6006
824 Ga0207651_10009081 3300025960 Bacteria 5412
825 Ga0207651_10009881 3300025960 Bacteria 5251
826 Ga0207651_10014015 3300025960 Bacteria 4613
827 Ga0207651_10167567 3300025960 Bacteria 1729
828 Ga0207651_10275756 3300025960 Bacteria 1387
829 Ga0207712_10000115 3300025961 Bacteria 86728
830 Ga0207712_10000269 3300025961 Bacteria 50416
831 Ga0207712_10001847 3300025961 Bacteria 13973
832 Ga0207712_10059784 3300025961 Bacteria 2699
833 Ga0207712_10136770 3300025961 Bacteria 1875
834 Ga0207712_10218852 3300025961 Bacteria 1521
835 Ga0207668_10000080 3300025972 Bacteria 72198
836 Ga0207668_10000293 3300025972 Bacteria 32843
837 Ga0207668_10002630 3300025972 Bacteria 10509
838 Ga0207668_10033158 3300025972 Bacteria 3419
839 Ga0207668_10089910 3300025972 Bacteria 2252
840 Ga0207668_10195295 3300025972 Bacteria 1607
841 Ga0207640_10000922 3300025981 Bacteria 16485
842 Ga0207640_10001385 3300025981 Bacteria 13123
843 Ga0207640_10036504 3300025981 Bacteria 3086
844 Ga0207640_10050441 3300025981 Bacteria 2700
845 Ga0207640_10081024 3300025981 Bacteria 2218
846 Ga0207658_10002645 3300025986 Bacteria 12976
847 Ga0207658_10003348 3300025986 Bacteria 11367
848 Ga0207658_10006798 3300025986 Bacteria 7792
849 Ga0207658_10007421 3300025986 Bacteria 7477
850 Ga0207658_10010339 3300025986 Bacteria 6340
851 Ga0207658_10014800 3300025986 Bacteria 5345
852 Ga0207658_10015585 3300025986 Bacteria 5215
853 Ga0207658_10016561 3300025986 Bacteria 5073
854 Ga0207658_10020445 3300025986 Bacteria 4583
855 Ga0207658_10028031 3300025986 Bacteria 3963
856 Ga0207658_10037108 3300025986 Bacteria 3498
857 Ga0207658_10175015 3300025986 Bacteria 1771
858 Ga0207677_10001622 3300026023 Bacteria 11935
859 Ga0207677_10007300 3300026023 Bacteria 6102
860 Ga0207677_10008848 3300026023 Bacteria 5644
861 Ga0207677_10079597 3300026023 Bacteria 2344
862 Ga0207703_10000515 3300026035 Bacteria 39972
863 Ga0207703_10001781 3300026035 Bacteria 19226
864 Ga0207703_10001798 3300026035 Bacteria 19132
865 Ga0207703_10002682 3300026035 Bacteria 15276
866 Ga0207703_10003524 3300026035 Bacteria 13094
867 Ga0207703_10004783 3300026035 Bacteria 11034
868 Ga0207703_10004802 3300026035 Bacteria 11007
869 Ga0207703_10009105 3300026035 Bacteria 7817
870 Ga0207703_10016679 3300026035 Bacteria 5730
871 Ga0207703_10067108 3300026035 Bacteria 2952
872 Ga0207703_10096257 3300026035 Bacteria 2499
873 Ga0207703_10148827 3300026035 Bacteria 2039
874 Ga0207639_10000131 3300026041 Bacteria 54681
875 Ga0207639_10005418 3300026041 Bacteria 8625
876 Ga0207639_10005686 3300026041 Bacteria 8438
877 Ga0207639_10042457 3300026041 Bacteria 3408
878 Ga0207639_10072666 3300026041 Bacteria 2694
879 Ga0207639_10084269 3300026041 Bacteria 2525
880 Ga0207678_10000198 3300026067 Bacteria 52573
881 Ga0207678_10000740 3300026067 Bacteria 29953
882 Ga0207678_10004259 3300026067 Bacteria 12829
883 Ga0207678_10005020 3300026067 Bacteria 11873
884 Ga0207678_10005050 3300026067 Bacteria 11841
885 Ga0207678_10015898 3300026067 Bacteria 6611
886 Ga0207678_10026121 3300026067 Bacteria 5095
887 Ga0207678_10057378 3300026067 Bacteria 3350
888 Ga0207678_10072445 3300026067 Bacteria 2952
889 Ga0207678_10155377 3300026067 Bacteria 1953
890 Ga0207678_10188928 3300026067 Bacteria 1760
891 Ga0207702_10000247 3300026078 Bacteria 62873
892 Ga0207702_10004072 3300026078 Bacteria 13122
893 Ga0207702_10011956 3300026078 Bacteria 7220
894 Ga0207702_10127922 3300026078 Bacteria 2283
895 Ga0207702_10140116 3300026078 Bacteria 2187
896 Ga0207702_10159744 3300026078 Bacteria 2057
897 Ga0207702_10197262 3300026078 Bacteria 1864
898 Ga0207702_10254257 3300026078 Bacteria 1651
899 Ga0207702_10344167 3300026078 Bacteria 1425
900 Ga0207641_10000004 3300026088 Bacteria 481088
901 Ga0207641_10000073 3300026088 Bacteria 149989
902 Ga0207641_10000221 3300026088 Bacteria 74390
903 Ga0207641_10001038 3300026088 Bacteria 28176
904 Ga0207641_10002527 3300026088 Bacteria 16854
905 Ga0207641_10005042 3300026088 Bacteria 11314
906 Ga0207641_10005367 3300026088 Bacteria 10945
907 Ga0207641_10013846 3300026088 Bacteria 6616
908 Ga0207641_10030273 3300026088 Bacteria 4483
909 Ga0207641_10030321 3300026088 Bacteria 4480
910 Ga0207641_10031905 3300026088 Bacteria 4371
911 Ga0207641_10037367 3300026088 Bacteria 4055
912 Ga0207648_10006196 3300026089 Bacteria 11911
913 Ga0207648_10008887 3300026089 Bacteria 9672
914 Ga0207648_10034392 3300026089 Bacteria 4467
915 Ga0207648_10036146 3300026089 Bacteria 4351
916 Ga0207648_10138313 3300026089 Bacteria 2146
917 Ga0207676_10002026 3300026095 Bacteria 14724
918 Ga0207676_10002161 3300026095 Bacteria 14204
919 Ga0207676_10003162 3300026095 Bacteria 11751
920 Ga0207676_10004385 3300026095 Bacteria 9979
921 Ga0207676_10017908 3300026095 Bacteria 5141
922 Ga0207676_10034087 3300026095 Bacteria 3852
923 Ga0207676_10086231 3300026095 Bacteria 2564
924 Ga0207674_10000289 3300026116 Bacteria 63604
925 Ga0207674_10002023 3300026116 Bacteria 25726
926 Ga0207674_10002652 3300026116 Bacteria 22343
927 Ga0207674_10006972 3300026116 Bacteria 13225
928 Ga0207674_10008981 3300026116 Bacteria 11487
929 Ga0207674_10012168 3300026116 Bacteria 9633
930 Ga0207674_10014969 3300026116 Bacteria 8544
931 Ga0207674_10016447 3300026116 Bacteria 8097
932 Ga0207674_10018937 3300026116 Bacteria 7464
933 Ga0207674_10025465 3300026116 Bacteria 6309
934 Ga0207674_10086035 3300026116 Bacteria 3138
935 Ga0207674_10109608 3300026116 Bacteria 2737
936 Ga0207675_100000135 3300026118 Bacteria 62501
937 Ga0207675_100000172 3300026118 Bacteria 58085
938 Ga0207675_100069152 3300026118 Bacteria 3300
939 Ga0207683_10032416 3300026121 Bacteria 4539
940 Ga0207683_10043045 3300026121 Bacteria 3944
941 Ga0207683_10073999 3300026121 Bacteria 3014
942 Ga0207683_10191977 3300026121 Bacteria 1855
943 Ga0207683_10213962 3300026121 Bacteria 1755
944 Ga0207698_10000944 3300026142 Bacteria 16887
945 Ga0207698_10001888 3300026142 Bacteria 12271
946 Ga0207698_10015158 3300026142 Bacteria 5154
947 Ga0207698_10015356 3300026142 Bacteria 5125
948 Ga0207698_10016046 3300026142 Bacteria 5038
949 Ga0207698_10018337 3300026142 Bacteria 4766
950 Ga0207698_10047184 3300026142 Bacteria 3260
951 Ga0207698_10063200 3300026142 Bacteria 2896
952 Ga0207698_10091820 3300026142 Bacteria 2487
953 Ga0209179_1000001 3300027512 Bacteria 128813
954 Ga0209974_10002244 3300027876 Bacteria 7026
955 Ga0207428_10090158 3300027907 Bacteria 2382
956 Ga0268266_10000025 3300028379 Bacteria 477143
957 Ga0268266_10000433 3300028379 Bacteria 62887
958 Ga0268266_10003150 3300028379 Bacteria 16743
959 Ga0268266_10012368 3300028379 Bacteria 7378
960 Ga0268266_10016623 3300028379 Bacteria 6287
961 Ga0268266_10018141 3300028379 Bacteria 5999
962 Ga0268266_10029989 3300028379 Bacteria 4622
963 Ga0268266_10031756 3300028379 Bacteria 4487
964 Ga0268266_10047737 3300028379 Bacteria 3669
965 Ga0268266_10069687 3300028379 Bacteria 3047
966 Ga0268266_10107736 3300028379 Bacteria 2464
967 Ga0268266_10149854 3300028379 Bacteria 2101
968 Ga0268266_10163828 3300028379 Bacteria 2013
969 Ga0268266_10293443 3300028379 Bacteria 1515
970 Ga0268265_10000064 3300028380 Bacteria 144164
971 Ga0268265_10000107 3300028380 Bacteria 104685
972 Ga0268265_10020623 3300028380 Bacteria 4603
973 Ga0268265_10027327 3300028380 Bacteria 4071
974 Ga0268265_10038539 3300028380 Bacteria 3516
975 Ga0268265_10055694 3300028380 Bacteria 3005
976 Ga0268265_10204665 3300028380 Bacteria 1715
977 Ga0268265_10276386 3300028380 Bacteria 1501
978 Ga0268264_10000010 3300028381 Bacteria 596543
979 Ga0268264_10000278 3300028381 Bacteria 86729
980 Ga0268264_10000567 3300028381 Bacteria 45270
981 Ga0268264_10002045 3300028381 Bacteria 18020
982 Ga0268264_10002177 3300028381 Bacteria 17427
983 Ga0268264_10005259 3300028381 Bacteria 10956
984 Ga0268264_10006022 3300028381 Bacteria 10262
985 Ga0268264_10019845 3300028381 Bacteria 5491
986 Ga0268264_10022226 3300028381 Bacteria 5178
987 Ga0268264_10053564 3300028381 Bacteria 3366
988 Ga0268264_10066545 3300028381 Bacteria 3039
989 Ga0268264_10105302 3300028381 Bacteria 2460
990 Ga0268264_10143582 3300028381 Bacteria 2132
991 Ga0268264_10281275 3300028381 Bacteria 1559
992 Ga0265319_1012169 3300028563 Bacteria 3488
993 Ga0265318_10011502 3300028577 Bacteria 3807
994 Ga0307515_10000027 3300028794 Bacteria 371624
995 Ga0307515_10039280 3300028794 Bacteria 7534
996 Ga0307515_10205377 3300028794 Bacteria 1832
997 Ga0265324_10041286 3300029957 Bacteria 1597
998 Ga0316177_1100564 3300030731 Bacteria 2389
999 Ga0316182_1189875 3300030745 Bacteria 2743
1000 Ga0316182_1433154 3300030745 Bacteria 2123
1001 Ga0265320_10015009 3300031240 Bacteria 4389
1002 Ga0265327_10022856 3300031251 Bacteria 3721
1003 Ga0307513_10000001 3300031456 Bacteria 1660464
1004 Ga0307509_10000002 3300031507 Bacteria 607551
1005 Ga0307408_100002898 3300031548 Bacteria 11892
1006 Ga0307408_100002967 3300031548 Bacteria 11753
1007 Ga0307408_100012582 3300031548 Bacteria 5608
1008 Ga0307408_100015521 3300031548 Bacteria 5072
1009 Ga0307408_100029940 3300031548 Bacteria 3776
1010 Ga0307408_100048260 3300031548 Bacteria 3053
1011 Ga0307408_100188248 3300031548 Bacteria 1661
1012 Ga0307508_10002405 3300031616 Bacteria 19765
1013 Ga0307516_10001732 3300031730 Bacteria 29952
1014 Ga0307405_10001334 3300031731 Bacteria 10338
1015 Ga0307405_10005492 3300031731 Bacteria 6120
1016 Ga0307405_10011011 3300031731 Bacteria 4717
1017 Ga0307405_10012904 3300031731 Bacteria 4441
1018 Ga0307405_10016071 3300031731 Bacteria 4071
1019 Ga0307405_10016186 3300031731 Bacteria 4060
1020 Ga0307405_10034756 3300031731 Bacteria 3003
1021 Ga0307405_10090788 3300031731 Bacteria 2022
1022 Ga0307413_10000144 3300031824 Bacteria 19106
1023 Ga0307413_10000917 3300031824 Bacteria 10465
1024 Ga0307413_10005133 3300031824 Bacteria 5800
1025 Ga0307413_10034618 3300031824 Bacteria 2888
1026 Ga0307413_10114955 3300031824 Bacteria 1810
1027 Ga0307413_10115966 3300031824 Bacteria 1803
1028 Ga0307413_10119379 3300031824 Bacteria 1782
1029 Ga0307410_10009720 3300031852 Bacteria 5409
1030 Ga0307410_10010793 3300031852 Bacteria 5197
1031 Ga0307410_10012347 3300031852 Bacteria 4936
1032 Ga0307410_10014542 3300031852 Bacteria 4635
1033 Ga0307410_10015716 3300031852 Bacteria 4497
1034 Ga0307410_10041040 3300031852 Bacteria 3049
1035 Ga0307410_10057891 3300031852 Bacteria 2640
1036 Ga0307410_10094198 3300031852 Bacteria 2132
1037 Ga0307410_10173421 3300031852 Bacteria 1627
1038 Ga0307406_10000061 3300031901 Bacteria 60128
1039 Ga0307406_10000444 3300031901 Bacteria 24155
1040 Ga0307406_10005150 3300031901 Bacteria 7131
1041 Ga0307406_10008769 3300031901 Bacteria 5652
1042 Ga0307406_10022911 3300031901 Bacteria 3710
1043 Ga0307406_10058341 3300031901 Bacteria 2480
1044 Ga0307406_10126422 3300031901 Bacteria 1787
1045 Ga0307407_10006018 3300031903 Bacteria 5342
1046 Ga0307407_10006801 3300031903 Bacteria 5123
1047 Ga0307407_10007023 3300031903 Bacteria 5067
1048 Ga0307407_10007706 3300031903 Bacteria 4890
1049 Ga0307407_10025564 3300031903 Bacteria 3113
1050 Ga0307407_10068031 3300031903 Bacteria 2108
1051 Ga0307407_10076812 3300031903 Bacteria 2006
1052 Ga0307407_10110060 3300031903 Bacteria 1727
1053 Ga0307407_10112357 3300031903 Bacteria 1712
1054 Ga0307407_10113471 3300031903 Bacteria 1705
1055 Ga0307407_10136476 3300031903 Bacteria 1577
1056 Ga0307412_10000004 3300031911 Bacteria 544053
1057 Ga0307412_10016666 3300031911 Bacteria 4382
1058 Ga0307412_10028016 3300031911 Bacteria 3520
1059 Ga0307412_10029004 3300031911 Bacteria 3469
1060 Ga0307412_10034105 3300031911 Bacteria 3241
1061 Ga0307412_10045681 3300031911 Bacteria 2865
1062 Ga0307412_10061860 3300031911 Bacteria 2518
1063 Ga0307412_10078776 3300031911 Bacteria 2271
1064 Ga0307412_10183444 3300031911 Bacteria 1576
1065 Ga0307409_100000049 3300031995 Bacteria 42215
1066 Ga0307409_100001231 3300031995 Bacteria 12332
1067 Ga0307409_100006386 3300031995 Bacteria 6921
1068 Ga0307409_100010794 3300031995 Bacteria 5708
1069 Ga0307409_100015511 3300031995 Bacteria 5004
1070 Ga0307409_100034116 3300031995 Bacteria 3712
1071 Ga0307409_100061997 3300031995 Bacteria 2925
1072 Ga0307409_100094881 3300031995 Bacteria 2456
1073 Ga0307409_100116482 3300031995 Bacteria 2252
1074 Ga0307409_100118363 3300031995 Bacteria 2237
1075 Ga0307409_100120849 3300031995 Bacteria 2218
1076 Ga0307409_100196347 3300031995 Bacteria 1801
1077 Ga0307409_100220149 3300031995 Bacteria 1713
1078 Ga0307409_100314232 3300031995 Bacteria 1463
1079 Ga0307409_100340461 3300031995 Bacteria 1411
1080 Ga0307416_100000186 3300032002 Bacteria 33626
1081 Ga0307416_100006793 3300032002 Bacteria 7195
1082 Ga0307416_100019803 3300032002 Bacteria 4781
1083 Ga0307416_100050457 3300032002 Bacteria 3316
1084 Ga0307416_100068874 3300032002 Bacteria 2926
1085 Ga0307416_100069177 3300032002 Bacteria 2920
1086 Ga0307416_100071508 3300032002 Bacteria 2882
1087 Ga0307416_100072245 3300032002 Bacteria 2871
1088 Ga0307416_100092662 3300032002 Bacteria 2600
1089 Ga0307416_100099156 3300032002 Bacteria 2529
1090 Ga0307416_100112469 3300032002 Bacteria 2403
1091 Ga0307416_100149906 3300032002 Bacteria 2137
1092 Ga0307416_100203850 3300032002 Bacteria 1879
1093 Ga0307416_100276184 3300032002 Bacteria 1653
1094 Ga0307414_10000735 3300032004 Bacteria 16778
1095 Ga0307414_10001265 3300032004 Bacteria 13028
1096 Ga0307414_10001794 3300032004 Bacteria 11117
1097 Ga0307414_10003339 3300032004 Bacteria 8571
1098 Ga0307414_10005567 3300032004 Bacteria 6946
1099 Ga0307414_10032847 3300032004 Bacteria 3422
1100 Ga0307414_10033122 3300032004 Bacteria 3411
1101 Ga0307414_10074773 3300032004 Bacteria 2456
1102 Ga0307414_10169784 3300032004 Bacteria 1742
1103 Ga0307414_10176017 3300032004 Bacteria 1716
1104 Ga0307414_10358068 3300032004 Bacteria 1254
1105 Ga0307411_10000702 3300032005 Bacteria 12290
1106 Ga0307411_10002909 3300032005 Bacteria 7754
1107 Ga0307411_10007368 3300032005 Bacteria 5597
1108 Ga0307411_10012009 3300032005 Bacteria 4704
1109 Ga0307411_10013476 3300032005 Bacteria 4512
1110 Ga0307411_10015098 3300032005 Bacteria 4325
1111 Ga0307411_10030014 3300032005 Bacteria 3328
1112 Ga0307411_10067594 3300032005 Bacteria 2405
1113 Ga0307411_10073382 3300032005 Bacteria 2327
1114 Ga0307411_10088051 3300032005 Bacteria 2158
1115 Ga0307411_10109607 3300032005 Bacteria 1972
1116 Ga0307411_10129419 3300032005 Bacteria 1842
1117 Ga0307411_10150533 3300032005 Bacteria 1728
1118 Ga0307411_10179750 3300032005 Bacteria 1604
1119 Ga0307411_10195169 3300032005 Bacteria 1549
1120 Ga0307415_100000244 3300032126 Bacteria 23531
1121 Ga0307415_100003494 3300032126 Bacteria 8010
1122 Ga0307415_100007694 3300032126 Bacteria 5916
1123 Ga0307415_100009878 3300032126 Bacteria 5379
1124 Ga0307415_100020451 3300032126 Bacteria 4042
1125 Ga0307415_100026196 3300032126 Bacteria 3674
1126 Ga0307415_100045062 3300032126 Bacteria 2954
1127 Ga0307415_100045109 3300032126 Bacteria 2953
1128 Ga0307415_100090284 3300032126 Bacteria 2215
1129 Ga0307415_100091220 3300032126 Bacteria 2206
1130 Ga0307415_100096547 3300032126 Bacteria 2154
1131 Ga0307415_100135320 3300032126 Bacteria 1873
1132 Ga0307415_100198478 3300032126 Bacteria 1590
1133 Ga0307415_100242435 3300032126 Bacteria 1459
1134 Ga0307507_10002651 3300033179 Bacteria 36900
1135 Ga0307510_10000003 3300033180 Bacteria 756654
1136 Ga0307510_10019979 3300033180 Bacteria 7844
1137 Ga0316212_1003469 3300033547 Bacteria 2278
1138 Ga0373950_0000001 3300034818 Bacteria 1001987
1139 Ga0373950_0001111 3300034818 Bacteria 3445
1140 Ga0373934_0044959 3300035086 Bacteria 1746
1141 Ga0373941_0008202 3300035115 Bacteria 2587
1142 Ga0373943_0035022 3300035170 Bacteria 2397
1143 Ga0373955_0004423 3300035172 Bacteria 6225
1144 Ga0373942_0000076 3300035207 Bacteria 21156
1145 Ga0373962_0062408 3300035242 Bacteria 1097
1146 Ga0373935_0002341 3300035692 Bacteria 10815
1147 Ga0373927_0093474 3300035695 Bacteria 1954
1148 Ga0373933_0006446 3300035724 Bacteria 6393
1149 Ga0373947_0009709 3300035725 Bacteria 5522
1150 Ga0373937_0004086 3300036401 Bacteria 12375
1151 Ga0373925_0000053 3300037068 Bacteria 125353
1152 Ga0395899_0000588 3300037312 Bacteria 38318
1153 Ga0395899_0004324 3300037312 Bacteria 11091
1154 Ga0395899_0005357 3300037312 Bacteria 9967
1155 Ga0395899_0010317 3300037312 Bacteria 7162
1156 Ga0395899_0025601 3300037312 Bacteria 4453
1157 Ga0395899_0033919 3300037312 Bacteria 3833
1158 Ga0395899_0059202 3300037312 Bacteria 2823
1159 Ga0395899_0074408 3300037312 Bacteria 2481
1160 Ga0395899_0097235 3300037312 Bacteria 2128
1161 Ga0395899_0150288 3300037312 Bacteria 1651
1162 Ga0395899_0157944 3300037312 Bacteria 1603
1163 Ga0395900_0000447 3300037418 Bacteria 59069
1164 Ga0395900_0001237 3300037418 Bacteria 31404
1165 Ga0395900_0003293 3300037418 Bacteria 17476
1166 Ga0395900_0008912 3300037418 Bacteria 10293
1167 Ga0395900_0010430 3300037418 Bacteria 9503
1168 Ga0395900_0012370 3300037418 Bacteria 8733
1169 Ga0395900_0014134 3300037418 Bacteria 8151
1170 Ga0395900_0023784 3300037418 Bacteria 6268
1171 Ga0395900_0031449 3300037418 Bacteria 5453
1172 Ga0395900_0031981 3300037418 Bacteria 5408
1173 Ga0395900_0043530 3300037418 Bacteria 4627
1174 Ga0395900_0060690 3300037418 Bacteria 3890
1175 Ga0395900_0078347 3300037418 Bacteria 3396
1176 Ga0395900_0090264 3300037418 Bacteria 3149
1177 Ga0395900_0093241 3300037418 Bacteria 3093
1178 Ga0395900_0149452 3300037418 Bacteria 2387
1179 Ga0395900_0153780 3300037418 Bacteria 2350
1180 Ga0395900_0215182 3300037418 Bacteria 1939
1181 Ga0395898_0000978 3300037466 Bacteria 44946
1182 Ga0395898_0005900 3300037466 Bacteria 13169
1183 Ga0395898_0010805 3300037466 Bacteria 9538
1184 Ga0395898_0013212 3300037466 Bacteria 8506
1185 Ga0395898_0019019 3300037466 Bacteria 6995
1186 Ga0395898_0026042 3300037466 Bacteria 5889
1187 Ga0395898_0027768 3300037466 Bacteria 5675
1188 Ga0395898_0069451 3300037466 Bacteria 3408
1189 Ga0395898_0079598 3300037466 Bacteria 3161
1190 Ga0395898_0120402 3300037466 Bacteria 2515
1191 Ga0395898_0130858 3300037466 Bacteria 2404
1192 Ga0395898_0141896 3300037466 Bacteria 2299
1193 Ga0395905_0000104 3300037471 Bacteria 141965
1194 Ga0395905_0000974 3300037471 Bacteria 36725
1195 Ga0395905_0001255 3300037471 Bacteria 31369
1196 Ga0395905_0001886 3300037471 Bacteria 24164
1197 Ga0395905_0004314 3300037471 Bacteria 14817
1198 Ga0395905_0005211 3300037471 Bacteria 13309
1199 Ga0395905_0008284 3300037471 Bacteria 10261
1200 Ga0395905_0009884 3300037471 Bacteria 9297
1201 Ga0395905_0014108 3300037471 Bacteria 7639
1202 Ga0395905_0016029 3300037471 Bacteria 7123
1203 Ga0395905_0016902 3300037471 Bacteria 6930
1204 Ga0395905_0023848 3300037471 Bacteria 5776
1205 Ga0395905_0026200 3300037471 Bacteria 5498
1206 Ga0395905_0026869 3300037471 Bacteria 5428
1207 Ga0395905_0038225 3300037471 Bacteria 4503
1208 Ga0395905_0039669 3300037471 Bacteria 4418
1209 Ga0395905_0064932 3300037471 Bacteria 3416
1210 Ga0395905_0070210 3300037471 Bacteria 3281
1211 Ga0395905_0073786 3300037471 Bacteria 3198
1212 Ga0395905_0077640 3300037471 Bacteria 3111
1213 Ga0395905_0088810 3300037471 Bacteria 2896
1214 Ga0395905_0094324 3300037471 Bacteria 2807
1215 Ga0395905_0095012 3300037471 Bacteria 2797
1216 Ga0395905_0097272 3300037471 Bacteria 2764
1217 Ga0395905_0137704 3300037471 Bacteria 2297
1218 Ga0395905_0168475 3300037471 Bacteria 2058
1219 Ga0395905_0206485 3300037471 Bacteria 1841
1220 Ga0395905_0309360 3300037471 Bacteria 1468
1221 Ga0395905_0325408 3300037471 Bacteria 1427
1222 Ga0395905_0353352 3300037471 Bacteria 1362
1223 Ga0436364_0086296 3300037853 Bacteria 8589
1224 Ga0436364_0331782 3300037853 Bacteria 57289
1225 Ga0436364_0430514 3300037853 Bacteria 4239
1226 Ga0436364_0454096 3300037853 Bacteria 3613
1227 Ga0436364_0584120 3300037853 Bacteria 7267
1228 Ga0436364_1449597 3300037853 Bacteria 171227
1229 Ga0395901_0000276 3300038443 Bacteria 63580
1230 Ga0395901_0000324 3300038443 Bacteria 59134
1231 Ga0395901_0000702 3300038443 Bacteria 38241
1232 Ga0395901_0001229 3300038443 Bacteria 27314
1233 Ga0395901_0003633 3300038443 Bacteria 15561
1234 Ga0395901_0010013 3300038443 Bacteria 9610
1235 Ga0395901_0020870 3300038443 Bacteria 6709
1236 Ga0395901_0023392 3300038443 Bacteria 6333
1237 Ga0395901_0038736 3300038443 Bacteria 4931
1238 Ga0395901_0039030 3300038443 Bacteria 4912
1239 Ga0395901_0040045 3300038443 Bacteria 4851
1240 Ga0395901_0060689 3300038443 Bacteria 3935
1241 Ga0395901_0068820 3300038443 Bacteria 3687
1242 Ga0395901_0081320 3300038443 Bacteria 3384
1243 Ga0395901_0088892 3300038443 Bacteria 3232
1244 Ga0395901_0121313 3300038443 Bacteria 2747
1245 Ga0395901_0153861 3300038443 Bacteria 2415
1246 Ga0395901_0196084 3300038443 Bacteria 2117
1247 Ga0395901_0199360 3300038443 Bacteria 2098
1248 Ga0395901_0204822 3300038443 Bacteria 2067
1249 Ga0395901_0272156 3300038443 Bacteria 1761
1250 Ga0395901_0363701 3300038443 Bacteria 1491
1251 Ga0436365_0329501 3300039437 Bacteria 19789
1252 Ga0436365_0490562 3300039437 Bacteria 7472
1253 Ga0436365_0862833 3300039437 Bacteria 88455
1254 Ga0436365_1291448 3300039437 Bacteria 25345
1255 Ga0436365_1796505 3300039437 Bacteria 4604
1256 Ga0436365_1804902 3300039437 Bacteria 3443
1257 Ga0436360_1263027 3300039438 Bacteria 4036
1258 Ga0436361_0272150 3300039447 Bacteria 6822
1259 Ga0436361_0553665 3300039447 Bacteria 3660
1260 Ga0436361_0749976 3300039447 Unclassified 3133
1261 Ga0436363_1089207 3300039450 Bacteria 10918
1262 Ga0436363_1565021 3300039450 Bacteria 1778
1263 Ga0436362_0949954 3300039453 Bacteria 89092
1264 Ga0439465_0000100 3300041413 Bacteria 19698
1265 Ga0451853_1298320 3300041512 Bacteria 2587
1266 Ga0439445_0001968 3300042004 Bacteria 4533
1267 Ga0439445_0007987 3300042004 Bacteria 2468
1268 Ga0439432_002208 3300042006 Bacteria 7351
1269 Ga0439432_004034 3300042006 Bacteria 5386
1270 Ga0439449_0000021 3300042007 Bacteria 46082
1271 Ga0439463_008450 3300042016 Bacteria 2539
1272 Ga0450920_005478 3300042122 Bacteria 2256
1273 Ga0450889_000635 3300042144 Bacteria 3884
1274 Ga0439464_0000318 3300042439 Bacteria 9184
1275 Ga0466969_0002544 3300044656 Bacteria 9741
1276 Ga0466969_0003603 3300044656 Bacteria 8241
1277 Ga0466972_0066638 3300044658 Bacteria 1721
1278 Ga0466966_0000701 3300044684 Bacteria 21320
1279 Ga0466966_0016093 3300044684 Bacteria 4945
1280 Ga0466966_0100131 3300044684 Bacteria 1793
1281 Ga0466961_0003965 3300044693 Bacteria 9260
1282 Ga0466961_0043703 3300044693 Bacteria 2869
1283 Ga0466963_0009670 3300044694 Bacteria 5813
1284 Ga0466963_0051756 3300044694 Bacteria 2723
1285 Ga0466963_0169622 3300044694 Bacteria 1521
1286 Ga0466971_0003466 3300044719 Bacteria 6736
1287 Ga0466971_0018889 3300044719 Bacteria 3057
1288 Ga0466968_0016441 3300044735 Bacteria 2946
1289 Ga0466970_0021751 3300044765 Bacteria 3344
1290 Ga0466957_0076075 3300044842 Unclassified 2084
1291 Ga0466957_0106689 3300044842 Bacteria 1772
1292 Ga0466959_0000100 3300045049 Bacteria 54979
1293 Ga0466959_0003665 3300045049 Bacteria 10132
1294 Ga0466959_0215466 3300045049 Bacteria 1333
1295 Ga0466958_0015261 3300045836 Bacteria 4399
1296 Ga0466958_0048253 3300045836 Bacteria 2572
1297 Ga0466967_0119767 3300045976 Bacteria 2430
1298 Ga0466967_0132000 3300045976 Bacteria 2319
1299 Ga0466967_0136099 3300045976 Bacteria 2284
1300 Ga0466967_0162923 3300045976 Bacteria 2094
1301 Ga0466967_0282317 3300045976 Bacteria 1593
1302 Ga0466967_0308310 3300045976 Bacteria 1524
1303 Ga0466967_0385353 3300045976 Bacteria 1362
1304 Ga0495592_0051368 3300046454 Bacteria 3062
1305 Ga0495603_0002224 3300046455 Bacteria 11404
1306 Ga0495638_0004735 3300046460 Bacteria 10267
1307 Ga0495638_0071311 3300046460 Bacteria 2126
1308 Ga0495582_0008247 3300046473 Bacteria 5748
1309 Ga0495605_0006156 3300046474 Bacteria 6916
1310 Ga0495610_0001199 3300046512 Bacteria 23439
1311 Ga0495616_0020759 3300046513 Bacteria 3568
1312 Ga0495616_0025365 3300046513 Bacteria 3168
1313 Ga0495628_0038869 3300046516 Bacteria 3807
1314 Ga0495637_0060578 3300046520 Bacteria 1554
1315 Ga0495648_0076783 3300046524 Bacteria 1917
1316 Ga0495663_0000528 3300046525 Bacteria 13699
1317 Ga0495663_0000927 3300046525 Bacteria 9803
1318 Ga0495652_0060253 3300046529 Bacteria 3208
1319 Ga0495665_0005801 3300046531 Bacteria 6665
1320 Ga0495598_0002187 3300046537 Bacteria 4008
1321 Ga0495598_0010308 3300046537 Bacteria 2236
1322 Ga0495621_0000065 3300046539 Bacteria 20486
1323 Ga0495621_0000800 3300046539 Bacteria 7954
1324 Ga0495621_0014727 3300046539 Bacteria 2481
1325 Ga0495633_0002388 3300046558 Bacteria 13292
1326 Ga0495656_0112979 3300046615 Bacteria 1273
1327 Ga0495668_0000034 3300046616 Bacteria 254171
1328 Ga0495668_0000079 3300046616 Bacteria 157703
1329 Ga0495661_0006794 3300046665 Bacteria 8019
1330 Ga0495657_0000862 3300046675 Bacteria 26723
1331 Ga0495623_0024603 3300046679 Bacteria 3878
1332 Ga0495669_0002616 3300046684 Bacteria 7364
1333 Ga0495669_0004574 3300046684 Bacteria 5727
1334 Ga0495669_0006311 3300046684 Bacteria 4951
1335 Ga0495669_0006914 3300046684 Bacteria 4752
1336 Ga0495669_0064756 3300046684 Bacteria 1658
1337 Ga0495613_0001217 3300046689 Bacteria 19682
1338 Ga0495624_0158504 3300046690 Bacteria 1383
1339 Ga0495670_0000467 3300046691 Bacteria 19301
1340 Ga0495670_0023273 3300046691 Bacteria 3058
1341 Ga0495671_0005011 3300046692 Bacteria 7801
1342 Ga0495649_0025286 3300046694 Bacteria 3307
1343 Ga0495660_0004360 3300046810 Bacteria 8568
1344 Ga0495675_0012835 3300047444 Bacteria 5278
1345 Ga0495677_0003352 3300047445 Bacteria 6233
1346 Ga0495677_0005915 3300047445 Bacteria 4634
1347 Ga0495685_061071 3300047447 Bacteria 1270
1348 Ga0495686_0000164 3300047472 Bacteria 126101
1349 Ga0495686_0025665 3300047472 Bacteria 3862
1350 Ga0495686_0061585 3300047472 Bacteria 2330
1351 Ga0496100_0003792 3300048903 Bacteria 7913
1352 Ga0496100_0037167 3300048903 Bacteria 3076
1353 Ga0496101_0001530 3300048904 Bacteria 13854
1354 Ga0496101_0021951 3300048904 Bacteria 4388
1355 Ga0496101_0022269 3300048904 Bacteria 4361
1356 Ga0496101_0030191 3300048904 Bacteria 3798
1357 Ga0496101_0047686 3300048904 Bacteria 3077
1358 Ga0496101_0099624 3300048904 Bacteria 2173
1359 Ga0496102_0001739 3300048905 Bacteria 19070
1360 Ga0496102_0014406 3300048905 Bacteria 6870
1361 Ga0496102_0032814 3300048905 Unclassified 4666
1362 Ga0496102_0123882 3300048905 Bacteria 2415
1363 Ga0496102_0192597 3300048905 Bacteria 1921
1364 Ga0496102_0221408 3300048905 Bacteria 1784
1365 Ga0496103_0002913 3300048906 Bacteria 10609
1366 Ga0496103_0011702 3300048906 Bacteria 5204
1367 Ga0496103_0012986 3300048906 Bacteria 4938
1368 Ga0496103_0029807 3300048906 Bacteria 3317
1369 Ga0496103_0052039 3300048906 Bacteria 2536
1370 Ga0496104_0001296 3300048907 Bacteria 21566
1371 Ga0496104_0015717 3300048907 Bacteria 6865
1372 Ga0496104_0078080 3300048907 Bacteria 3155
1373 Ga0496104_0286449 3300048907 Bacteria 1560
1374 Ga0496105_0000695 3300048908 Bacteria 22689
1375 Ga0496105_0000932 3300048908 Bacteria 19921
1376 Ga0496105_0022358 3300048908 Bacteria 5121
1377 Ga0496105_0275116 3300048908 Bacteria 1359
1378 Ga0496106_0000685 3300048909 Bacteria 24284
1379 Ga0496106_0017079 3300048909 Bacteria 5371
1380 Ga0496106_0018321 3300048909 Bacteria 5174
1381 Ga0496106_0055678 3300048909 Bacteria 2990
1382 Ga0496106_0117567 3300048909 Bacteria 2075
1383 Ga0496107_0000057 3300048910 Bacteria 57260
1384 Ga0496107_0001610 3300048910 Bacteria 14069
1385 Ga0496107_0002088 3300048910 Bacteria 12791
1386 Ga0496107_0002535 3300048910 Bacteria 11898
1387 Ga0496107_0003034 3300048910 Bacteria 11130
1388 Ga0496107_0144163 3300048910 Bacteria 1761
1389 Ga0496107_0168901 3300048910 Bacteria 1623
1390 Ga0496107_0174638 3300048910 Bacteria 1595
1391 Ga0496108_0004255 3300048911 Bacteria 11525
1392 Ga0496108_0006866 3300048911 Bacteria 9210
1393 Ga0496108_0013082 3300048911 Bacteria 6763
1394 Ga0496108_0022113 3300048911 Bacteria 5228
1395 Ga0496108_0029034 3300048911 Bacteria 4577
1396 Ga0496108_0049189 3300048911 Bacteria 3526
1397 Ga0496108_0086212 3300048911 Bacteria 2666
1398 Ga0496109_0000521 3300048912 Bacteria 32573
1399 Ga0496109_0010536 3300048912 Bacteria 7902
1400 Ga0496109_0013067 3300048912 Bacteria 7182
1401 Ga0496109_0138588 3300048912 Bacteria 2274
1402 Ga0496110_0000847 3300048913 Bacteria 21521
1403 Ga0496110_0012913 3300048913 Bacteria 6887
1404 Ga0496110_0029506 3300048913 Bacteria 4721
1405 Ga0496110_0038466 3300048913 Bacteria 4163
1406 Ga0496110_0058135 3300048913 Bacteria 3405
1407 Ga0496110_0089550 3300048913 Bacteria 2750
1408 Ga0496110_0336969 3300048913 Bacteria 1374
1409 Ga0496111_0000782 3300048914 Bacteria 16994
1410 Ga0496111_0003138 3300048914 Bacteria 10164
1411 Ga0496111_0005026 3300048914 Bacteria 8411
1412 Ga0496111_0006263 3300048914 Bacteria 7714
1413 Ga0496111_0014601 3300048914 Bacteria 5371
1414 Ga0496111_0074700 3300048914 Bacteria 2469
1415 Ga0496112_0005760 3300048915 Bacteria 10774
1416 Ga0496112_0005909 3300048915 Bacteria 10673
1417 Ga0496112_0008648 3300048915 Bacteria 9128
1418 Ga0496112_0014514 3300048915 Bacteria 7315
1419 Ga0496112_0072844 3300048915 Bacteria 3396
1420 Ga0496112_0256623 3300048915 Bacteria 1698
1421 Ga0496113_0002271 3300048916 Bacteria 11088
1422 Ga0496113_0042465 3300048916 Bacteria 3360
1423 Ga0496113_0049295 3300048916 Bacteria 3135
1424 Ga0496113_0061068 3300048916 Bacteria 2843
1425 Ga0496113_0129310 3300048916 Bacteria 1980
1426 Ga0496114_0000109 3300048917 Bacteria 59733
1427 Ga0496114_0001315 3300048917 Bacteria 18828
1428 Ga0496114_0021294 3300048917 Bacteria 5273
1429 Ga0496114_0056792 3300048917 Bacteria 3267
1430 Ga0496115_0000691 3300048918 Bacteria 25050
1431 Ga0496115_0029126 3300048918 Bacteria 4334
1432 Ga0496115_0144925 3300048918 Bacteria 1960
1433 Ga0496116_0006891 3300048919 Bacteria 10203
1434 Ga0496117_0000316 3300048920 Bacteria 84475
1435 Ga0496117_0007881 3300048920 Bacteria 10241
1436 Ga0496118_0000003 3300048921 Bacteria 773148
1437 Ga0496118_0011358 3300048921 Bacteria 8705
1438 Ga0496118_0021325 3300048921 Bacteria 5707
1439 Ga0496118_0058208 3300048921 Bacteria 2890
1440 Ga0496119_0035935 3300048922 Bacteria 3239
1441 Ga0496120_0053834 3300048923 Bacteria 2284
1442 Ga0496121_0000078 3300048924 Bacteria 233455
1443 Ga0496121_0000293 3300048924 Bacteria 103372
1444 Ga0496121_0000520 3300048924 Bacteria 73411
1445 Ga0496121_0001591 3300048924 Bacteria 37770
1446 Ga0496121_0032025 3300048924 Bacteria 4788
1447 Ga0496121_0120858 3300048924 Bacteria 1978
1448 Ga0496123_0001205 3300048926 Bacteria 37836
1449 Ga0496125_0000743 3300048928 Bacteria 53879
1450 Ga0496125_0049656 3300048928 Bacteria 3483
1451 Ga0496126_0002855 3300048929 Bacteria 22592
1452 Ga0496126_0024757 3300048929 Bacteria 5789
1453 Ga0496126_0131367 3300048929 Bacteria 2163
1454 Ga0501344_00458 3300049133 Bacteria 1700
1455 Ga0501033_0003807 3300049570 Bacteria 12270
1456 Ga0501033_0164138 3300049570 Bacteria 1598
1457 Ga0501034_0001823 3300049571 Bacteria 27089
1458 Ga0501034_0032213 3300049571 Bacteria 5325
1459 Ga0501034_0058147 3300049571 Bacteria 3886
1460 Ga0501034_0066987 3300049571 Unclassified 3604
1461 Ga0501034_0078002 3300049571 Bacteria 3318
1462 Ga0501034_0112927 3300049571 Bacteria 2707
1463 Ga0501034_0206973 3300049571 Bacteria 1918
1464 Ga0501034_0274715 3300049571 Bacteria 1625
1465 Ga0501037_0052873 3300049573 Bacteria 2970
1466 Ga0501037_0098195 3300049573 Bacteria 2116
1467 Ga0501037_0137414 3300049573 Bacteria 1750
1468 Ga0501038_0072611 3300049574 Bacteria 2916
1469 Ga0501040_0001111 3300049576 Archaea 17023
1470 Ga0501043_0015010 3300049579 Bacteria 6066
1471 Ga0501043_0048773 3300049579 Bacteria 3328
1472 Ga0501046_0059507 3300049580 Archaea 2992
1473 Ga0501047_0000495 3300049581 Bacteria 42674
1474 Ga0501047_0031886 3300049581 Bacteria 5085
1475 Ga0501047_0051112 3300049581 Bacteria 3992
1476 Ga0501047_0065590 3300049581 Archaea 3500
1477 Ga0501047_0162834 3300049581 Bacteria 2102
1478 Ga0501067_0000020 3300049583 Bacteria 99898
1479 Ga0501067_0035347 3300049583 Bacteria 2775
1480 Ga0501067_0036455 3300049583 Unclassified 2730
1481 Ga0501068_0007993 3300049584 Bacteria 5865
1482 Ga0501069_0059272 3300049585 Bacteria 2136
1483 Ga0501070_0196199 3300049586 Bacteria 1658
1484 Ga0501070_0226721 3300049586 Bacteria 1531
1485 Ga0501072_0110194 3300049588 Bacteria 2191
1486 Ga0501073_0000969 3300049589 Bacteria 20678
1487 Ga0501073_0002061 3300049589 Bacteria 15026
1488 Ga0501073_0034893 3300049589 Bacteria 3577
1489 Ga0501074_0028679 3300049590 Bacteria 4034
1490 Ga0501257_000008 3300049686 Bacteria 54624
1491 Ga0501225_0002546 3300049705 Bacteria 5626
1492 Ga0501080_0026026 3300049742 Bacteria 5435
1493 Ga0501080_0055953 3300049742 Bacteria 3674
1494 Ga0501080_0109957 3300049742 Unclassified 2554
1495 Ga0501080_0113436 3300049742 Bacteria 2513
1496 Ga0501080_0218200 3300049742 Bacteria 1746
1497 Ga0501083_0000016 3300049744 Bacteria 156309
1498 Ga0501083_0007007 3300049744 Bacteria 8001
1499 Ga0501083_0032268 3300049744 Bacteria 3593
1500 Ga0501241_003362 3300049758 Unclassified 3019
1501 Ga0501280_001017 3300049776 Bacteria 5802
1502 Ga0501035_0003147 3300049822 Bacteria 15853
1503 Ga0501035_0073610 3300049822 Bacteria 3023
1504 Ga0501035_0128836 3300049822 Bacteria 2207
1505 Ga0501044_0004599 3300049823 Bacteria 15432
1506 Ga0501044_0025812 3300049823 Bacteria 6228
1507 Ga0501044_0243772 3300049823 Bacteria 1740
1508 nmdc:mga00v17_40517_c1 3300050491 Bacteria 2794
1509 nmdc:mga06r32_4357_c1 3300050510 Bacteria 12660
1510 nmdc:mga08y16_309658_c1 3300050511 Bacteria 1626
1511 nmdc:mga08y16_5569_c1 3300050511 Bacteria 13191
1512 nmdc:mga08x19_112903_c1 3300050514 Bacteria 1242
1513 nmdc:mga0a205_54162_c1 3300050515 Bacteria 3873
1514 Ga0500610_0001905 3300053079 Bacteria 7411
1515 Ga0500643_001292 3300053087 Bacteria 14753
1516 Ga0500595_013270 3300053119 Bacteria 3160
1517 Ga0500658_0001563 3300053134 Bacteria 9136
1518 Ga0500559_0000752 3300053136 Bacteria 21274
1519 Ga0500616_0000209 3300053153 Bacteria 94705
1520 Ga0500620_005002 3300053155 Bacteria 3021
1521 Ga0500622_0026058 3300053156 Bacteria 3088
1522 Ga0500636_0009880 3300053177 Bacteria 5554
1523 Ga0501084_0002756 3300054114 Bacteria 14186
1524 Ga0501082_0246015 3300060353 Bacteria 1556
1525 Ga0466962_0002025 3300061719 Bacteria 9565
1526 Ga0466962_0120631 3300061719 Bacteria 1265
1527 2512962544 2512875024 Bacteria 7195110
1528 2514038625 2513237164 Bacteria 7563725
1529 2524612328 2524023250 Bacteria 5457705
1530 2552114059 2551306166 Bacteria 9731570
1531 2585154249 2582581280 Bacteria 5994497
1532 2585197868 2582581293 Bacteria 5907401
1533 2585307976 2582581313 Bacteria 10042643
1534 2587741855 2585428059 Bacteria 8696589
1535 2587917817 2585428106 Bacteria 5179711
1536 2644270501 2643221647 Bacteria 10741251
1537 2644424714 2643221676 Bacteria 8119172
1538 2644716654 2643221731 Bacteria 5623886
1539 2644722682 2643221732 Bacteria 5756404
1540 2676479782 2675903059 Bacteria 8644972
1541 2688595614 2687453392 Bacteria 6880454
1542 2739790688 2739367756 Bacteria 4553612
1543 2792746798 2791355123 Bacteria 8049106
1544 2816424314 2816332119 Bacteria 8120218
1545 2817482147 2816332295 Bacteria 4352468
1546 2819567143 2818991441 Bacteria 5062707
1547 2819674182 2818991459 Bacteria 8736032
1548 2819745704 2818991472 Bacteria 10089953
1549 2835318484 2835312727 Bacteria 7413381
1550 2837271733 2837268691 Bacteria 7850704
1551 2840678409 2840677318 Bacteria 2664183
1552 2849562923 2849560528 Bacteria 5393480
1553 2852633712 2852632344 Bacteria 3463163
1554 2857457643 2857453340 Bacteria 8090534
1555 2857470485 2857465823 Bacteria 6772595
1556 2857476157 2857472729 Bacteria 6568124
1557 2857596877 2857591370 Bacteria 6569758
1558 2857608160 2857604169 Bacteria 5111450
1559 2862293481 2862290372 Bacteria 7471434
1560 2862709330 2862705112 Bacteria 6563286
1561 2865000746 2864997549 Bacteria 5139696
1562 2866616696 2866612099 Bacteria 7543886
1563 2869280102 2869278585 Bacteria 7077053
1564 2874143346 2874139085 Bacteria 7021506
1565 2874172002 2874168670 Bacteria 8062617
1566 2878740585 2878738818 Bacteria 7136951
1567 2883068479 2883068021 Bacteria 6192739
1568 2888342955 2888337043 Bacteria 6629336
1569 2889298590 2889295896 Bacteria 4704906
1570 2894235901 2894232714 Bacteria 8834183
1571 2898329748 2898329390 Bacteria 5168154
1572 2899361453 2899359706 Bacteria 10940472
1573 2904525411 2904524088 Bacteria 5887454
1574 2904762516 2904755435 Bacteria 7986759
1575 2906379059 2906378014 Bacteria 6911440
1576 2916974015 2916971899 Bacteria 4250608
1577 2918507924 2918501144 Bacteria 8668083
1578 2919431797 2919425241 Bacteria 8055701
1579 2919722273 2919720352 Bacteria 5986006
1580 2922158346 2922151315 Bacteria 6902399
1581 2924721744 2924718760 Bacteria 6331356
1582 2924778186 2924776078 Bacteria 7492003
1583 2925328487 2925326138 Bacteria 9652120
1584 2935893635 2935890801 Bacteria 4593001
1585 2937824309 2937822353 Bacteria 7290551
1586 2937877984 2937877337 Bacteria 7246526
1587 2937973971 2937972304 Bacteria 7532020
1588 2939615303 2939611941 Bacteria 3892017
1589 2958035968 2958034702 Bacteria 6989922
1590 2958045274 2958041894 Bacteria 13082850
1591 2958085095 2958084443 Bacteria 7312792
1592 2958098880 2958092219 Bacteria 6861151
1593 2958147362 2958144490 Bacteria 6677056
1594 2960324589 2960319331 Bacteria 5502575
1595 2965115385 2965110997 Bacteria 6693150
1596 2968017055 2968016561 Bacteria 7022047
1597 2968146089 2968138860 Bacteria 6605449
1598 2970470212 2970469710 Bacteria 6969209
1599 2970594699 2970593180 Bacteria 7073582
1600 2979796775 2979793036 Bacteria 6808957
1601 2980130617 2980125574 Bacteria 5567337
1602 2980186566 2980182181 Bacteria 9454109
1603 2980188806 2980182181 Bacteria 9454109
1604 2981289056 2981284811 Bacteria 4641497
1605 2981293807 2981289755 Bacteria 4641509
1606 2981984662 2981980479 Bacteria 4641628
1607 2981989523 2981985349 Bacteria 4641497
1608 2987674316 2987673487 Bacteria 6884027
1609 2996349001 2996348954 Bacteria 7239054
1610 2997605507 2997600082 Bacteria 9896405
1611 3004272591 3004268573 Bacteria 7043476
1612 3004275713 3004275668 Bacteria 7114440
1613 3006862578 3006858327 Bacteria 4317835
1614 8008487660 8008485437 Bacteria 7198341
1615 8022896719 8022893055 Bacteria 5300455
1616 8022916360 8022914991 Bacteria 5584517
1617 8025526821 8025524527 Bacteria 7197316
1618 8047710846 8047710418 Bacteria 11023148
1619 8054802387 8054795415 Bacteria 9785225
1620 8057133497 8057132660 Bacteria 4061191
1621 8057981202 8057977335 Bacteria 5694872
1622 Ga0496106_0004331
1623 LJQas_1007542
1624 JGI24752J21851_1000015
1625 JGI24740J21852_10001942
1626 JGI24740J21852_10002481
1627 JGI24740J21852_10030586
1628 JGI24739J22299_10000129
1629 JGI24739J22299_10001243
1630 JGI24739J22299_10010594
1631 JGI24737J22298_10000357
1632 JGI24735J21928_10003791
1633 JGI24735J21928_10004250
1634 JGI24750J21931_1000434
1635 JGI24748J21848_1000013
1636 JGI24738J21930_10001003
1637 JGI24034J26672_10000011
1638 JGI25152J39213_1000138
1639 JGI25406J46586_10023598
1640 JGI25165J46597_1000210
1641 rootH2_10050297
1642 rootH2_10150611
1643 rootL2_10101515
1644 rootH1_10031917
1645 rootH1_10148928
1646 Ga0006562J51391_1009051
1647 Ga0055538_1000322
1648 Ga0055541_1003007
1649 Ga0055541_1007684
1650 Ga0065714_10004129
1651 Ga0065704_10000326
1652 Ga0065712_10075748
1653 Ga0065707_10081772
1654 Ga0070658_10000029
1655 Ga0070658_10015513
1656 Ga0070658_10019049
1657 Ga0070658_10035022
1658 Ga0070658_10046977
1659 Ga0070658_10050553
1660 Ga0070658_10056234
1661 Ga0070658_10093432
1662 Ga0070658_10134521
1663 Ga0070658_10136067
1664 Ga0070658_10168122
1665 Ga0070676_10013130
1666 Ga0070676_10048337
1667 Ga0070676_10095230
1668 Ga0070676_10103857
1669 Ga0070683_100000209
1670 Ga0070683_100054521
1671 Ga0070690_100000015
1672 Ga0070690_100012081
1673 Ga0070670_100000265
1674 Ga0070670_100000333
1675 Ga0070670_100010774
1676 Ga0070670_100011548
1677 Ga0070670_100014114
1678 Ga0070670_100056692
1679 Ga0070670_100066739
1680 Ga0070670_100098713
1681 Ga0070670_100116628
1682 Ga0070670_100201606
1683 Ga0070677_10044276
1684 Ga0068869_100000331
1685 Ga0070666_10000059
1686 Ga0070666_10000822
1687 Ga0070666_10000924
1688 Ga0070666_10001749
1689 Ga0070666_10026371
1690 Ga0070666_10026417
1691 Ga0070666_10056586
1692 Ga0070666_10090125
1693 Ga0070680_100001008
1694 Ga0070680_100001026
1695 Ga0070680_100013601
1696 Ga0070680_100041386
1697 Ga0070680_100123252
1698 Ga0070680_100208480
1699 Ga0070682_100000911
1700 Ga0070682_100006572
1701 Ga0070682_100056759
1702 Ga0070682_100132525
1703 Ga0068868_100000156
1704 Ga0068868_100002559
1705 Ga0068868_100044269
1706 Ga0068868_100124156
1707 Ga0070660_100002984
1708 Ga0070660_100002991
1709 Ga0070660_100004528
1710 Ga0070660_100011417
1711 Ga0070660_100012339
1712 Ga0070660_100018362
1713 Ga0070660_100019062
1714 Ga0070660_100026651
1715 Ga0070660_100034110
1716 Ga0070660_100046442
1717 Ga0070660_100068479
1718 Ga0070660_100071425
1719 Ga0070660_100075563
1720 Ga0070660_100082431
1721 Ga0070660_100108282
1722 Ga0070660_100185182
1723 Ga0070660_100245582
1724 Ga0070691_10004057
1725 Ga0070691_10043237
1726 Ga0070661_100000055
1727 Ga0070661_100000452
1728 Ga0070661_100003453
1729 Ga0070661_100005269
1730 Ga0070661_100007519
1731 Ga0070661_100032834
1732 Ga0070661_100041781
1733 Ga0070661_100060605
1734 Ga0070661_100067281
1735 Ga0070661_100072538
1736 Ga0070661_100091640
1737 Ga0070661_100107098
1738 Ga0070661_100142069
1739 Ga0070692_10001859
1740 Ga0070692_10003716
1741 Ga0070692_10006583
1742 Ga0070692_10011780
1743 Ga0070692_10016014
1744 Ga0070692_10027252
1745 Ga0070692_10028647
1746 Ga0070668_100000208
1747 Ga0070668_100000591
1748 Ga0070668_100007660
1749 Ga0070668_100036966
1750 Ga0070668_100116817
1751 Ga0070669_100000014
1752 Ga0070669_100000018
1753 Ga0070669_100000383
1754 Ga0070669_100000547
1755 Ga0070669_100025265
1756 Ga0070669_100037421
1757 Ga0070669_100165980
1758 Ga0070675_100025854
1759 Ga0070675_100051525
1760 Ga0070675_100147595
1761 Ga0070675_100244746
1762 Ga0070671_100000011
1763 Ga0070671_100000138
1764 Ga0070671_100002540
1765 Ga0070671_100003224
1766 Ga0070671_100003249
1767 Ga0070671_100003781
1768 Ga0070671_100008552
1769 Ga0070671_100022349
1770 Ga0070671_100023574
1771 Ga0070671_100025830
1772 Ga0070671_100042370
1773 Ga0070671_100125996
1774 Ga0070671_100151273
1775 Ga0070674_100004496
1776 Ga0070674_100059472
1777 Ga0070673_100000249
1778 Ga0070673_100003351
1779 Ga0070673_100004608
1780 Ga0070673_100006422
1781 Ga0070673_100011717
1782 Ga0070673_100016074
1783 Ga0070673_100020978
1784 Ga0070673_100050456
1785 Ga0070673_100155268
1786 Ga0070673_100180969
1787 Ga0070688_100001575
1788 Ga0070659_100000138
1789 Ga0070659_100000814
1790 Ga0070659_100001062
1791 Ga0070659_100001635
1792 Ga0070659_100003157
1793 Ga0070659_100043899
1794 Ga0070659_100064535
1795 Ga0070659_100085565
1796 Ga0070659_100104108
1797 Ga0070659_100135631
1798 Ga0070667_100001760
1799 Ga0070667_100001996
1800 Ga0070667_100003528
1801 Ga0070667_100005828
1802 Ga0070667_100006388
1803 Ga0070667_100014945
1804 Ga0070667_100026953
1805 Ga0070667_100035104
1806 Ga0070667_100059501
1807 Ga0070667_100061428
1808 Ga0070667_100080608
1809 Ga0070667_100089958
1810 Ga0070667_100097262
1811 Ga0070667_100235258
1812 Ga0070714_100139803
1813 Ga0070714_100267670
1814 Ga0070714_100318743
1815 Ga0070713_100005721
1816 Ga0070713_100033460
1817 Ga0070713_100139352
1818 Ga0070710_10016872
1819 Ga0070705_100016857
1820 Ga0070694_100003977
1821 Ga0070694_100018841
1822 Ga0070708_100019568
1823 Ga0070663_100001943
1824 Ga0070663_100005160
1825 Ga0070663_100009792
1826 Ga0070663_100015781
1827 Ga0070663_100070917
1828 Ga0070663_100085961
1829 Ga0070663_100111925
1830 Ga0070663_100163391
1831 Ga0070678_100002527
1832 Ga0070678_100040203
1833 Ga0070662_100000410
1834 Ga0070662_100001186
1835 Ga0070662_100001575
1836 Ga0070662_100005039
1837 Ga0070662_100017550
1838 Ga0070662_100034654
1839 Ga0070662_100167063
1840 Ga0070662_100215002
1841 Ga0070681_10001014
1842 Ga0070681_10010375
1843 Ga0070681_10102557
1844 Ga0070681_10124855
1845 Ga0068867_100007188
1846 Ga0068867_100014158
1847 Ga0068867_100028424
1848 Ga0070685_10000034
1849 Ga0070706_100000486
1850 Ga0070706_100061886
1851 Ga0070698_100027244
1852 Ga0070698_100215516
1853 Ga0070699_100215973
1854 Ga0070679_100000027
1855 Ga0070679_100016295
1856 Ga0070679_100035208
1857 Ga0070679_100037121
1858 Ga0070679_100072968
1859 Ga0070684_100004466
1860 Ga0070697_100155128
1861 Ga0068853_100000479
1862 Ga0068853_100001793
1863 Ga0068853_100015391
1864 Ga0068853_100015680
1865 Ga0068853_100023329
1866 Ga0068853_100027977
1867 Ga0068853_100099081
1868 Ga0068853_100166964
1869 Ga0068853_100267374
1870 Ga0070672_100006526
1871 Ga0070672_100016187
1872 Ga0070672_100055472
1873 Ga0070672_100077915
1874 Ga0070672_100129659
1875 Ga0070672_100216691
1876 Ga0070686_100000023
1877 Ga0070695_100116778
1878 Ga0070696_100006403
1879 Ga0070693_100019343
1880 Ga0070693_100088625
1881 Ga0070693_100112654
1882 Ga0070665_100000019
1883 Ga0070665_100011777
1884 Ga0070665_100014723
1885 Ga0070665_100016127
1886 Ga0070665_100046267
1887 Ga0070665_100063123
1888 Ga0070665_100065942
1889 Ga0070665_100068081
1890 Ga0070665_100153459
1891 Ga0070665_100168006
1892 Ga0070665_100205763
1893 Ga0070665_100344960
1894 Ga0068855_100000163
1895 Ga0068855_100004220
1896 Ga0068855_100014035
1897 Ga0068855_100017460
1898 Ga0068855_100035645
1899 Ga0068855_100058082
1900 Ga0068855_100133095
1901 Ga0068855_100154414
1902 Ga0068855_100449656
1903 Ga0068855_100472127
1904 Ga0070664_100000544
1905 Ga0070664_100001299
1906 Ga0070664_100002185
1907 Ga0070664_100009697
1908 Ga0070664_100013307
1909 Ga0070664_100014974
1910 Ga0070664_100025960
1911 Ga0070664_100026091
1912 Ga0070664_100062360
1913 Ga0070664_100069993
1914 Ga0070664_100152282
1915 Ga0068857_100000282
1916 Ga0068857_100002754
1917 Ga0068857_100002765
1918 Ga0068857_100010471
1919 Ga0068857_100017928
1920 Ga0068857_100027407
1921 Ga0068857_100055403
1922 Ga0068857_100081064
1923 Ga0068854_100001188
1924 Ga0068854_100001438
1925 Ga0068854_100004579
1926 Ga0068854_100005135
1927 Ga0068854_100007835
1928 Ga0068854_100034460
1929 Ga0068854_100039635
1930 Ga0068854_100052257
1931 Ga0068854_100057710
1932 Ga0068856_100000829
1933 Ga0068856_100008781
1934 Ga0068856_100015666
1935 Ga0068856_100258308
1936 Ga0068852_100001212
1937 Ga0068852_100005039
1938 Ga0068852_100022025
1939 Ga0068852_100042999
1940 Ga0068852_100045754
1941 Ga0068852_100114387
1942 Ga0068852_100120257
1943 Ga0068852_100204035
1944 Ga0068852_100235157
1945 Ga0068859_100003915
1946 Ga0068859_100005794
1947 Ga0068859_100023456
1948 Ga0068859_100036132
1949 Ga0068859_100046411
1950 Ga0068859_100093009
1951 Ga0068859_100134443
1952 Ga0068859_100140264
1953 Ga0068859_100206557
1954 Ga0068859_100424013
1955 Ga0068864_100000173
1956 Ga0068864_100001720
1957 Ga0068864_100006305
1958 Ga0068864_100006342
1959 Ga0068864_100006905
1960 Ga0068864_100012818
1961 Ga0068864_100031578
1962 Ga0068864_100077173
1963 Ga0068864_100114965
1964 Ga0068864_100230990
1965 Ga0068866_10009444
1966 Ga0068861_100002173
1967 Ga0068861_100002954
1968 Ga0068861_100327675
1969 Ga0068851_10013555
1970 Ga0068851_10019101
1971 Ga0068851_10020603
1972 Ga0068851_10098791
1973 Ga0068863_100000044
1974 Ga0068863_100000131
1975 Ga0068863_100000816
1976 Ga0068863_100000921
1977 Ga0068863_100003770
1978 Ga0068863_100010883
1979 Ga0068863_100055996
1980 Ga0068863_100056031
1981 Ga0068863_100093128
1982 Ga0068863_100098332
1983 Ga0068858_100001349
1984 Ga0068858_100002655
1985 Ga0068858_100003690
1986 Ga0068858_100003884
1987 Ga0068858_100005521
1988 Ga0068858_100009461
1989 Ga0068858_100017613
1990 Ga0068858_100045120
1991 Ga0068858_100048457
1992 Ga0068858_100060194
1993 Ga0068858_100069382
1994 Ga0068858_100104431
1995 Ga0068858_100118044
1996 Ga0068860_100000229
1997 Ga0068860_100001926
1998 Ga0068860_100003370
1999 Ga0068860_100006472
2000 Ga0068860_100009386
2001 Ga0068860_100014106
2002 Ga0068860_100017319
2003 Ga0068860_100042596
2004 Ga0068860_100056062
2005 Ga0068860_100189540
2006 Ga0068860_100228587
2007 Ga0068860_100411876
2008 Ga0068862_100000097
2009 Ga0068862_100001102
2010 Ga0068862_100001850
2011 Ga0068862_100022798
2012 Ga0068862_100038167
2013 Ga0068862_100039098
2014 Ga0068862_100048277
2015 Ga0068862_100052452
2016 Ga0068862_100072551
2017 Ga0068862_100177959
2018 Ga0068862_100374489
2019 Ga0081455_10000675
2020 Ga0081539_10004604
2021 Ga0081539_10005951
2022 Ga0081539_10040287
2023 Ga0070717_10123685
2024 Ga0070712_100022944
2025 Ga0097621_100002177
2026 Ga0097621_100161811
2027 Ga0097621_100280209
2028 Ga0068871_100012935
2029 Ga0068871_100027524
2030 Ga0068871_100150555
2031 Ga0068871_100192329
2032 Ga0075428_100301389
2033 Ga0075428_100522712
2034 Ga0075431_100007044
2035 Ga0068865_100016371
2036 Ga0068865_100016787
2037 Ga0068865_100035927
2038 Ga0075436_100267541
2039 Ga0097620_100003915
2040 Ga0097620_100005794
2041 Ga0097620_100023456
2042 Ga0097620_100036130
2043 Ga0097620_100046410
2044 Ga0097620_100093006
2045 Ga0097620_100134449
2046 Ga0097620_100140269
2047 Ga0097620_100206567
2048 Ga0097620_100423982
2049 Ga0099795_10000020
2050 Ga0099795_10000692
2051 Ga0105240_10000022
2052 Ga0105240_10000078
2053 Ga0105240_10007481
2054 Ga0105240_10010752
2055 Ga0105240_10020736
2056 Ga0105240_10056203
2057 Ga0105240_10065379
2058 Ga0105240_10134814
2059 Ga0105240_10148929
2060 Ga0105240_10430218
2061 Ga0111539_10006409
2062 Ga0111539_10008489
2063 Ga0111539_10225985
2064 Ga0111539_10311352
2065 Ga0111539_10364437
2066 Ga0105245_10000326
2067 Ga0105245_10024639
2068 Ga0105245_10166850
2069 Ga0105245_10291403
2070 Ga0105247_10000542
2071 Ga0105247_10009282
2072 Ga0105247_10020569
2073 Ga0114129_10535955
2074 Ga0105243_10039135
2075 Ga0105243_10095518
2076 Ga0105243_10097864
2077 Ga0105241_10086910
2078 Ga0105242_10007725
2079 Ga0105242_10023363
2080 Ga0105248_10000123
2081 Ga0105248_10000159
2082 Ga0105248_10000516
2083 Ga0105248_10002100
2084 Ga0105248_10003349
2085 Ga0105248_10005569
2086 Ga0105248_10024334
2087 Ga0105248_10027345
2088 Ga0105248_10027972
2089 Ga0105248_10047942
2090 Ga0105248_10059878
2091 Ga0105248_10088061
2092 Ga0105248_10092200
2093 Ga0105248_10094165
2094 Ga0105248_10099492
2095 Ga0105248_10120666
2096 Ga0105237_10000135
2097 Ga0105237_10004469
2098 Ga0105237_10004941
2099 Ga0105237_10007089
2100 Ga0105237_10009195
2101 Ga0105237_10097071
2102 Ga0105237_10132866
2103 Ga0105237_10336500
2104 Ga0105238_10011703
2105 Ga0105238_10013560
2106 Ga0105238_10066511
2107 Ga0105238_10080446
2108 Ga0105238_10158169
2109 Ga0105238_10187212
2110 Ga0105249_10000153
2111 Ga0105249_10016978
2112 Ga0105249_10020199
2113 Ga0105249_10029974
2114 Ga0105249_10053810
2115 Ga0105249_10090407
2116 Ga0105249_10416107
2117 Ga0099796_10000070
2118 Ga0099796_10000802
2119 Ga0105239_10000524
2120 Ga0105239_10007408
2121 Ga0105239_10054164
2122 Ga0105239_10056053
2123 Ga0105239_10159582
2124 Ga0105239_10162157
2125 Ga0105246_10043877
2126 Ga0105246_10175373
2127 Ga0157373_10003162
2128 Ga0157373_10036632
2129 Ga0157373_10041283
2130 Ga0157373_10052037
2131 Ga0157373_10069239
2132 Ga0157371_10000784
2133 Ga0157371_10016692
2134 Ga0157370_10025359
2135 Ga0157370_10124617
2136 Ga0157369_10001983
2137 Ga0157369_10014639
2138 Ga0157369_10015070
2139 Ga0157369_10092231
2140 Ga0157369_10133424
2141 Ga0157369_10291505
2142 Ga0157369_10306261
2143 Ga0157374_10017801
2144 Ga0157374_10024724
2145 Ga0157374_10071031
2146 Ga0157374_10100360
2147 Ga0157378_10054398
2148 Ga0157378_10057561
2149 Ga0157378_10135898
2150 Ga0163162_10000839
2151 Ga0163162_10001101
2152 Ga0163162_10005580
2153 Ga0163162_10015905
2154 Ga0163162_10024415
2155 Ga0163162_10035863
2156 Ga0163162_10099221
2157 Ga0163162_10218967
2158 Ga0157372_10008989
2159 Ga0157372_10031832
2160 Ga0157372_10063213
2161 Ga0157372_10129234
2162 Ga0157372_10210723
2163 Ga0157372_10462526
2164 Ga0157372_10518107
2165 Ga0157375_10003764
2166 Ga0157375_10030040
2167 Ga0157375_10070892
2168 Ga0163163_10006126
2169 Ga0163163_10090908
2170 Ga0163163_10094372
2171 Ga0163163_10128307
2172 Ga0157380_10000123
2173 Ga0157380_10000671
2174 Ga0182008_10015296
2175 Ga0182008_10020642
2176 Ga0157379_10000867
2177 Ga0157379_10001552
2178 Ga0157379_10002249
2179 Ga0157379_10014455
2180 Ga0157379_10141285
2181 Ga0157379_10158189
2182 Ga0157379_10230079
2183 Ga0157376_10144587
2184 Ga0157376_10443936
2185 Ga0182006_1008348
2186 Ga0163161_10000096
2187 Ga0163161_10004455
2188 Ga0206356_10423425
2189 Ga0206356_11302048
2190 Ga0206353_10148542
2191 Ga0213873_10000006
2192 Ga0213872_10003007
2193 Ga0213876_10000004
2194 Ga0213876_10001088
2195 Ga0213876_10001093
2196 Ga0213876_10012133
2197 Ga0213876_10081864
2198 Ga0213875_10000061
2199 Ga0213875_10000398
2200 Ga0213875_10002425
2201 Ga0213875_10010098
2202 Ga0213875_10012927
2203 Ga0224712_10003352
2204 Ga0209784_100335
2205 Ga0209566_100046
2206 Ga0209566_100166
2207 Ga0209674_100975
2208 Ga0209026_1000050
2209 Ga0209026_1000214
2210 Ga0209026_1001506
2211 Ga0209759_1000229
2212 Ga0209759_1007916
2213 Ga0209233_1000003
2214 Ga0209676_1001179
2215 Ga0209025_1012628
2216 Ga0209025_1033697
2217 Ga0209257_1000245
2218 Ga0207697_10000219
2219 Ga0207697_10000584
2220 Ga0207656_10006275
2221 Ga0207656_10010407
2222 Ga0207656_10029709
2223 Ga0207656_10082146
2224 Ga0207682_10002744
2225 Ga0207682_10033762
2226 Ga0207642_10004027
2227 Ga0207710_10001754
2228 Ga0207710_10011152
2229 Ga0207688_10001613
2230 Ga0207688_10007152
2231 Ga0207680_10000020
2232 Ga0207680_10000027
2233 Ga0207680_10001404
2234 Ga0207680_10003774
2235 Ga0207680_10010476
2236 Ga0207680_10013386
2237 Ga0207680_10026060
2238 Ga0207680_10074110
2239 Ga0207647_10000575
2240 Ga0207647_10002145
2241 Ga0207647_10007590
2242 Ga0207647_10019789
2243 Ga0207647_10032408
2244 Ga0207647_10071623
2245 Ga0207647_10092157
2246 Ga0207699_10024944
2247 Ga0207645_10001233
2248 Ga0207645_10023613
2249 Ga0207645_10085526
2250 Ga0207705_10000002
2251 Ga0207705_10000260
2252 Ga0207705_10000673
2253 Ga0207705_10004275
2254 Ga0207705_10005171
2255 Ga0207705_10006422
2256 Ga0207705_10007630
2257 Ga0207705_10016552
2258 Ga0207705_10016829
2259 Ga0207705_10019940
2260 Ga0207705_10024723
2261 Ga0207705_10040672
2262 Ga0207705_10042478
2263 Ga0207705_10043677
2264 Ga0207705_10061232
2265 Ga0207705_10067128
2266 Ga0207705_10068045
2267 Ga0207705_10097094
2268 Ga0207705_10121203
2269 Ga0207705_10153453
2270 Ga0207705_10153878
2271 Ga0207684_10000732
2272 Ga0207684_10100166
2273 Ga0207654_10000540
2274 Ga0207707_10004278
2275 Ga0207707_10033033
2276 Ga0207695_10000022
2277 Ga0207695_10000064
2278 Ga0207695_10029739
2279 Ga0207695_10042320
2280 Ga0207695_10052908
2281 Ga0207695_10118832
2282 Ga0207695_10247946
2283 Ga0207671_10000089
2284 Ga0207671_10005075
2285 Ga0207671_10005664
2286 Ga0207671_10016587
2287 Ga0207671_10028364
2288 Ga0207671_10030779
2289 Ga0207671_10033487
2290 Ga0207693_10053329
2291 Ga0207693_10060938
2292 Ga0207660_10000787
2293 Ga0207660_10001023
2294 Ga0207660_10007267
2295 Ga0207660_10137346
2296 Ga0207657_10000031
2297 Ga0207657_10000267
2298 Ga0207657_10000625
2299 Ga0207657_10002051
2300 Ga0207657_10003334
2301 Ga0207657_10003748
2302 Ga0207657_10003760
2303 Ga0207657_10006383
2304 Ga0207657_10006861
2305 Ga0207657_10007939
2306 Ga0207657_10018947
2307 Ga0207657_10052752
2308 Ga0207657_10060914
2309 Ga0207657_10070000
2310 Ga0207657_10094032
2311 Ga0207657_10105581
2312 Ga0207657_10108643
2313 Ga0207657_10134143
2314 Ga0207657_10172243
2315 Ga0207649_10000103
2316 Ga0207649_10000394
2317 Ga0207649_10008644
2318 Ga0207649_10009140
2319 Ga0207649_10012162
2320 Ga0207649_10027244
2321 Ga0207652_10000001
2322 Ga0207652_10014570
2323 Ga0207652_10017973
2324 Ga0207652_10053697
2325 Ga0207652_10090491
2326 Ga0207652_10108075
2327 Ga0207652_10126353
2328 Ga0207681_10000008
2329 Ga0207681_10000082
2330 Ga0207681_10000528
2331 Ga0207681_10001333
2332 Ga0207681_10004527
2333 Ga0207681_10029309
2334 Ga0207694_10003458
2335 Ga0207694_10014139
2336 Ga0207694_10071498
2337 Ga0207694_10208302
2338 Ga0207650_10001366
2339 Ga0207650_10007278
2340 Ga0207650_10008924
2341 Ga0207650_10040021
2342 Ga0207650_10068709
2343 Ga0207650_10088225
2344 Ga0207650_10122566
2345 Ga0207650_10206569
2346 Ga0207659_10007983
2347 Ga0207659_10034085
2348 Ga0207687_10002526
2349 Ga0207687_10143672
2350 Ga0207700_10028720
2351 Ga0207700_10074976
2352 Ga0207664_10000041
2353 Ga0207664_10021648
2354 Ga0207644_10000005
2355 Ga0207644_10000006
2356 Ga0207644_10000153
2357 Ga0207644_10000220
2358 Ga0207644_10000593
2359 Ga0207644_10000941
2360 Ga0207644_10002867
2361 Ga0207644_10004200
2362 Ga0207644_10018705
2363 Ga0207644_10040253
2364 Ga0207644_10250097
2365 Ga0207690_10000382
2366 Ga0207690_10002417
2367 Ga0207690_10003206
2368 Ga0207690_10003550
2369 Ga0207690_10016632
2370 Ga0207690_10035870
2371 Ga0207690_10051785
2372 Ga0207690_10067190
2373 Ga0207690_10135662
2374 Ga0207690_10138240
2375 Ga0207706_10000028
2376 Ga0207706_10000171
2377 Ga0207706_10000285
2378 Ga0207706_10000475
2379 Ga0207706_10004574
2380 Ga0207706_10005076
2381 Ga0207706_10006857
2382 Ga0207706_10010395
2383 Ga0207706_10023541
2384 Ga0207706_10027086
2385 Ga0207706_10040257
2386 Ga0207706_10062849
2387 Ga0207706_10064292
2388 Ga0207706_10169145
2389 Ga0207706_10237757
2390 Ga0207706_10268345
2391 Ga0207709_10118340
2392 Ga0207670_10101115
2393 Ga0207669_10025408
2394 Ga0207669_10030752
2395 Ga0207704_10033427
2396 Ga0207704_10068058
2397 Ga0207704_10152191
2398 Ga0207665_10023959
2399 Ga0207691_10003885
2400 Ga0207691_10004037
2401 Ga0207691_10007857
2402 Ga0207691_10013013
2403 Ga0207691_10073175
2404 Ga0207691_10127774
2405 Ga0207691_10230668
2406 Ga0207691_10307923
2407 Ga0207711_10000100
2408 Ga0207711_10000500
2409 Ga0207711_10001375
2410 Ga0207711_10001810
2411 Ga0207711_10002836
2412 Ga0207711_10005966
2413 Ga0207711_10006042
2414 Ga0207711_10009820
2415 Ga0207711_10014697
2416 Ga0207711_10017324
2417 Ga0207711_10044099
2418 Ga0207711_10048152
2419 Ga0207711_10048787
2420 Ga0207711_10049600
2421 Ga0207711_10101010
2422 Ga0207711_10353204
2423 Ga0207689_10000092
2424 Ga0207689_10023842
2425 Ga0207661_10003597
2426 Ga0207661_10107187
2427 Ga0207679_10000129
2428 Ga0207679_10004617
2429 Ga0207679_10007146
2430 Ga0207679_10007159
2431 Ga0207679_10045221
2432 Ga0207679_10301087
2433 Ga0207667_10000357
2434 Ga0207667_10007813
2435 Ga0207667_10019487
2436 Ga0207667_10020146
2437 Ga0207667_10025870
2438 Ga0207667_10039064
2439 Ga0207667_10042463
2440 Ga0207667_10123085
2441 Ga0207667_10130473
2442 Ga0207667_10238040
2443 Ga0207651_10000176
2444 Ga0207651_10006875
2445 Ga0207651_10009081
2446 Ga0207651_10009881
2447 Ga0207651_10014015
2448 Ga0207651_10167567
2449 Ga0207651_10275756
2450 Ga0207712_10000115
2451 Ga0207712_10000269
2452 Ga0207712_10001847
2453 Ga0207712_10059784
2454 Ga0207712_10136770
2455 Ga0207712_10218852
2456 Ga0207668_10000080
2457 Ga0207668_10000293
2458 Ga0207668_10002630
2459 Ga0207668_10033158
2460 Ga0207668_10089910
2461 Ga0207668_10195295
2462 Ga0207640_10000922
2463 Ga0207640_10001385
2464 Ga0207640_10036504
2465 Ga0207640_10050441
2466 Ga0207640_10081024
2467 Ga0207658_10002645
2468 Ga0207658_10003348
2469 Ga0207658_10006798
2470 Ga0207658_10007421
2471 Ga0207658_10010339
2472 Ga0207658_10014800
2473 Ga0207658_10015585
2474 Ga0207658_10016561
2475 Ga0207658_10020445
2476 Ga0207658_10028031
2477 Ga0207658_10037108
2478 Ga0207658_10175015
2479 Ga0207677_10001622
2480 Ga0207677_10007300
2481 Ga0207677_10008848
2482 Ga0207677_10079597
2483 Ga0207703_10000515
2484 Ga0207703_10001781
2485 Ga0207703_10001798
2486 Ga0207703_10002682
2487 Ga0207703_10003524
2488 Ga0207703_10004783
2489 Ga0207703_10004802
2490 Ga0207703_10009105
2491 Ga0207703_10016679
2492 Ga0207703_10067108
2493 Ga0207703_10096257
2494 Ga0207703_10148827
2495 Ga0207639_10000131
2496 Ga0207639_10005418
2497 Ga0207639_10005686
2498 Ga0207639_10042457
2499 Ga0207639_10072666
2500 Ga0207639_10084269
2501 Ga0207678_10000198
2502 Ga0207678_10000740
2503 Ga0207678_10004259
2504 Ga0207678_10005020
2505 Ga0207678_10005050
2506 Ga0207678_10015898
2507 Ga0207678_10026121
2508 Ga0207678_10057378
2509 Ga0207678_10072445
2510 Ga0207678_10155377
2511 Ga0207678_10188928
2512 Ga0207702_10000247
2513 Ga0207702_10004072
2514 Ga0207702_10011956
2515 Ga0207702_10127922
2516 Ga0207702_10140116
2517 Ga0207702_10159744
2518 Ga0207702_10197262
2519 Ga0207702_10254257
2520 Ga0207702_10344167
2521 Ga0207641_10000004
2522 Ga0207641_10000073
2523 Ga0207641_10000221
2524 Ga0207641_10001038
2525 Ga0207641_10002527
2526 Ga0207641_10005042
2527 Ga0207641_10005367
2528 Ga0207641_10013846
2529 Ga0207641_10030273
2530 Ga0207641_10030321
2531 Ga0207641_10031905
2532 Ga0207641_10037367
2533 Ga0207648_10006196
2534 Ga0207648_10008887
2535 Ga0207648_10034392
2536 Ga0207648_10036146
2537 Ga0207648_10138313
2538 Ga0207676_10002026
2539 Ga0207676_10002161
2540 Ga0207676_10003162
2541 Ga0207676_10004385
2542 Ga0207676_10017908
2543 Ga0207676_10034087
2544 Ga0207676_10086231
2545 Ga0207674_10000289
2546 Ga0207674_10002023
2547 Ga0207674_10002652
2548 Ga0207674_10006972
2549 Ga0207674_10008981
2550 Ga0207674_10012168
2551 Ga0207674_10014969
2552 Ga0207674_10016447
2553 Ga0207674_10018937
2554 Ga0207674_10025465
2555 Ga0207674_10086035
2556 Ga0207674_10109608
2557 Ga0207675_100000135
2558 Ga0207675_100000172
2559 Ga0207675_100069152
2560 Ga0207683_10032416
2561 Ga0207683_10043045
2562 Ga0207683_10073999
2563 Ga0207683_10191977
2564 Ga0207683_10213962
2565 Ga0207698_10000944
2566 Ga0207698_10001888
2567 Ga0207698_10015158
2568 Ga0207698_10015356
2569 Ga0207698_10016046
2570 Ga0207698_10018337
2571 Ga0207698_10047184
2572 Ga0207698_10063200
2573 Ga0207698_10091820
2574 Ga0209179_1000001
2575 Ga0209974_10002244
2576 Ga0207428_10090158
2577 Ga0268266_10000025
2578 Ga0268266_10000433
2579 Ga0268266_10003150
2580 Ga0268266_10012368
2581 Ga0268266_10016623
2582 Ga0268266_10018141
2583 Ga0268266_10029989
2584 Ga0268266_10031756
2585 Ga0268266_10047737
2586 Ga0268266_10069687
2587 Ga0268266_10107736
2588 Ga0268266_10149854
2589 Ga0268266_10163828
2590 Ga0268266_10293443
2591 Ga0268265_10000064
2592 Ga0268265_10000107
2593 Ga0268265_10020623
2594 Ga0268265_10027327
2595 Ga0268265_10038539
2596 Ga0268265_10055694
2597 Ga0268265_10204665
2598 Ga0268265_10276386
2599 Ga0268264_10000010
2600 Ga0268264_10000278
2601 Ga0268264_10000567
2602 Ga0268264_10002045
2603 Ga0268264_10002177
2604 Ga0268264_10005259
2605 Ga0268264_10006022
2606 Ga0268264_10019845
2607 Ga0268264_10022226
2608 Ga0268264_10053564
2609 Ga0268264_10066545
2610 Ga0268264_10105302
2611 Ga0268264_10143582
2612 Ga0268264_10281275
2613 Ga0265319_1012169
2614 Ga0265318_10011502
2615 Ga0307515_10000027
2616 Ga0307515_10039280
2617 Ga0307515_10205377
2618 Ga0265324_10041286
2619 Ga0316177_1100564
2620 Ga0316182_1189875
2621 Ga0316182_1433154
2622 Ga0265320_10015009
2623 Ga0265327_10022856
2624 Ga0307513_10000001
2625 Ga0307509_10000002
2626 Ga0307408_100002898
2627 Ga0307408_100002967
2628 Ga0307408_100012582
2629 Ga0307408_100015521
2630 Ga0307408_100029940
2631 Ga0307408_100048260
2632 Ga0307408_100188248
2633 Ga0307508_10002405
2634 Ga0307516_10001732
2635 Ga0307405_10001334
2636 Ga0307405_10005492
2637 Ga0307405_10011011
2638 Ga0307405_10012904
2639 Ga0307405_10016071
2640 Ga0307405_10016186
2641 Ga0307405_10034756
2642 Ga0307405_10090788
2643 Ga0307413_10000144
2644 Ga0307413_10000917
2645 Ga0307413_10005133
2646 Ga0307413_10034618
2647 Ga0307413_10114955
2648 Ga0307413_10115966
2649 Ga0307413_10119379
2650 Ga0307410_10009720
2651 Ga0307410_10010793
2652 Ga0307410_10012347
2653 Ga0307410_10014542
2654 Ga0307410_10015716
2655 Ga0307410_10041040
2656 Ga0307410_10057891
2657 Ga0307410_10094198
2658 Ga0307410_10173421
2659 Ga0307406_10000061
2660 Ga0307406_10000444
2661 Ga0307406_10005150
2662 Ga0307406_10008769
2663 Ga0307406_10022911
2664 Ga0307406_10058341
2665 Ga0307406_10126422
2666 Ga0307407_10006018
2667 Ga0307407_10006801
2668 Ga0307407_10007023
2669 Ga0307407_10007706
2670 Ga0307407_10025564
2671 Ga0307407_10068031
2672 Ga0307407_10076812
2673 Ga0307407_10110060
2674 Ga0307407_10112357
2675 Ga0307407_10113471
2676 Ga0307407_10136476
2677 Ga0307412_10000004
2678 Ga0307412_10016666
2679 Ga0307412_10028016
2680 Ga0307412_10029004
2681 Ga0307412_10034105
2682 Ga0307412_10045681
2683 Ga0307412_10061860
2684 Ga0307412_10078776
2685 Ga0307412_10183444
2686 Ga0307409_100000049
2687 Ga0307409_100001231
2688 Ga0307409_100006386
2689 Ga0307409_100010794
2690 Ga0307409_100015511
2691 Ga0307409_100034116
2692 Ga0307409_100061997
2693 Ga0307409_100094881
2694 Ga0307409_100116482
2695 Ga0307409_100118363
2696 Ga0307409_100120849
2697 Ga0307409_100196347
2698 Ga0307409_100220149
2699 Ga0307409_100314232
2700 Ga0307409_100340461
2701 Ga0307416_100000186
2702 Ga0307416_100006793
2703 Ga0307416_100019803
2704 Ga0307416_100050457
2705 Ga0307416_100068874
2706 Ga0307416_100069177
2707 Ga0307416_100071508
2708 Ga0307416_100072245
2709 Ga0307416_100092662
2710 Ga0307416_100099156
2711 Ga0307416_100112469
2712 Ga0307416_100149906
2713 Ga0307416_100203850
2714 Ga0307416_100276184
2715 Ga0307414_10000735
2716 Ga0307414_10001265
2717 Ga0307414_10001794
2718 Ga0307414_10003339
2719 Ga0307414_10005567
2720 Ga0307414_10032847
2721 Ga0307414_10033122
2722 Ga0307414_10074773
2723 Ga0307414_10169784
2724 Ga0307414_10176017
2725 Ga0307414_10358068
2726 Ga0307411_10000702
2727 Ga0307411_10002909
2728 Ga0307411_10007368
2729 Ga0307411_10012009
2730 Ga0307411_10013476
2731 Ga0307411_10015098
2732 Ga0307411_10030014
2733 Ga0307411_10067594
2734 Ga0307411_10073382
2735 Ga0307411_10088051
2736 Ga0307411_10109607
2737 Ga0307411_10129419
2738 Ga0307411_10150533
2739 Ga0307411_10179750
2740 Ga0307411_10195169
2741 Ga0307415_100000244
2742 Ga0307415_100003494
2743 Ga0307415_100007694
2744 Ga0307415_100009878
2745 Ga0307415_100020451
2746 Ga0307415_100026196
2747 Ga0307415_100045062
2748 Ga0307415_100045109
2749 Ga0307415_100090284
2750 Ga0307415_100091220
2751 Ga0307415_100096547
2752 Ga0307415_100135320
2753 Ga0307415_100198478
2754 Ga0307415_100242435
2755 Ga0307507_10002651
2756 Ga0307510_10000003
2757 Ga0307510_10019979
2758 Ga0316212_1003469
2759 Ga0373950_0000001
2760 Ga0373950_0001111
2761 Ga0373934_0044959
2762 Ga0373941_0008202
2763 Ga0373943_0035022
2764 Ga0373955_0004423
2765 Ga0373942_0000076
2766 Ga0373962_0062408
2767 Ga0373935_0002341
2768 Ga0373927_0093474
2769 Ga0373933_0006446
2770 Ga0373947_0009709
2771 Ga0373937_0004086
2772 Ga0373925_0000053
2773 Ga0395899_0000588
2774 Ga0395899_0004324
2775 Ga0395899_0005357
2776 Ga0395899_0010317
2777 Ga0395899_0025601
2778 Ga0395899_0033919
2779 Ga0395899_0059202
2780 Ga0395899_0074408
2781 Ga0395899_0097235
2782 Ga0395899_0150288
2783 Ga0395899_0157944
2784 Ga0395900_0000447
2785 Ga0395900_0001237
2786 Ga0395900_0003293
2787 Ga0395900_0008912
2788 Ga0395900_0010430
2789 Ga0395900_0012370
2790 Ga0395900_0014134
2791 Ga0395900_0023784
2792 Ga0395900_0031449
2793 Ga0395900_0031981
2794 Ga0395900_0043530
2795 Ga0395900_0060690
2796 Ga0395900_0078347
2797 Ga0395900_0090264
2798 Ga0395900_0093241
2799 Ga0395900_0149452
2800 Ga0395900_0153780
2801 Ga0395900_0215182
2802 Ga0395898_0000978
2803 Ga0395898_0005900
2804 Ga0395898_0010805
2805 Ga0395898_0013212
2806 Ga0395898_0019019
2807 Ga0395898_0026042
2808 Ga0395898_0027768
2809 Ga0395898_0069451
2810 Ga0395898_0079598
2811 Ga0395898_0120402
2812 Ga0395898_0130858
2813 Ga0395898_0141896
2814 Ga0395905_0000104
2815 Ga0395905_0000974
2816 Ga0395905_0001255
2817 Ga0395905_0001886
2818 Ga0395905_0004314
2819 Ga0395905_0005211
2820 Ga0395905_0008284
2821 Ga0395905_0009884
2822 Ga0395905_0014108
2823 Ga0395905_0016029
2824 Ga0395905_0016902
2825 Ga0395905_0023848
2826 Ga0395905_0026200
2827 Ga0395905_0026869
2828 Ga0395905_0038225
2829 Ga0395905_0039669
2830 Ga0395905_0064932
2831 Ga0395905_0070210
2832 Ga0395905_0073786
2833 Ga0395905_0077640
2834 Ga0395905_0088810
2835 Ga0395905_0094324
2836 Ga0395905_0095012
2837 Ga0395905_0097272
2838 Ga0395905_0137704
2839 Ga0395905_0168475
2840 Ga0395905_0206485
2841 Ga0395905_0309360
2842 Ga0395905_0325408
2843 Ga0395905_0353352
2844 Ga0436364_0086296
2845 Ga0436364_0331782
2846 Ga0436364_0430514
2847 Ga0436364_0454096
2848 Ga0436364_0584120
2849 Ga0436364_1449597
2850 Ga0395901_0000276
2851 Ga0395901_0000324
2852 Ga0395901_0000702
2853 Ga0395901_0001229
2854 Ga0395901_0003633
2855 Ga0395901_0010013
2856 Ga0395901_0020870
2857 Ga0395901_0023392
2858 Ga0395901_0038736
2859 Ga0395901_0039030
2860 Ga0395901_0040045
2861 Ga0395901_0060689
2862 Ga0395901_0068820
2863 Ga0395901_0081320
2864 Ga0395901_0088892
2865 Ga0395901_0121313
2866 Ga0395901_0153861
2867 Ga0395901_0196084
2868 Ga0395901_0199360
2869 Ga0395901_0204822
2870 Ga0395901_0272156
2871 Ga0395901_0363701
2872 Ga0436365_0329501
2873 Ga0436365_0490562
2874 Ga0436365_0862833
2875 Ga0436365_1291448
2876 Ga0436365_1796505
2877 Ga0436365_1804902
2878 Ga0436360_1263027
2879 Ga0436361_0272150
2880 Ga0436361_0553665
2881 Ga0436361_0749976
2882 Ga0436363_1089207
2883 Ga0436363_1565021
2884 Ga0436362_0949954
2885 Ga0439465_0000100
2886 Ga0451853_1298320
2887 Ga0439445_0001968
2888 Ga0439445_0007987
2889 Ga0439432_002208
2890 Ga0439432_004034
2891 Ga0439449_0000021
2892 Ga0439463_008450
2893 Ga0450920_005478
2894 Ga0450889_000635
2895 Ga0439464_0000318
2896 Ga0466969_0002544
2897 Ga0466969_0003603
2898 Ga0466972_0066638
2899 Ga0466966_0000701
2900 Ga0466966_0016093
2901 Ga0466966_0100131
2902 Ga0466961_0003965
2903 Ga0466961_0043703
2904 Ga0466963_0009670
2905 Ga0466963_0051756
2906 Ga0466963_0169622
2907 Ga0466971_0003466
2908 Ga0466971_0018889
2909 Ga0466968_0016441
2910 Ga0466970_0021751
2911 Ga0466957_0076075
2912 Ga0466957_0106689
2913 Ga0466959_0000100
2914 Ga0466959_0003665
2915 Ga0466959_0215466
2916 Ga0466958_0015261
2917 Ga0466958_0048253
2918 Ga0466967_0119767
2919 Ga0466967_0132000
2920 Ga0466967_0136099
2921 Ga0466967_0162923
2922 Ga0466967_0282317
2923 Ga0466967_0308310
2924 Ga0466967_0385353
2925 Ga0495592_0051368
2926 Ga0495603_0002224
2927 Ga0495638_0004735
2928 Ga0495638_0071311
2929 Ga0495582_0008247
2930 Ga0495605_0006156
2931 Ga0495610_0001199
2932 Ga0495616_0020759
2933 Ga0495616_0025365
2934 Ga0495628_0038869
2935 Ga0495637_0060578
2936 Ga0495648_0076783
2937 Ga0495663_0000528
2938 Ga0495663_0000927
2939 Ga0495652_0060253
2940 Ga0495665_0005801
2941 Ga0495598_0002187
2942 Ga0495598_0010308
2943 Ga0495621_0000065
2944 Ga0495621_0000800
2945 Ga0495621_0014727
2946 Ga0495633_0002388
2947 Ga0495656_0112979
2948 Ga0495668_0000034
2949 Ga0495668_0000079
2950 Ga0495661_0006794
2951 Ga0495657_0000862
2952 Ga0495623_0024603
2953 Ga0495669_0002616
2954 Ga0495669_0004574
2955 Ga0495669_0006311
2956 Ga0495669_0006914
2957 Ga0495669_0064756
2958 Ga0495613_0001217
2959 Ga0495624_0158504
2960 Ga0495670_0000467
2961 Ga0495670_0023273
2962 Ga0495671_0005011
2963 Ga0495649_0025286
2964 Ga0495660_0004360
2965 Ga0495675_0012835
2966 Ga0495677_0003352
2967 Ga0495677_0005915
2968 Ga0495685_061071
2969 Ga0495686_0000164
2970 Ga0495686_0025665
2971 Ga0495686_0061585
2972 Ga0496100_0003792
2973 Ga0496100_0037167
2974 Ga0496101_0001530
2975 Ga0496101_0021951
2976 Ga0496101_0022269
2977 Ga0496101_0030191
2978 Ga0496101_0047686
2979 Ga0496101_0099624
2980 Ga0496102_0001739
2981 Ga0496102_0014406
2982 Ga0496102_0032814
2983 Ga0496102_0123882
2984 Ga0496102_0192597
2985 Ga0496102_0221408
2986 Ga0496103_0002913
2987 Ga0496103_0011702
2988 Ga0496103_0012986
2989 Ga0496103_0029807
2990 Ga0496103_0052039
2991 Ga0496104_0001296
2992 Ga0496104_0015717
2993 Ga0496104_0078080
2994 Ga0496104_0286449
2995 Ga0496105_0000695
2996 Ga0496105_0000932
2997 Ga0496105_0022358
2998 Ga0496105_0275116
2999 Ga0496106_0000685
3000 Ga0496106_0017079
3001 Ga0496106_0018321
3002 Ga0496106_0055678
3003 Ga0496106_0117567
3004 Ga0496107_0000057
3005 Ga0496107_0001610
3006 Ga0496107_0002088
3007 Ga0496107_0002535
3008 Ga0496107_0003034
3009 Ga0496107_0144163
3010 Ga0496107_0168901
3011 Ga0496107_0174638
3012 Ga0496108_0004255
3013 Ga0496108_0006866
3014 Ga0496108_0013082
3015 Ga0496108_0022113
3016 Ga0496108_0029034
3017 Ga0496108_0049189
3018 Ga0496108_0086212
3019 Ga0496109_0000521
3020 Ga0496109_0010536
3021 Ga0496109_0013067
3022 Ga0496109_0138588
3023 Ga0496110_0000847
3024 Ga0496110_0012913
3025 Ga0496110_0029506
3026 Ga0496110_0038466
3027 Ga0496110_0058135
3028 Ga0496110_0089550
3029 Ga0496110_0336969
3030 Ga0496111_0000782
3031 Ga0496111_0003138
3032 Ga0496111_0005026
3033 Ga0496111_0006263
3034 Ga0496111_0014601
3035 Ga0496111_0074700
3036 Ga0496112_0005760
3037 Ga0496112_0005909
3038 Ga0496112_0008648
3039 Ga0496112_0014514
3040 Ga0496112_0072844
3041 Ga0496112_0256623
3042 Ga0496113_0002271
3043 Ga0496113_0042465
3044 Ga0496113_0049295
3045 Ga0496113_0061068
3046 Ga0496113_0129310
3047 Ga0496114_0000109
3048 Ga0496114_0001315
3049 Ga0496114_0021294
3050 Ga0496114_0056792
3051 Ga0496115_0000691
3052 Ga0496115_0029126
3053 Ga0496115_0144925
3054 Ga0496116_0006891
3055 Ga0496117_0000316
3056 Ga0496117_0007881
3057 Ga0496118_0000003
3058 Ga0496118_0011358
3059 Ga0496118_0021325
3060 Ga0496118_0058208
3061 Ga0496119_0035935
3062 Ga0496120_0053834
3063 Ga0496121_0000078
3064 Ga0496121_0000293
3065 Ga0496121_0000520
3066 Ga0496121_0001591
3067 Ga0496121_0032025
3068 Ga0496121_0120858
3069 Ga0496123_0001205
3070 Ga0496125_0000743
3071 Ga0496125_0049656
3072 Ga0496126_0002855
3073 Ga0496126_0024757
3074 Ga0496126_0131367
3075 Ga0501344_00458
3076 Ga0501033_0003807
3077 Ga0501033_0164138
3078 Ga0501034_0001823
3079 Ga0501034_0032213
3080 Ga0501034_0058147
3081 Ga0501034_0066987
3082 Ga0501034_0078002
3083 Ga0501034_0112927
3084 Ga0501034_0206973
3085 Ga0501034_0274715
3086 Ga0501037_0052873
3087 Ga0501037_0098195
3088 Ga0501037_0137414
3089 Ga0501038_0072611
3090 Ga0501040_0001111
3091 Ga0501043_0015010
3092 Ga0501043_0048773
3093 Ga0501046_0059507
3094 Ga0501047_0000495
3095 Ga0501047_0031886
3096 Ga0501047_0051112
3097 Ga0501047_0065590
3098 Ga0501047_0162834
3099 Ga0501067_0000020
3100 Ga0501067_0035347
3101 Ga0501067_0036455
3102 Ga0501068_0007993
3103 Ga0501069_0059272
3104 Ga0501070_0196199
3105 Ga0501070_0226721
3106 Ga0501072_0110194
3107 Ga0501073_0000969
3108 Ga0501073_0002061
3109 Ga0501073_0034893
3110 Ga0501074_0028679
3111 Ga0501257_000008
3112 Ga0501225_0002546
3113 Ga0501080_0026026
3114 Ga0501080_0055953
3115 Ga0501080_0109957
3116 Ga0501080_0113436
3117 Ga0501080_0218200
3118 Ga0501083_0000016
3119 Ga0501083_0007007
3120 Ga0501083_0032268
3121 Ga0501241_003362
3122 Ga0501280_001017
3123 Ga0501035_0003147
3124 Ga0501035_0073610
3125 Ga0501035_0128836
3126 Ga0501044_0004599
3127 Ga0501044_0025812
3128 Ga0501044_0243772
3129 nmdc:mga00v17_40517_c1
3130 nmdc:mga06r32_4357_c1
3131 nmdc:mga08y16_309658_c1
3132 nmdc:mga08y16_5569_c1
3133 nmdc:mga08x19_112903_c1
3134 nmdc:mga0a205_54162_c1
3135 Ga0500610_0001905
3136 Ga0500643_001292
3137 Ga0500595_013270
3138 Ga0500658_0001563
3139 Ga0500559_0000752
3140 Ga0500616_0000209
3141 Ga0500620_005002
3142 Ga0500622_0026058
3143 Ga0500636_0009880
3144 Ga0501084_0002756
3145 Ga0501082_0246015
3146 Ga0466962_0002025
3147 Ga0466962_0120631
3148 2512962544
3149 2514038625
3150 2524612328
3151 2552114059
3152 2585154249
3153 2585197868
3154 2585307976
3155 2587741855
3156 2587917817
3157 2644270501
3158 2644424714
3159 2644716654
3160 2644722682
3161 2676479782
3162 2688595614
3163 2739790688
3164 2792746798
3165 2816424314
3166 2817482147
3167 2819567143
3168 2819674182
3169 2819745704
3170 2835318484
3171 2837271733
3172 2840678409
3173 2849562923
3174 2852633712
3175 2857457643
3176 2857470485
3177 2857476157
3178 2857596877
3179 2857608160
3180 2862293481
3181 2862709330
3182 2865000746
3183 2866616696
3184 2869280102
3185 2874143346
3186 2874172002
3187 2878740585
3188 2883068479
3189 2888342955
3190 2889298590
3191 2894235901
3192 2898329748
3193 2899361453
3194 2904525411
3195 2904762516
3196 2906379059
3197 2916974015
3198 2918507924
3199 2919431797
3200 2919722273
3201 2922158346
3202 2924721744
3203 2924778186
3204 2925328487
3205 2935893635
3206 2937824309
3207 2937877984
3208 2937973971
3209 2939615303
3210 2958035968
3211 2958045274
3212 2958085095
3213 2958098880
3214 2958147362
3215 2960324589
3216 2965115385
3217 2968017055
3218 2968146089
3219 2970470212
3220 2970594699
3221 2979796775
3222 2980130617
3223 2980186566
3224 2980188806
3225 2981289056
3226 2981293807
3227 2981984662
3228 2981989523
3229 2987674316
3230 2996349001
3231 2997605507
3232 3004272591
3233 3004275713
3234 3006862578
3235 8008487660
3236 8022896719
3237 8022916360
3238 8025526821
3239 8047710846
3240 8054802387
3241 8057133497
3242 8057981202

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13378

MR_MLE_C

Enolase C-terminal domain-like

185

411

0.97

PF02746

MR_MLE_N

Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

48

165

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rra-assembly1.cif.gz_B crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j with magnesium bound 0.9492 2 379
3rr1-assembly1.cif.gz_B crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j 0.9474 2 379
3rra-assembly1.cif.gz_A crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j with magnesium bound 0.9471 1 379
3rr1-assembly1.cif.gz_A crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j 0.9439 2 379
3rra-assembly1.cif.gz_A crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j with magnesium bound 0.9373 1 379
ID Description Score Start End Superfamily
af_Q6BF17_1_106_3.30.390.10 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9885 1 105 3.30.390.10
af_Q6BF17_1_106_3.30.390.10 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9702 1 105 3.30.390.10
3rraA01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9699 1 99 3.30.390.10
3s47B01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9537 2 98 3.30.390.10
4jn8A01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9433 1 98 3.30.390.10
ID Description Score Start End GO Terms
AF-A0A066WBJ3-F1-model_v4 deleted 0.9884 53 302
AF-A0A7H8QMT8-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme C-terminal domain-containing protein 0.987 2 379 GO:0008869
GO:0009063
GO:0016491
GO:0034194
AF-A0A066WBJ3-F1-model_v4 deleted 0.9845 53 302
AF-A0A4Z1P4F4-F1-model_v4 Mandelate racemase/muconate lactonizing protein-like protein 0.9844 2 377 GO:0008869
GO:0009063
GO:0034194
AF-A0A2K0TNN2-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme C-terminal domain-containing protein 0.9837 2 379 GO:0008869
GO:0009063
GO:0034194

Map