F495085
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1622 | 705 | 1189 | 319 |
Family's Representative Sequence
| Representative Sequence | 3300009011|Ga0105251_10000648|Ga0105251_1000064830 |
| Length | 338 |
| Sequence | MIDFSNFYQLIAKSPLSHWLETLPAQVAAWQRDALHGKYREWERAVEFLPEFAPYRLDLLHSVTAESETPLGEGQRLRIENLLKNLMPWRKGPFSLYGVNIDTEWRSDWKWERVLPHLSDLTGRTILDVGCGSGYHMWRMIGAGAHLAVGIDPTQLFLCQFEAVRKLLGNDQRAHLLPLGIEQLPALNAFDTVFSMGVLYHRRSPLDHLWQLKDQLVPGGELVLETLVVEGDENTVLVPGDRYAQMRNVYFIPSAAALKQWLEKCGFVDVRIVDACVTSTDEQRRTEWMTTESLADFLDPRDSSKTVEGYPAPLRAVIIASKPETQQSLAAKKTRSQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 4 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 5 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 6 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 7 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 8 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 9 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 10 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 11 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 12 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 13 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 14 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 15 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 16 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 17 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 18 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 19 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 20 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 21 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 22 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 23 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 24 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 25 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 26 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 27 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 28 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 29 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 30 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 31 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 32 | 2537561728 | Pectobacterium wasabiae CFBP 3304 | Isolate | Rhizoplane |
| 33 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 34 | 2547132416 | Enterobacter sp. MR1 | Isolate | Rhizoplane |
| 35 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 36 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 37 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 38 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 39 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 40 | 2565956521 | Vibrio rhizosphaerae DSM 18581 | Isolate | Rhizosphere |
| 41 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 42 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 43 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 44 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 45 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 46 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 47 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 48 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 49 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 50 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 51 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 52 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 53 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 54 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 55 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 56 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 57 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 58 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 59 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 60 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 61 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 62 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 63 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 64 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 65 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 66 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 67 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 68 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 69 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 70 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 71 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 72 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 73 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 74 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 75 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 76 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 77 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 78 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 79 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 80 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 81 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 82 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 83 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 84 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 85 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 86 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 87 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 88 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 89 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 90 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 91 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 92 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 93 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 94 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 95 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 96 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 97 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 98 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 99 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 100 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 101 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 102 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 103 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 104 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 105 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 106 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 107 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 108 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 109 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 110 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 111 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 112 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 113 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 114 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 115 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 116 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 117 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 118 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 119 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 120 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 121 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 122 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 123 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 124 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 125 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 126 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 127 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 128 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 129 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 130 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 131 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 132 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 133 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 134 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 135 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 136 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 137 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 138 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 139 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 140 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 141 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 142 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 143 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 144 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 145 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 146 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 147 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 148 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 149 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 150 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 151 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 152 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 153 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 154 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 155 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 156 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 157 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 158 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 159 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 160 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 161 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 162 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 163 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 164 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 165 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 166 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 167 | 2648501241 | Vibrio splendidus UCD-SED7 | Isolate | Rhizosphere |
| 168 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 169 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 170 | 2651869818 | Vibrio splendidus UCD-SED10 | Isolate | Rhizosphere |
| 171 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 172 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 173 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 174 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 175 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 176 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 177 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 178 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 179 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 180 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 181 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 182 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 183 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 184 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 185 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 186 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 187 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 188 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 189 | 2711768156 | Atlantibacter hermannii DDE1 | Isolate | Unclassified |
| 190 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 191 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 192 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 193 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 194 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 195 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 196 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 197 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 198 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 199 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 200 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 201 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 202 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 203 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 204 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 205 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 206 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 207 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 208 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 209 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 210 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 211 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 212 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 213 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 214 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 215 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 216 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 217 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 218 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 219 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 220 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 221 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 222 | 2791355275 | Enterobacter sp. Sa187 | Isolate | Unclassified |
| 223 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 224 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 225 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 226 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 227 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 228 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 229 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 230 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 231 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 232 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 233 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 234 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 235 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 236 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 237 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 238 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 239 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 240 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 241 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 242 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 243 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 244 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 245 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 246 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 247 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 248 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 249 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 250 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 251 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 252 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 253 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 254 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 255 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 256 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 257 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 258 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 259 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 260 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 261 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 262 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 263 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 264 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 265 | 2846540461 | Photorhabdus luminescens HIM3 | Isolate | Rhizosphere |
| 266 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 267 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 268 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 269 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 270 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 271 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 272 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 273 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 274 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 275 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 276 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 277 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 278 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 279 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 280 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 281 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 282 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 283 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 284 | 2881714928 | Pseudidiomarina mangrovi ZQ330 | Isolate | Rhizosphere |
| 285 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 286 | 2887630918 | Psychrosphaera haliotis UCD-MCMsp1aY | Isolate | Unclassified |
| 287 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 288 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 289 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 290 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 291 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 292 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 293 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 294 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 295 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 296 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 297 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 298 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 299 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 300 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 301 | 2916178963 | Pseudoalteromonas rhizosphaerae RA15 | Isolate | Rhizosphere |
| 302 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 303 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 304 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 305 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 306 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 307 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 308 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 309 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 310 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 311 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 312 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 313 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 314 | 2919497567 | Shewanella putrefaciens 3469 | Isolate | Unclassified |
| 315 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 316 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 317 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 318 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 319 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 320 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 321 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 322 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 323 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 324 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 325 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 326 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 327 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 328 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 329 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 330 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 331 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 332 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 333 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 334 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 335 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 336 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 337 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 338 | 2939568625 | Lelliottia sp. 489 | Isolate | Rhizosphere |
| 339 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 340 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 341 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 342 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 343 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 344 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 345 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 346 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 347 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 348 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 349 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 350 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 351 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 352 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 353 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 354 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 355 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 356 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 357 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 358 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 359 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 360 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 361 | 2978975091 | Pantoea anthophila SORGH_AS 797 | Isolate | Unclassified |
| 362 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 363 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 364 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 365 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 366 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 367 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 368 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 369 | 2989392574 | Methylomonas rhizoryzae GJ1 | Isolate | Unclassified |
| 370 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 371 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 372 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 373 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 374 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 375 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 376 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 377 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 378 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 379 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 380 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 381 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 382 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 383 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 384 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 385 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 386 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 387 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 388 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 389 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 390 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 391 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 392 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 393 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 394 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 395 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 396 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 397 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 398 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 399 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 400 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 401 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 402 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 403 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 404 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 405 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 406 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 407 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 408 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 409 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 410 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 411 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 412 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 413 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 414 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 415 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 416 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 417 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 418 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 419 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 420 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 421 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 422 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 423 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 424 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 425 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 426 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 427 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 428 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 429 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 430 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 431 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 432 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 433 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 434 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 435 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 436 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 437 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 438 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 439 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 440 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 441 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 442 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 443 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 444 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 445 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 446 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 447 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 448 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 449 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 450 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 451 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 452 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 453 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 454 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 455 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 456 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 457 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 458 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 459 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 460 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 461 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 462 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 463 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 464 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 465 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 466 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 467 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 468 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 469 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 470 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 471 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 472 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 473 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 474 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 475 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 476 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 477 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 478 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 479 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 480 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 481 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 482 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 483 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 484 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 485 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 486 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 487 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 488 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 489 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 490 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 491 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 492 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 493 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 494 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 495 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 496 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 497 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 498 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 499 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 500 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 501 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 502 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 503 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 504 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 505 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 506 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 507 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 508 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 509 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 510 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 511 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 512 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 513 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 514 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 515 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 516 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 517 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 518 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 519 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 520 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 521 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 522 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 523 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 524 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 525 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 526 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 527 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 528 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 529 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 530 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 531 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 532 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 533 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 534 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 535 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 536 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 537 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 538 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 539 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 540 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 541 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 542 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 543 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 544 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 545 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 546 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 547 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 548 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 549 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 550 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 551 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 552 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 553 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 554 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 555 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 556 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 557 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 558 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 559 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 560 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 561 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 562 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 628 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 629 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 630 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 631 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 632 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 633 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 634 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 635 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 636 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 637 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 638 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 639 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 640 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 641 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 642 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 643 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 644 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 645 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 646 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 647 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 648 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 649 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 650 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 651 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 652 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 653 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 654 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 655 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 656 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 657 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 658 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 659 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 660 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 661 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 662 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 663 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 664 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 665 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 666 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 667 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 668 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 669 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 670 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 671 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 672 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 673 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 674 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 675 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 676 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 677 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 678 | 8054357960 | Idiomarina rhizosphaerae M1R2S28 | Isolate | Rhizosphere |
| 679 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 680 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 681 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 682 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 683 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 684 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 685 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 686 | 8055693939 | Hafnia alvei A23BA | Isolate | Rhizosphere |
| 687 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 688 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 689 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 690 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 691 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 692 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 693 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 694 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 695 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 696 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 697 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 698 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 699 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 700 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 701 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 702 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 703 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
| 704 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
| 705 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.18 |
| Metatranscriptomes | 0.12 |
| Isolates | 26.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.37 |
| Bulb | 0.06 |
| Endosphere | 5.18 |
| Nodule | 3.21 |
| Rhizoplane | 8.45 |
| Rhizosphere | 62.33 |
| Stem | 0.06 |
| Stem Tuber | 0.31 |
| Unclassified | 20.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_24676 | 2124908027 | Bacteria | 1746 |
| 2 | MRS2a_Contig_35 | 2124908027 | Bacteria | 26362 |
| 3 | MRS1b_contig_6647355 | 2162886011 | Bacteria | 1208 |
| 4 | JGI25162J39368_1000019 | 3300002737 | Bacteria | 262053 |
| 5 | JGI25162J39368_1002438 | 3300002737 | Bacteria | 7232 |
| 6 | JGI25163J39215_1000079 | 3300002771 | Bacteria | 42883 |
| 7 | JGI25164J39214_1000011 | 3300002772 | Bacteria | 262057 |
| 8 | JGI25164J39214_1000018 | 3300002772 | Bacteria | 185215 |
| 9 | JGI25164J39214_1000207 | 3300002772 | Bacteria | 50241 |
| 10 | JGI25152J39213_1000482 | 3300002773 | Bacteria | 22790 |
| 11 | JGI25165J46597_1000123 | 3300003214 | Bacteria | 131481 |
| 12 | JGI25165J46597_1000376 | 3300003214 | Bacteria | 49186 |
| 13 | rootH2_10011341 | 3300003320 | Bacteria | 15752 |
| 14 | Ga0055538_1000021 | 3300003751 | Bacteria | 262057 |
| 15 | Ga0055538_1000029 | 3300003751 | Bacteria | 203858 |
| 16 | Ga0055539_1000026 | 3300003752 | Bacteria | 262057 |
| 17 | Ga0055539_1000039 | 3300003752 | Bacteria | 203858 |
| 18 | Ga0055533_1000035 | 3300003756 | Bacteria | 262057 |
| 19 | Ga0055533_1000049 | 3300003756 | Bacteria | 203858 |
| 20 | Ga0055532_1000049 | 3300003758 | Bacteria | 174079 |
| 21 | Ga0055525_1000045 | 3300003759 | Bacteria | 262057 |
| 22 | Ga0055525_1000077 | 3300003759 | Bacteria | 166608 |
| 23 | Ga0055536_1000958 | 3300003781 | Bacteria | 18467 |
| 24 | Ga0055536_1000968 | 3300003781 | Bacteria | 18344 |
| 25 | Ga0055536_1001745 | 3300003781 | Bacteria | 12833 |
| 26 | Ga0055530_10001199 | 3300003791 | Bacteria | 20031 |
| 27 | Ga0055530_10001316 | 3300003791 | Bacteria | 18672 |
| 28 | Ga0055530_10003779 | 3300003791 | Bacteria | 8345 |
| 29 | Ga0055530_10021492 | 3300003791 | Bacteria | 1901 |
| 30 | Ga0055540_1000963 | 3300003792 | Bacteria | 18672 |
| 31 | Ga0055540_1001690 | 3300003792 | Bacteria | 12725 |
| 32 | Ga0055540_1002538 | 3300003792 | Bacteria | 9525 |
| 33 | Ga0055531_10000140 | 3300003794 | Bacteria | 82793 |
| 34 | Ga0055541_1000020 | 3300003841 | Bacteria | 262057 |
| 35 | Ga0055541_1000026 | 3300003841 | Bacteria | 203858 |
| 36 | Ga0058692_1000085 | 3300003856 | Bacteria | 65543 |
| 37 | Ga0058692_1000167 | 3300003856 | Bacteria | 40623 |
| 38 | Ga0058692_1000364 | 3300003856 | Bacteria | 21856 |
| 39 | Ga0058692_1000797 | 3300003856 | Bacteria | 12608 |
| 40 | Ga0058692_1001265 | 3300003856 | Bacteria | 9621 |
| 41 | Ga0058692_1003493 | 3300003856 | Bacteria | 4845 |
| 42 | Ga0058692_1008516 | 3300003856 | Bacteria | 2645 |
| 43 | Ga0058692_1012199 | 3300003856 | Bacteria | 2045 |
| 44 | Ga0058692_1014733 | 3300003856 | Bacteria | 1784 |
| 45 | Ga0058692_1014891 | 3300003856 | Bacteria | 1768 |
| 46 | Ga0058692_1015467 | 3300003856 | Bacteria | 1718 |
| 47 | Ga0058692_1027113 | 3300003856 | Bacteria | 1119 |
| 48 | Ga0065703_1019293 | 3300005272 | Bacteria | 3277 |
| 49 | Ga0065714_10007229 | 3300005288 | Bacteria | 3634 |
| 50 | Ga0065714_10010762 | 3300005288 | Bacteria | 2251 |
| 51 | Ga0065714_10012414 | 3300005288 | Bacteria | 3258 |
| 52 | Ga0065714_10065016 | 3300005288 | Bacteria | 13938 |
| 53 | Ga0065714_10069503 | 3300005288 | Bacteria | 4199 |
| 54 | Ga0065714_10075872 | 3300005288 | Bacteria | 2855 |
| 55 | Ga0065714_10076526 | 3300005288 | Bacteria | 2775 |
| 56 | Ga0065714_10096328 | 3300005288 | Bacteria | 1763 |
| 57 | Ga0065714_10103343 | 3300005288 | Bacteria | 1605 |
| 58 | Ga0065714_10154227 | 3300005288 | Bacteria | 1081 |
| 59 | Ga0065704_10000318 | 3300005289 | Bacteria | 39615 |
| 60 | Ga0065704_10000359 | 3300005289 | Bacteria | 28149 |
| 61 | Ga0065704_10001844 | 3300005289 | Bacteria | 6433 |
| 62 | Ga0065704_10002406 | 3300005289 | Bacteria | 9195 |
| 63 | Ga0065704_10084486 | 3300005289 | Bacteria | 3329 |
| 64 | Ga0065704_10087552 | 3300005289 | Bacteria | 3012 |
| 65 | Ga0065704_10091125 | 3300005289 | Bacteria | 2739 |
| 66 | Ga0065704_10096731 | 3300005289 | Bacteria | 2427 |
| 67 | Ga0065704_10099352 | 3300005289 | Bacteria | 2315 |
| 68 | Ga0065704_10163380 | 3300005289 | Bacteria | 1339 |
| 69 | Ga0065704_10186442 | 3300005289 | Bacteria | 1211 |
| 70 | Ga0065704_10197502 | 3300005289 | Bacteria | 1161 |
| 71 | Ga0065712_10085474 | 3300005290 | Bacteria | 2695 |
| 72 | Ga0065712_10107913 | 3300005290 | Bacteria | 1831 |
| 73 | Ga0065715_10040540 | 3300005293 | Bacteria | 1912 |
| 74 | Ga0070670_100007345 | 3300005331 | Bacteria | 9353 |
| 75 | Ga0070670_100019945 | 3300005331 | Bacteria | 5755 |
| 76 | Ga0070661_100000066 | 3300005344 | Bacteria | 84469 |
| 77 | Ga0070668_100051975 | 3300005347 | Bacteria | 3158 |
| 78 | Ga0070669_100000310 | 3300005353 | Bacteria | 38441 |
| 79 | Ga0070669_100009197 | 3300005353 | Bacteria | 7039 |
| 80 | Ga0070659_100076066 | 3300005366 | Bacteria | 2677 |
| 81 | Ga0070662_100000560 | 3300005457 | Bacteria | 22585 |
| 82 | Ga0070665_100000356 | 3300005548 | Bacteria | 68816 |
| 83 | Ga0070665_100014132 | 3300005548 | Bacteria | 8022 |
| 84 | Ga0070665_100031477 | 3300005548 | Bacteria | 5339 |
| 85 | Ga0070664_100000034 | 3300005564 | Bacteria | 82848 |
| 86 | Ga0070664_100089387 | 3300005564 | Bacteria | 2665 |
| 87 | Ga0068857_100001074 | 3300005577 | Bacteria | 21158 |
| 88 | Ga0068854_100145094 | 3300005578 | Bacteria | 1825 |
| 89 | Ga0068851_10000006 | 3300005834 | Bacteria | 258116 |
| 90 | Ga0068851_10036752 | 3300005834 | Bacteria | 2453 |
| 91 | Ga0075364_10002374 | 3300006051 | Bacteria | 10566 |
| 92 | Ga0075364_10028598 | 3300006051 | Bacteria | 3569 |
| 93 | Ga0075364_10248553 | 3300006051 | Bacteria | 1209 |
| 94 | Ga0075432_10023165 | 3300006058 | Bacteria | 2126 |
| 95 | Ga0075432_10035382 | 3300006058 | Bacteria | 1735 |
| 96 | Ga0075432_10057284 | 3300006058 | Bacteria | 1382 |
| 97 | Ga0075432_10063618 | 3300006058 | Bacteria | 1317 |
| 98 | Ga0075432_10071090 | 3300006058 | Bacteria | 1250 |
| 99 | Ga0075362_10004456 | 3300006177 | Bacteria | 5037 |
| 100 | Ga0099823_1000054 | 3300006944 | Bacteria | 55085 |
| 101 | Ga0079104_1000047 | 3300006946 | Bacteria | 182563 |
| 102 | Ga0079104_1000060 | 3300006946 | Bacteria | 161936 |
| 103 | Ga0079104_1000225 | 3300006946 | Bacteria | 78440 |
| 104 | Ga0079104_1000475 | 3300006946 | Bacteria | 44675 |
| 105 | Ga0079104_1000867 | 3300006946 | Bacteria | 25004 |
| 106 | Ga0079104_1001084 | 3300006946 | Bacteria | 20407 |
| 107 | Ga0079104_1001209 | 3300006946 | Bacteria | 18310 |
| 108 | Ga0079104_1002173 | 3300006946 | Bacteria | 11075 |
| 109 | Ga0079104_1003218 | 3300006946 | Bacteria | 7860 |
| 110 | Ga0079104_1008699 | 3300006946 | Bacteria | 3514 |
| 111 | Ga0079104_1012111 | 3300006946 | Bacteria | 2733 |
| 112 | Ga0079104_1018323 | 3300006946 | Bacteria | 1985 |
| 113 | Ga0079104_1018332 | 3300006946 | Bacteria | 1984 |
| 114 | Ga0079104_1039575 | 3300006946 | Bacteria | 1110 |
| 115 | Ga0099826_10002377 | 3300006948 | Bacteria | 12115 |
| 116 | Ga0105251_10000004 | 3300009011 | Bacteria | 285212 |
| 117 | Ga0105251_10000149 | 3300009011 | Bacteria | 71244 |
| 118 | Ga0105251_10000226 | 3300009011 | Bacteria | 56731 |
| 119 | Ga0105251_10000605 | 3300009011 | Bacteria | 32851 |
| 120 | Ga0105251_10000648 | 3300009011 | Bacteria | 32068 |
| 121 | Ga0105251_10000740 | 3300009011 | Bacteria | 29928 |
| 122 | Ga0105251_10000935 | 3300009011 | Bacteria | 26139 |
| 123 | Ga0105251_10002574 | 3300009011 | Bacteria | 14064 |
| 124 | Ga0105251_10003255 | 3300009011 | Bacteria | 11932 |
| 125 | Ga0105251_10003382 | 3300009011 | Bacteria | 11603 |
| 126 | Ga0105251_10004557 | 3300009011 | Bacteria | 9382 |
| 127 | Ga0105251_10005578 | 3300009011 | Bacteria | 8186 |
| 128 | Ga0105251_10007670 | 3300009011 | Bacteria | 6602 |
| 129 | Ga0105251_10013931 | 3300009011 | Bacteria | 4472 |
| 130 | Ga0105251_10016626 | 3300009011 | Bacteria | 3967 |
| 131 | Ga0105251_10017330 | 3300009011 | Bacteria | 3864 |
| 132 | Ga0105251_10019782 | 3300009011 | Bacteria | 3546 |
| 133 | Ga0105251_10019949 | 3300009011 | Bacteria | 3528 |
| 134 | Ga0105251_10021494 | 3300009011 | Bacteria | 3367 |
| 135 | Ga0105251_10053066 | 3300009011 | Bacteria | 1928 |
| 136 | Ga0105251_10062773 | 3300009011 | Bacteria | 1744 |
| 137 | Ga0105251_10064635 | 3300009011 | Bacteria | 1714 |
| 138 | Ga0105251_10070191 | 3300009011 | Bacteria | 1632 |
| 139 | Ga0105251_10090870 | 3300009011 | Bacteria | 1403 |
| 140 | Ga0105251_10109261 | 3300009011 | Bacteria | 1261 |
| 141 | Ga0105251_10143841 | 3300009011 | Bacteria | 1078 |
| 142 | Ga0105244_10000020 | 3300009036 | Bacteria | 241021 |
| 143 | Ga0105244_10000047 | 3300009036 | Bacteria | 142097 |
| 144 | Ga0105244_10000141 | 3300009036 | Bacteria | 75197 |
| 145 | Ga0105244_10000223 | 3300009036 | Bacteria | 58908 |
| 146 | Ga0105244_10000761 | 3300009036 | Bacteria | 27525 |
| 147 | Ga0105244_10000922 | 3300009036 | Bacteria | 24861 |
| 148 | Ga0105244_10001402 | 3300009036 | Bacteria | 19561 |
| 149 | Ga0105244_10001660 | 3300009036 | Bacteria | 17613 |
| 150 | Ga0105244_10002703 | 3300009036 | Bacteria | 13261 |
| 151 | Ga0105244_10002753 | 3300009036 | Bacteria | 13108 |
| 152 | Ga0105244_10003421 | 3300009036 | Bacteria | 11311 |
| 153 | Ga0105244_10005552 | 3300009036 | Bacteria | 8354 |
| 154 | Ga0105244_10011040 | 3300009036 | Bacteria | 5443 |
| 155 | Ga0105244_10012847 | 3300009036 | Bacteria | 4931 |
| 156 | Ga0105244_10017503 | 3300009036 | Bacteria | 4047 |
| 157 | Ga0105244_10021675 | 3300009036 | Bacteria | 3548 |
| 158 | Ga0105244_10025019 | 3300009036 | Bacteria | 3250 |
| 159 | Ga0105244_10025151 | 3300009036 | Bacteria | 3241 |
| 160 | Ga0105244_10030409 | 3300009036 | Bacteria | 2874 |
| 161 | Ga0105244_10041920 | 3300009036 | Bacteria | 2370 |
| 162 | Ga0105244_10059527 | 3300009036 | Bacteria | 1925 |
| 163 | Ga0105244_10059960 | 3300009036 | Bacteria | 1918 |
| 164 | Ga0105244_10106047 | 3300009036 | Bacteria | 1371 |
| 165 | Ga0105244_10107932 | 3300009036 | Bacteria | 1357 |
| 166 | Ga0105244_10118847 | 3300009036 | Bacteria | 1281 |
| 167 | Ga0105244_10130274 | 3300009036 | Bacteria | 1214 |
| 168 | Ga0105250_10000001 | 3300009092 | Bacteria | 617357 |
| 169 | Ga0105250_10000016 | 3300009092 | Bacteria | 256310 |
| 170 | Ga0105250_10000119 | 3300009092 | Bacteria | 70121 |
| 171 | Ga0105250_10000235 | 3300009092 | Bacteria | 46317 |
| 172 | Ga0105250_10000847 | 3300009092 | Bacteria | 18131 |
| 173 | Ga0105250_10002820 | 3300009092 | Bacteria | 8511 |
| 174 | Ga0105250_10003478 | 3300009092 | Bacteria | 7450 |
| 175 | Ga0105250_10004467 | 3300009092 | Bacteria | 6432 |
| 176 | Ga0105250_10012686 | 3300009092 | Bacteria | 3473 |
| 177 | Ga0105250_10018277 | 3300009092 | Bacteria | 2842 |
| 178 | Ga0105250_10019913 | 3300009092 | Bacteria | 2714 |
| 179 | Ga0105250_10023550 | 3300009092 | Bacteria | 2481 |
| 180 | Ga0105250_10029050 | 3300009092 | Bacteria | 2225 |
| 181 | Ga0105250_10042759 | 3300009092 | Bacteria | 1816 |
| 182 | Ga0105250_10086816 | 3300009092 | Bacteria | 1270 |
| 183 | Ga0105247_10000012 | 3300009101 | Bacteria | 292188 |
| 184 | Ga0105243_10000133 | 3300009148 | Bacteria | 85133 |
| 185 | Ga0105243_10004466 | 3300009148 | Bacteria | 11063 |
| 186 | Ga0105243_10007553 | 3300009148 | Bacteria | 8359 |
| 187 | Ga0105243_10008586 | 3300009148 | Bacteria | 7839 |
| 188 | Ga0105243_10046604 | 3300009148 | Bacteria | 3411 |
| 189 | Ga0105243_10133956 | 3300009148 | Bacteria | 2106 |
| 190 | Ga0105243_10220692 | 3300009148 | Bacteria | 1675 |
| 191 | Ga0105243_10333449 | 3300009148 | Bacteria | 1387 |
| 192 | Ga0105241_10000001 | 3300009174 | Bacteria | 879793 |
| 193 | Ga0105242_10000233 | 3300009176 | Bacteria | 43902 |
| 194 | Ga0105242_10422557 | 3300009176 | Bacteria | 1249 |
| 195 | Ga0105248_10122604 | 3300009177 | Bacteria | 2932 |
| 196 | Ga0105237_10000160 | 3300009545 | Bacteria | 95183 |
| 197 | Ga0105246_10007947 | 3300011119 | Bacteria | 6511 |
| 198 | Ga0105246_10054546 | 3300011119 | Bacteria | 2755 |
| 199 | Ga0105246_10107601 | 3300011119 | Bacteria | 2042 |
| 200 | Ga0157345_1002802 | 3300012498 | Bacteria | 1247 |
| 201 | Ga0157373_10000137 | 3300013100 | Bacteria | 57817 |
| 202 | Ga0157373_10000779 | 3300013100 | Bacteria | 24578 |
| 203 | Ga0157373_10001377 | 3300013100 | Bacteria | 18652 |
| 204 | Ga0157373_10005333 | 3300013100 | Bacteria | 9659 |
| 205 | Ga0157373_10017667 | 3300013100 | Bacteria | 5193 |
| 206 | Ga0157373_10029939 | 3300013100 | Bacteria | 3919 |
| 207 | Ga0157373_10088253 | 3300013100 | Bacteria | 2185 |
| 208 | Ga0157373_10123513 | 3300013100 | Bacteria | 1820 |
| 209 | Ga0157371_10000098 | 3300013102 | Bacteria | 134017 |
| 210 | Ga0157371_10000460 | 3300013102 | Bacteria | 49750 |
| 211 | Ga0157371_10000810 | 3300013102 | Bacteria | 35896 |
| 212 | Ga0157371_10001729 | 3300013102 | Bacteria | 22149 |
| 213 | Ga0157371_10002644 | 3300013102 | Bacteria | 16991 |
| 214 | Ga0157371_10005574 | 3300013102 | Bacteria | 10581 |
| 215 | Ga0157371_10032848 | 3300013102 | Bacteria | 3732 |
| 216 | Ga0157371_10086528 | 3300013102 | Bacteria | 2219 |
| 217 | Ga0157371_10162197 | 3300013102 | Bacteria | 1596 |
| 218 | Ga0157371_10164859 | 3300013102 | Bacteria | 1583 |
| 219 | Ga0157370_10000075 | 3300013104 | Bacteria | 108060 |
| 220 | Ga0157370_10000301 | 3300013104 | Bacteria | 62779 |
| 221 | Ga0157370_10005690 | 3300013104 | Bacteria | 13932 |
| 222 | Ga0157370_10018571 | 3300013104 | Bacteria | 6989 |
| 223 | Ga0157370_10154794 | 3300013104 | Bacteria | 2133 |
| 224 | Ga0157370_10228312 | 3300013104 | Bacteria | 1723 |
| 225 | Ga0157370_10456392 | 3300013104 | Bacteria | 1175 |
| 226 | Ga0157369_10006243 | 3300013105 | Bacteria | 13828 |
| 227 | Ga0157369_10020382 | 3300013105 | Bacteria | 7412 |
| 228 | Ga0157369_10032725 | 3300013105 | Bacteria | 5714 |
| 229 | Ga0157369_10039167 | 3300013105 | Bacteria | 5180 |
| 230 | Ga0157369_10064144 | 3300013105 | Bacteria | 3956 |
| 231 | Ga0157369_10065052 | 3300013105 | Bacteria | 3926 |
| 232 | Ga0163162_10001088 | 3300013306 | Bacteria | 25181 |
| 233 | Ga0163162_10006068 | 3300013306 | Bacteria | 11695 |
| 234 | Ga0163162_10119254 | 3300013306 | Bacteria | 2741 |
| 235 | Ga0163162_10460463 | 3300013306 | Bacteria | 1403 |
| 236 | Ga0157372_10000815 | 3300013307 | Bacteria | 33774 |
| 237 | Ga0157372_10008169 | 3300013307 | Bacteria | 11125 |
| 238 | Ga0157372_10024055 | 3300013307 | Bacteria | 6609 |
| 239 | Ga0157372_10045132 | 3300013307 | Bacteria | 4887 |
| 240 | Ga0157372_10102711 | 3300013307 | Bacteria | 3266 |
| 241 | Ga0157372_10199055 | 3300013307 | Bacteria | 2320 |
| 242 | Ga0157372_10525877 | 3300013307 | Bacteria | 1379 |
| 243 | Ga0182008_10000235 | 3300014497 | Bacteria | 43235 |
| 244 | Ga0182008_10004762 | 3300014497 | Bacteria | 7856 |
| 245 | Ga0182008_10010235 | 3300014497 | Bacteria | 5026 |
| 246 | Ga0182008_10024098 | 3300014497 | Bacteria | 3100 |
| 247 | Ga0182008_10032743 | 3300014497 | Bacteria | 2610 |
| 248 | Ga0182008_10035354 | 3300014497 | Bacteria | 2503 |
| 249 | Ga0182008_10047300 | 3300014497 | Bacteria | 2137 |
| 250 | Ga0182008_10056042 | 3300014497 | Bacteria | 1948 |
| 251 | Ga0182008_10072573 | 3300014497 | Bacteria | 1694 |
| 252 | Ga0182006_1000087 | 3300015261 | Bacteria | 115141 |
| 253 | Ga0182006_1008071 | 3300015261 | Bacteria | 4783 |
| 254 | Ga0182006_1010353 | 3300015261 | Bacteria | 4148 |
| 255 | Ga0182006_1023063 | 3300015261 | Bacteria | 2579 |
| 256 | Ga0182006_1035094 | 3300015261 | Bacteria | 2002 |
| 257 | Ga0182007_10000613 | 3300015262 | Bacteria | 20791 |
| 258 | Ga0182007_10034420 | 3300015262 | Bacteria | 1712 |
| 259 | Ga0182005_1000428 | 3300015265 | Bacteria | 22428 |
| 260 | Ga0182005_1002342 | 3300015265 | Bacteria | 6835 |
| 261 | Ga0182005_1004652 | 3300015265 | Bacteria | 4389 |
| 262 | Ga0182005_1023056 | 3300015265 | Bacteria | 1704 |
| 263 | Ga0182005_1024933 | 3300015265 | Bacteria | 1632 |
| 264 | Ga0183366_1001 | 3300015679 | Bacteria | 2743932 |
| 265 | Ga0183370_1001 | 3300015680 | Bacteria | 2743932 |
| 266 | Ga0183369_1001 | 3300015685 | Bacteria | 2743932 |
| 267 | Ga0183368_1001 | 3300015687 | Bacteria | 2743932 |
| 268 | Ga0163161_10000001 | 3300017792 | Bacteria | 2041488 |
| 269 | Ga0163161_10001062 | 3300017792 | Bacteria | 20818 |
| 270 | Ga0163161_10051296 | 3300017792 | Bacteria | 2988 |
| 271 | Ga0163161_10054321 | 3300017792 | Bacteria | 2907 |
| 272 | Ga0163161_10306623 | 3300017792 | Bacteria | 1252 |
| 273 | Ga0213876_10000016 | 3300021384 | Bacteria | 300175 |
| 274 | Ga0209435_101165 | 3300025206 | Bacteria | 3593 |
| 275 | Ga0209760_100004 | 3300025207 | Bacteria | 254650 |
| 276 | Ga0209760_100127 | 3300025207 | Bacteria | 50815 |
| 277 | Ga0209760_100144 | 3300025207 | Bacteria | 44880 |
| 278 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 279 | Ga0209784_100045 | 3300025224 | Bacteria | 203911 |
| 280 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 281 | Ga0209566_100057 | 3300025225 | Bacteria | 203960 |
| 282 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 283 | Ga0209674_100080 | 3300025226 | Bacteria | 203960 |
| 284 | Ga0209147_100079 | 3300025229 | Bacteria | 203960 |
| 285 | Ga0209563_100002 | 3300025230 | Bacteria | 2045675 |
| 286 | Ga0209563_100078 | 3300025230 | Bacteria | 203960 |
| 287 | Ga0209563_100284 | 3300025230 | Bacteria | 21201 |
| 288 | Ga0207427_100007 | 3300025231 | Bacteria | 746220 |
| 289 | Ga0207427_100012 | 3300025231 | Bacteria | 585657 |
| 290 | Ga0207427_100038 | 3300025231 | Bacteria | 292975 |
| 291 | Ga0209437_100001 | 3300025233 | Bacteria | 2045675 |
| 292 | Ga0209437_100006 | 3300025233 | Bacteria | 1042724 |
| 293 | Ga0209437_100009 | 3300025233 | Bacteria | 915954 |
| 294 | Ga0209437_100155 | 3300025233 | Bacteria | 152749 |
| 295 | Ga0209258_100178 | 3300025242 | Bacteria | 138843 |
| 296 | Ga0209646_1000311 | 3300025246 | Bacteria | 38501 |
| 297 | Ga0209677_100002 | 3300025253 | Bacteria | 2045675 |
| 298 | Ga0209677_100045 | 3300025253 | Bacteria | 203960 |
| 299 | Ga0209759_1002924 | 3300025256 | Bacteria | 7155 |
| 300 | Ga0209129_1000004 | 3300025258 | Bacteria | 884499 |
| 301 | Ga0209233_1000059 | 3300025261 | Bacteria | 414562 |
| 302 | Ga0209233_1000074 | 3300025261 | Bacteria | 357367 |
| 303 | Ga0209233_1001376 | 3300025261 | Bacteria | 9645 |
| 304 | Ga0209676_1000006 | 3300025292 | Bacteria | 1039588 |
| 305 | Ga0209676_1000010 | 3300025292 | Bacteria | 954025 |
| 306 | Ga0209676_1000270 | 3300025292 | Bacteria | 108368 |
| 307 | Ga0209676_1000721 | 3300025292 | Bacteria | 45474 |
| 308 | Ga0209676_1003505 | 3300025292 | Bacteria | 9597 |
| 309 | Ga0209050_1000019 | 3300025298 | Bacteria | 608757 |
| 310 | Ga0209050_1000060 | 3300025298 | Bacteria | 321699 |
| 311 | Ga0209050_1000065 | 3300025298 | Bacteria | 313668 |
| 312 | Ga0209050_1001314 | 3300025298 | Bacteria | 27871 |
| 313 | Ga0209051_1000037 | 3300025303 | Bacteria | 321747 |
| 314 | Ga0209051_1000238 | 3300025303 | Bacteria | 92629 |
| 315 | Ga0209051_1000265 | 3300025303 | Bacteria | 87617 |
| 316 | Ga0209257_1000119 | 3300025304 | Bacteria | 225893 |
| 317 | Ga0209257_1019834 | 3300025304 | Bacteria | 2513 |
| 318 | Ga0207656_10000017 | 3300025321 | Bacteria | 117646 |
| 319 | Ga0207696_1000001 | 3300025711 | Bacteria | 2579611 |
| 320 | Ga0207696_1000015 | 3300025711 | Bacteria | 507848 |
| 321 | Ga0207696_1000022 | 3300025711 | Bacteria | 427529 |
| 322 | Ga0207696_1000030 | 3300025711 | Bacteria | 395961 |
| 323 | Ga0207696_1000044 | 3300025711 | Bacteria | 300953 |
| 324 | Ga0207696_1000062 | 3300025711 | Bacteria | 239603 |
| 325 | Ga0207696_1000121 | 3300025711 | Bacteria | 143687 |
| 326 | Ga0207696_1000179 | 3300025711 | Bacteria | 99732 |
| 327 | Ga0207696_1000216 | 3300025711 | Bacteria | 84411 |
| 328 | Ga0207696_1000298 | 3300025711 | Bacteria | 57382 |
| 329 | Ga0207696_1000924 | 3300025711 | Bacteria | 18140 |
| 330 | Ga0207696_1001803 | 3300025711 | Bacteria | 11058 |
| 331 | Ga0207696_1002483 | 3300025711 | Bacteria | 9016 |
| 332 | Ga0207696_1005451 | 3300025711 | Bacteria | 5279 |
| 333 | Ga0207696_1018992 | 3300025711 | Bacteria | 2247 |
| 334 | Ga0207696_1020773 | 3300025711 | Bacteria | 2111 |
| 335 | Ga0207696_1023696 | 3300025711 | Bacteria | 1933 |
| 336 | Ga0207655_1000001 | 3300025728 | Bacteria | 1866413 |
| 337 | Ga0207655_1000002 | 3300025728 | Bacteria | 1148694 |
| 338 | Ga0207655_1000004 | 3300025728 | Bacteria | 1021221 |
| 339 | Ga0207655_1000007 | 3300025728 | Bacteria | 773492 |
| 340 | Ga0207655_1000021 | 3300025728 | Bacteria | 518596 |
| 341 | Ga0207655_1000086 | 3300025728 | Bacteria | 206068 |
| 342 | Ga0207655_1000110 | 3300025728 | Bacteria | 171137 |
| 343 | Ga0207655_1000229 | 3300025728 | Bacteria | 93185 |
| 344 | Ga0207655_1000240 | 3300025728 | Bacteria | 90267 |
| 345 | Ga0207655_1000296 | 3300025728 | Bacteria | 75293 |
| 346 | Ga0207655_1000462 | 3300025728 | Bacteria | 53331 |
| 347 | Ga0207655_1000859 | 3300025728 | Bacteria | 32375 |
| 348 | Ga0207655_1000886 | 3300025728 | Bacteria | 31679 |
| 349 | Ga0207655_1001511 | 3300025728 | Bacteria | 21214 |
| 350 | Ga0207655_1001729 | 3300025728 | Bacteria | 19176 |
| 351 | Ga0207655_1005688 | 3300025728 | Bacteria | 8429 |
| 352 | Ga0207655_1008864 | 3300025728 | Bacteria | 6321 |
| 353 | Ga0207655_1009864 | 3300025728 | Bacteria | 5877 |
| 354 | Ga0207655_1014133 | 3300025728 | Bacteria | 4532 |
| 355 | Ga0207655_1019444 | 3300025728 | Bacteria | 3549 |
| 356 | Ga0207655_1026480 | 3300025728 | Bacteria | 2784 |
| 357 | Ga0207655_1027259 | 3300025728 | Bacteria | 2725 |
| 358 | Ga0207655_1039814 | 3300025728 | Bacteria | 2037 |
| 359 | Ga0207655_1066733 | 3300025728 | Bacteria | 1358 |
| 360 | Ga0207655_1071672 | 3300025728 | Bacteria | 1285 |
| 361 | Ga0207655_1085168 | 3300025728 | Bacteria | 1128 |
| 362 | Ga0207655_1088434 | 3300025728 | Bacteria | 1096 |
| 363 | Ga0207713_1000001 | 3300025735 | Bacteria | 2295391 |
| 364 | Ga0207713_1000004 | 3300025735 | Bacteria | 702781 |
| 365 | Ga0207713_1000013 | 3300025735 | Bacteria | 475751 |
| 366 | Ga0207713_1000015 | 3300025735 | Bacteria | 424741 |
| 367 | Ga0207713_1000027 | 3300025735 | Bacteria | 312621 |
| 368 | Ga0207713_1000088 | 3300025735 | Bacteria | 155734 |
| 369 | Ga0207713_1000104 | 3300025735 | Bacteria | 138310 |
| 370 | Ga0207713_1000356 | 3300025735 | Bacteria | 50001 |
| 371 | Ga0207713_1000454 | 3300025735 | Bacteria | 42911 |
| 372 | Ga0207713_1000734 | 3300025735 | Bacteria | 30649 |
| 373 | Ga0207713_1000753 | 3300025735 | Bacteria | 30153 |
| 374 | Ga0207713_1001064 | 3300025735 | Bacteria | 23714 |
| 375 | Ga0207713_1001329 | 3300025735 | Bacteria | 20259 |
| 376 | Ga0207713_1002680 | 3300025735 | Bacteria | 12738 |
| 377 | Ga0207713_1006156 | 3300025735 | Bacteria | 7367 |
| 378 | Ga0207713_1007324 | 3300025735 | Bacteria | 6536 |
| 379 | Ga0207713_1007367 | 3300025735 | Bacteria | 6507 |
| 380 | Ga0207713_1007806 | 3300025735 | Bacteria | 6243 |
| 381 | Ga0207713_1009534 | 3300025735 | Bacteria | 5460 |
| 382 | Ga0207713_1014251 | 3300025735 | Bacteria | 4144 |
| 383 | Ga0207713_1017204 | 3300025735 | Bacteria | 3637 |
| 384 | Ga0207713_1017833 | 3300025735 | Bacteria | 3537 |
| 385 | Ga0207713_1021022 | 3300025735 | Bacteria | 3139 |
| 386 | Ga0207713_1046323 | 3300025735 | Bacteria | 1769 |
| 387 | Ga0207713_1049082 | 3300025735 | Bacteria | 1694 |
| 388 | Ga0207713_1066113 | 3300025735 | Bacteria | 1355 |
| 389 | Ga0207710_10000083 | 3300025900 | Bacteria | 136593 |
| 390 | Ga0207654_10000004 | 3300025911 | Bacteria | 902334 |
| 391 | Ga0207671_10000019 | 3300025914 | Bacteria | 317781 |
| 392 | Ga0207649_10000004 | 3300025920 | Bacteria | 360726 |
| 393 | Ga0207681_10000679 | 3300025923 | Bacteria | 22341 |
| 394 | Ga0207681_10001883 | 3300025923 | Bacteria | 13423 |
| 395 | Ga0207650_10000668 | 3300025925 | Bacteria | 26952 |
| 396 | Ga0207650_10001102 | 3300025925 | Bacteria | 19910 |
| 397 | Ga0207706_10001474 | 3300025933 | Bacteria | 23502 |
| 398 | Ga0207706_10014803 | 3300025933 | Bacteria | 7061 |
| 399 | Ga0207686_10002443 | 3300025934 | Bacteria | 10104 |
| 400 | Ga0207709_10000013 | 3300025935 | Bacteria | 531977 |
| 401 | Ga0207709_10003688 | 3300025935 | Bacteria | 9014 |
| 402 | Ga0207709_10005522 | 3300025935 | Bacteria | 7174 |
| 403 | Ga0207709_10012279 | 3300025935 | Bacteria | 4721 |
| 404 | Ga0207709_10037052 | 3300025935 | Bacteria | 2895 |
| 405 | Ga0207709_10048780 | 3300025935 | Bacteria | 2581 |
| 406 | Ga0207709_10061528 | 3300025935 | Bacteria | 2346 |
| 407 | Ga0207709_10335959 | 3300025935 | Bacteria | 1135 |
| 408 | Ga0207711_10020084 | 3300025941 | Bacteria | 5568 |
| 409 | Ga0207679_10000019 | 3300025945 | Bacteria | 230270 |
| 410 | Ga0207712_10025540 | 3300025961 | Bacteria | 3926 |
| 411 | Ga0207640_10060517 | 3300025981 | Bacteria | 2503 |
| 412 | Ga0207639_10003002 | 3300026041 | Bacteria | 11354 |
| 413 | Ga0207674_10027056 | 3300026116 | Bacteria | 6076 |
| 414 | Ga0209281_1000001 | 3300027111 | Bacteria | 1933496 |
| 415 | Ga0209281_1000003 | 3300027111 | Bacteria | 1260089 |
| 416 | Ga0209281_1000004 | 3300027111 | Bacteria | 1253949 |
| 417 | Ga0209281_1000006 | 3300027111 | Bacteria | 1170244 |
| 418 | Ga0209281_1000010 | 3300027111 | Bacteria | 726106 |
| 419 | Ga0209281_1000012 | 3300027111 | Bacteria | 684886 |
| 420 | Ga0209281_1000013 | 3300027111 | Bacteria | 653449 |
| 421 | Ga0209281_1000064 | 3300027111 | Bacteria | 287876 |
| 422 | Ga0209281_1000071 | 3300027111 | Bacteria | 274050 |
| 423 | Ga0209281_1000109 | 3300027111 | Bacteria | 216504 |
| 424 | Ga0209281_1000434 | 3300027111 | Bacteria | 61798 |
| 425 | Ga0209281_1001629 | 3300027111 | Bacteria | 12045 |
| 426 | Ga0209281_1004175 | 3300027111 | Bacteria | 4410 |
| 427 | Ga0209281_1004912 | 3300027111 | Bacteria | 3853 |
| 428 | Ga0209389_1000002 | 3300027296 | Bacteria | 333932 |
| 429 | Ga0209371_1000001 | 3300027312 | Bacteria | 2771503 |
| 430 | Ga0209371_1000002 | 3300027312 | Bacteria | 1551985 |
| 431 | Ga0209371_1000005 | 3300027312 | Bacteria | 1061740 |
| 432 | Ga0209371_1000039 | 3300027312 | Bacteria | 350081 |
| 433 | Ga0209371_1000052 | 3300027312 | Bacteria | 274444 |
| 434 | Ga0209371_1000199 | 3300027312 | Bacteria | 87337 |
| 435 | Ga0209371_1000205 | 3300027312 | Bacteria | 84439 |
| 436 | Ga0209371_1000239 | 3300027312 | Bacteria | 68842 |
| 437 | Ga0209371_1000253 | 3300027312 | Bacteria | 65388 |
| 438 | Ga0209371_1001211 | 3300027312 | Bacteria | 18647 |
| 439 | Ga0209371_1001746 | 3300027312 | Bacteria | 13702 |
| 440 | Ga0209371_1002164 | 3300027312 | Bacteria | 11510 |
| 441 | Ga0209371_1002408 | 3300027312 | Bacteria | 10511 |
| 442 | Ga0209371_1002488 | 3300027312 | Bacteria | 10231 |
| 443 | Ga0209371_1003168 | 3300027312 | Bacteria | 8324 |
| 444 | Ga0209371_1004744 | 3300027312 | Bacteria | 5754 |
| 445 | Ga0209371_1005029 | 3300027312 | Bacteria | 5448 |
| 446 | Ga0209371_1008280 | 3300027312 | Bacteria | 3482 |
| 447 | Ga0209983_1000325 | 3300027665 | Bacteria | 9954 |
| 448 | Ga0209971_1001041 | 3300027682 | Bacteria | 7079 |
| 449 | Ga0209974_10023657 | 3300027876 | Bacteria | 2033 |
| 450 | Ga0209974_10027692 | 3300027876 | Bacteria | 1875 |
| 451 | Ga0207428_10010530 | 3300027907 | Bacteria | 8256 |
| 452 | Ga0207428_10025831 | 3300027907 | Bacteria | 4910 |
| 453 | Ga0207428_10066757 | 3300027907 | Bacteria | 2834 |
| 454 | Ga0207428_10073063 | 3300027907 | Bacteria | 2692 |
| 455 | Ga0268266_10000959 | 3300028379 | Bacteria | 36713 |
| 456 | Ga0268266_10003720 | 3300028379 | Bacteria | 15009 |
| 457 | Ga0268256_1000001 | 3300030500 | Bacteria | 2771065 |
| 458 | Ga0268256_1000002 | 3300030500 | Bacteria | 1535763 |
| 459 | Ga0268256_1000006 | 3300030500 | Bacteria | 1063991 |
| 460 | Ga0268256_1000033 | 3300030500 | Bacteria | 420973 |
| 461 | Ga0268256_1000061 | 3300030500 | Bacteria | 216116 |
| 462 | Ga0268256_1000098 | 3300030500 | Bacteria | 136395 |
| 463 | Ga0268256_1000199 | 3300030500 | Bacteria | 68849 |
| 464 | Ga0268256_1000367 | 3300030500 | Bacteria | 42860 |
| 465 | Ga0268256_1000618 | 3300030500 | Bacteria | 27786 |
| 466 | Ga0268256_1001036 | 3300030500 | Bacteria | 18647 |
| 467 | Ga0268256_1001327 | 3300030500 | Bacteria | 15157 |
| 468 | Ga0268256_1001446 | 3300030500 | Bacteria | 14305 |
| 469 | Ga0268256_1001521 | 3300030500 | Bacteria | 13702 |
| 470 | Ga0268256_1004683 | 3300030500 | Bacteria | 5585 |
| 471 | Ga0268256_1005544 | 3300030500 | Bacteria | 4921 |
| 472 | Ga0268256_1008497 | 3300030500 | Bacteria | 3509 |
| 473 | Ga0268256_1011168 | 3300030500 | Bacteria | 2861 |
| 474 | Ga0307511_10050424 | 3300030521 | Bacteria | 3352 |
| 475 | Ga0316177_1108430 | 3300030731 | Bacteria | 2173 |
| 476 | Ga0314311_1045991 | 3300030733 | Bacteria | 3606 |
| 477 | Ga0316178_1076498 | 3300030735 | Bacteria | 31398 |
| 478 | Ga0316183_1053494 | 3300030742 | Bacteria | 4078 |
| 479 | Ga0316181_1247282 | 3300030744 | Bacteria | 1534 |
| 480 | Ga0265331_10047402 | 3300031250 | Bacteria | 2068 |
| 481 | Ga0307408_100000304 | 3300031548 | Bacteria | 47053 |
| 482 | Ga0307408_100063987 | 3300031548 | Bacteria | 2692 |
| 483 | Ga0307408_100473096 | 3300031548 | Bacteria | 1091 |
| 484 | Ga0316576_10026621 | 3300031727 | Bacteria | 4060 |
| 485 | Ga0307405_10013400 | 3300031731 | Bacteria | 4371 |
| 486 | Ga0307405_10153890 | 3300031731 | Bacteria | 1620 |
| 487 | Ga0307413_10033078 | 3300031824 | Bacteria | 2939 |
| 488 | Ga0307407_10191217 | 3300031903 | Bacteria | 1364 |
| 489 | Ga0307416_100176787 | 3300032002 | Bacteria | 1995 |
| 490 | Ga0307416_100295816 | 3300032002 | Bacteria | 1606 |
| 491 | Ga0307414_10458513 | 3300032004 | Bacteria | 1119 |
| 492 | Ga0307411_10033480 | 3300032005 | Bacteria | 3187 |
| 493 | Ga0316593_10008423 | 3300032168 | Bacteria | 2876 |
| 494 | Ga0316593_10012354 | 3300032168 | Bacteria | 2505 |
| 495 | Ga0307510_10001771 | 3300033180 | Bacteria | 24088 |
| 496 | Ga0316574_0076175 | 3300035398 | Bacteria | 2125 |
| 497 | Ga0316582_0027234 | 3300036647 | Bacteria | 3450 |
| 498 | Ga0316582_0173070 | 3300036647 | Bacteria | 1467 |
| 499 | Ga0316584_0125882 | 3300036712 | Bacteria | 1914 |
| 500 | Ga0237819_01795 | 3300038705 | Bacteria | 5009 |
| 501 | Ga0400484_12942 | 3300038725 | Bacteria | 5216 |
| 502 | Ga0400484_35463 | 3300038725 | Unclassified | 1485 |
| 503 | Ga0400484_40121 | 3300038725 | Bacteria | 2287 |
| 504 | Ga0400490_01226 | 3300038726 | Unclassified | 2332 |
| 505 | Ga0400490_06757 | 3300038726 | Bacteria | 1515 |
| 506 | Ga0400490_09120 | 3300038726 | Bacteria | 2424 |
| 507 | Ga0400490_21691 | 3300038726 | Bacteria | 1194 |
| 508 | Ga0400490_56575 | 3300038726 | Bacteria | 1759 |
| 509 | Ga0400485_20298 | 3300038735 | Bacteria | 11165 |
| 510 | Ga0400488_07942 | 3300038741 | Bacteria | 5276 |
| 511 | Ga0400488_39372 | 3300038741 | Bacteria | 6613 |
| 512 | Ga0400486_07960 | 3300038742 | Bacteria | 30944 |
| 513 | Ga0400486_09951 | 3300038742 | Bacteria | 43440 |
| 514 | Ga0400483_023904 | 3300039062 | Bacteria | 7280 |
| 515 | Ga0400483_072717 | 3300039062 | Bacteria | 3959 |
| 516 | Ga0400483_086677 | 3300039062 | Bacteria | 66767 |
| 517 | Ga0400483_112441 | 3300039062 | Bacteria | 1347 |
| 518 | Ga0400483_117887 | 3300039062 | Unclassified | 3292 |
| 519 | Ga0400483_189767 | 3300039062 | Bacteria | 6071 |
| 520 | Ga0400483_218673 | 3300039062 | Bacteria | 21299 |
| 521 | Ga0400483_220601 | 3300039062 | Bacteria | 35731 |
| 522 | Ga0400483_250036 | 3300039062 | Bacteria | 396353 |
| 523 | Ga0400489_26060 | 3300039093 | Bacteria | 35012 |
| 524 | Ga0400489_62285 | 3300039093 | Bacteria | 27106 |
| 525 | Ga0400487_15044 | 3300039110 | Bacteria | 1767 |
| 526 | Ga0436365_1910565 | 3300039437 | Bacteria | 475219 |
| 527 | Ga0439436_0000700 | 3300041404 | Bacteria | 9035 |
| 528 | Ga0439438_000001 | 3300041405 | Bacteria | 1263568 |
| 529 | Ga0439438_000936 | 3300041405 | Bacteria | 13027 |
| 530 | Ga0439438_001200 | 3300041405 | Bacteria | 11505 |
| 531 | Ga0439438_002923 | 3300041405 | Bacteria | 7093 |
| 532 | Ga0439438_003266 | 3300041405 | Bacteria | 6626 |
| 533 | Ga0439438_007572 | 3300041405 | Bacteria | 3697 |
| 534 | Ga0439438_015687 | 3300041405 | Bacteria | 2220 |
| 535 | Ga0439438_019352 | 3300041405 | Bacteria | 1924 |
| 536 | Ga0439447_001502 | 3300041407 | Bacteria | 8543 |
| 537 | Ga0439447_003794 | 3300041407 | Bacteria | 5304 |
| 538 | Ga0439447_009195 | 3300041407 | Bacteria | 3010 |
| 539 | Ga0439447_009543 | 3300041407 | Bacteria | 2932 |
| 540 | Ga0439447_013754 | 3300041407 | Bacteria | 2288 |
| 541 | Ga0439447_016505 | 3300041407 | Bacteria | 2025 |
| 542 | Ga0439447_037427 | 3300041407 | Bacteria | 1195 |
| 543 | Ga0439466_0000013 | 3300041411 | Bacteria | 134749 |
| 544 | Ga0439466_0001124 | 3300041411 | Bacteria | 10402 |
| 545 | Ga0439466_0011673 | 3300041411 | Bacteria | 3246 |
| 546 | Ga0439466_0013560 | 3300041411 | Bacteria | 2982 |
| 547 | Ga0439466_0062413 | 3300041411 | Bacteria | 1198 |
| 548 | Ga0439437_000026 | 3300042000 | Bacteria | 11182 |
| 549 | Ga0439432_001755 | 3300042006 | Bacteria | 8127 |
| 550 | Ga0439432_002272 | 3300042006 | Bacteria | 7244 |
| 551 | Ga0439432_002413 | 3300042006 | Bacteria | 7055 |
| 552 | Ga0439432_003075 | 3300042006 | Bacteria | 6216 |
| 553 | Ga0439432_005501 | 3300042006 | Bacteria | 4557 |
| 554 | Ga0439432_007431 | 3300042006 | Bacteria | 3885 |
| 555 | Ga0439432_008354 | 3300042006 | Bacteria | 3636 |
| 556 | Ga0439432_038985 | 3300042006 | Bacteria | 1511 |
| 557 | Ga0439451_007229 | 3300042009 | Bacteria | 2266 |
| 558 | Ga0439451_016810 | 3300042009 | Bacteria | 1472 |
| 559 | Ga0439452_000001 | 3300042010 | Bacteria | 1725439 |
| 560 | Ga0439452_000002 | 3300042010 | Bacteria | 1377577 |
| 561 | Ga0439452_000022 | 3300042010 | Bacteria | 267565 |
| 562 | Ga0439452_000066 | 3300042010 | Bacteria | 92251 |
| 563 | Ga0439452_000101 | 3300042010 | Bacteria | 72026 |
| 564 | Ga0439452_000781 | 3300042010 | Bacteria | 15105 |
| 565 | Ga0439452_001455 | 3300042010 | Bacteria | 9670 |
| 566 | Ga0439452_002278 | 3300042010 | Bacteria | 7164 |
| 567 | Ga0439452_004034 | 3300042010 | Bacteria | 4996 |
| 568 | Ga0439452_010697 | 3300042010 | Bacteria | 2658 |
| 569 | Ga0439452_016819 | 3300042010 | Bacteria | 1978 |
| 570 | Ga0439456_000039 | 3300042013 | Bacteria | 48127 |
| 571 | Ga0439456_001479 | 3300042013 | Bacteria | 4724 |
| 572 | Ga0439456_006017 | 3300042013 | Bacteria | 2471 |
| 573 | Ga0439463_000853 | 3300042016 | Bacteria | 8362 |
| 574 | Ga0439463_001820 | 3300042016 | Bacteria | 5542 |
| 575 | Ga0450911_000002 | 3300042115 | Bacteria | 277703 |
| 576 | Ga0450919_003044 | 3300042121 | Bacteria | 2136 |
| 577 | Ga0450890_013500 | 3300042127 | Bacteria | 1066 |
| 578 | Ga0450902_000054 | 3300042137 | Bacteria | 10769 |
| 579 | Ga0450902_001351 | 3300042137 | Bacteria | 3320 |
| 580 | Ga0450903_010271 | 3300042138 | Bacteria | 1516 |
| 581 | Ga0450904_000035 | 3300042139 | Bacteria | 30443 |
| 582 | Ga0450904_003356 | 3300042139 | Bacteria | 1747 |
| 583 | Ga0450905_000276 | 3300042142 | Bacteria | 6110 |
| 584 | Ga0450905_000679 | 3300042142 | Bacteria | 4166 |
| 585 | Ga0450906_001159 | 3300042145 | Bacteria | 5823 |
| 586 | Ga0450907_001025 | 3300042146 | Bacteria | 6552 |
| 587 | Ga0450907_001598 | 3300042146 | Bacteria | 4795 |
| 588 | Ga0450907_001604 | 3300042146 | Bacteria | 4768 |
| 589 | Ga0450907_018177 | 3300042146 | Bacteria | 1175 |
| 590 | Ga0439446_0000240 | 3300042156 | Bacteria | 10126 |
| 591 | Ga0450909_009403 | 3300042185 | Bacteria | 1426 |
| 592 | Ga0439434_0001047 | 3300042435 | Bacteria | 8018 |
| 593 | Ga0439434_0001060 | 3300042435 | Bacteria | 7982 |
| 594 | Ga0439464_0004058 | 3300042439 | Bacteria | 3727 |
| 595 | Ga0439464_0013200 | 3300042439 | Bacteria | 2208 |
| 596 | Ga0439460_0000893 | 3300042461 | Bacteria | 6826 |
| 597 | Ga0439460_0004840 | 3300042461 | Bacteria | 3291 |
| 598 | Ga0450893_0000791 | 3300042532 | Bacteria | 4642 |
| 599 | Ga0450893_0003075 | 3300042532 | Bacteria | 2623 |
| 600 | Ga0450901_000269 | 3300042533 | Bacteria | 6307 |
| 601 | Ga0451577_0000105 | 3300042876 | Bacteria | 184360 |
| 602 | Ga0451577_0002122 | 3300042876 | Bacteria | 24368 |
| 603 | Ga0451577_0035200 | 3300042876 | Bacteria | 4511 |
| 604 | Ga0451577_0106840 | 3300042876 | Bacteria | 2502 |
| 605 | Ga0439440_0013310 | 3300042993 | Bacteria | 1761 |
| 606 | Ga0466981_0000008 | 3300044669 | Bacteria | 147179 |
| 607 | Ga0453683_0000034 | 3300044673 | Bacteria | 235218 |
| 608 | Ga0453683_0000152 | 3300044673 | Bacteria | 102028 |
| 609 | Ga0453683_0002320 | 3300044673 | Bacteria | 14952 |
| 610 | Ga0453683_0010577 | 3300044673 | Bacteria | 6110 |
| 611 | Ga0453683_0034708 | 3300044673 | Bacteria | 3179 |
| 612 | Ga0453683_0158873 | 3300044673 | Bacteria | 1430 |
| 613 | Ga0453684_0000231 | 3300044712 | Bacteria | 241070 |
| 614 | Ga0453684_0000713 | 3300044712 | Bacteria | 117530 |
| 615 | Ga0453684_0002182 | 3300044712 | Bacteria | 48823 |
| 616 | Ga0453684_0012933 | 3300044712 | Bacteria | 13664 |
| 617 | Ga0453684_0023203 | 3300044712 | Bacteria | 9154 |
| 618 | Ga0453684_0031819 | 3300044712 | Bacteria | 7400 |
| 619 | Ga0453684_0041565 | 3300044712 | Bacteria | 6215 |
| 620 | Ga0453684_0108661 | 3300044712 | Bacteria | 3375 |
| 621 | Ga0453684_0235963 | 3300044712 | Bacteria | 2108 |
| 622 | Ga0451576_0000077 | 3300045051 | Bacteria | 243265 |
| 623 | Ga0451576_0026038 | 3300045051 | Bacteria | 6294 |
| 624 | Ga0495617_000978 | 3300046452 | Bacteria | 13267 |
| 625 | Ga0495617_003030 | 3300046452 | Bacteria | 6403 |
| 626 | Ga0495617_009176 | 3300046452 | Bacteria | 3400 |
| 627 | Ga0495617_011834 | 3300046452 | Bacteria | 2976 |
| 628 | Ga0495617_046308 | 3300046452 | Bacteria | 1449 |
| 629 | Ga0495617_053111 | 3300046452 | Bacteria | 1345 |
| 630 | Ga0495617_086097 | 3300046452 | Bacteria | 1027 |
| 631 | Ga0495627_000021 | 3300046453 | Bacteria | 282454 |
| 632 | Ga0495627_000027 | 3300046453 | Bacteria | 236960 |
| 633 | Ga0495627_000279 | 3300046453 | Bacteria | 51531 |
| 634 | Ga0495627_000789 | 3300046453 | Bacteria | 23155 |
| 635 | Ga0495627_003053 | 3300046453 | Bacteria | 7630 |
| 636 | Ga0495627_009390 | 3300046453 | Bacteria | 3602 |
| 637 | Ga0495627_017288 | 3300046453 | Bacteria | 2454 |
| 638 | Ga0495627_031784 | 3300046453 | Bacteria | 1664 |
| 639 | Ga0495627_050072 | 3300046453 | Bacteria | 1259 |
| 640 | Ga0495603_0221390 | 3300046455 | Bacteria | 1092 |
| 641 | Ga0495590_0003408 | 3300046457 | Bacteria | 6500 |
| 642 | Ga0495590_0008914 | 3300046457 | Bacteria | 3811 |
| 643 | Ga0495590_0053248 | 3300046457 | Bacteria | 1413 |
| 644 | Ga0495591_000007 | 3300046458 | Bacteria | 366385 |
| 645 | Ga0495591_000015 | 3300046458 | Bacteria | 252107 |
| 646 | Ga0495591_000318 | 3300046458 | Bacteria | 43617 |
| 647 | Ga0495591_001085 | 3300046458 | Bacteria | 18132 |
| 648 | Ga0495591_002885 | 3300046458 | Bacteria | 9218 |
| 649 | Ga0495591_004271 | 3300046458 | Bacteria | 7066 |
| 650 | Ga0495591_004439 | 3300046458 | Bacteria | 6880 |
| 651 | Ga0495591_008529 | 3300046458 | Bacteria | 4190 |
| 652 | Ga0495591_010606 | 3300046458 | Bacteria | 3556 |
| 653 | Ga0495591_017922 | 3300046458 | Bacteria | 2415 |
| 654 | Ga0495591_023321 | 3300046458 | Bacteria | 1985 |
| 655 | Ga0495638_0002945 | 3300046460 | Bacteria | 13586 |
| 656 | Ga0495638_0013602 | 3300046460 | Bacteria | 5531 |
| 657 | Ga0495638_0023837 | 3300046460 | Bacteria | 3997 |
| 658 | Ga0495638_0029899 | 3300046460 | Bacteria | 3511 |
| 659 | Ga0495638_0058607 | 3300046460 | Bacteria | 2385 |
| 660 | Ga0495638_0217287 | 3300046460 | Bacteria | 1070 |
| 661 | Ga0495653_0004180 | 3300046463 | Bacteria | 11682 |
| 662 | Ga0495653_0009118 | 3300046463 | Bacteria | 8113 |
| 663 | Ga0495653_0049059 | 3300046463 | Bacteria | 3255 |
| 664 | Ga0495650_0000026 | 3300046471 | Bacteria | 476029 |
| 665 | Ga0495650_0000182 | 3300046471 | Bacteria | 137031 |
| 666 | Ga0495650_0000493 | 3300046471 | Bacteria | 59904 |
| 667 | Ga0495650_0000672 | 3300046471 | Bacteria | 44486 |
| 668 | Ga0495650_0004078 | 3300046471 | Bacteria | 10214 |
| 669 | Ga0495650_0010743 | 3300046471 | Bacteria | 5086 |
| 670 | Ga0495650_0022733 | 3300046471 | Bacteria | 3002 |
| 671 | Ga0495650_0026483 | 3300046471 | Bacteria | 2696 |
| 672 | Ga0495650_0054121 | 3300046471 | Bacteria | 1639 |
| 673 | Ga0495650_0079889 | 3300046471 | Bacteria | 1263 |
| 674 | Ga0495605_0000016 | 3300046474 | Bacteria | 289508 |
| 675 | Ga0495605_0000031 | 3300046474 | Bacteria | 213242 |
| 676 | Ga0495605_0000523 | 3300046474 | Bacteria | 32529 |
| 677 | Ga0495605_0004855 | 3300046474 | Bacteria | 7863 |
| 678 | Ga0495605_0005949 | 3300046474 | Bacteria | 7056 |
| 679 | Ga0495605_0011368 | 3300046474 | Bacteria | 4968 |
| 680 | Ga0495605_0012213 | 3300046474 | Bacteria | 4769 |
| 681 | Ga0495605_0024757 | 3300046474 | Bacteria | 3137 |
| 682 | Ga0495605_0083802 | 3300046474 | Bacteria | 1487 |
| 683 | Ga0495584_0001616 | 3300046491 | Bacteria | 13254 |
| 684 | Ga0495584_0002458 | 3300046491 | Bacteria | 10499 |
| 685 | Ga0495584_0005988 | 3300046491 | Bacteria | 6406 |
| 686 | Ga0495584_0006381 | 3300046491 | Bacteria | 6179 |
| 687 | Ga0495584_0019201 | 3300046491 | Bacteria | 3472 |
| 688 | Ga0495584_0043034 | 3300046491 | Bacteria | 2279 |
| 689 | Ga0495584_0046731 | 3300046491 | Bacteria | 2183 |
| 690 | Ga0495584_0048084 | 3300046491 | Bacteria | 2151 |
| 691 | Ga0495584_0054401 | 3300046491 | Bacteria | 2014 |
| 692 | Ga0495584_0058183 | 3300046491 | Bacteria | 1944 |
| 693 | Ga0495585_0001037 | 3300046492 | Bacteria | 23052 |
| 694 | Ga0495585_0005139 | 3300046492 | Bacteria | 8316 |
| 695 | Ga0495585_0010653 | 3300046492 | Bacteria | 5462 |
| 696 | Ga0495585_0056583 | 3300046492 | Bacteria | 2165 |
| 697 | Ga0495585_0075497 | 3300046492 | Bacteria | 1832 |
| 698 | Ga0495585_0075614 | 3300046492 | Bacteria | 1830 |
| 699 | Ga0495585_0181323 | 3300046492 | Bacteria | 1082 |
| 700 | Ga0495594_0002644 | 3300046499 | Bacteria | 9322 |
| 701 | Ga0495594_0143250 | 3300046499 | Bacteria | 1356 |
| 702 | Ga0495596_0005154 | 3300046500 | Bacteria | 6222 |
| 703 | Ga0495596_0005876 | 3300046500 | Bacteria | 5733 |
| 704 | Ga0495596_0010866 | 3300046500 | Bacteria | 3947 |
| 705 | Ga0495607_0000213 | 3300046501 | Bacteria | 61906 |
| 706 | Ga0495607_0000237 | 3300046501 | Bacteria | 59197 |
| 707 | Ga0495607_0000248 | 3300046501 | Bacteria | 57955 |
| 708 | Ga0495607_0000780 | 3300046501 | Bacteria | 30486 |
| 709 | Ga0495607_0008778 | 3300046501 | Bacteria | 6884 |
| 710 | Ga0495607_0008930 | 3300046501 | Bacteria | 6823 |
| 711 | Ga0495607_0011600 | 3300046501 | Bacteria | 5859 |
| 712 | Ga0495607_0019456 | 3300046501 | Bacteria | 4314 |
| 713 | Ga0495607_0024302 | 3300046501 | Bacteria | 3780 |
| 714 | Ga0495607_0032884 | 3300046501 | Bacteria | 3160 |
| 715 | Ga0495607_0042224 | 3300046501 | Bacteria | 2704 |
| 716 | Ga0495607_0056721 | 3300046501 | Bacteria | 2247 |
| 717 | Ga0495583_0000041 | 3300046506 | Bacteria | 234707 |
| 718 | Ga0495583_0000698 | 3300046506 | Bacteria | 43244 |
| 719 | Ga0495583_0001956 | 3300046506 | Bacteria | 18948 |
| 720 | Ga0495583_0004463 | 3300046506 | Bacteria | 10007 |
| 721 | Ga0495583_0007614 | 3300046506 | Bacteria | 6759 |
| 722 | Ga0495583_0016954 | 3300046506 | Bacteria | 3888 |
| 723 | Ga0495583_0022460 | 3300046506 | Bacteria | 3218 |
| 724 | Ga0495606_0000076 | 3300046507 | Bacteria | 166969 |
| 725 | Ga0495606_0002535 | 3300046507 | Bacteria | 21017 |
| 726 | Ga0495606_0004769 | 3300046507 | Bacteria | 13335 |
| 727 | Ga0495606_0006037 | 3300046507 | Bacteria | 11331 |
| 728 | Ga0495606_0008423 | 3300046507 | Bacteria | 8967 |
| 729 | Ga0495606_0032362 | 3300046507 | Bacteria | 3623 |
| 730 | Ga0495606_0036057 | 3300046507 | Bacteria | 3374 |
| 731 | Ga0495606_0058125 | 3300046507 | Bacteria | 2487 |
| 732 | Ga0495606_0117556 | 3300046507 | Bacteria | 1595 |
| 733 | Ga0495606_0216053 | 3300046507 | Bacteria | 1083 |
| 734 | Ga0495610_0002616 | 3300046512 | Bacteria | 14907 |
| 735 | Ga0495610_0011574 | 3300046512 | Bacteria | 5380 |
| 736 | Ga0495610_0019155 | 3300046512 | Bacteria | 3837 |
| 737 | Ga0495610_0023628 | 3300046512 | Bacteria | 3335 |
| 738 | Ga0495610_0034853 | 3300046512 | Bacteria | 2589 |
| 739 | Ga0495610_0038305 | 3300046512 | Bacteria | 2435 |
| 740 | Ga0495616_0002404 | 3300046513 | Bacteria | 12458 |
| 741 | Ga0495616_0006595 | 3300046513 | Bacteria | 7013 |
| 742 | Ga0495616_0021752 | 3300046513 | Bacteria | 3468 |
| 743 | Ga0495616_0143417 | 3300046513 | Bacteria | 1085 |
| 744 | Ga0495620_0000013 | 3300046515 | Bacteria | 160349 |
| 745 | Ga0495620_0000015 | 3300046515 | Bacteria | 154625 |
| 746 | Ga0495620_0004506 | 3300046515 | Bacteria | 7838 |
| 747 | Ga0495620_0007041 | 3300046515 | Bacteria | 6134 |
| 748 | Ga0495620_0014204 | 3300046515 | Bacteria | 4054 |
| 749 | Ga0495620_0042178 | 3300046515 | Bacteria | 1995 |
| 750 | Ga0495620_0052047 | 3300046515 | Bacteria | 1740 |
| 751 | Ga0495620_0053691 | 3300046515 | Bacteria | 1705 |
| 752 | Ga0495620_0060381 | 3300046515 | Bacteria | 1581 |
| 753 | Ga0495631_0001077 | 3300046518 | Bacteria | 16951 |
| 754 | Ga0495631_0005273 | 3300046518 | Bacteria | 6792 |
| 755 | Ga0495631_0012543 | 3300046518 | Bacteria | 4135 |
| 756 | Ga0495631_0125795 | 3300046518 | Bacteria | 1102 |
| 757 | Ga0495632_0000912 | 3300046519 | Bacteria | 25920 |
| 758 | Ga0495632_0000914 | 3300046519 | Bacteria | 25916 |
| 759 | Ga0495632_0001648 | 3300046519 | Bacteria | 18284 |
| 760 | Ga0495632_0001676 | 3300046519 | Bacteria | 18117 |
| 761 | Ga0495632_0002354 | 3300046519 | Bacteria | 14486 |
| 762 | Ga0495632_0004171 | 3300046519 | Bacteria | 9898 |
| 763 | Ga0495632_0004792 | 3300046519 | Bacteria | 9107 |
| 764 | Ga0495632_0006071 | 3300046519 | Bacteria | 7836 |
| 765 | Ga0495632_0039895 | 3300046519 | Bacteria | 2367 |
| 766 | Ga0495632_0061073 | 3300046519 | Bacteria | 1829 |
| 767 | Ga0495637_0000913 | 3300046520 | Bacteria | 18936 |
| 768 | Ga0495637_0002612 | 3300046520 | Bacteria | 9881 |
| 769 | Ga0495637_0003141 | 3300046520 | Bacteria | 8816 |
| 770 | Ga0495637_0007261 | 3300046520 | Bacteria | 5510 |
| 771 | Ga0495637_0007862 | 3300046520 | Bacteria | 5260 |
| 772 | Ga0495637_0030027 | 3300046520 | Bacteria | 2414 |
| 773 | Ga0495637_0031219 | 3300046520 | Bacteria | 2358 |
| 774 | Ga0495637_0039831 | 3300046520 | Bacteria | 2025 |
| 775 | Ga0495637_0083328 | 3300046520 | Bacteria | 1271 |
| 776 | Ga0495643_0000223 | 3300046522 | Bacteria | 86920 |
| 777 | Ga0495643_0000903 | 3300046522 | Bacteria | 31380 |
| 778 | Ga0495643_0005943 | 3300046522 | Bacteria | 8141 |
| 779 | Ga0495643_0010375 | 3300046522 | Bacteria | 5734 |
| 780 | Ga0495643_0018092 | 3300046522 | Bacteria | 4103 |
| 781 | Ga0495643_0068346 | 3300046522 | Bacteria | 1870 |
| 782 | Ga0495643_0084132 | 3300046522 | Bacteria | 1651 |
| 783 | Ga0495643_0153275 | 3300046522 | Bacteria | 1139 |
| 784 | Ga0495644_0000723 | 3300046523 | Bacteria | 13701 |
| 785 | Ga0495644_0002168 | 3300046523 | Bacteria | 7885 |
| 786 | Ga0495644_0007316 | 3300046523 | Bacteria | 4264 |
| 787 | Ga0495644_0011601 | 3300046523 | Bacteria | 3392 |
| 788 | Ga0495644_0105733 | 3300046523 | Bacteria | 1066 |
| 789 | Ga0495648_0001423 | 3300046524 | Bacteria | 23410 |
| 790 | Ga0495648_0002171 | 3300046524 | Bacteria | 18452 |
| 791 | Ga0495648_0002708 | 3300046524 | Bacteria | 16008 |
| 792 | Ga0495648_0006275 | 3300046524 | Bacteria | 9727 |
| 793 | Ga0495648_0013055 | 3300046524 | Bacteria | 6162 |
| 794 | Ga0495648_0015574 | 3300046524 | Bacteria | 5515 |
| 795 | Ga0495648_0035683 | 3300046524 | Bacteria | 3220 |
| 796 | Ga0495648_0050318 | 3300046524 | Bacteria | 2546 |
| 797 | Ga0495648_0051193 | 3300046524 | Bacteria | 2518 |
| 798 | Ga0495648_0116647 | 3300046524 | Bacteria | 1442 |
| 799 | Ga0495648_0130266 | 3300046524 | Bacteria | 1338 |
| 800 | Ga0495666_0001375 | 3300046526 | Bacteria | 11789 |
| 801 | Ga0495666_0009905 | 3300046526 | Bacteria | 4760 |
| 802 | Ga0495666_0018038 | 3300046526 | Bacteria | 3515 |
| 803 | Ga0495642_0000153 | 3300046528 | Bacteria | 39992 |
| 804 | Ga0495642_0000800 | 3300046528 | Bacteria | 15289 |
| 805 | Ga0495654_0000007 | 3300046530 | Bacteria | 403529 |
| 806 | Ga0495654_0000069 | 3300046530 | Bacteria | 120853 |
| 807 | Ga0495654_0000356 | 3300046530 | Bacteria | 39697 |
| 808 | Ga0495654_0001518 | 3300046530 | Bacteria | 15840 |
| 809 | Ga0495654_0001554 | 3300046530 | Bacteria | 15582 |
| 810 | Ga0495654_0001707 | 3300046530 | Bacteria | 14761 |
| 811 | Ga0495654_0002300 | 3300046530 | Bacteria | 12356 |
| 812 | Ga0495654_0003578 | 3300046530 | Bacteria | 9458 |
| 813 | Ga0495654_0005355 | 3300046530 | Bacteria | 7476 |
| 814 | Ga0495654_0009802 | 3300046530 | Bacteria | 5235 |
| 815 | Ga0495654_0015604 | 3300046530 | Bacteria | 4031 |
| 816 | Ga0495654_0016284 | 3300046530 | Bacteria | 3934 |
| 817 | Ga0495654_0038838 | 3300046530 | Bacteria | 2378 |
| 818 | Ga0495654_0048535 | 3300046530 | Bacteria | 2082 |
| 819 | Ga0495654_0049043 | 3300046530 | Bacteria | 2069 |
| 820 | Ga0495654_0062178 | 3300046530 | Bacteria | 1790 |
| 821 | Ga0495654_0114533 | 3300046530 | Bacteria | 1226 |
| 822 | Ga0495654_0121992 | 3300046530 | Bacteria | 1178 |
| 823 | Ga0495587_0077495 | 3300046536 | Bacteria | 1929 |
| 824 | Ga0495609_0000015 | 3300046538 | Bacteria | 322474 |
| 825 | Ga0495609_0000070 | 3300046538 | Bacteria | 128181 |
| 826 | Ga0495609_0003891 | 3300046538 | Bacteria | 8374 |
| 827 | Ga0495609_0005696 | 3300046538 | Bacteria | 6488 |
| 828 | Ga0495597_0000005 | 3300046542 | Bacteria | 286580 |
| 829 | Ga0495597_0000174 | 3300046542 | Bacteria | 57170 |
| 830 | Ga0495597_0005772 | 3300046542 | Bacteria | 6497 |
| 831 | Ga0495597_0007051 | 3300046542 | Bacteria | 5754 |
| 832 | Ga0495597_0018470 | 3300046542 | Bacteria | 3272 |
| 833 | Ga0495597_0033564 | 3300046542 | Bacteria | 2323 |
| 834 | Ga0495645_0030346 | 3300046543 | Bacteria | 3937 |
| 835 | Ga0495622_0009062 | 3300046557 | Bacteria | 4607 |
| 836 | Ga0495633_0000060 | 3300046558 | Bacteria | 144561 |
| 837 | Ga0495656_0006796 | 3300046615 | Bacteria | 4021 |
| 838 | Ga0495668_0016569 | 3300046616 | Bacteria | 4282 |
| 839 | Ga0495668_0025217 | 3300046616 | Bacteria | 3380 |
| 840 | Ga0495668_0044242 | 3300046616 | Bacteria | 2474 |
| 841 | Ga0495611_0000720 | 3300046648 | Bacteria | 18678 |
| 842 | Ga0495611_0000817 | 3300046648 | Bacteria | 17225 |
| 843 | Ga0495611_0003033 | 3300046648 | Bacteria | 7477 |
| 844 | Ga0495611_0003416 | 3300046648 | Bacteria | 7005 |
| 845 | Ga0495611_0069106 | 3300046648 | Bacteria | 1613 |
| 846 | Ga0495625_0001491 | 3300046660 | Bacteria | 28149 |
| 847 | Ga0495625_0004073 | 3300046660 | Bacteria | 13960 |
| 848 | Ga0495625_0008789 | 3300046660 | Bacteria | 8554 |
| 849 | Ga0495625_0048065 | 3300046660 | Bacteria | 3074 |
| 850 | Ga0495625_0116723 | 3300046660 | Bacteria | 1820 |
| 851 | Ga0495625_0129471 | 3300046660 | Bacteria | 1710 |
| 852 | Ga0495625_0130031 | 3300046660 | Bacteria | 1706 |
| 853 | Ga0495625_0262401 | 3300046660 | Bacteria | 1117 |
| 854 | Ga0495635_0037354 | 3300046663 | Bacteria | 3363 |
| 855 | Ga0495661_0000110 | 3300046665 | Bacteria | 97854 |
| 856 | Ga0495661_0000139 | 3300046665 | Bacteria | 85160 |
| 857 | Ga0495661_0000194 | 3300046665 | Bacteria | 70173 |
| 858 | Ga0495661_0000304 | 3300046665 | Bacteria | 56019 |
| 859 | Ga0495661_0019103 | 3300046665 | Bacteria | 4496 |
| 860 | Ga0495661_0026217 | 3300046665 | Bacteria | 3755 |
| 861 | Ga0495661_0027633 | 3300046665 | Bacteria | 3639 |
| 862 | Ga0495661_0042224 | 3300046665 | Bacteria | 2812 |
| 863 | Ga0495661_0153040 | 3300046665 | Bacteria | 1244 |
| 864 | Ga0495661_0190255 | 3300046665 | Bacteria | 1081 |
| 865 | Ga0495588_0008789 | 3300046674 | Bacteria | 4642 |
| 866 | Ga0495588_0040628 | 3300046674 | Bacteria | 2373 |
| 867 | Ga0495623_0069962 | 3300046679 | Bacteria | 2186 |
| 868 | Ga0495646_0091703 | 3300046680 | Bacteria | 1753 |
| 869 | Ga0495669_0017189 | 3300046684 | Bacteria | 3101 |
| 870 | Ga0495613_0301470 | 3300046689 | Bacteria | 1109 |
| 871 | Ga0495670_0004111 | 3300046691 | Bacteria | 7142 |
| 872 | Ga0495670_0005750 | 3300046691 | Bacteria | 6080 |
| 873 | Ga0495671_0001949 | 3300046692 | Bacteria | 13244 |
| 874 | Ga0495671_0006975 | 3300046692 | Bacteria | 6478 |
| 875 | Ga0495671_0010944 | 3300046692 | Bacteria | 5009 |
| 876 | Ga0495671_0012308 | 3300046692 | Bacteria | 4676 |
| 877 | Ga0495671_0012367 | 3300046692 | Bacteria | 4665 |
| 878 | Ga0495671_0017262 | 3300046692 | Bacteria | 3842 |
| 879 | Ga0495671_0022086 | 3300046692 | Bacteria | 3336 |
| 880 | Ga0495671_0053917 | 3300046692 | Bacteria | 1994 |
| 881 | Ga0495671_0056015 | 3300046692 | Bacteria | 1952 |
| 882 | Ga0495671_0102462 | 3300046692 | Bacteria | 1398 |
| 883 | Ga0495649_0001408 | 3300046694 | Bacteria | 18166 |
| 884 | Ga0495649_0002123 | 3300046694 | Bacteria | 14216 |
| 885 | Ga0495649_0006667 | 3300046694 | Bacteria | 7166 |
| 886 | Ga0495649_0006754 | 3300046694 | Bacteria | 7108 |
| 887 | Ga0495649_0014726 | 3300046694 | Bacteria | 4470 |
| 888 | Ga0495649_0023580 | 3300046694 | Bacteria | 3437 |
| 889 | Ga0495649_0045699 | 3300046694 | Bacteria | 2386 |
| 890 | Ga0495649_0063994 | 3300046694 | Bacteria | 1975 |
| 891 | Ga0495649_0099940 | 3300046694 | Bacteria | 1542 |
| 892 | Ga0495589_0000001 | 3300046794 | Bacteria | 888100 |
| 893 | Ga0495589_0002276 | 3300046794 | Bacteria | 10787 |
| 894 | Ga0495589_0005001 | 3300046794 | Bacteria | 7021 |
| 895 | Ga0495589_0005441 | 3300046794 | Bacteria | 6719 |
| 896 | Ga0495589_0015046 | 3300046794 | Bacteria | 3981 |
| 897 | Ga0495600_0056440 | 3300046809 | Bacteria | 2565 |
| 898 | Ga0495600_0103275 | 3300046809 | Bacteria | 1857 |
| 899 | Ga0495660_0000004 | 3300046810 | Bacteria | 1003183 |
| 900 | Ga0495660_0000016 | 3300046810 | Bacteria | 321859 |
| 901 | Ga0495660_0001756 | 3300046810 | Bacteria | 14444 |
| 902 | Ga0495660_0003768 | 3300046810 | Bacteria | 9298 |
| 903 | Ga0495660_0012461 | 3300046810 | Bacteria | 4936 |
| 904 | Ga0495660_0018712 | 3300046810 | Bacteria | 3978 |
| 905 | Ga0495660_0022208 | 3300046810 | Bacteria | 3625 |
| 906 | Ga0495660_0023661 | 3300046810 | Bacteria | 3504 |
| 907 | Ga0495660_0066105 | 3300046810 | Bacteria | 1928 |
| 908 | Ga0495660_0113743 | 3300046810 | Bacteria | 1378 |
| 909 | Ga0495581_0285140 | 3300047315 | Bacteria | 965 |
| 910 | Ga0495604_0167636 | 3300047317 | Bacteria | 1547 |
| 911 | Ga0495604_0333389 | 3300047317 | Bacteria | 1011 |
| 912 | Ga0495636_0009371 | 3300047318 | Bacteria | 3856 |
| 913 | Ga0495672_0000001 | 3300047320 | Bacteria | 1458820 |
| 914 | Ga0495672_0000015 | 3300047320 | Bacteria | 502855 |
| 915 | Ga0495672_0000076 | 3300047320 | Bacteria | 174487 |
| 916 | Ga0495672_0002745 | 3300047320 | Bacteria | 15776 |
| 917 | Ga0495672_0006543 | 3300047320 | Bacteria | 8982 |
| 918 | Ga0495672_0014337 | 3300047320 | Bacteria | 5432 |
| 919 | Ga0495672_0022683 | 3300047320 | Bacteria | 4076 |
| 920 | Ga0495672_0023110 | 3300047320 | Bacteria | 4030 |
| 921 | Ga0495672_0026253 | 3300047320 | Bacteria | 3718 |
| 922 | Ga0495672_0071400 | 3300047320 | Bacteria | 1965 |
| 923 | Ga0495672_0121507 | 3300047320 | Bacteria | 1387 |
| 924 | Ga0495676_0000013 | 3300047321 | Bacteria | 213031 |
| 925 | Ga0495676_0067231 | 3300047321 | Bacteria | 2773 |
| 926 | Ga0495680_0167094 | 3300047322 | Bacteria | 1594 |
| 927 | Ga0495683_0000027 | 3300047323 | Bacteria | 153730 |
| 928 | Ga0495683_0000261 | 3300047323 | Bacteria | 47209 |
| 929 | Ga0495683_0014602 | 3300047323 | Bacteria | 4092 |
| 930 | Ga0495683_0018906 | 3300047323 | Bacteria | 3557 |
| 931 | Ga0495683_0021349 | 3300047323 | Bacteria | 3336 |
| 932 | Ga0495683_0022851 | 3300047323 | Bacteria | 3215 |
| 933 | Ga0495683_0057536 | 3300047323 | Bacteria | 1932 |
| 934 | Ga0495683_0084407 | 3300047323 | Bacteria | 1545 |
| 935 | Ga0495683_0152496 | 3300047323 | Bacteria | 1074 |
| 936 | Ga0495687_005661 | 3300047443 | Bacteria | 7890 |
| 937 | Ga0495675_0009682 | 3300047444 | Bacteria | 6006 |
| 938 | Ga0495675_0044070 | 3300047444 | Bacteria | 2841 |
| 939 | Ga0495679_000005 | 3300047446 | Bacteria | 455007 |
| 940 | Ga0495679_000206 | 3300047446 | Bacteria | 51518 |
| 941 | Ga0495679_005588 | 3300047446 | Bacteria | 5547 |
| 942 | Ga0495679_024505 | 3300047446 | Bacteria | 2031 |
| 943 | Ga0495679_030670 | 3300047446 | Bacteria | 1742 |
| 944 | Ga0495679_033117 | 3300047446 | Bacteria | 1652 |
| 945 | Ga0495673_0000007 | 3300047469 | Bacteria | 796722 |
| 946 | Ga0495673_0000358 | 3300047469 | Bacteria | 56024 |
| 947 | Ga0495673_0001257 | 3300047469 | Bacteria | 20926 |
| 948 | Ga0495673_0002579 | 3300047469 | Bacteria | 12608 |
| 949 | Ga0495673_0003090 | 3300047469 | Bacteria | 11196 |
| 950 | Ga0495673_0005035 | 3300047469 | Bacteria | 8094 |
| 951 | Ga0495673_0005632 | 3300047469 | Bacteria | 7526 |
| 952 | Ga0495673_0006585 | 3300047469 | Bacteria | 6812 |
| 953 | Ga0495673_0007928 | 3300047469 | Bacteria | 6030 |
| 954 | Ga0495673_0009812 | 3300047469 | Bacteria | 5262 |
| 955 | Ga0495673_0010469 | 3300047469 | Bacteria | 5038 |
| 956 | Ga0495673_0015057 | 3300047469 | Bacteria | 3999 |
| 957 | Ga0495673_0015965 | 3300047469 | Bacteria | 3852 |
| 958 | Ga0495673_0017418 | 3300047469 | Bacteria | 3650 |
| 959 | Ga0495673_0022001 | 3300047469 | Bacteria | 3133 |
| 960 | Ga0495673_0033902 | 3300047469 | Bacteria | 2364 |
| 961 | Ga0495673_0034146 | 3300047469 | Bacteria | 2353 |
| 962 | Ga0495673_0061061 | 3300047469 | Bacteria | 1615 |
| 963 | Ga0495673_0074043 | 3300047469 | Bacteria | 1426 |
| 964 | Ga0495681_0001327 | 3300047470 | Bacteria | 18719 |
| 965 | Ga0495681_0002119 | 3300047470 | Bacteria | 14429 |
| 966 | Ga0495681_0004330 | 3300047470 | Bacteria | 9713 |
| 967 | Ga0495681_0005466 | 3300047470 | Bacteria | 8496 |
| 968 | Ga0495681_0009761 | 3300047470 | Bacteria | 5876 |
| 969 | Ga0495681_0014330 | 3300047470 | Bacteria | 4550 |
| 970 | Ga0495681_0061521 | 3300047470 | Bacteria | 1729 |
| 971 | Ga0495686_0088025 | 3300047472 | Bacteria | 1888 |
| 972 | Ga0495686_0088724 | 3300047472 | Bacteria | 1879 |
| 973 | Ga0495626_0000056 | 3300048091 | Bacteria | 150654 |
| 974 | Ga0495626_0001052 | 3300048091 | Bacteria | 23584 |
| 975 | Ga0495626_0001474 | 3300048091 | Bacteria | 18588 |
| 976 | Ga0495626_0001525 | 3300048091 | Bacteria | 18206 |
| 977 | Ga0495626_0002948 | 3300048091 | Bacteria | 11327 |
| 978 | Ga0495626_0003635 | 3300048091 | Bacteria | 9813 |
| 979 | Ga0495626_0004137 | 3300048091 | Bacteria | 9005 |
| 980 | Ga0495626_0009473 | 3300048091 | Bacteria | 5262 |
| 981 | Ga0495626_0016825 | 3300048091 | Bacteria | 3706 |
| 982 | Ga0495626_0017201 | 3300048091 | Bacteria | 3657 |
| 983 | Ga0495626_0123335 | 3300048091 | Bacteria | 1111 |
| 984 | Ga0496100_0014748 | 3300048903 | Bacteria | 4545 |
| 985 | Ga0496101_0000093 | 3300048904 | Bacteria | 95734 |
| 986 | Ga0496101_0028513 | 3300048904 | Bacteria | 3898 |
| 987 | Ga0496101_0267964 | 3300048904 | Bacteria | 1333 |
| 988 | Ga0496102_0006258 | 3300048905 | Bacteria | 10150 |
| 989 | Ga0496102_0047483 | 3300048905 | Bacteria | 3902 |
| 990 | Ga0496104_0000328 | 3300048907 | Bacteria | 42377 |
| 991 | Ga0496104_0002655 | 3300048907 | Bacteria | 15391 |
| 992 | Ga0496105_0004370 | 3300048908 | Bacteria | 10645 |
| 993 | Ga0496110_0029079 | 3300048913 | Bacteria | 4752 |
| 994 | Ga0496113_0122856 | 3300048916 | Bacteria | 2032 |
| 995 | Ga0496114_0018708 | 3300048917 | Bacteria | 5605 |
| 996 | Ga0496114_0019375 | 3300048917 | Bacteria | 5513 |
| 997 | Ga0496116_0000001 | 3300048919 | Bacteria | 1501681 |
| 998 | Ga0496116_0000086 | 3300048919 | Bacteria | 217597 |
| 999 | Ga0496116_0000094 | 3300048919 | Bacteria | 205588 |
| 1000 | Ga0496116_0000163 | 3300048919 | Bacteria | 134121 |
| 1001 | Ga0496116_0001669 | 3300048919 | Bacteria | 24382 |
| 1002 | Ga0496116_0002562 | 3300048919 | Bacteria | 18976 |
| 1003 | Ga0496116_0003077 | 3300048919 | Bacteria | 16822 |
| 1004 | Ga0496116_0005711 | 3300048919 | Bacteria | 11446 |
| 1005 | Ga0496116_0040547 | 3300048919 | Bacteria | 3206 |
| 1006 | Ga0496116_0047037 | 3300048919 | Bacteria | 2907 |
| 1007 | Ga0496116_0067062 | 3300048919 | Bacteria | 2293 |
| 1008 | Ga0496116_0073422 | 3300048919 | Bacteria | 2156 |
| 1009 | Ga0496117_0000009 | 3300048920 | Bacteria | 613759 |
| 1010 | Ga0496117_0000058 | 3300048920 | Bacteria | 264132 |
| 1011 | Ga0496117_0000378 | 3300048920 | Bacteria | 76852 |
| 1012 | Ga0496117_0001274 | 3300048920 | Bacteria | 37377 |
| 1013 | Ga0496117_0002620 | 3300048920 | Bacteria | 22324 |
| 1014 | Ga0496117_0003171 | 3300048920 | Bacteria | 19546 |
| 1015 | Ga0496117_0003939 | 3300048920 | Bacteria | 16796 |
| 1016 | Ga0496117_0006411 | 3300048920 | Bacteria | 11929 |
| 1017 | Ga0496117_0007875 | 3300048920 | Bacteria | 10247 |
| 1018 | Ga0496117_0008528 | 3300048920 | Bacteria | 9722 |
| 1019 | Ga0496117_0012252 | 3300048920 | Bacteria | 7581 |
| 1020 | Ga0496117_0016135 | 3300048920 | Bacteria | 6318 |
| 1021 | Ga0496117_0025007 | 3300048920 | Bacteria | 4703 |
| 1022 | Ga0496117_0035911 | 3300048920 | Bacteria | 3714 |
| 1023 | Ga0496117_0044858 | 3300048920 | Bacteria | 3199 |
| 1024 | Ga0496117_0125930 | 3300048920 | Bacteria | 1563 |
| 1025 | Ga0496117_0128128 | 3300048920 | Bacteria | 1544 |
| 1026 | Ga0496118_0000007 | 3300048921 | Bacteria | 650986 |
| 1027 | Ga0496118_0000199 | 3300048921 | Bacteria | 105620 |
| 1028 | Ga0496118_0001807 | 3300048921 | Bacteria | 30813 |
| 1029 | Ga0496118_0002970 | 3300048921 | Bacteria | 21939 |
| 1030 | Ga0496118_0004470 | 3300048921 | Bacteria | 16575 |
| 1031 | Ga0496118_0006308 | 3300048921 | Bacteria | 13104 |
| 1032 | Ga0496118_0006442 | 3300048921 | Bacteria | 12897 |
| 1033 | Ga0496118_0010654 | 3300048921 | Bacteria | 9070 |
| 1034 | Ga0496118_0010787 | 3300048921 | Bacteria | 9006 |
| 1035 | Ga0496118_0040415 | 3300048921 | Bacteria | 3708 |
| 1036 | Ga0496118_0069631 | 3300048921 | Bacteria | 2546 |
| 1037 | Ga0496118_0090361 | 3300048921 | Bacteria | 2110 |
| 1038 | Ga0496118_0097843 | 3300048921 | Bacteria | 1995 |
| 1039 | Ga0496119_0000001 | 3300048922 | Bacteria | 789520 |
| 1040 | Ga0496119_0000018 | 3300048922 | Bacteria | 306476 |
| 1041 | Ga0496119_0000106 | 3300048922 | Bacteria | 116871 |
| 1042 | Ga0496119_0000111 | 3300048922 | Bacteria | 114905 |
| 1043 | Ga0496119_0000112 | 3300048922 | Bacteria | 114767 |
| 1044 | Ga0496119_0001831 | 3300048922 | Bacteria | 24634 |
| 1045 | Ga0496119_0006761 | 3300048922 | Bacteria | 10518 |
| 1046 | Ga0496119_0006919 | 3300048922 | Bacteria | 10344 |
| 1047 | Ga0496119_0007156 | 3300048922 | Bacteria | 10118 |
| 1048 | Ga0496119_0019652 | 3300048922 | Bacteria | 4962 |
| 1049 | Ga0496119_0036624 | 3300048922 | Bacteria | 3199 |
| 1050 | Ga0496119_0037014 | 3300048922 | Bacteria | 3176 |
| 1051 | Ga0496119_0037439 | 3300048922 | Bacteria | 3150 |
| 1052 | Ga0496119_0056638 | 3300048922 | Bacteria | 2374 |
| 1053 | Ga0496119_0103631 | 3300048922 | Bacteria | 1593 |
| 1054 | Ga0496120_0000002 | 3300048923 | Bacteria | 547999 |
| 1055 | Ga0496120_0000116 | 3300048923 | Bacteria | 135302 |
| 1056 | Ga0496120_0000152 | 3300048923 | Bacteria | 114905 |
| 1057 | Ga0496120_0000641 | 3300048923 | Bacteria | 51804 |
| 1058 | Ga0496120_0000917 | 3300048923 | Bacteria | 41032 |
| 1059 | Ga0496120_0000921 | 3300048923 | Bacteria | 40877 |
| 1060 | Ga0496120_0000940 | 3300048923 | Bacteria | 40056 |
| 1061 | Ga0496120_0002130 | 3300048923 | Bacteria | 21149 |
| 1062 | Ga0496120_0003722 | 3300048923 | Bacteria | 13561 |
| 1063 | Ga0496120_0004409 | 3300048923 | Bacteria | 11819 |
| 1064 | Ga0496120_0011462 | 3300048923 | Bacteria | 6094 |
| 1065 | Ga0496120_0022189 | 3300048923 | Bacteria | 3996 |
| 1066 | Ga0496120_0029556 | 3300048923 | Bacteria | 3344 |
| 1067 | Ga0496120_0033093 | 3300048923 | Bacteria | 3109 |
| 1068 | Ga0496120_0046921 | 3300048923 | Bacteria | 2493 |
| 1069 | Ga0496120_0166617 | 3300048923 | Bacteria | 1093 |
| 1070 | Ga0496121_0000544 | 3300048924 | Bacteria | 71622 |
| 1071 | Ga0496121_0001283 | 3300048924 | Bacteria | 43277 |
| 1072 | Ga0496121_0003009 | 3300048924 | Bacteria | 24478 |
| 1073 | Ga0496121_0008399 | 3300048924 | Bacteria | 12168 |
| 1074 | Ga0496121_0009768 | 3300048924 | Bacteria | 10971 |
| 1075 | Ga0496121_0013228 | 3300048924 | Bacteria | 8891 |
| 1076 | Ga0496121_0017560 | 3300048924 | Bacteria | 7296 |
| 1077 | Ga0496121_0022025 | 3300048924 | Bacteria | 6206 |
| 1078 | Ga0496121_0028049 | 3300048924 | Bacteria | 5250 |
| 1079 | Ga0496121_0028786 | 3300048924 | Bacteria | 5161 |
| 1080 | Ga0496121_0041289 | 3300048924 | Bacteria | 4034 |
| 1081 | Ga0496121_0233744 | 3300048924 | Bacteria | 1285 |
| 1082 | Ga0496122_0000003 | 3300048925 | Bacteria | 645810 |
| 1083 | Ga0496122_0000007 | 3300048925 | Bacteria | 606493 |
| 1084 | Ga0496122_0000122 | 3300048925 | Bacteria | 181491 |
| 1085 | Ga0496122_0000211 | 3300048925 | Bacteria | 130145 |
| 1086 | Ga0496122_0000264 | 3300048925 | Bacteria | 117620 |
| 1087 | Ga0496122_0003261 | 3300048925 | Bacteria | 21531 |
| 1088 | Ga0496122_0003412 | 3300048925 | Bacteria | 20907 |
| 1089 | Ga0496122_0006802 | 3300048925 | Bacteria | 12988 |
| 1090 | Ga0496122_0008288 | 3300048925 | Bacteria | 11271 |
| 1091 | Ga0496122_0009298 | 3300048925 | Bacteria | 10388 |
| 1092 | Ga0496122_0020664 | 3300048925 | Bacteria | 5933 |
| 1093 | Ga0496122_0026934 | 3300048925 | Bacteria | 4935 |
| 1094 | Ga0496122_0029929 | 3300048925 | Bacteria | 4575 |
| 1095 | Ga0496122_0046369 | 3300048925 | Bacteria | 3367 |
| 1096 | Ga0496122_0158012 | 3300048925 | Bacteria | 1387 |
| 1097 | Ga0496122_0259220 | 3300048925 | Bacteria | 966 |
| 1098 | Ga0496123_0000004 | 3300048926 | Bacteria | 777230 |
| 1099 | Ga0496123_0000047 | 3300048926 | Bacteria | 244302 |
| 1100 | Ga0496123_0000215 | 3300048926 | Bacteria | 117620 |
| 1101 | Ga0496123_0000391 | 3300048926 | Bacteria | 82015 |
| 1102 | Ga0496123_0000507 | 3300048926 | Bacteria | 67803 |
| 1103 | Ga0496123_0000878 | 3300048926 | Bacteria | 47732 |
| 1104 | Ga0496123_0001340 | 3300048926 | Bacteria | 34830 |
| 1105 | Ga0496123_0001635 | 3300048926 | Bacteria | 30148 |
| 1106 | Ga0496123_0002536 | 3300048926 | Bacteria | 22362 |
| 1107 | Ga0496123_0003243 | 3300048926 | Bacteria | 18515 |
| 1108 | Ga0496123_0012443 | 3300048926 | Bacteria | 7253 |
| 1109 | Ga0496123_0046368 | 3300048926 | Bacteria | 2949 |
| 1110 | Ga0496123_0052447 | 3300048926 | Bacteria | 2706 |
| 1111 | Ga0496123_0198302 | 3300048926 | Bacteria | 1031 |
| 1112 | Ga0496124_0000008 | 3300048927 | Bacteria | 864372 |
| 1113 | Ga0496124_0000025 | 3300048927 | Bacteria | 405471 |
| 1114 | Ga0496124_0000222 | 3300048927 | Bacteria | 110854 |
| 1115 | Ga0496124_0000357 | 3300048927 | Bacteria | 83170 |
| 1116 | Ga0496124_0001891 | 3300048927 | Bacteria | 28792 |
| 1117 | Ga0496124_0002226 | 3300048927 | Bacteria | 25820 |
| 1118 | Ga0496124_0005218 | 3300048927 | Bacteria | 14743 |
| 1119 | Ga0496124_0005891 | 3300048927 | Bacteria | 13570 |
| 1120 | Ga0496124_0006121 | 3300048927 | Bacteria | 13215 |
| 1121 | Ga0496124_0010141 | 3300048927 | Bacteria | 9589 |
| 1122 | Ga0496124_0011885 | 3300048927 | Bacteria | 8668 |
| 1123 | Ga0496124_0012924 | 3300048927 | Bacteria | 8190 |
| 1124 | Ga0496124_0013421 | 3300048927 | Bacteria | 7995 |
| 1125 | Ga0496124_0016180 | 3300048927 | Bacteria | 7110 |
| 1126 | Ga0496124_0020850 | 3300048927 | Bacteria | 6047 |
| 1127 | Ga0496124_0025858 | 3300048927 | Bacteria | 5305 |
| 1128 | Ga0496124_0034180 | 3300048927 | Bacteria | 4465 |
| 1129 | Ga0496124_0041187 | 3300048927 | Bacteria | 3989 |
| 1130 | Ga0496124_0049308 | 3300048927 | Bacteria | 3593 |
| 1131 | Ga0496124_0058510 | 3300048927 | Bacteria | 3240 |
| 1132 | Ga0496124_0073840 | 3300048927 | Bacteria | 2821 |
| 1133 | Ga0496124_0085811 | 3300048927 | Bacteria | 2578 |
| 1134 | Ga0496124_0102408 | 3300048927 | Bacteria | 2317 |
| 1135 | Ga0496124_0103594 | 3300048927 | Bacteria | 2302 |
| 1136 | Ga0496124_0105661 | 3300048927 | Bacteria | 2274 |
| 1137 | Ga0496124_0120836 | 3300048927 | Bacteria | 2093 |
| 1138 | Ga0496124_0173580 | 3300048927 | Bacteria | 1666 |
| 1139 | Ga0496124_0179691 | 3300048927 | Bacteria | 1629 |
| 1140 | Ga0496124_0185756 | 3300048927 | Bacteria | 1595 |
| 1141 | Ga0496124_0205723 | 3300048927 | Bacteria | 1493 |
| 1142 | Ga0496125_0000013 | 3300048928 | Bacteria | 628761 |
| 1143 | Ga0496125_0000065 | 3300048928 | Bacteria | 249830 |
| 1144 | Ga0496125_0000908 | 3300048928 | Bacteria | 46824 |
| 1145 | Ga0496125_0019451 | 3300048928 | Bacteria | 6403 |
| 1146 | Ga0496125_0020974 | 3300048928 | Bacteria | 6111 |
| 1147 | Ga0496125_0027866 | 3300048928 | Bacteria | 5112 |
| 1148 | Ga0496125_0027889 | 3300048928 | Bacteria | 5109 |
| 1149 | Ga0496125_0042239 | 3300048928 | Bacteria | 3886 |
| 1150 | Ga0496125_0046158 | 3300048928 | Bacteria | 3657 |
| 1151 | Ga0496125_0046322 | 3300048928 | Bacteria | 3648 |
| 1152 | Ga0496125_0081689 | 3300048928 | Bacteria | 2467 |
| 1153 | Ga0496125_0232512 | 3300048928 | Bacteria | 1177 |
| 1154 | Ga0496126_0000276 | 3300048929 | Bacteria | 108459 |
| 1155 | Ga0496126_0001263 | 3300048929 | Bacteria | 40762 |
| 1156 | Ga0496126_0015473 | 3300048929 | Bacteria | 7672 |
| 1157 | Ga0496126_0040844 | 3300048929 | Bacteria | 4298 |
| 1158 | Ga0496126_0051784 | 3300048929 | Bacteria | 3736 |
| 1159 | Ga0496126_0062444 | 3300048929 | Bacteria | 3342 |
| 1160 | Ga0496126_0071241 | 3300048929 | Bacteria | 3094 |
| 1161 | Ga0496126_0172684 | 3300048929 | Bacteria | 1840 |
| 1162 | Ga0496126_0198450 | 3300048929 | Bacteria | 1695 |
| 1163 | Ga0496126_0287497 | 3300048929 | Bacteria | 1360 |
| 1164 | Ga0496126_0300501 | 3300048929 | Bacteria | 1324 |
| 1165 | Ga0495678_000031 | 3300049459 | Bacteria | 215528 |
| 1166 | Ga0495678_000039 | 3300049459 | Bacteria | 191665 |
| 1167 | Ga0495678_000091 | 3300049459 | Bacteria | 114504 |
| 1168 | Ga0495678_005928 | 3300049459 | Bacteria | 6606 |
| 1169 | Ga0495678_008574 | 3300049459 | Bacteria | 5141 |
| 1170 | Ga0495678_008769 | 3300049459 | Bacteria | 5067 |
| 1171 | Ga0495678_011885 | 3300049459 | Bacteria | 4149 |
| 1172 | Ga0495678_012838 | 3300049459 | Bacteria | 3953 |
| 1173 | Ga0495678_015738 | 3300049459 | Bacteria | 3473 |
| 1174 | Ga0495678_052291 | 3300049459 | Bacteria | 1573 |
| 1175 | Ga0495678_068829 | 3300049459 | Bacteria | 1303 |
| 1176 | Ga0495678_086545 | 3300049459 | Bacteria | 1114 |
| 1177 | Ga0495682_0000001 | 3300049460 | Bacteria | 1559116 |
| 1178 | Ga0495682_0000577 | 3300049460 | Bacteria | 24873 |
| 1179 | Ga0495682_0004465 | 3300049460 | Bacteria | 5977 |
| 1180 | Ga0501034_0000137 | 3300049571 | Bacteria | 136592 |
| 1181 | Ga0501037_0042957 | 3300049573 | Bacteria | 3322 |
| 1182 | Ga0501226_000007 | 3300049853 | Bacteria | 227827 |
| 1183 | nmdc:mga00v17_14833_c1 | 3300050491 | Bacteria | 4359 |
| 1184 | nmdc:mga00v17_228261_c1 | 3300050491 | Bacteria | 1206 |
| 1185 | Ga0500618_022861 | 3300053125 | Bacteria | 1516 |
| 1186 | Ga0500621_000002 | 3300053126 | Bacteria | 849473 |
| 1187 | Ga0500659_0021849 | 3300053135 | Bacteria | 3488 |
| 1188 | Ga0500573_0024813 | 3300053140 | Bacteria | 3447 |
| 1189 | Ga0500634_0018308 | 3300053161 | Bacteria | 3760 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046616 | Ga0495668_0044242 | Ga0495668_0044242_22_828 | 267 |
| 2 | 3300046507 | Ga0495606_0036057 | Ga0495606_0036057_2535_3350 | 271 |
| 3 | iso_pu_bacteria | 2974298342 | 2974301232 | 280 |
| 4 | 3300014497 | Ga0182008_10004762 | Ga0182008_100047625 | 288 |
| 5 | 3300025961 | Ga0207712_10025540 | Ga0207712_100255405 | 288 |
| 6 | 3300036647 | Ga0316582_0173070 | Ga0316582_0173070_35_919 | 288 |
| 7 | 3300042010 | Ga0439452_004034 | Ga0439452_004034_4110_4976 | 288 |
| 8 | 3300042185 | Ga0450909_009403 | Ga0450909_009403_16_882 | 288 |
| 9 | 3300046458 | Ga0495591_017922 | Ga0495591_017922_1527_2396 | 288 |
| 10 | 3300046491 | Ga0495584_0048084 | Ga0495584_0048084_10_876 | 288 |
| 11 | 3300046492 | Ga0495585_0075497 | Ga0495585_0075497_13_879 | 288 |
| 12 | 3300046507 | Ga0495606_0216053 | Ga0495606_0216053_190_1059 | 288 |
| 13 | 3300046515 | Ga0495620_0052047 | Ga0495620_0052047_18_884 | 288 |
| 14 | 3300046520 | Ga0495637_0083328 | Ga0495637_0083328_377_1243 | 288 |
| 15 | 3300046526 | Ga0495666_0001375 | Ga0495666_0001375_23_889 | 288 |
| 16 | 3300046530 | Ga0495654_0114533 | Ga0495654_0114533_264_1130 | 288 |
| 17 | 3300047317 | Ga0495604_0167636 | Ga0495604_0167636_24_890 | 288 |
| 18 | 3300048922 | Ga0496119_0056638 | Ga0496119_0056638_1488_2354 | 288 |
| 19 | 3300048925 | Ga0496122_0259220 | Ga0496122_0259220_24_893 | 288 |
| 20 | 3300048928 | Ga0496125_0046322 | Ga0496125_0046322_21_887 | 288 |
| 21 | 3300046463 | Ga0495653_0009118 | Ga0495653_0009118_13_897 | 294 |
| 22 | 3300047315 | Ga0495581_0285140 | Ga0495581_0285140_67_951 | 294 |
| 23 | 3300048926 | Ga0496123_0198302 | Ga0496123_0198302_24_929 | 301 |
| 24 | 3300053161 | Ga0500634_0018308 | Ga0500634_0018308_2805_3710 | 301 |
| 25 | 3300032168 | Ga0316593_10008423 | Ga0316593_100084233 | 303 |
| 26 | 3300046474 | Ga0495605_0083802 | Ga0495605_0083802_541_1452 | 303 |
| 27 | 3300046557 | Ga0495622_0009062 | Ga0495622_0009062_24_935 | 303 |
| 28 | 3300046674 | Ga0495588_0040628 | Ga0495588_0040628_1433_2344 | 303 |
| 29 | 3300035398 | Ga0316574_0076175 | Ga0316574_0076175_997_1974 | 304 |
| 30 | 3300042013 | Ga0439456_000039 | Ga0439456_000039_122_1078 | 305 |
| 31 | 3300042876 | Ga0451577_0002122 | Ga0451577_0002122_17980_18912 | 305 |
| 32 | 3300038735 | Ga0400485_20298 | Ga0400485_20298_4211_5146 | 306 |
| 33 | 3300049853 | Ga0501226_000007 | Ga0501226_000007_108864_109835 | 306 |
| 34 | 3300046522 | Ga0495643_0153275 | Ga0495643_0153275_17_943 | 308 |
| 35 | 3300046530 | Ga0495654_0038838 | Ga0495654_0038838_28_954 | 308 |
| 36 | 3300047317 | Ga0495604_0333389 | Ga0495604_0333389_26_952 | 308 |
| 37 | 3300047322 | Ga0495680_0167094 | Ga0495680_0167094_650_1576 | 308 |
| 38 | 3300047446 | Ga0495679_033117 | Ga0495679_033117_715_1641 | 308 |
| 39 | 3300048927 | Ga0496124_0013421 | Ga0496124_0013421_3523_4479 | 311 |
| 40 | iso_pu_bacteria | 2847085930 | 2847087278 | 311 |
| 41 | iso_pu_bacteria | 2908669403 | 2908669409 | 311 |
| 42 | 3300038725 | Ga0400484_12942 | Ga0400484_12942_1298_2254 | 312 |
| 43 | 3300039062 | Ga0400483_023904 | Ga0400483_023904_2619_3572 | 312 |
| 44 | 3300039062 | Ga0400483_218673 | Ga0400483_218673_19699_20652 | 312 |
| 45 | iso_pu_bacteria | 2511231025 | 2511382943 | 312 |
| 46 | iso_pu_bacteria | 2511231035 | 2511435056 | 312 |
| 47 | iso_pu_bacteria | 2599185299 | 2599926000 | 312 |
| 48 | iso_pu_bacteria | 2608642108 | 2608669768 | 312 |
| 49 | iso_pu_bacteria | 2648501693 | 2650896432 | 312 |
| 50 | iso_pu_bacteria | 2684622997 | 2686353712 | 312 |
| 51 | iso_pu_bacteria | 2690315857 | 2691329960 | 312 |
| 52 | iso_pu_bacteria | 2808606414 | 2809124988 | 312 |
| 53 | iso_pu_bacteria | 2844528606 | 2844528737 | 312 |
| 54 | iso_pu_bacteria | 2847797336 | 2847799501 | 312 |
| 55 | iso_pu_bacteria | 2865014394 | 2865018377 | 312 |
| 56 | iso_pu_bacteria | 2876601092 | 2876603880 | 312 |
| 57 | iso_pu_bacteria | 2881609920 | 2881611555 | 312 |
| 58 | iso_pu_bacteria | 2881714928 | 2881716291 | 312 |
| 59 | iso_pu_bacteria | 2884086401 | 2884088324 | 312 |
| 60 | iso_pu_bacteria | 2919534386 | 2919537804 | 312 |
| 61 | iso_pu_bacteria | 2919688452 | 2919690783 | 312 |
| 62 | iso_pu_bacteria | 2939573065 | 2939573250 | 312 |
| 63 | iso_pu_bacteria | 2939602548 | 2939606094 | 312 |
| 64 | iso_pu_bacteria | 2945951305 | 2945952623 | 312 |
| 65 | iso_pu_bacteria | 2978975091 | 2978979192 | 312 |
| 66 | iso_pu_bacteria | 2984494565 | 2984497001 | 312 |
| 67 | iso_pu_bacteria | 2990261002 | 2990262417 | 312 |
| 68 | iso_pu_bacteria | 8016733728 | 8016735574 | 312 |
| 69 | iso_pu_bacteria | 8019499862 | 8019501038 | 312 |
| 70 | 3300038725 | Ga0400484_35463 | Ga0400484_35463_474_1466 | 313 |
| 71 | 3300038725 | Ga0400484_40121 | Ga0400484_40121_336_1295 | 313 |
| 72 | 3300038726 | Ga0400490_01226 | Ga0400490_01226_335_1294 | 313 |
| 73 | 3300038726 | Ga0400490_06757 | Ga0400490_06757_403_1362 | 313 |
| 74 | 3300038726 | Ga0400490_09120 | Ga0400490_09120_31_1023 | 313 |
| 75 | 3300038726 | Ga0400490_21691 | Ga0400490_21691_105_1073 | 313 |
| 76 | 3300038726 | Ga0400490_56575 | Ga0400490_56575_572_1531 | 313 |
| 77 | 3300038741 | Ga0400488_07942 | Ga0400488_07942_275_1234 | 313 |
| 78 | 3300038741 | Ga0400488_39372 | Ga0400488_39372_4555_5514 | 313 |
| 79 | 3300038742 | Ga0400486_07960 | Ga0400486_07960_2555_3514 | 313 |
| 80 | 3300038742 | Ga0400486_09951 | Ga0400486_09951_30403_31362 | 313 |
| 81 | 3300039062 | Ga0400483_072717 | Ga0400483_072717_509_1507 | 313 |
| 82 | 3300039062 | Ga0400483_086677 | Ga0400483_086677_21233_22192 | 313 |
| 83 | 3300039062 | Ga0400483_220601 | Ga0400483_220601_11942_12901 | 313 |
| 84 | 3300039093 | Ga0400489_26060 | Ga0400489_26060_27902_28861 | 313 |
| 85 | 3300039093 | Ga0400489_62285 | Ga0400489_62285_10456_11415 | 313 |
| 86 | iso_pu_bacteria | 2506520007 | 2506578952 | 313 |
| 87 | iso_pu_bacteria | 2506520008 | 2506584091 | 313 |
| 88 | iso_pu_bacteria | 2508501071 | 2508852825 | 313 |
| 89 | iso_pu_bacteria | 2537561728 | 2538424375 | 313 |
| 90 | iso_pu_bacteria | 2547132181 | 2547695532 | 313 |
| 91 | iso_pu_bacteria | 2547132416 | 2548650422 | 313 |
| 92 | iso_pu_bacteria | 2554235234 | 2555261036 | 313 |
| 93 | iso_pu_bacteria | 2561511199 | 2562463154 | 313 |
| 94 | iso_pu_bacteria | 2565956521 | 2566038430 | 313 |
| 95 | iso_pu_bacteria | 2585427591 | 2585827606 | 313 |
| 96 | iso_pu_bacteria | 2585427592 | 2585832326 | 313 |
| 97 | iso_pu_bacteria | 2599185169 | 2599408671 | 313 |
| 98 | iso_pu_bacteria | 2600255254 | 2601522817 | 313 |
| 99 | iso_pu_bacteria | 2600255255 | 2601527844 | 313 |
| 100 | iso_pu_bacteria | 2600255256 | 2601533368 | 313 |
| 101 | iso_pu_bacteria | 2600255257 | 2601541014 | 313 |
| 102 | iso_pu_bacteria | 2600255280 | 2601614675 | 313 |
| 103 | iso_pu_bacteria | 2600255281 | 2601619395 | 313 |
| 104 | iso_pu_bacteria | 2600255287 | 2601642011 | 313 |
| 105 | iso_pu_bacteria | 2600255288 | 2601646847 | 313 |
| 106 | iso_pu_bacteria | 2600255289 | 2601652822 | 313 |
| 107 | iso_pu_bacteria | 2600255290 | 2601658148 | 313 |
| 108 | iso_pu_bacteria | 2600255291 | 2601661833 | 313 |
| 109 | iso_pu_bacteria | 2600255298 | 2601694791 | 313 |
| 110 | iso_pu_bacteria | 2600255299 | 2601701754 | 313 |
| 111 | iso_pu_bacteria | 2600255300 | 2601706669 | 313 |
| 112 | iso_pu_bacteria | 2600255301 | 2601710973 | 313 |
| 113 | iso_pu_bacteria | 2600255302 | 2601715987 | 313 |
| 114 | iso_pu_bacteria | 2600255303 | 2601719818 | 313 |
| 115 | iso_pu_bacteria | 2600255304 | 2601726393 | 313 |
| 116 | iso_pu_bacteria | 2600255305 | 2601730934 | 313 |
| 117 | iso_pu_bacteria | 2600255306 | 2601735949 | 313 |
| 118 | iso_pu_bacteria | 2600255307 | 2601741213 | 313 |
| 119 | iso_pu_bacteria | 2600255309 | 2601751144 | 313 |
| 120 | iso_pu_bacteria | 2600255310 | 2601759512 | 313 |
| 121 | iso_pu_bacteria | 2600255311 | 2601763425 | 313 |
| 122 | iso_pu_bacteria | 2600255392 | 2602018397 | 313 |
| 123 | iso_pu_bacteria | 2602042046 | 2603637301 | 313 |
| 124 | iso_pu_bacteria | 2602042047 | 2603645189 | 313 |
| 125 | iso_pu_bacteria | 2602042052 | 2603661513 | 313 |
| 126 | iso_pu_bacteria | 2602042053 | 2603664467 | 313 |
| 127 | iso_pu_bacteria | 2602042066 | 2603698977 | 313 |
| 128 | iso_pu_bacteria | 2602042067 | 2603702379 | 313 |
| 129 | iso_pu_bacteria | 2602042103 | 2603838328 | 313 |
| 130 | iso_pu_bacteria | 2602042104 | 2603843406 | 313 |
| 131 | iso_pu_bacteria | 2602042105 | 2603848479 | 313 |
| 132 | iso_pu_bacteria | 2602042106 | 2603853552 | 313 |
| 133 | iso_pu_bacteria | 2602042109 | 2603868888 | 313 |
| 134 | iso_pu_bacteria | 2602042110 | 2603871606 | 313 |
| 135 | iso_pu_bacteria | 2602042111 | 2603876506 | 313 |
| 136 | iso_pu_bacteria | 2603880178 | 2606048797 | 313 |
| 137 | iso_pu_bacteria | 2603880184 | 2606068899 | 313 |
| 138 | iso_pu_bacteria | 2603880202 | 2606144690 | 313 |
| 139 | iso_pu_bacteria | 2603880211 | 2606176199 | 313 |
| 140 | iso_pu_bacteria | 2609459761 | 2609910623 | 313 |
| 141 | iso_pu_bacteria | 2636415599 | 2637224472 | 313 |
| 142 | iso_pu_bacteria | 2648501241 | 2649121063 | 313 |
| 143 | iso_pu_bacteria | 2651869818 | 2652974596 | 313 |
| 144 | iso_pu_bacteria | 2654587920 | 2656279825 | 313 |
| 145 | iso_pu_bacteria | 2667528172 | 2671101541 | 313 |
| 146 | iso_pu_bacteria | 2667528173 | 2671108690 | 313 |
| 147 | iso_pu_bacteria | 2671180115 | 2671588351 | 313 |
| 148 | iso_pu_bacteria | 2675903046 | 2676405810 | 313 |
| 149 | iso_pu_bacteria | 2681812866 | 2681998223 | 313 |
| 150 | iso_pu_bacteria | 2681812869 | 2682006011 | 313 |
| 151 | iso_pu_bacteria | 2687453601 | 2689445404 | 313 |
| 152 | iso_pu_bacteria | 2706794495 | 2707099007 | 313 |
| 153 | iso_pu_bacteria | 2711768156 | 2712469264 | 313 |
| 154 | iso_pu_bacteria | 2751185917 | 2753856552 | 313 |
| 155 | iso_pu_bacteria | 2765235842 | 2765589582 | 313 |
| 156 | iso_pu_bacteria | 2772190666 | 2772439377 | 313 |
| 157 | iso_pu_bacteria | 2775506706 | 2775539583 | 313 |
| 158 | iso_pu_bacteria | 2775507074 | 2777023121 | 313 |
| 159 | iso_pu_bacteria | 2791354903 | 2791921724 | 313 |
| 160 | iso_pu_bacteria | 2791355010 | 2792310537 | 313 |
| 161 | iso_pu_bacteria | 2791355275 | 2793405134 | 313 |
| 162 | iso_pu_bacteria | 2806310673 | 2807179797 | 313 |
| 163 | iso_pu_bacteria | 2811995292 | 2813728347 | 313 |
| 164 | iso_pu_bacteria | 2814123068 | 2814695856 | 313 |
| 165 | iso_pu_bacteria | 2821118458 | 2821121732 | 313 |
| 166 | iso_pu_bacteria | 2823373977 | 2823375304 | 313 |
| 167 | iso_pu_bacteria | 2844425489 | 2844428017 | 313 |
| 168 | iso_pu_bacteria | 2846540461 | 2846543697 | 313 |
| 169 | iso_pu_bacteria | 2852103415 | 2852104537 | 313 |
| 170 | iso_pu_bacteria | 2855195626 | 2855198797 | 313 |
| 171 | iso_pu_bacteria | 2858466076 | 2858467061 | 313 |
| 172 | iso_pu_bacteria | 2869551831 | 2869554852 | 313 |
| 173 | iso_pu_bacteria | 2871272651 | 2871275221 | 313 |
| 174 | iso_pu_bacteria | 2871282230 | 2871285173 | 313 |
| 175 | iso_pu_bacteria | 2887630918 | 2887631465 | 313 |
| 176 | iso_pu_bacteria | 2888366609 | 2888369437 | 313 |
| 177 | iso_pu_bacteria | 2888373701 | 2888377921 | 313 |
| 178 | iso_pu_bacteria | 2891670763 | 2891671231 | 313 |
| 179 | iso_pu_bacteria | 2894510363 | 2894513083 | 313 |
| 180 | iso_pu_bacteria | 2900051742 | 2900052223 | 313 |
| 181 | iso_pu_bacteria | 2904474040 | 2904475615 | 313 |
| 182 | iso_pu_bacteria | 2904504865 | 2904507562 | 313 |
| 183 | iso_pu_bacteria | 2904513164 | 2904514596 | 313 |
| 184 | iso_pu_bacteria | 2916178963 | 2916182953 | 313 |
| 185 | iso_pu_bacteria | 2919108558 | 2919111440 | 313 |
| 186 | iso_pu_bacteria | 2919150387 | 2919151784 | 313 |
| 187 | iso_pu_bacteria | 2919493220 | 2919497159 | 313 |
| 188 | iso_pu_bacteria | 2919497567 | 2919500080 | 313 |
| 189 | iso_pu_bacteria | 2919543075 | 2919544467 | 313 |
| 190 | iso_pu_bacteria | 2923525760 | 2923527770 | 313 |
| 191 | iso_pu_bacteria | 2923634449 | 2923635468 | 313 |
| 192 | iso_pu_bacteria | 2927143783 | 2927144453 | 313 |
| 193 | iso_pu_bacteria | 2927833300 | 2927833558 | 313 |
| 194 | iso_pu_bacteria | 2932406140 | 2932407866 | 313 |
| 195 | iso_pu_bacteria | 2935625433 | 2935626191 | 313 |
| 196 | iso_pu_bacteria | 2937539931 | 2937542153 | 313 |
| 197 | iso_pu_bacteria | 2937967321 | 2937968009 | 313 |
| 198 | iso_pu_bacteria | 2939568625 | 2939569617 | 313 |
| 199 | iso_pu_bacteria | 2939577877 | 2939580271 | 313 |
| 200 | iso_pu_bacteria | 2939607340 | 2939609027 | 313 |
| 201 | iso_pu_bacteria | 2939617950 | 2939618113 | 313 |
| 202 | iso_pu_bacteria | 2939642701 | 2939643363 | 313 |
| 203 | iso_pu_bacteria | 2945874760 | 2945878552 | 313 |
| 204 | iso_pu_bacteria | 2969079654 | 2969081511 | 313 |
| 205 | iso_pu_bacteria | 2971820967 | 2971822952 | 313 |
| 206 | iso_pu_bacteria | 2974310843 | 2974311488 | 313 |
| 207 | iso_pu_bacteria | 2974435778 | 2974438891 | 313 |
| 208 | iso_pu_bacteria | 2984559226 | 2984563926 | 313 |
| 209 | iso_pu_bacteria | 2984595703 | 2984596659 | 313 |
| 210 | iso_pu_bacteria | 2989392574 | 2989393300 | 313 |
| 211 | iso_pu_bacteria | 3000376612 | 3000379483 | 313 |
| 212 | iso_pu_bacteria | 640753048 | 640938328 | 313 |
| 213 | iso_pu_bacteria | 8004592986 | 8004596975 | 313 |
| 214 | iso_pu_bacteria | 8015394850 | 8015395568 | 313 |
| 215 | iso_pu_bacteria | 8018221730 | 8018222693 | 313 |
| 216 | iso_pu_bacteria | 8018405270 | 8018409696 | 313 |
| 217 | iso_pu_bacteria | 8019504834 | 8019505550 | 313 |
| 218 | iso_pu_bacteria | 8054357960 | 8054359966 | 313 |
| 219 | iso_pu_bacteria | 8054844752 | 8054848991 | 313 |
| 220 | iso_pu_bacteria | 8054849141 | 8054849250 | 313 |
| 221 | iso_pu_bacteria | 8055087960 | 8055090417 | 313 |
| 222 | iso_pu_bacteria | 8055092621 | 8055095129 | 313 |
| 223 | iso_pu_bacteria | 8055097453 | 8055098571 | 313 |
| 224 | iso_pu_bacteria | 8055693939 | 8055695853 | 313 |
| 225 | iso_pu_bacteria | 8057304971 | 8057307152 | 313 |
| 226 | iso_pu_bacteria | 2511231004 | 2511256631 | 314 |
| 227 | iso_pu_bacteria | 2511231006 | 2511267516 | 314 |
| 228 | iso_pu_bacteria | 2511231007 | 2511273451 | 314 |
| 229 | iso_pu_bacteria | 2511231008 | 2511276460 | 314 |
| 230 | iso_pu_bacteria | 2511231010 | 2511291120 | 314 |
| 231 | iso_pu_bacteria | 2511231011 | 2511295742 | 314 |
| 232 | iso_pu_bacteria | 2511231012 | 2511300117 | 314 |
| 233 | iso_pu_bacteria | 2511231014 | 2511313457 | 314 |
| 234 | iso_pu_bacteria | 2511231015 | 2511317326 | 314 |
| 235 | iso_pu_bacteria | 2511231016 | 2511329195 | 314 |
| 236 | iso_pu_bacteria | 2511231017 | 2511330768 | 314 |
| 237 | iso_pu_bacteria | 2511231018 | 2511336586 | 314 |
| 238 | iso_pu_bacteria | 2511231019 | 2511346079 | 314 |
| 239 | iso_pu_bacteria | 2511231020 | 2511352532 | 314 |
| 240 | iso_pu_bacteria | 2511231021 | 2511355778 | 314 |
| 241 | iso_pu_bacteria | 2511231022 | 2511362537 | 314 |
| 242 | iso_pu_bacteria | 2511231023 | 2511369591 | 314 |
| 243 | iso_pu_bacteria | 2511231024 | 2511375557 | 314 |
| 244 | iso_pu_bacteria | 2511231031 | 2511414837 | 314 |
| 245 | iso_pu_bacteria | 2511231156 | 2511823037 | 314 |
| 246 | iso_pu_bacteria | 2512047018 | 2512324260 | 314 |
| 247 | iso_pu_bacteria | 2554235231 | 2555244603 | 314 |
| 248 | iso_pu_bacteria | 2554235341 | 2555671854 | 314 |
| 249 | iso_pu_bacteria | 2582580891 | 2583794348 | 314 |
| 250 | iso_pu_bacteria | 2597489887 | 2597859939 | 314 |
| 251 | iso_pu_bacteria | 2597489888 | 2597862333 | 314 |
| 252 | iso_pu_bacteria | 2597489889 | 2597868055 | 314 |
| 253 | iso_pu_bacteria | 2599185155 | 2599330100 | 314 |
| 254 | iso_pu_bacteria | 2599185160 | 2599353991 | 314 |
| 255 | iso_pu_bacteria | 2599185161 | 2599360330 | 314 |
| 256 | iso_pu_bacteria | 2599185162 | 2599366652 | 314 |
| 257 | iso_pu_bacteria | 2599185163 | 2599373441 | 314 |
| 258 | iso_pu_bacteria | 2599185164 | 2599379099 | 314 |
| 259 | iso_pu_bacteria | 2599185165 | 2599385923 | 314 |
| 260 | iso_pu_bacteria | 2599185166 | 2599392300 | 314 |
| 261 | iso_pu_bacteria | 2599185167 | 2599397061 | 314 |
| 262 | iso_pu_bacteria | 2599185168 | 2599404066 | 314 |
| 263 | iso_pu_bacteria | 2599185179 | 2599449054 | 314 |
| 264 | iso_pu_bacteria | 2599185181 | 2599460825 | 314 |
| 265 | iso_pu_bacteria | 2599185182 | 2599470372 | 314 |
| 266 | iso_pu_bacteria | 2599185185 | 2599482767 | 314 |
| 267 | iso_pu_bacteria | 2599185186 | 2599489846 | 314 |
| 268 | iso_pu_bacteria | 2599185188 | 2599501143 | 314 |
| 269 | iso_pu_bacteria | 2599185189 | 2599508828 | 314 |
| 270 | iso_pu_bacteria | 2599185190 | 2599511202 | 314 |
| 271 | iso_pu_bacteria | 2599185191 | 2599519307 | 314 |
| 272 | iso_pu_bacteria | 2599185212 | 2599613896 | 314 |
| 273 | iso_pu_bacteria | 2599185248 | 2599770786 | 314 |
| 274 | iso_pu_bacteria | 2599185257 | 2599803507 | 314 |
| 275 | iso_pu_bacteria | 2599185288 | 2599879649 | 314 |
| 276 | iso_pu_bacteria | 2599185289 | 2599886665 | 314 |
| 277 | iso_pu_bacteria | 2599185290 | 2599890576 | 314 |
| 278 | iso_pu_bacteria | 2599185291 | 2599897035 | 314 |
| 279 | iso_pu_bacteria | 2599185300 | 2599934698 | 314 |
| 280 | iso_pu_bacteria | 2599185302 | 2599943035 | 314 |
| 281 | iso_pu_bacteria | 2599185303 | 2599948148 | 314 |
| 282 | iso_pu_bacteria | 2599185304 | 2599953926 | 314 |
| 283 | iso_pu_bacteria | 2599185305 | 2599959435 | 314 |
| 284 | iso_pu_bacteria | 2599185306 | 2599968043 | 314 |
| 285 | iso_pu_bacteria | 2599185307 | 2599974111 | 314 |
| 286 | iso_pu_bacteria | 2599185308 | 2599979234 | 314 |
| 287 | iso_pu_bacteria | 2599185309 | 2599985331 | 314 |
| 288 | iso_pu_bacteria | 2599185310 | 2599987255 | 314 |
| 289 | iso_pu_bacteria | 2599185311 | 2599995434 | 314 |
| 290 | iso_pu_bacteria | 2599185312 | 2599999916 | 314 |
| 291 | iso_pu_bacteria | 2599185313 | 2600008825 | 314 |
| 292 | iso_pu_bacteria | 2599185314 | 2600013119 | 314 |
| 293 | iso_pu_bacteria | 2599185315 | 2600016630 | 314 |
| 294 | iso_pu_bacteria | 2599185316 | 2600025348 | 314 |
| 295 | iso_pu_bacteria | 2599185317 | 2600029596 | 314 |
| 296 | iso_pu_bacteria | 2599185318 | 2600035512 | 314 |
| 297 | iso_pu_bacteria | 2599185319 | 2600041360 | 314 |
| 298 | iso_pu_bacteria | 2599185320 | 2600045582 | 314 |
| 299 | iso_pu_bacteria | 2599185321 | 2600056600 | 314 |
| 300 | iso_pu_bacteria | 2599185322 | 2600058490 | 314 |
| 301 | iso_pu_bacteria | 2599185323 | 2600063841 | 314 |
| 302 | iso_pu_bacteria | 2599185324 | 2600074165 | 314 |
| 303 | iso_pu_bacteria | 2599185325 | 2600079807 | 314 |
| 304 | iso_pu_bacteria | 2599185356 | 2600213440 | 314 |
| 305 | iso_pu_bacteria | 2600254930 | 2600358274 | 314 |
| 306 | iso_pu_bacteria | 2600254931 | 2600365210 | 314 |
| 307 | iso_pu_bacteria | 2600255283 | 2601625730 | 314 |
| 308 | iso_pu_bacteria | 2600255296 | 2601690918 | 314 |
| 309 | iso_pu_bacteria | 2600255313 | 2601773607 | 314 |
| 310 | iso_pu_bacteria | 2600255318 | 2601799803 | 314 |
| 311 | iso_pu_bacteria | 2603880185 | 2606074011 | 314 |
| 312 | iso_pu_bacteria | 2603880199 | 2606126344 | 314 |
| 313 | iso_pu_bacteria | 2619619299 | 2621301542 | 314 |
| 314 | iso_pu_bacteria | 2623620443 | 2624482554 | 314 |
| 315 | iso_pu_bacteria | 2623620446 | 2624494076 | 314 |
| 316 | iso_pu_bacteria | 2643221565 | 2643844267 | 314 |
| 317 | iso_pu_bacteria | 2643221571 | 2643868896 | 314 |
| 318 | iso_pu_bacteria | 2643221589 | 2643952282 | 314 |
| 319 | iso_pu_bacteria | 2643221602 | 2644023956 | 314 |
| 320 | iso_pu_bacteria | 2643221633 | 2644188047 | 314 |
| 321 | iso_pu_bacteria | 2643221650 | 2644281582 | 314 |
| 322 | iso_pu_bacteria | 2643221713 | 2644624009 | 314 |
| 323 | iso_pu_bacteria | 2651869719 | 2652548335 | 314 |
| 324 | iso_pu_bacteria | 2667528170 | 2671094467 | 314 |
| 325 | iso_pu_bacteria | 2667528171 | 2671096573 | 314 |
| 326 | iso_pu_bacteria | 2667528176 | 2671127919 | 314 |
| 327 | iso_pu_bacteria | 2671180172 | 2671770925 | 314 |
| 328 | iso_pu_bacteria | 2675903420 | 2677898170 | 314 |
| 329 | iso_pu_bacteria | 2675903515 | 2678261568 | 314 |
| 330 | iso_pu_bacteria | 2713897148 | 2715752120 | 314 |
| 331 | iso_pu_bacteria | 2713897149 | 2715755048 | 314 |
| 332 | iso_pu_bacteria | 2718217725 | 2718635756 | 314 |
| 333 | iso_pu_bacteria | 2721755607 | 2723247224 | 314 |
| 334 | iso_pu_bacteria | 2738541265 | 2738673762 | 314 |
| 335 | iso_pu_bacteria | 2738541271 | 2738691548 | 314 |
| 336 | iso_pu_bacteria | 2738541282 | 2738752155 | 314 |
| 337 | iso_pu_bacteria | 2738541294 | 2738809107 | 314 |
| 338 | iso_pu_bacteria | 2738541303 | 2738861196 | 314 |
| 339 | iso_pu_bacteria | 2738541309 | 2738896467 | 314 |
| 340 | iso_pu_bacteria | 2738543004 | 2739198383 | 314 |
| 341 | iso_pu_bacteria | 2738543015 | 2739256848 | 314 |
| 342 | iso_pu_bacteria | 2738543016 | 2739267323 | 314 |
| 343 | iso_pu_bacteria | 2738543020 | 2739286200 | 314 |
| 344 | iso_pu_bacteria | 2738543021 | 2739291513 | 314 |
| 345 | iso_pu_bacteria | 2738543025 | 2739315546 | 314 |
| 346 | iso_pu_bacteria | 2740892503 | 2743739481 | 314 |
| 347 | iso_pu_bacteria | 2744054620 | 2745007917 | 314 |
| 348 | iso_pu_bacteria | 2765235841 | 2765585687 | 314 |
| 349 | iso_pu_bacteria | 2773857670 | 2774120624 | 314 |
| 350 | iso_pu_bacteria | 2773857673 | 2774133435 | 314 |
| 351 | iso_pu_bacteria | 2784132063 | 2784262683 | 314 |
| 352 | iso_pu_bacteria | 2784132072 | 2784313541 | 314 |
| 353 | iso_pu_bacteria | 2791355520 | 2794594365 | 314 |
| 354 | iso_pu_bacteria | 2806310737 | 2807406927 | 314 |
| 355 | iso_pu_bacteria | 2806310745 | 2807455259 | 314 |
| 356 | iso_pu_bacteria | 2808606361 | 2808854089 | 314 |
| 357 | iso_pu_bacteria | 2808606376 | 2808923380 | 314 |
| 358 | iso_pu_bacteria | 2808606377 | 2808930392 | 314 |
| 359 | iso_pu_bacteria | 2808606378 | 2808934121 | 314 |
| 360 | iso_pu_bacteria | 2808606380 | 2808945345 | 314 |
| 361 | iso_pu_bacteria | 2808606381 | 2808952514 | 314 |
| 362 | iso_pu_bacteria | 2808606382 | 2808956685 | 314 |
| 363 | iso_pu_bacteria | 2808606383 | 2808962478 | 314 |
| 364 | iso_pu_bacteria | 2808606385 | 2808975247 | 314 |
| 365 | iso_pu_bacteria | 2808606388 | 2808991114 | 314 |
| 366 | iso_pu_bacteria | 2808606389 | 2808997481 | 314 |
| 367 | iso_pu_bacteria | 2808606445 | 2809218433 | 314 |
| 368 | iso_pu_bacteria | 2816332298 | 2817489104 | 314 |
| 369 | iso_pu_bacteria | 2818991456 | 2819656241 | 314 |
| 370 | iso_pu_bacteria | 2818991464 | 2819701666 | 314 |
| 371 | iso_pu_bacteria | 2825651385 | 2825653709 | 314 |
| 372 | iso_pu_bacteria | 2826581358 | 2826585739 | 314 |
| 373 | iso_pu_bacteria | 2834028612 | 2834029007 | 314 |
| 374 | iso_pu_bacteria | 2842805378 | 2842805629 | 314 |
| 375 | iso_pu_bacteria | 2842815866 | 2842818609 | 314 |
| 376 | iso_pu_bacteria | 2842826826 | 2842828724 | 314 |
| 377 | iso_pu_bacteria | 2842832357 | 2842837400 | 314 |
| 378 | iso_pu_bacteria | 2842837860 | 2842843212 | 314 |
| 379 | iso_pu_bacteria | 2842843487 | 2842845195 | 314 |
| 380 | iso_pu_bacteria | 2842849001 | 2842853831 | 314 |
| 381 | iso_pu_bacteria | 2842854478 | 2842857262 | 314 |
| 382 | iso_pu_bacteria | 2844665904 | 2844666019 | 314 |
| 383 | iso_pu_bacteria | 2852612431 | 2852615508 | 314 |
| 384 | iso_pu_bacteria | 2852657418 | 2852660705 | 314 |
| 385 | iso_pu_bacteria | 2852667396 | 2852670476 | 314 |
| 386 | iso_pu_bacteria | 2860339153 | 2860344393 | 314 |
| 387 | iso_pu_bacteria | 2860867994 | 2860869036 | 314 |
| 388 | iso_pu_bacteria | 2878029506 | 2878034486 | 314 |
| 389 | iso_pu_bacteria | 2880230671 | 2880235128 | 314 |
| 390 | iso_pu_bacteria | 2904518522 | 2904521496 | 314 |
| 391 | iso_pu_bacteria | 2904550169 | 2904551130 | 314 |
| 392 | iso_pu_bacteria | 2908446538 | 2908447829 | 314 |
| 393 | iso_pu_bacteria | 2912963787 | 2912967948 | 314 |
| 394 | iso_pu_bacteria | 2913036834 | 2913037909 | 314 |
| 395 | iso_pu_bacteria | 2917070673 | 2917075724 | 314 |
| 396 | iso_pu_bacteria | 2919063839 | 2919066455 | 314 |
| 397 | iso_pu_bacteria | 2919155634 | 2919159286 | 314 |
| 398 | iso_pu_bacteria | 2919385768 | 2919388553 | 314 |
| 399 | iso_pu_bacteria | 2919456309 | 2919459523 | 314 |
| 400 | iso_pu_bacteria | 2919481497 | 2919482816 | 314 |
| 401 | iso_pu_bacteria | 2919487758 | 2919490125 | 314 |
| 402 | iso_pu_bacteria | 2919697872 | 2919700005 | 314 |
| 403 | iso_pu_bacteria | 2923153595 | 2923158566 | 314 |
| 404 | iso_pu_bacteria | 2923586266 | 2923591779 | 314 |
| 405 | iso_pu_bacteria | 2929144301 | 2929145360 | 314 |
| 406 | iso_pu_bacteria | 2929189879 | 2929191033 | 314 |
| 407 | iso_pu_bacteria | 2931369376 | 2931371299 | 314 |
| 408 | iso_pu_bacteria | 2931390751 | 2931392038 | 314 |
| 409 | iso_pu_bacteria | 2931396565 | 2931397170 | 314 |
| 410 | iso_pu_bacteria | 2935353572 | 2935356714 | 314 |
| 411 | iso_pu_bacteria | 2939636861 | 2939638100 | 314 |
| 412 | iso_pu_bacteria | 2939651529 | 2939652377 | 314 |
| 413 | iso_pu_bacteria | 2945928738 | 2945929547 | 314 |
| 414 | iso_pu_bacteria | 2945961074 | 2945961264 | 314 |
| 415 | iso_pu_bacteria | 2946006987 | 2946011826 | 314 |
| 416 | iso_pu_bacteria | 2946027586 | 2946029282 | 314 |
| 417 | iso_pu_bacteria | 2947233263 | 2947235830 | 314 |
| 418 | iso_pu_bacteria | 2969304461 | 2969309269 | 314 |
| 419 | iso_pu_bacteria | 2974289157 | 2974289371 | 314 |
| 420 | iso_pu_bacteria | 2984286254 | 2984287604 | 314 |
| 421 | iso_pu_bacteria | 2988728565 | 2988732905 | 314 |
| 422 | iso_pu_bacteria | 2990196909 | 2990198317 | 314 |
| 423 | iso_pu_bacteria | 2998139840 | 2998144537 | 314 |
| 424 | iso_pu_bacteria | 3007419365 | 3007424925 | 314 |
| 425 | iso_pu_bacteria | 3007511990 | 3007512420 | 314 |
| 426 | iso_pu_bacteria | 3007614139 | 3007618453 | 314 |
| 427 | iso_pu_bacteria | 3007619802 | 3007624352 | 314 |
| 428 | iso_pu_bacteria | 3007718800 | 3007719451 | 314 |
| 429 | iso_pu_bacteria | 3007803356 | 3007808406 | 314 |
| 430 | iso_pu_bacteria | 3007855910 | 3007858479 | 314 |
| 431 | iso_pu_bacteria | 3007861166 | 3007866000 | 314 |
| 432 | iso_pu_bacteria | 3007866637 | 3007871260 | 314 |
| 433 | iso_pu_bacteria | 3007872151 | 3007875433 | 314 |
| 434 | iso_pu_bacteria | 637000220 | 637322262 | 314 |
| 435 | iso_pu_bacteria | 8015687852 | 8015692650 | 314 |
| 436 | iso_pu_bacteria | 8019769354 | 8019771633 | 314 |
| 437 | iso_pu_bacteria | 8019775933 | 8019776672 | 314 |
| 438 | iso_pu_bacteria | 8029995093 | 8029996342 | 314 |
| 439 | iso_pu_bacteria | 8052494512 | 8052495674 | 314 |
| 440 | iso_pu_bacteria | 8054285046 | 8054286233 | 314 |
| 441 | iso_pu_bacteria | 8054347763 | 8054352550 | 314 |
| 442 | iso_pu_bacteria | 8054503363 | 8054504617 | 314 |
| 443 | iso_pu_bacteria | 8054929484 | 8054933243 | 314 |
| 444 | iso_pu_bacteria | 8055770955 | 8055775884 | 314 |
| 445 | iso_pu_bacteria | 8055817908 | 8055819058 | 314 |
| 446 | iso_pu_bacteria | 8055878733 | 8055884073 | 314 |
| 447 | iso_pu_bacteria | 8056115690 | 8056117443 | 314 |
| 448 | iso_pu_bacteria | 8056120720 | 8056124771 | 314 |
| 449 | iso_pu_bacteria | 8056125926 | 8056127110 | 314 |
| 450 | iso_pu_bacteria | 8056131705 | 8056132927 | 314 |
| 451 | iso_pu_bacteria | 8056137416 | 8056138581 | 314 |
| 452 | iso_pu_bacteria | 8056143049 | 8056147919 | 314 |
| 453 | iso_pu_bacteria | 8056148874 | 8056149143 | 314 |
| 454 | iso_pu_bacteria | 8056155041 | 8056155525 | 314 |
| 455 | iso_pu_bacteria | 8056161164 | 8056161198 | 314 |
| 456 | iso_pu_bacteria | 8056166840 | 8056172035 | 314 |
| 457 | iso_pu_bacteria | 8056172158 | 8056172696 | 314 |
| 458 | iso_pu_bacteria | 8056177738 | 8056180548 | 314 |
| 459 | iso_pu_bacteria | 8056569372 | 8056574535 | 314 |
| 460 | iso_pu_bacteria | 8057160832 | 8057163013 | 314 |
| 461 | iso_pu_bacteria | 8057798959 | 8057804738 | 314 |
| 462 | 3300003856 | Ga0058692_1012199 | Ga0058692_10121992 | 315 |
| 463 | 3300013307 | Ga0157372_10008169 | Ga0157372_1000816912 | 315 |
| 464 | 3300027312 | Ga0209371_1002408 | Ga0209371_10024082 | 315 |
| 465 | 3300030500 | Ga0268256_1001327 | Ga0268256_10013276 | 315 |
| 466 | 3300036712 | Ga0316584_0125882 | Ga0316584_0125882_664_1635 | 315 |
| 467 | 3300041405 | Ga0439438_019352 | Ga0439438_019352_600_1565 | 315 |
| 468 | 3300046458 | Ga0495591_000318 | Ga0495591_000318_21261_22229 | 315 |
| 469 | 3300046471 | Ga0495650_0000026 | Ga0495650_0000026_442602_443570 | 315 |
| 470 | 3300046491 | Ga0495584_0058183 | Ga0495584_0058183_75_1043 | 315 |
| 471 | 3300046507 | Ga0495606_0004769 | Ga0495606_0004769_9136_10104 | 315 |
| 472 | 3300046523 | Ga0495644_0105733 | Ga0495644_0105733_50_1018 | 315 |
| 473 | 3300046524 | Ga0495648_0002708 | Ga0495648_0002708_4643_5611 | 315 |
| 474 | 3300046530 | Ga0495654_0000069 | Ga0495654_0000069_69506_70474 | 315 |
| 475 | 3300046692 | Ga0495671_0053917 | Ga0495671_0053917_188_1156 | 315 |
| 476 | 3300046794 | Ga0495589_0002276 | Ga0495589_0002276_4041_5009 | 315 |
| 477 | 3300046810 | Ga0495660_0000016 | Ga0495660_0000016_257259_258227 | 315 |
| 478 | 3300047320 | Ga0495672_0000001 | Ga0495672_0000001_487279_488247 | 315 |
| 479 | 3300047323 | Ga0495683_0014602 | Ga0495683_0014602_2930_3898 | 315 |
| 480 | 3300047323 | Ga0495683_0057536 | Ga0495683_0057536_782_1750 | 315 |
| 481 | 3300047469 | Ga0495673_0000358 | Ga0495673_0000358_8136_9104 | 315 |
| 482 | 3300048919 | Ga0496116_0000086 | Ga0496116_0000086_26397_27362 | 315 |
| 483 | 3300048922 | Ga0496119_0000018 | Ga0496119_0000018_281835_282800 | 315 |
| 484 | 3300048922 | Ga0496119_0006919 | Ga0496119_0006919_4282_5247 | 315 |
| 485 | 3300048923 | Ga0496120_0000002 | Ga0496120_0000002_53376_54341 | 315 |
| 486 | 3300048923 | Ga0496120_0000917 | Ga0496120_0000917_25151_26116 | 315 |
| 487 | 3300049459 | Ga0495678_000091 | Ga0495678_000091_67583_68551 | 315 |
| 488 | 3300049460 | Ga0495682_0000001 | Ga0495682_0000001_612280_613248 | 315 |
| 489 | 3300053126 | Ga0500621_000002 | Ga0500621_000002_618997_619965 | 315 |
| 490 | iso_pu_bacteria | 2510065053 | 2510280852 | 315 |
| 491 | iso_pu_bacteria | 2510065055 | 2510295018 | 315 |
| 492 | iso_pu_bacteria | 2510065058 | 2510308999 | 315 |
| 493 | iso_pu_bacteria | 2728369097 | 2729145893 | 315 |
| 494 | iso_pu_bacteria | 2773857672 | 2774132199 | 315 |
| 495 | iso_pu_bacteria | 2917832318 | 2917835153 | 315 |
| 496 | iso_pu_bacteria | 2919125081 | 2919130048 | 315 |
| 497 | iso_pu_bacteria | 2984499530 | 2984503709 | 315 |
| 498 | iso_pu_bacteria | 2984504281 | 2984507711 | 315 |
| 499 | iso_pu_bacteria | 651053060 | 651175070 | 315 |
| 500 | iso_pu_bacteria | 8016728285 | 8016730144 | 315 |
| 501 | 3300002737 | JGI25162J39368_1002438 | JGI25162J39368_10024385 | 316 |
| 502 | 3300003856 | Ga0058692_1000085 | Ga0058692_100008551 | 316 |
| 503 | 3300003856 | Ga0058692_1000167 | Ga0058692_100016733 | 316 |
| 504 | 3300003856 | Ga0058692_1000364 | Ga0058692_10003645 | 316 |
| 505 | 3300003856 | Ga0058692_1000797 | Ga0058692_100079714 | 316 |
| 506 | 3300003856 | Ga0058692_1001265 | Ga0058692_10012659 | 316 |
| 507 | 3300003856 | Ga0058692_1003493 | Ga0058692_10034932 | 316 |
| 508 | 3300003856 | Ga0058692_1015467 | Ga0058692_10154671 | 316 |
| 509 | 3300003856 | Ga0058692_1027113 | Ga0058692_10271131 | 316 |
| 510 | 3300005347 | Ga0070668_100051975 | Ga0070668_1000519753 | 316 |
| 511 | 3300006946 | Ga0079104_1000225 | Ga0079104_100022533 | 316 |
| 512 | 3300009011 | Ga0105251_10004557 | Ga0105251_100045575 | 316 |
| 513 | 3300009011 | Ga0105251_10143841 | Ga0105251_101438412 | 316 |
| 514 | 3300009036 | Ga0105244_10000020 | Ga0105244_10000020164 | 316 |
| 515 | 3300009036 | Ga0105244_10000761 | Ga0105244_1000076120 | 316 |
| 516 | 3300009036 | Ga0105244_10001402 | Ga0105244_1000140217 | 316 |
| 517 | 3300009092 | Ga0105250_10000119 | Ga0105250_1000011924 | 316 |
| 518 | 3300009092 | Ga0105250_10029050 | Ga0105250_100290503 | 316 |
| 519 | 3300009092 | Ga0105250_10042759 | Ga0105250_100427592 | 316 |
| 520 | 3300009148 | Ga0105243_10133956 | Ga0105243_101339562 | 316 |
| 521 | 3300011119 | Ga0105246_10107601 | Ga0105246_101076013 | 316 |
| 522 | 3300013100 | Ga0157373_10000137 | Ga0157373_1000013737 | 316 |
| 523 | 3300013102 | Ga0157371_10000810 | Ga0157371_1000081024 | 316 |
| 524 | 3300013102 | Ga0157371_10001729 | Ga0157371_100017297 | 316 |
| 525 | 3300013104 | Ga0157370_10000301 | Ga0157370_1000030135 | 316 |
| 526 | 3300013105 | Ga0157369_10032725 | Ga0157369_100327252 | 316 |
| 527 | 3300013306 | Ga0163162_10460463 | Ga0163162_104604631 | 316 |
| 528 | 3300013307 | Ga0157372_10045132 | Ga0157372_100451322 | 316 |
| 529 | 3300013307 | Ga0157372_10199055 | Ga0157372_101990552 | 316 |
| 530 | 3300015261 | Ga0182006_1023063 | Ga0182006_10230632 | 316 |
| 531 | 3300025233 | Ga0209437_100155 | Ga0209437_10015538 | 316 |
| 532 | 3300025711 | Ga0207696_1000062 | Ga0207696_100006269 | 316 |
| 533 | 3300025711 | Ga0207696_1000216 | Ga0207696_100021626 | 316 |
| 534 | 3300025728 | Ga0207655_1000004 | Ga0207655_1000004618 | 316 |
| 535 | 3300025728 | Ga0207655_1000007 | Ga0207655_1000007186 | 316 |
| 536 | 3300025728 | Ga0207655_1085168 | Ga0207655_10851682 | 316 |
| 537 | 3300025728 | Ga0207655_1088434 | Ga0207655_10884341 | 316 |
| 538 | 3300025735 | Ga0207713_1000001 | Ga0207713_10000011437 | 316 |
| 539 | 3300025735 | Ga0207713_1066113 | Ga0207713_10661131 | 316 |
| 540 | 3300027111 | Ga0209281_1000001 | Ga0209281_1000001254 | 316 |
| 541 | 3300027312 | Ga0209371_1000005 | Ga0209371_1000005526 | 316 |
| 542 | 3300027312 | Ga0209371_1000039 | Ga0209371_1000039308 | 316 |
| 543 | 3300027312 | Ga0209371_1000199 | Ga0209371_100019966 | 316 |
| 544 | 3300027312 | Ga0209371_1000205 | Ga0209371_10002056 | 316 |
| 545 | 3300027312 | Ga0209371_1001746 | Ga0209371_10017465 | 316 |
| 546 | 3300027312 | Ga0209371_1002164 | Ga0209371_10021649 | 316 |
| 547 | 3300027312 | Ga0209371_1002488 | Ga0209371_10024889 | 316 |
| 548 | 3300027312 | Ga0209371_1008280 | Ga0209371_10082802 | 316 |
| 549 | 3300030500 | Ga0268256_1000006 | Ga0268256_1000006531 | 316 |
| 550 | 3300030500 | Ga0268256_1000033 | Ga0268256_100003354 | 316 |
| 551 | 3300030500 | Ga0268256_1000098 | Ga0268256_100009823 | 316 |
| 552 | 3300030500 | Ga0268256_1000618 | Ga0268256_100061813 | 316 |
| 553 | 3300030500 | Ga0268256_1001521 | Ga0268256_100152112 | 316 |
| 554 | 3300030500 | Ga0268256_1005544 | Ga0268256_10055443 | 316 |
| 555 | 3300039110 | Ga0400487_15044 | Ga0400487_15044_389_1348 | 316 |
| 556 | 3300041405 | Ga0439438_000001 | Ga0439438_000001_1189170_1190138 | 316 |
| 557 | 3300041407 | Ga0439447_009543 | Ga0439447_009543_1217_2185 | 316 |
| 558 | 3300041407 | Ga0439447_013754 | Ga0439447_013754_223_1191 | 316 |
| 559 | 3300041411 | Ga0439466_0000013 | Ga0439466_0000013_42950_43918 | 316 |
| 560 | 3300042006 | Ga0439432_001755 | Ga0439432_001755_2584_3552 | 316 |
| 561 | 3300042006 | Ga0439432_005501 | Ga0439432_005501_3146_4114 | 316 |
| 562 | 3300042010 | Ga0439452_000001 | Ga0439452_000001_1252298_1253266 | 316 |
| 563 | 3300042146 | Ga0450907_001025 | Ga0450907_001025_5186_6154 | 316 |
| 564 | 3300046458 | Ga0495591_000007 | Ga0495591_000007_318349_319317 | 316 |
| 565 | 3300046500 | Ga0495596_0010866 | Ga0495596_0010866_882_1850 | 316 |
| 566 | 3300046522 | Ga0495643_0084132 | Ga0495643_0084132_267_1235 | 316 |
| 567 | 3300046524 | Ga0495648_0035683 | Ga0495648_0035683_1542_2510 | 316 |
| 568 | 3300046530 | Ga0495654_0000007 | Ga0495654_0000007_355485_356453 | 316 |
| 569 | 3300046616 | Ga0495668_0025217 | Ga0495668_0025217_1745_2713 | 316 |
| 570 | 3300046810 | Ga0495660_0022208 | Ga0495660_0022208_2030_2998 | 316 |
| 571 | 3300047320 | Ga0495672_0000015 | Ga0495672_0000015_192398_193366 | 316 |
| 572 | 3300047446 | Ga0495679_005588 | Ga0495679_005588_386_1354 | 316 |
| 573 | 3300048903 | Ga0496100_0014748 | Ga0496100_0014748_2831_3799 | 316 |
| 574 | 3300048904 | Ga0496101_0000093 | Ga0496101_0000093_58479_59447 | 316 |
| 575 | 3300048905 | Ga0496102_0006258 | Ga0496102_0006258_3669_4637 | 316 |
| 576 | 3300048908 | Ga0496105_0004370 | Ga0496105_0004370_6676_7644 | 316 |
| 577 | 3300048919 | Ga0496116_0000163 | Ga0496116_0000163_60863_61831 | 316 |
| 578 | 3300048919 | Ga0496116_0005711 | Ga0496116_0005711_7431_8399 | 316 |
| 579 | 3300048920 | Ga0496117_0000009 | Ga0496117_0000009_26643_27611 | 316 |
| 580 | 3300048920 | Ga0496117_0000058 | Ga0496117_0000058_71961_72929 | 316 |
| 581 | 3300048920 | Ga0496117_0000378 | Ga0496117_0000378_6869_7837 | 316 |
| 582 | 3300048921 | Ga0496118_0000007 | Ga0496118_0000007_613188_614156 | 316 |
| 583 | 3300048921 | Ga0496118_0000199 | Ga0496118_0000199_62974_63942 | 316 |
| 584 | 3300048921 | Ga0496118_0006442 | Ga0496118_0006442_8692_9660 | 316 |
| 585 | 3300048922 | Ga0496119_0000106 | Ga0496119_0000106_66468_67436 | 316 |
| 586 | 3300048922 | Ga0496119_0000111 | Ga0496119_0000111_40303_41271 | 316 |
| 587 | 3300048922 | Ga0496119_0007156 | Ga0496119_0007156_1766_2734 | 316 |
| 588 | 3300048923 | Ga0496120_0000116 | Ga0496120_0000116_72859_73827 | 316 |
| 589 | 3300048923 | Ga0496120_0000152 | Ga0496120_0000152_40303_41271 | 316 |
| 590 | 3300048923 | Ga0496120_0000921 | Ga0496120_0000921_351_1319 | 316 |
| 591 | 3300048923 | Ga0496120_0046921 | Ga0496120_0046921_848_1816 | 316 |
| 592 | 3300048924 | Ga0496121_0000544 | Ga0496121_0000544_48078_49046 | 316 |
| 593 | 3300048925 | Ga0496122_0003261 | Ga0496122_0003261_8152_9120 | 316 |
| 594 | 3300048925 | Ga0496122_0003412 | Ga0496122_0003412_6890_7858 | 316 |
| 595 | 3300048925 | Ga0496122_0046369 | Ga0496122_0046369_1842_2810 | 316 |
| 596 | 3300048926 | Ga0496123_0002536 | Ga0496123_0002536_14505_15473 | 316 |
| 597 | 3300048926 | Ga0496123_0003243 | Ga0496123_0003243_8789_9757 | 316 |
| 598 | 3300048927 | Ga0496124_0000357 | Ga0496124_0000357_39580_40548 | 316 |
| 599 | 3300048927 | Ga0496124_0005891 | Ga0496124_0005891_3848_4816 | 316 |
| 600 | 3300048927 | Ga0496124_0006121 | Ga0496124_0006121_519_1487 | 316 |
| 601 | 3300048927 | Ga0496124_0011885 | Ga0496124_0011885_4134_5102 | 316 |
| 602 | 3300048927 | Ga0496124_0041187 | Ga0496124_0041187_1198_2166 | 316 |
| 603 | 3300048927 | Ga0496124_0085811 | Ga0496124_0085811_1563_2531 | 316 |
| 604 | 3300048927 | Ga0496124_0205723 | Ga0496124_0205723_156_1124 | 316 |
| 605 | 3300048928 | Ga0496125_0000065 | Ga0496125_0000065_239362_240330 | 316 |
| 606 | 3300048928 | Ga0496125_0020974 | Ga0496125_0020974_2018_2986 | 316 |
| 607 | 3300048929 | Ga0496126_0051784 | Ga0496126_0051784_924_1892 | 316 |
| 608 | 3300048929 | Ga0496126_0172684 | Ga0496126_0172684_184_1152 | 316 |
| 609 | 3300048929 | Ga0496126_0287497 | Ga0496126_0287497_231_1199 | 316 |
| 610 | 3300050491 | nmdc:mga00v17_228261_c1 | nmdc:mga00v17_228261_c1_169_1137 | 316 |
| 611 | iso_pu_bacteria | 2687453129 | 2687578174 | 316 |
| 612 | iso_pu_bacteria | 3007395558 | 3007398192 | 316 |
| 613 | 3300002737 | JGI25162J39368_1000019 | JGI25162J39368_1000019223 | 317 |
| 614 | 3300002771 | JGI25163J39215_1000079 | JGI25163J39215_100007920 | 317 |
| 615 | 3300002772 | JGI25164J39214_1000011 | JGI25164J39214_100001151 | 317 |
| 616 | 3300002773 | JGI25152J39213_1000482 | JGI25152J39213_100048211 | 317 |
| 617 | 3300003320 | rootH2_10011341 | rootH2_100113416 | 317 |
| 618 | 3300003751 | Ga0055538_1000021 | Ga0055538_100002151 | 317 |
| 619 | 3300003752 | Ga0055539_1000026 | Ga0055539_1000026223 | 317 |
| 620 | 3300003756 | Ga0055533_1000035 | Ga0055533_100003551 | 317 |
| 621 | 3300003759 | Ga0055525_1000045 | Ga0055525_100004551 | 317 |
| 622 | 3300003841 | Ga0055541_1000020 | Ga0055541_100002051 | 317 |
| 623 | 3300003856 | Ga0058692_1014733 | Ga0058692_10147331 | 317 |
| 624 | 3300003856 | Ga0058692_1014891 | Ga0058692_10148911 | 317 |
| 625 | 3300005272 | Ga0065703_1019293 | Ga0065703_10192933 | 317 |
| 626 | 3300005288 | Ga0065714_10096328 | Ga0065714_100963282 | 317 |
| 627 | 3300005289 | Ga0065704_10000318 | Ga0065704_1000031811 | 317 |
| 628 | 3300005289 | Ga0065704_10002406 | Ga0065704_100024067 | 317 |
| 629 | 3300005289 | Ga0065704_10084486 | Ga0065704_100844862 | 317 |
| 630 | 3300005289 | Ga0065704_10091125 | Ga0065704_100911252 | 317 |
| 631 | 3300005289 | Ga0065704_10096731 | Ga0065704_100967312 | 317 |
| 632 | 3300005366 | Ga0070659_100076066 | Ga0070659_1000760663 | 317 |
| 633 | 3300005548 | Ga0070665_100000356 | Ga0070665_1000003564 | 317 |
| 634 | 3300005577 | Ga0068857_100001074 | Ga0068857_10000107412 | 317 |
| 635 | 3300005834 | Ga0068851_10036752 | Ga0068851_100367522 | 317 |
| 636 | 3300006051 | Ga0075364_10002374 | Ga0075364_100023748 | 317 |
| 637 | 3300006051 | Ga0075364_10028598 | Ga0075364_100285982 | 317 |
| 638 | 3300006946 | Ga0079104_1000047 | Ga0079104_1000047102 | 317 |
| 639 | 3300006946 | Ga0079104_1000060 | Ga0079104_100006027 | 317 |
| 640 | 3300006946 | Ga0079104_1000475 | Ga0079104_100047517 | 317 |
| 641 | 3300006946 | Ga0079104_1001084 | Ga0079104_10010842 | 317 |
| 642 | 3300006946 | Ga0079104_1002173 | Ga0079104_10021736 | 317 |
| 643 | 3300006946 | Ga0079104_1003218 | Ga0079104_10032185 | 317 |
| 644 | 3300006946 | Ga0079104_1008699 | Ga0079104_10086995 | 317 |
| 645 | 3300006946 | Ga0079104_1012111 | Ga0079104_10121112 | 317 |
| 646 | 3300006946 | Ga0079104_1018323 | Ga0079104_10183231 | 317 |
| 647 | 3300006946 | Ga0079104_1018332 | Ga0079104_10183322 | 317 |
| 648 | 3300009011 | Ga0105251_10000226 | Ga0105251_1000022634 | 317 |
| 649 | 3300009011 | Ga0105251_10000648 | Ga0105251_1000064830 | 317 |
| 650 | 3300009011 | Ga0105251_10000740 | Ga0105251_100007408 | 317 |
| 651 | 3300009011 | Ga0105251_10002574 | Ga0105251_1000257414 | 317 |
| 652 | 3300009011 | Ga0105251_10003382 | Ga0105251_100033826 | 317 |
| 653 | 3300009011 | Ga0105251_10007670 | Ga0105251_100076705 | 317 |
| 654 | 3300009011 | Ga0105251_10053066 | Ga0105251_100530662 | 317 |
| 655 | 3300009036 | Ga0105244_10000047 | Ga0105244_1000004732 | 317 |
| 656 | 3300009036 | Ga0105244_10000141 | Ga0105244_1000014166 | 317 |
| 657 | 3300009036 | Ga0105244_10000223 | Ga0105244_100002232 | 317 |
| 658 | 3300009036 | Ga0105244_10001660 | Ga0105244_1000166018 | 317 |
| 659 | 3300009036 | Ga0105244_10011040 | Ga0105244_100110403 | 317 |
| 660 | 3300009036 | Ga0105244_10021675 | Ga0105244_100216753 | 317 |
| 661 | 3300009036 | Ga0105244_10025019 | Ga0105244_100250193 | 317 |
| 662 | 3300009036 | Ga0105244_10130274 | Ga0105244_101302741 | 317 |
| 663 | 3300009092 | Ga0105250_10000001 | Ga0105250_10000001202 | 317 |
| 664 | 3300009092 | Ga0105250_10000016 | Ga0105250_1000001654 | 317 |
| 665 | 3300009092 | Ga0105250_10000847 | Ga0105250_1000084712 | 317 |
| 666 | 3300009092 | Ga0105250_10002820 | Ga0105250_100028205 | 317 |
| 667 | 3300009092 | Ga0105250_10012686 | Ga0105250_100126862 | 317 |
| 668 | 3300009092 | Ga0105250_10018277 | Ga0105250_100182771 | 317 |
| 669 | 3300009101 | Ga0105247_10000012 | Ga0105247_10000012149 | 317 |
| 670 | 3300009174 | Ga0105241_10000001 | Ga0105241_10000001163 | 317 |
| 671 | 3300009176 | Ga0105242_10422557 | Ga0105242_104225571 | 317 |
| 672 | 3300013100 | Ga0157373_10000779 | Ga0157373_1000077910 | 317 |
| 673 | 3300013100 | Ga0157373_10017667 | Ga0157373_100176673 | 317 |
| 674 | 3300013102 | Ga0157371_10000098 | Ga0157371_1000009861 | 317 |
| 675 | 3300013102 | Ga0157371_10032848 | Ga0157371_100328482 | 317 |
| 676 | 3300013104 | Ga0157370_10000075 | Ga0157370_1000007595 | 317 |
| 677 | 3300013104 | Ga0157370_10018571 | Ga0157370_100185716 | 317 |
| 678 | 3300013105 | Ga0157369_10006243 | Ga0157369_1000624315 | 317 |
| 679 | 3300013306 | Ga0163162_10006068 | Ga0163162_1000606811 | 317 |
| 680 | 3300013307 | Ga0157372_10102711 | Ga0157372_101027112 | 317 |
| 681 | 3300014497 | Ga0182008_10024098 | Ga0182008_100240983 | 317 |
| 682 | 3300015261 | Ga0182006_1000087 | Ga0182006_100008766 | 317 |
| 683 | 3300015679 | Ga0183366_1001 | Ga0183366_10011994 | 317 |
| 684 | 3300015680 | Ga0183370_1001 | Ga0183370_10011994 | 317 |
| 685 | 3300015685 | Ga0183369_1001 | Ga0183369_10011994 | 317 |
| 686 | 3300015687 | Ga0183368_1001 | Ga0183368_10011994 | 317 |
| 687 | 3300017792 | Ga0163161_10000001 | Ga0163161_100000011623 | 317 |
| 688 | 3300021384 | Ga0213876_10000016 | Ga0213876_10000016129 | 317 |
| 689 | 3300025207 | Ga0209760_100004 | Ga0209760_10000451 | 317 |
| 690 | 3300025224 | Ga0209784_100001 | Ga0209784_1000012538 | 317 |
| 691 | 3300025225 | Ga0209566_100001 | Ga0209566_1000012538 | 317 |
| 692 | 3300025226 | Ga0209674_100002 | Ga0209674_1000022538 | 317 |
| 693 | 3300025230 | Ga0209563_100002 | Ga0209563_1000021073 | 317 |
| 694 | 3300025231 | Ga0207427_100012 | Ga0207427_100012278 | 317 |
| 695 | 3300025233 | Ga0209437_100001 | Ga0209437_1000011073 | 317 |
| 696 | 3300025253 | Ga0209677_100002 | Ga0209677_1000021073 | 317 |
| 697 | 3300025258 | Ga0209129_1000004 | Ga0209129_1000004772 | 317 |
| 698 | 3300025261 | Ga0209233_1001376 | Ga0209233_10013764 | 317 |
| 699 | 3300025711 | Ga0207696_1000001 | Ga0207696_10000011704 | 317 |
| 700 | 3300025711 | Ga0207696_1000015 | Ga0207696_1000015379 | 317 |
| 701 | 3300025711 | Ga0207696_1000030 | Ga0207696_1000030129 | 317 |
| 702 | 3300025711 | Ga0207696_1000298 | Ga0207696_100029828 | 317 |
| 703 | 3300025711 | Ga0207696_1002483 | Ga0207696_10024836 | 317 |
| 704 | 3300025711 | Ga0207696_1005451 | Ga0207696_10054512 | 317 |
| 705 | 3300025711 | Ga0207696_1023696 | Ga0207696_10236962 | 317 |
| 706 | 3300025728 | Ga0207655_1000001 | Ga0207655_10000011824 | 317 |
| 707 | 3300025728 | Ga0207655_1000002 | Ga0207655_1000002635 | 317 |
| 708 | 3300025728 | Ga0207655_1000110 | Ga0207655_100011017 | 317 |
| 709 | 3300025728 | Ga0207655_1000229 | Ga0207655_100022931 | 317 |
| 710 | 3300025728 | Ga0207655_1000296 | Ga0207655_100029665 | 317 |
| 711 | 3300025728 | Ga0207655_1000886 | Ga0207655_100088616 | 317 |
| 712 | 3300025728 | Ga0207655_1019444 | Ga0207655_10194442 | 317 |
| 713 | 3300025735 | Ga0207713_1000004 | Ga0207713_1000004269 | 317 |
| 714 | 3300025735 | Ga0207713_1000015 | Ga0207713_1000015242 | 317 |
| 715 | 3300025735 | Ga0207713_1000027 | Ga0207713_100002797 | 317 |
| 716 | 3300025735 | Ga0207713_1000088 | Ga0207713_1000088129 | 317 |
| 717 | 3300025735 | Ga0207713_1000753 | Ga0207713_100075327 | 317 |
| 718 | 3300025735 | Ga0207713_1001329 | Ga0207713_100132917 | 317 |
| 719 | 3300025735 | Ga0207713_1009534 | Ga0207713_10095341 | 317 |
| 720 | 3300025735 | Ga0207713_1046323 | Ga0207713_10463232 | 317 |
| 721 | 3300025900 | Ga0207710_10000083 | Ga0207710_1000008362 | 317 |
| 722 | 3300025911 | Ga0207654_10000004 | Ga0207654_10000004191 | 317 |
| 723 | 3300025935 | Ga0207709_10037052 | Ga0207709_100370524 | 317 |
| 724 | 3300026116 | Ga0207674_10027056 | Ga0207674_100270565 | 317 |
| 725 | 3300027111 | Ga0209281_1000003 | Ga0209281_1000003804 | 317 |
| 726 | 3300027111 | Ga0209281_1000004 | Ga0209281_1000004595 | 317 |
| 727 | 3300027111 | Ga0209281_1000006 | Ga0209281_1000006356 | 317 |
| 728 | 3300027111 | Ga0209281_1000012 | Ga0209281_1000012547 | 317 |
| 729 | 3300027111 | Ga0209281_1000064 | Ga0209281_100006428 | 317 |
| 730 | 3300027111 | Ga0209281_1000071 | Ga0209281_1000071210 | 317 |
| 731 | 3300027111 | Ga0209281_1000109 | Ga0209281_100010976 | 317 |
| 732 | 3300027111 | Ga0209281_1000434 | Ga0209281_100043417 | 317 |
| 733 | 3300027111 | Ga0209281_1001629 | Ga0209281_10016296 | 317 |
| 734 | 3300027111 | Ga0209281_1004912 | Ga0209281_10049122 | 317 |
| 735 | 3300027312 | Ga0209371_1000001 | Ga0209371_10000011982 | 317 |
| 736 | 3300027312 | Ga0209371_1000002 | Ga0209371_10000021048 | 317 |
| 737 | 3300027312 | Ga0209371_1000052 | Ga0209371_100005269 | 317 |
| 738 | 3300027312 | Ga0209371_1001211 | Ga0209371_100121116 | 317 |
| 739 | 3300027312 | Ga0209371_1003168 | Ga0209371_10031682 | 317 |
| 740 | 3300027312 | Ga0209371_1004744 | Ga0209371_10047446 | 317 |
| 741 | 3300027312 | Ga0209371_1005029 | Ga0209371_10050295 | 317 |
| 742 | 3300028379 | Ga0268266_10000959 | Ga0268266_1000095931 | 317 |
| 743 | 3300030500 | Ga0268256_1000001 | Ga0268256_1000001658 | 317 |
| 744 | 3300030500 | Ga0268256_1000002 | Ga0268256_1000002414 | 317 |
| 745 | 3300030500 | Ga0268256_1000061 | Ga0268256_100006135 | 317 |
| 746 | 3300030500 | Ga0268256_1001036 | Ga0268256_10010362 | 317 |
| 747 | 3300030500 | Ga0268256_1001446 | Ga0268256_10014468 | 317 |
| 748 | 3300030500 | Ga0268256_1004683 | Ga0268256_10046832 | 317 |
| 749 | 3300030500 | Ga0268256_1008497 | Ga0268256_10084972 | 317 |
| 750 | 3300030500 | Ga0268256_1011168 | Ga0268256_10111682 | 317 |
| 751 | 3300031250 | Ga0265331_10047402 | Ga0265331_100474023 | 317 |
| 752 | 3300039062 | Ga0400483_189767 | Ga0400483_189767_1533_2513 | 317 |
| 753 | 3300039437 | Ga0436365_1910565 | Ga0436365_1910565_341296_342267 | 317 |
| 754 | 3300041405 | Ga0439438_003266 | Ga0439438_003266_3178_4149 | 317 |
| 755 | 3300042006 | Ga0439432_008354 | Ga0439432_008354_1442_2413 | 317 |
| 756 | 3300042010 | Ga0439452_000002 | Ga0439452_000002_662838_663809 | 317 |
| 757 | 3300042010 | Ga0439452_000022 | Ga0439452_000022_121471_122442 | 317 |
| 758 | 3300042010 | Ga0439452_000066 | Ga0439452_000066_52646_53617 | 317 |
| 759 | 3300042010 | Ga0439452_000101 | Ga0439452_000101_3310_4281 | 317 |
| 760 | 3300042010 | Ga0439452_016819 | Ga0439452_016819_87_1058 | 317 |
| 761 | 3300042439 | Ga0439464_0013200 | Ga0439464_0013200_527_1498 | 317 |
| 762 | 3300042532 | Ga0450893_0003075 | Ga0450893_0003075_212_1183 | 317 |
| 763 | 3300042876 | Ga0451577_0000105 | Ga0451577_0000105_182306_183277 | 317 |
| 764 | 3300042876 | Ga0451577_0035200 | Ga0451577_0035200_1284_2255 | 317 |
| 765 | 3300044669 | Ga0466981_0000008 | Ga0466981_0000008_3317_4288 | 317 |
| 766 | 3300044673 | Ga0453683_0000034 | Ga0453683_0000034_155380_156351 | 317 |
| 767 | 3300044673 | Ga0453683_0000152 | Ga0453683_0000152_9212_10183 | 317 |
| 768 | 3300044673 | Ga0453683_0002320 | Ga0453683_0002320_9947_10918 | 317 |
| 769 | 3300044673 | Ga0453683_0010577 | Ga0453683_0010577_1967_2938 | 317 |
| 770 | 3300044673 | Ga0453683_0034708 | Ga0453683_0034708_1427_2404 | 317 |
| 771 | 3300044673 | Ga0453683_0158873 | Ga0453683_0158873_297_1268 | 317 |
| 772 | 3300044712 | Ga0453684_0000231 | Ga0453684_0000231_17256_18227 | 317 |
| 773 | 3300044712 | Ga0453684_0000713 | Ga0453684_0000713_114927_115898 | 317 |
| 774 | 3300044712 | Ga0453684_0002182 | Ga0453684_0002182_2313_3284 | 317 |
| 775 | 3300044712 | Ga0453684_0012933 | Ga0453684_0012933_2445_3416 | 317 |
| 776 | 3300044712 | Ga0453684_0023203 | Ga0453684_0023203_5472_6449 | 317 |
| 777 | 3300044712 | Ga0453684_0031819 | Ga0453684_0031819_2196_3167 | 317 |
| 778 | 3300044712 | Ga0453684_0041565 | Ga0453684_0041565_1723_2694 | 317 |
| 779 | 3300044712 | Ga0453684_0108661 | Ga0453684_0108661_2164_3135 | 317 |
| 780 | 3300044712 | Ga0453684_0235963 | Ga0453684_0235963_78_1049 | 317 |
| 781 | 3300045051 | Ga0451576_0026038 | Ga0451576_0026038_2328_3299 | 317 |
| 782 | 3300046453 | Ga0495627_000027 | Ga0495627_000027_202207_203178 | 317 |
| 783 | 3300046458 | Ga0495591_004271 | Ga0495591_004271_3389_4360 | 317 |
| 784 | 3300046458 | Ga0495591_008529 | Ga0495591_008529_951_1925 | 317 |
| 785 | 3300046460 | Ga0495638_0023837 | Ga0495638_0023837_2411_3385 | 317 |
| 786 | 3300046471 | Ga0495650_0000182 | Ga0495650_0000182_101527_102498 | 317 |
| 787 | 3300046471 | Ga0495650_0000493 | Ga0495650_0000493_3339_4310 | 317 |
| 788 | 3300046520 | Ga0495637_0030027 | Ga0495637_0030027_1281_2252 | 317 |
| 789 | 3300046530 | Ga0495654_0000356 | Ga0495654_0000356_31554_32525 | 317 |
| 790 | 3300046530 | Ga0495654_0001554 | Ga0495654_0001554_11011_11982 | 317 |
| 791 | 3300046542 | Ga0495597_0000174 | Ga0495597_0000174_25906_26877 | 317 |
| 792 | 3300046660 | Ga0495625_0008789 | Ga0495625_0008789_3321_4292 | 317 |
| 793 | 3300046674 | Ga0495588_0008789 | Ga0495588_0008789_1155_2126 | 317 |
| 794 | 3300046694 | Ga0495649_0001408 | Ga0495649_0001408_2391_3365 | 317 |
| 795 | 3300046694 | Ga0495649_0006754 | Ga0495649_0006754_3055_4029 | 317 |
| 796 | 3300046794 | Ga0495589_0000001 | Ga0495589_0000001_260843_261814 | 317 |
| 797 | 3300046810 | Ga0495660_0000004 | Ga0495660_0000004_825080_826051 | 317 |
| 798 | 3300047320 | Ga0495672_0000076 | Ga0495672_0000076_109925_110896 | 317 |
| 799 | 3300047446 | Ga0495679_000005 | Ga0495679_000005_363504_364475 | 317 |
| 800 | 3300047446 | Ga0495679_024505 | Ga0495679_024505_405_1379 | 317 |
| 801 | 3300047469 | Ga0495673_0000007 | Ga0495673_0000007_308756_309727 | 317 |
| 802 | 3300047470 | Ga0495681_0009761 | Ga0495681_0009761_4351_5322 | 317 |
| 803 | 3300048904 | Ga0496101_0028513 | Ga0496101_0028513_767_1738 | 317 |
| 804 | 3300048907 | Ga0496104_0000328 | Ga0496104_0000328_38043_39014 | 317 |
| 805 | 3300048907 | Ga0496104_0002655 | Ga0496104_0002655_9796_10767 | 317 |
| 806 | 3300048916 | Ga0496113_0122856 | Ga0496113_0122856_52_1023 | 317 |
| 807 | 3300048919 | Ga0496116_0000001 | Ga0496116_0000001_1138774_1139745 | 317 |
| 808 | 3300048919 | Ga0496116_0000094 | Ga0496116_0000094_50491_51462 | 317 |
| 809 | 3300048919 | Ga0496116_0047037 | Ga0496116_0047037_83_1054 | 317 |
| 810 | 3300048919 | Ga0496116_0067062 | Ga0496116_0067062_89_1060 | 317 |
| 811 | 3300048919 | Ga0496116_0073422 | Ga0496116_0073422_348_1319 | 317 |
| 812 | 3300048920 | Ga0496117_0001274 | Ga0496117_0001274_28319_29290 | 317 |
| 813 | 3300048920 | Ga0496117_0003171 | Ga0496117_0003171_2363_3334 | 317 |
| 814 | 3300048920 | Ga0496117_0008528 | Ga0496117_0008528_6373_7344 | 317 |
| 815 | 3300048920 | Ga0496117_0012252 | Ga0496117_0012252_4250_5221 | 317 |
| 816 | 3300048920 | Ga0496117_0016135 | Ga0496117_0016135_2170_3141 | 317 |
| 817 | 3300048920 | Ga0496117_0025007 | Ga0496117_0025007_1857_2828 | 317 |
| 818 | 3300048920 | Ga0496117_0044858 | Ga0496117_0044858_425_1396 | 317 |
| 819 | 3300048920 | Ga0496117_0128128 | Ga0496117_0128128_22_993 | 317 |
| 820 | 3300048921 | Ga0496118_0002970 | Ga0496118_0002970_17722_18693 | 317 |
| 821 | 3300048921 | Ga0496118_0004470 | Ga0496118_0004470_11580_12551 | 317 |
| 822 | 3300048921 | Ga0496118_0006308 | Ga0496118_0006308_2915_3886 | 317 |
| 823 | 3300048921 | Ga0496118_0010654 | Ga0496118_0010654_7052_8023 | 317 |
| 824 | 3300048921 | Ga0496118_0040415 | Ga0496118_0040415_192_1163 | 317 |
| 825 | 3300048921 | Ga0496118_0069631 | Ga0496118_0069631_1468_2439 | 317 |
| 826 | 3300048922 | Ga0496119_0000001 | Ga0496119_0000001_112200_113171 | 317 |
| 827 | 3300048922 | Ga0496119_0001831 | Ga0496119_0001831_5209_6180 | 317 |
| 828 | 3300048922 | Ga0496119_0006761 | Ga0496119_0006761_6723_7694 | 317 |
| 829 | 3300048922 | Ga0496119_0019652 | Ga0496119_0019652_832_1803 | 317 |
| 830 | 3300048922 | Ga0496119_0036624 | Ga0496119_0036624_62_1066 | 317 |
| 831 | 3300048922 | Ga0496119_0037014 | Ga0496119_0037014_150_1121 | 317 |
| 832 | 3300048922 | Ga0496119_0037439 | Ga0496119_0037439_644_1615 | 317 |
| 833 | 3300048923 | Ga0496120_0000641 | Ga0496120_0000641_10777_11748 | 317 |
| 834 | 3300048923 | Ga0496120_0000940 | Ga0496120_0000940_28306_29277 | 317 |
| 835 | 3300048923 | Ga0496120_0002130 | Ga0496120_0002130_2617_3588 | 317 |
| 836 | 3300048923 | Ga0496120_0003722 | Ga0496120_0003722_2798_3769 | 317 |
| 837 | 3300048923 | Ga0496120_0011462 | Ga0496120_0011462_2106_3110 | 317 |
| 838 | 3300048923 | Ga0496120_0022189 | Ga0496120_0022189_2798_3769 | 317 |
| 839 | 3300048923 | Ga0496120_0029556 | Ga0496120_0029556_1702_2673 | 317 |
| 840 | 3300048923 | Ga0496120_0033093 | Ga0496120_0033093_2071_3042 | 317 |
| 841 | 3300048924 | Ga0496121_0008399 | Ga0496121_0008399_10549_11520 | 317 |
| 842 | 3300048924 | Ga0496121_0009768 | Ga0496121_0009768_2961_3932 | 317 |
| 843 | 3300048924 | Ga0496121_0013228 | Ga0496121_0013228_7840_8811 | 317 |
| 844 | 3300048924 | Ga0496121_0017560 | Ga0496121_0017560_4290_5261 | 317 |
| 845 | 3300048924 | Ga0496121_0028049 | Ga0496121_0028049_1267_2238 | 317 |
| 846 | 3300048924 | Ga0496121_0041289 | Ga0496121_0041289_637_1608 | 317 |
| 847 | 3300048925 | Ga0496122_0000003 | Ga0496122_0000003_110206_111177 | 317 |
| 848 | 3300048925 | Ga0496122_0000007 | Ga0496122_0000007_333611_334582 | 317 |
| 849 | 3300048925 | Ga0496122_0000211 | Ga0496122_0000211_125813_126784 | 317 |
| 850 | 3300048925 | Ga0496122_0000264 | Ga0496122_0000264_28039_29010 | 317 |
| 851 | 3300048925 | Ga0496122_0006802 | Ga0496122_0006802_4178_5149 | 317 |
| 852 | 3300048925 | Ga0496122_0020664 | Ga0496122_0020664_4571_5542 | 317 |
| 853 | 3300048925 | Ga0496122_0029929 | Ga0496122_0029929_127_1098 | 317 |
| 854 | 3300048925 | Ga0496122_0158012 | Ga0496122_0158012_43_1014 | 317 |
| 855 | 3300048926 | Ga0496123_0000004 | Ga0496123_0000004_442648_443619 | 317 |
| 856 | 3300048926 | Ga0496123_0000047 | Ga0496123_0000047_109589_110560 | 317 |
| 857 | 3300048926 | Ga0496123_0000215 | Ga0496123_0000215_88611_89582 | 317 |
| 858 | 3300048926 | Ga0496123_0000507 | Ga0496123_0000507_62685_63656 | 317 |
| 859 | 3300048926 | Ga0496123_0001635 | Ga0496123_0001635_10819_11790 | 317 |
| 860 | 3300048926 | Ga0496123_0052447 | Ga0496123_0052447_192_1163 | 317 |
| 861 | 3300048927 | Ga0496124_0000008 | Ga0496124_0000008_467994_468965 | 317 |
| 862 | 3300048927 | Ga0496124_0000025 | Ga0496124_0000025_149610_150581 | 317 |
| 863 | 3300048927 | Ga0496124_0002226 | Ga0496124_0002226_1468_2439 | 317 |
| 864 | 3300048927 | Ga0496124_0005218 | Ga0496124_0005218_2463_3437 | 317 |
| 865 | 3300048927 | Ga0496124_0020850 | Ga0496124_0020850_2013_2984 | 317 |
| 866 | 3300048927 | Ga0496124_0025858 | Ga0496124_0025858_4154_5125 | 317 |
| 867 | 3300048927 | Ga0496124_0103594 | Ga0496124_0103594_787_1800 | 317 |
| 868 | 3300048927 | Ga0496124_0105661 | Ga0496124_0105661_54_1025 | 317 |
| 869 | 3300048927 | Ga0496124_0120836 | Ga0496124_0120836_485_1456 | 317 |
| 870 | 3300048927 | Ga0496124_0185756 | Ga0496124_0185756_165_1136 | 317 |
| 871 | 3300048928 | Ga0496125_0000013 | Ga0496125_0000013_246869_247840 | 317 |
| 872 | 3300048928 | Ga0496125_0019451 | Ga0496125_0019451_1980_2951 | 317 |
| 873 | 3300048928 | Ga0496125_0081689 | Ga0496125_0081689_1266_2237 | 317 |
| 874 | 3300048929 | Ga0496126_0000276 | Ga0496126_0000276_50721_51692 | 317 |
| 875 | 3300048929 | Ga0496126_0001263 | Ga0496126_0001263_16734_17705 | 317 |
| 876 | 3300048929 | Ga0496126_0071241 | Ga0496126_0071241_620_1591 | 317 |
| 877 | 3300048929 | Ga0496126_0198450 | Ga0496126_0198450_266_1279 | 317 |
| 878 | 3300048929 | Ga0496126_0300501 | Ga0496126_0300501_28_999 | 317 |
| 879 | 3300050491 | nmdc:mga00v17_14833_c1 | nmdc:mga00v17_14833_c1_3136_4107 | 317 |
| 880 | iso_pu_bacteria | 2554235132 | 2554817002 | 317 |
| 881 | iso_pu_bacteria | 2600254954 | 2600442956 | 317 |
| 882 | iso_pu_bacteria | 2600255389 | 2602009568 | 317 |
| 883 | iso_pu_bacteria | 2606217733 | 2608379679 | 317 |
| 884 | iso_pu_bacteria | 2808606379 | 2808941658 | 317 |
| 885 | iso_pu_bacteria | 2811994881 | 2812368111 | 317 |
| 886 | iso_pu_bacteria | 2823421272 | 2823424585 | 317 |
| 887 | iso_pu_bacteria | 2919501602 | 2919504315 | 317 |
| 888 | iso_pu_bacteria | 2923519811 | 2923522164 | 317 |
| 889 | iso_pu_bacteria | 2926063275 | 2926065112 | 317 |
| 890 | iso_pu_bacteria | 3007252601 | 3007253686 | 317 |
| 891 | iso_pu_bacteria | 3007315729 | 3007317540 | 317 |
| 892 | iso_pu_bacteria | 8011350971 | 8011353175 | 317 |
| 893 | iso_pu_bacteria | 8034962539 | 8034962570 | 317 |
| 894 | 2124908027 | MRS2a_Contig_24676 | MRS2a_00536150 | 318 |
| 895 | 2124908027 | MRS2a_Contig_35 | MRS2a_00246670 | 318 |
| 896 | 2162886011 | MRS1b_contig_6647355 | MRS1b_0149.00002970 | 318 |
| 897 | 3300002772 | JGI25164J39214_1000018 | JGI25164J39214_100001885 | 318 |
| 898 | 3300002772 | JGI25164J39214_1000207 | JGI25164J39214_10002076 | 318 |
| 899 | 3300003214 | JGI25165J46597_1000123 | JGI25165J46597_100012341 | 318 |
| 900 | 3300003214 | JGI25165J46597_1000376 | JGI25165J46597_100037640 | 318 |
| 901 | 3300003751 | Ga0055538_1000029 | Ga0055538_100002970 | 318 |
| 902 | 3300003752 | Ga0055539_1000039 | Ga0055539_100003970 | 318 |
| 903 | 3300003756 | Ga0055533_1000049 | Ga0055533_100004998 | 318 |
| 904 | 3300003758 | Ga0055532_1000049 | Ga0055532_100004971 | 318 |
| 905 | 3300003759 | Ga0055525_1000077 | Ga0055525_100007771 | 318 |
| 906 | 3300003781 | Ga0055536_1000958 | Ga0055536_100095814 | 318 |
| 907 | 3300003781 | Ga0055536_1000968 | Ga0055536_100096815 | 318 |
| 908 | 3300003781 | Ga0055536_1001745 | Ga0055536_10017456 | 318 |
| 909 | 3300003791 | Ga0055530_10001199 | Ga0055530_100011995 | 318 |
| 910 | 3300003791 | Ga0055530_10001316 | Ga0055530_100013169 | 318 |
| 911 | 3300003791 | Ga0055530_10003779 | Ga0055530_100037794 | 318 |
| 912 | 3300003791 | Ga0055530_10021492 | Ga0055530_100214922 | 318 |
| 913 | 3300003792 | Ga0055540_1000963 | Ga0055540_10009639 | 318 |
| 914 | 3300003792 | Ga0055540_1001690 | Ga0055540_10016906 | 318 |
| 915 | 3300003792 | Ga0055540_1002538 | Ga0055540_10025385 | 318 |
| 916 | 3300003794 | Ga0055531_10000140 | Ga0055531_1000014022 | 318 |
| 917 | 3300003841 | Ga0055541_1000026 | Ga0055541_100002698 | 318 |
| 918 | 3300003856 | Ga0058692_1008516 | Ga0058692_10085162 | 318 |
| 919 | 3300005288 | Ga0065714_10007229 | Ga0065714_100072291 | 318 |
| 920 | 3300005288 | Ga0065714_10010762 | Ga0065714_100107622 | 318 |
| 921 | 3300005288 | Ga0065714_10012414 | Ga0065714_100124142 | 318 |
| 922 | 3300005288 | Ga0065714_10065016 | Ga0065714_1006501611 | 318 |
| 923 | 3300005288 | Ga0065714_10069503 | Ga0065714_100695034 | 318 |
| 924 | 3300005288 | Ga0065714_10075872 | Ga0065714_100758722 | 318 |
| 925 | 3300005288 | Ga0065714_10076526 | Ga0065714_100765262 | 318 |
| 926 | 3300005288 | Ga0065714_10103343 | Ga0065714_101033432 | 318 |
| 927 | 3300005288 | Ga0065714_10154227 | Ga0065714_101542271 | 318 |
| 928 | 3300005289 | Ga0065704_10000359 | Ga0065704_1000035910 | 318 |
| 929 | 3300005289 | Ga0065704_10001844 | Ga0065704_100018444 | 318 |
| 930 | 3300005289 | Ga0065704_10087552 | Ga0065704_100875522 | 318 |
| 931 | 3300005289 | Ga0065704_10099352 | Ga0065704_100993522 | 318 |
| 932 | 3300005289 | Ga0065704_10163380 | Ga0065704_101633801 | 318 |
| 933 | 3300005289 | Ga0065704_10186442 | Ga0065704_101864421 | 318 |
| 934 | 3300005289 | Ga0065704_10197502 | Ga0065704_101975021 | 318 |
| 935 | 3300005290 | Ga0065712_10085474 | Ga0065712_100854743 | 318 |
| 936 | 3300005290 | Ga0065712_10107913 | Ga0065712_101079133 | 318 |
| 937 | 3300005293 | Ga0065715_10040540 | Ga0065715_100405401 | 318 |
| 938 | 3300005331 | Ga0070670_100007345 | Ga0070670_1000073455 | 318 |
| 939 | 3300005331 | Ga0070670_100019945 | Ga0070670_1000199456 | 318 |
| 940 | 3300005344 | Ga0070661_100000066 | Ga0070661_10000006657 | 318 |
| 941 | 3300005353 | Ga0070669_100000310 | Ga0070669_1000003107 | 318 |
| 942 | 3300005353 | Ga0070669_100009197 | Ga0070669_1000091977 | 318 |
| 943 | 3300005457 | Ga0070662_100000560 | Ga0070662_1000005608 | 318 |
| 944 | 3300005548 | Ga0070665_100014132 | Ga0070665_1000141326 | 318 |
| 945 | 3300005548 | Ga0070665_100031477 | Ga0070665_1000314775 | 318 |
| 946 | 3300005564 | Ga0070664_100000034 | Ga0070664_1000000347 | 318 |
| 947 | 3300005564 | Ga0070664_100089387 | Ga0070664_1000893874 | 318 |
| 948 | 3300005578 | Ga0068854_100145094 | Ga0068854_1001450941 | 318 |
| 949 | 3300005834 | Ga0068851_10000006 | Ga0068851_1000000691 | 318 |
| 950 | 3300006051 | Ga0075364_10248553 | Ga0075364_102485531 | 318 |
| 951 | 3300006058 | Ga0075432_10023165 | Ga0075432_100231652 | 318 |
| 952 | 3300006058 | Ga0075432_10035382 | Ga0075432_100353822 | 318 |
| 953 | 3300006058 | Ga0075432_10057284 | Ga0075432_100572842 | 318 |
| 954 | 3300006058 | Ga0075432_10063618 | Ga0075432_100636182 | 318 |
| 955 | 3300006058 | Ga0075432_10071090 | Ga0075432_100710901 | 318 |
| 956 | 3300006177 | Ga0075362_10004456 | Ga0075362_100044562 | 318 |
| 957 | 3300006944 | Ga0099823_1000054 | Ga0099823_100005410 | 318 |
| 958 | 3300006946 | Ga0079104_1000867 | Ga0079104_100086721 | 318 |
| 959 | 3300006946 | Ga0079104_1001209 | Ga0079104_10012099 | 318 |
| 960 | 3300006946 | Ga0079104_1039575 | Ga0079104_10395752 | 318 |
| 961 | 3300006948 | Ga0099826_10002377 | Ga0099826_100023775 | 318 |
| 962 | 3300009011 | Ga0105251_10000004 | Ga0105251_1000000497 | 318 |
| 963 | 3300009011 | Ga0105251_10000149 | Ga0105251_1000014956 | 318 |
| 964 | 3300009011 | Ga0105251_10000605 | Ga0105251_100006056 | 318 |
| 965 | 3300009011 | Ga0105251_10000935 | Ga0105251_1000093514 | 318 |
| 966 | 3300009011 | Ga0105251_10003255 | Ga0105251_1000325512 | 318 |
| 967 | 3300009011 | Ga0105251_10005578 | Ga0105251_100055786 | 318 |
| 968 | 3300009011 | Ga0105251_10013931 | Ga0105251_100139312 | 318 |
| 969 | 3300009011 | Ga0105251_10016626 | Ga0105251_100166262 | 318 |
| 970 | 3300009011 | Ga0105251_10017330 | Ga0105251_100173304 | 318 |
| 971 | 3300009011 | Ga0105251_10019782 | Ga0105251_100197823 | 318 |
| 972 | 3300009011 | Ga0105251_10019949 | Ga0105251_100199494 | 318 |
| 973 | 3300009011 | Ga0105251_10021494 | Ga0105251_100214944 | 318 |
| 974 | 3300009011 | Ga0105251_10062773 | Ga0105251_100627732 | 318 |
| 975 | 3300009011 | Ga0105251_10064635 | Ga0105251_100646351 | 318 |
| 976 | 3300009011 | Ga0105251_10070191 | Ga0105251_100701912 | 318 |
| 977 | 3300009011 | Ga0105251_10090870 | Ga0105251_100908701 | 318 |
| 978 | 3300009011 | Ga0105251_10109261 | Ga0105251_101092612 | 318 |
| 979 | 3300009036 | Ga0105244_10000922 | Ga0105244_100009228 | 318 |
| 980 | 3300009036 | Ga0105244_10002703 | Ga0105244_1000270310 | 318 |
| 981 | 3300009036 | Ga0105244_10002753 | Ga0105244_100027537 | 318 |
| 982 | 3300009036 | Ga0105244_10003421 | Ga0105244_100034211 | 318 |
| 983 | 3300009036 | Ga0105244_10005552 | Ga0105244_100055526 | 318 |
| 984 | 3300009036 | Ga0105244_10012847 | Ga0105244_100128474 | 318 |
| 985 | 3300009036 | Ga0105244_10017503 | Ga0105244_100175034 | 318 |
| 986 | 3300009036 | Ga0105244_10025151 | Ga0105244_100251512 | 318 |
| 987 | 3300009036 | Ga0105244_10030409 | Ga0105244_100304093 | 318 |
| 988 | 3300009036 | Ga0105244_10041920 | Ga0105244_100419201 | 318 |
| 989 | 3300009036 | Ga0105244_10059527 | Ga0105244_100595272 | 318 |
| 990 | 3300009036 | Ga0105244_10059960 | Ga0105244_100599602 | 318 |
| 991 | 3300009036 | Ga0105244_10106047 | Ga0105244_101060471 | 318 |
| 992 | 3300009036 | Ga0105244_10107932 | Ga0105244_101079321 | 318 |
| 993 | 3300009036 | Ga0105244_10118847 | Ga0105244_101188472 | 318 |
| 994 | 3300009092 | Ga0105250_10000235 | Ga0105250_1000023521 | 318 |
| 995 | 3300009092 | Ga0105250_10003478 | Ga0105250_100034786 | 318 |
| 996 | 3300009092 | Ga0105250_10004467 | Ga0105250_100044677 | 318 |
| 997 | 3300009092 | Ga0105250_10019913 | Ga0105250_100199133 | 318 |
| 998 | 3300009092 | Ga0105250_10023550 | Ga0105250_100235502 | 318 |
| 999 | 3300009092 | Ga0105250_10086816 | Ga0105250_100868162 | 318 |
| 1000 | 3300009148 | Ga0105243_10000133 | Ga0105243_1000013376 | 318 |
| 1001 | 3300009148 | Ga0105243_10004466 | Ga0105243_100044662 | 318 |
| 1002 | 3300009148 | Ga0105243_10007553 | Ga0105243_100075536 | 318 |
| 1003 | 3300009148 | Ga0105243_10008586 | Ga0105243_100085864 | 318 |
| 1004 | 3300009148 | Ga0105243_10046604 | Ga0105243_100466042 | 318 |
| 1005 | 3300009148 | Ga0105243_10220692 | Ga0105243_102206922 | 318 |
| 1006 | 3300009148 | Ga0105243_10333449 | Ga0105243_103334492 | 318 |
| 1007 | 3300009176 | Ga0105242_10000233 | Ga0105242_1000023310 | 318 |
| 1008 | 3300009177 | Ga0105248_10122604 | Ga0105248_101226043 | 318 |
| 1009 | 3300009545 | Ga0105237_10000160 | Ga0105237_1000016065 | 318 |
| 1010 | 3300011119 | Ga0105246_10007947 | Ga0105246_100079476 | 318 |
| 1011 | 3300011119 | Ga0105246_10054546 | Ga0105246_100545462 | 318 |
| 1012 | 3300012498 | Ga0157345_1002802 | Ga0157345_10028021 | 318 |
| 1013 | 3300013100 | Ga0157373_10001377 | Ga0157373_100013772 | 318 |
| 1014 | 3300013100 | Ga0157373_10005333 | Ga0157373_100053333 | 318 |
| 1015 | 3300013100 | Ga0157373_10029939 | Ga0157373_100299392 | 318 |
| 1016 | 3300013100 | Ga0157373_10088253 | Ga0157373_100882532 | 318 |
| 1017 | 3300013100 | Ga0157373_10123513 | Ga0157373_101235132 | 318 |
| 1018 | 3300013102 | Ga0157371_10000460 | Ga0157371_1000046026 | 318 |
| 1019 | 3300013102 | Ga0157371_10002644 | Ga0157371_1000264412 | 318 |
| 1020 | 3300013102 | Ga0157371_10005574 | Ga0157371_100055745 | 318 |
| 1021 | 3300013102 | Ga0157371_10086528 | Ga0157371_100865282 | 318 |
| 1022 | 3300013102 | Ga0157371_10162197 | Ga0157371_101621973 | 318 |
| 1023 | 3300013102 | Ga0157371_10164859 | Ga0157371_101648592 | 318 |
| 1024 | 3300013104 | Ga0157370_10005690 | Ga0157370_100056907 | 318 |
| 1025 | 3300013104 | Ga0157370_10154794 | Ga0157370_101547943 | 318 |
| 1026 | 3300013104 | Ga0157370_10228312 | Ga0157370_102283121 | 318 |
| 1027 | 3300013104 | Ga0157370_10456392 | Ga0157370_104563921 | 318 |
| 1028 | 3300013105 | Ga0157369_10020382 | Ga0157369_100203826 | 318 |
| 1029 | 3300013105 | Ga0157369_10039167 | Ga0157369_100391671 | 318 |
| 1030 | 3300013105 | Ga0157369_10064144 | Ga0157369_100641444 | 318 |
| 1031 | 3300013105 | Ga0157369_10065052 | Ga0157369_100650522 | 318 |
| 1032 | 3300013306 | Ga0163162_10001088 | Ga0163162_100010886 | 318 |
| 1033 | 3300013306 | Ga0163162_10119254 | Ga0163162_101192541 | 318 |
| 1034 | 3300013307 | Ga0157372_10000815 | Ga0157372_1000081514 | 318 |
| 1035 | 3300013307 | Ga0157372_10024055 | Ga0157372_100240555 | 318 |
| 1036 | 3300013307 | Ga0157372_10525877 | Ga0157372_105258772 | 318 |
| 1037 | 3300014497 | Ga0182008_10000235 | Ga0182008_1000023514 | 318 |
| 1038 | 3300014497 | Ga0182008_10010235 | Ga0182008_100102351 | 318 |
| 1039 | 3300014497 | Ga0182008_10032743 | Ga0182008_100327433 | 318 |
| 1040 | 3300014497 | Ga0182008_10035354 | Ga0182008_100353543 | 318 |
| 1041 | 3300014497 | Ga0182008_10047300 | Ga0182008_100473003 | 318 |
| 1042 | 3300014497 | Ga0182008_10056042 | Ga0182008_100560423 | 318 |
| 1043 | 3300014497 | Ga0182008_10072573 | Ga0182008_100725732 | 318 |
| 1044 | 3300015261 | Ga0182006_1008071 | Ga0182006_10080714 | 318 |
| 1045 | 3300015261 | Ga0182006_1010353 | Ga0182006_10103531 | 318 |
| 1046 | 3300015261 | Ga0182006_1035094 | Ga0182006_10350942 | 318 |
| 1047 | 3300015262 | Ga0182007_10000613 | Ga0182007_1000061312 | 318 |
| 1048 | 3300015262 | Ga0182007_10034420 | Ga0182007_100344203 | 318 |
| 1049 | 3300015265 | Ga0182005_1000428 | Ga0182005_100042811 | 318 |
| 1050 | 3300015265 | Ga0182005_1002342 | Ga0182005_10023425 | 318 |
| 1051 | 3300015265 | Ga0182005_1004652 | Ga0182005_10046524 | 318 |
| 1052 | 3300015265 | Ga0182005_1023056 | Ga0182005_10230563 | 318 |
| 1053 | 3300015265 | Ga0182005_1024933 | Ga0182005_10249332 | 318 |
| 1054 | 3300017792 | Ga0163161_10001062 | Ga0163161_1000106213 | 318 |
| 1055 | 3300017792 | Ga0163161_10051296 | Ga0163161_100512963 | 318 |
| 1056 | 3300017792 | Ga0163161_10054321 | Ga0163161_100543212 | 318 |
| 1057 | 3300017792 | Ga0163161_10306623 | Ga0163161_103066231 | 318 |
| 1058 | 3300025206 | Ga0209435_101165 | Ga0209435_1011653 | 318 |
| 1059 | 3300025207 | Ga0209760_100127 | Ga0209760_10012715 | 318 |
| 1060 | 3300025207 | Ga0209760_100144 | Ga0209760_10014443 | 318 |
| 1061 | 3300025224 | Ga0209784_100045 | Ga0209784_10004598 | 318 |
| 1062 | 3300025225 | Ga0209566_100057 | Ga0209566_10005798 | 318 |
| 1063 | 3300025226 | Ga0209674_100080 | Ga0209674_10008098 | 318 |
| 1064 | 3300025229 | Ga0209147_100079 | Ga0209147_10007998 | 318 |
| 1065 | 3300025230 | Ga0209563_100078 | Ga0209563_10007898 | 318 |
| 1066 | 3300025230 | Ga0209563_100284 | Ga0209563_10028411 | 318 |
| 1067 | 3300025231 | Ga0207427_100007 | Ga0207427_100007445 | 318 |
| 1068 | 3300025231 | Ga0207427_100038 | Ga0207427_10003880 | 318 |
| 1069 | 3300025233 | Ga0209437_100006 | Ga0209437_100006711 | 318 |
| 1070 | 3300025233 | Ga0209437_100009 | Ga0209437_100009707 | 318 |
| 1071 | 3300025242 | Ga0209258_100178 | Ga0209258_10017857 | 318 |
| 1072 | 3300025246 | Ga0209646_1000311 | Ga0209646_100031117 | 318 |
| 1073 | 3300025253 | Ga0209677_100045 | Ga0209677_10004598 | 318 |
| 1074 | 3300025256 | Ga0209759_1002924 | Ga0209759_10029246 | 318 |
| 1075 | 3300025261 | Ga0209233_1000059 | Ga0209233_1000059284 | 318 |
| 1076 | 3300025261 | Ga0209233_1000074 | Ga0209233_100007480 | 318 |
| 1077 | 3300025292 | Ga0209676_1000006 | Ga0209676_1000006692 | 318 |
| 1078 | 3300025292 | Ga0209676_1000010 | Ga0209676_1000010683 | 318 |
| 1079 | 3300025292 | Ga0209676_1000270 | Ga0209676_100027063 | 318 |
| 1080 | 3300025292 | Ga0209676_1000721 | Ga0209676_100072143 | 318 |
| 1081 | 3300025292 | Ga0209676_1003505 | Ga0209676_10035053 | 318 |
| 1082 | 3300025298 | Ga0209050_1000019 | Ga0209050_1000019180 | 318 |
| 1083 | 3300025298 | Ga0209050_1000060 | Ga0209050_100006092 | 318 |
| 1084 | 3300025298 | Ga0209050_1000065 | Ga0209050_1000065174 | 318 |
| 1085 | 3300025298 | Ga0209050_1001314 | Ga0209050_100131422 | 318 |
| 1086 | 3300025303 | Ga0209051_1000037 | Ga0209051_100003793 | 318 |
| 1087 | 3300025303 | Ga0209051_1000238 | Ga0209051_100023860 | 318 |
| 1088 | 3300025303 | Ga0209051_1000265 | Ga0209051_100026514 | 318 |
| 1089 | 3300025304 | Ga0209257_1000119 | Ga0209257_100011988 | 318 |
| 1090 | 3300025304 | Ga0209257_1019834 | Ga0209257_10198342 | 318 |
| 1091 | 3300025321 | Ga0207656_10000017 | Ga0207656_1000001742 | 318 |
| 1092 | 3300025711 | Ga0207696_1000022 | Ga0207696_100002280 | 318 |
| 1093 | 3300025711 | Ga0207696_1000044 | Ga0207696_1000044120 | 318 |
| 1094 | 3300025711 | Ga0207696_1000121 | Ga0207696_100012161 | 318 |
| 1095 | 3300025711 | Ga0207696_1000179 | Ga0207696_100017912 | 318 |
| 1096 | 3300025711 | Ga0207696_1000924 | Ga0207696_100092415 | 318 |
| 1097 | 3300025711 | Ga0207696_1001803 | Ga0207696_10018035 | 318 |
| 1098 | 3300025711 | Ga0207696_1018992 | Ga0207696_10189923 | 318 |
| 1099 | 3300025711 | Ga0207696_1020773 | Ga0207696_10207732 | 318 |
| 1100 | 3300025728 | Ga0207655_1000021 | Ga0207655_1000021270 | 318 |
| 1101 | 3300025728 | Ga0207655_1000086 | Ga0207655_100008695 | 318 |
| 1102 | 3300025728 | Ga0207655_1000240 | Ga0207655_100024027 | 318 |
| 1103 | 3300025728 | Ga0207655_1000462 | Ga0207655_100046210 | 318 |
| 1104 | 3300025728 | Ga0207655_1000859 | Ga0207655_100085922 | 318 |
| 1105 | 3300025728 | Ga0207655_1001511 | Ga0207655_100151116 | 318 |
| 1106 | 3300025728 | Ga0207655_1001729 | Ga0207655_100172911 | 318 |
| 1107 | 3300025728 | Ga0207655_1005688 | Ga0207655_10056885 | 318 |
| 1108 | 3300025728 | Ga0207655_1008864 | Ga0207655_10088645 | 318 |
| 1109 | 3300025728 | Ga0207655_1009864 | Ga0207655_10098644 | 318 |
| 1110 | 3300025728 | Ga0207655_1014133 | Ga0207655_10141332 | 318 |
| 1111 | 3300025728 | Ga0207655_1026480 | Ga0207655_10264804 | 318 |
| 1112 | 3300025728 | Ga0207655_1027259 | Ga0207655_10272593 | 318 |
| 1113 | 3300025728 | Ga0207655_1039814 | Ga0207655_10398143 | 318 |
| 1114 | 3300025728 | Ga0207655_1066733 | Ga0207655_10667332 | 318 |
| 1115 | 3300025728 | Ga0207655_1071672 | Ga0207655_10716722 | 318 |
| 1116 | 3300025735 | Ga0207713_1000013 | Ga0207713_1000013142 | 318 |
| 1117 | 3300025735 | Ga0207713_1000104 | Ga0207713_10001049 | 318 |
| 1118 | 3300025735 | Ga0207713_1000356 | Ga0207713_100035627 | 318 |
| 1119 | 3300025735 | Ga0207713_1000454 | Ga0207713_100045431 | 318 |
| 1120 | 3300025735 | Ga0207713_1000734 | Ga0207713_100073419 | 318 |
| 1121 | 3300025735 | Ga0207713_1001064 | Ga0207713_10010642 | 318 |
| 1122 | 3300025735 | Ga0207713_1002680 | Ga0207713_10026802 | 318 |
| 1123 | 3300025735 | Ga0207713_1006156 | Ga0207713_10061566 | 318 |
| 1124 | 3300025735 | Ga0207713_1007324 | Ga0207713_10073242 | 318 |
| 1125 | 3300025735 | Ga0207713_1007367 | Ga0207713_10073673 | 318 |
| 1126 | 3300025735 | Ga0207713_1007806 | Ga0207713_10078062 | 318 |
| 1127 | 3300025735 | Ga0207713_1014251 | Ga0207713_10142515 | 318 |
| 1128 | 3300025735 | Ga0207713_1017204 | Ga0207713_10172042 | 318 |
| 1129 | 3300025735 | Ga0207713_1017833 | Ga0207713_10178332 | 318 |
| 1130 | 3300025735 | Ga0207713_1021022 | Ga0207713_10210223 | 318 |
| 1131 | 3300025735 | Ga0207713_1049082 | Ga0207713_10490821 | 318 |
| 1132 | 3300025914 | Ga0207671_10000019 | Ga0207671_1000001978 | 318 |
| 1133 | 3300025920 | Ga0207649_10000004 | Ga0207649_10000004225 | 318 |
| 1134 | 3300025923 | Ga0207681_10000679 | Ga0207681_100006799 | 318 |
| 1135 | 3300025923 | Ga0207681_10001883 | Ga0207681_100018836 | 318 |
| 1136 | 3300025925 | Ga0207650_10000668 | Ga0207650_100006689 | 318 |
| 1137 | 3300025925 | Ga0207650_10001102 | Ga0207650_1000110211 | 318 |
| 1138 | 3300025933 | Ga0207706_10001474 | Ga0207706_1000147415 | 318 |
| 1139 | 3300025933 | Ga0207706_10014803 | Ga0207706_100148037 | 318 |
| 1140 | 3300025934 | Ga0207686_10002443 | Ga0207686_100024435 | 318 |
| 1141 | 3300025935 | Ga0207709_10000013 | Ga0207709_10000013433 | 318 |
| 1142 | 3300025935 | Ga0207709_10003688 | Ga0207709_100036887 | 318 |
| 1143 | 3300025935 | Ga0207709_10005522 | Ga0207709_100055225 | 318 |
| 1144 | 3300025935 | Ga0207709_10012279 | Ga0207709_100122794 | 318 |
| 1145 | 3300025935 | Ga0207709_10048780 | Ga0207709_100487803 | 318 |
| 1146 | 3300025935 | Ga0207709_10061528 | Ga0207709_100615283 | 318 |
| 1147 | 3300025935 | Ga0207709_10335959 | Ga0207709_103359591 | 318 |
| 1148 | 3300025941 | Ga0207711_10020084 | Ga0207711_100200842 | 318 |
| 1149 | 3300025945 | Ga0207679_10000019 | Ga0207679_1000001996 | 318 |
| 1150 | 3300025981 | Ga0207640_10060517 | Ga0207640_100605173 | 318 |
| 1151 | 3300026041 | Ga0207639_10003002 | Ga0207639_100030023 | 318 |
| 1152 | 3300027111 | Ga0209281_1000010 | Ga0209281_1000010148 | 318 |
| 1153 | 3300027111 | Ga0209281_1000013 | Ga0209281_1000013261 | 318 |
| 1154 | 3300027111 | Ga0209281_1004175 | Ga0209281_10041755 | 318 |
| 1155 | 3300027296 | Ga0209389_1000002 | Ga0209389_1000002271 | 318 |
| 1156 | 3300027312 | Ga0209371_1000239 | Ga0209371_100023934 | 318 |
| 1157 | 3300027312 | Ga0209371_1000253 | Ga0209371_100025311 | 318 |
| 1158 | 3300027665 | Ga0209983_1000325 | Ga0209983_10003258 | 318 |
| 1159 | 3300027682 | Ga0209971_1001041 | Ga0209971_10010413 | 318 |
| 1160 | 3300027876 | Ga0209974_10023657 | Ga0209974_100236572 | 318 |
| 1161 | 3300027876 | Ga0209974_10027692 | Ga0209974_100276922 | 318 |
| 1162 | 3300027907 | Ga0207428_10010530 | Ga0207428_100105304 | 318 |
| 1163 | 3300027907 | Ga0207428_10025831 | Ga0207428_100258311 | 318 |
| 1164 | 3300027907 | Ga0207428_10066757 | Ga0207428_100667571 | 318 |
| 1165 | 3300027907 | Ga0207428_10073063 | Ga0207428_100730633 | 318 |
| 1166 | 3300028379 | Ga0268266_10003720 | Ga0268266_100037208 | 318 |
| 1167 | 3300030500 | Ga0268256_1000199 | Ga0268256_100019934 | 318 |
| 1168 | 3300030500 | Ga0268256_1000367 | Ga0268256_100036726 | 318 |
| 1169 | 3300030521 | Ga0307511_10050424 | Ga0307511_100504242 | 318 |
| 1170 | 3300030731 | Ga0316177_1108430 | Ga0316177_11084303 | 318 |
| 1171 | 3300030733 | Ga0314311_1045991 | Ga0314311_10459914 | 318 |
| 1172 | 3300030735 | Ga0316178_1076498 | Ga0316178_107649822 | 318 |
| 1173 | 3300030742 | Ga0316183_1053494 | Ga0316183_10534944 | 318 |
| 1174 | 3300030744 | Ga0316181_1247282 | Ga0316181_12472822 | 318 |
| 1175 | 3300031548 | Ga0307408_100000304 | Ga0307408_1000003043 | 318 |
| 1176 | 3300031548 | Ga0307408_100063987 | Ga0307408_1000639872 | 318 |
| 1177 | 3300031548 | Ga0307408_100473096 | Ga0307408_1004730961 | 318 |
| 1178 | 3300031727 | Ga0316576_10026621 | Ga0316576_100266213 | 318 |
| 1179 | 3300031731 | Ga0307405_10013400 | Ga0307405_100134005 | 318 |
| 1180 | 3300031731 | Ga0307405_10153890 | Ga0307405_101538903 | 318 |
| 1181 | 3300031824 | Ga0307413_10033078 | Ga0307413_100330783 | 318 |
| 1182 | 3300031903 | Ga0307407_10191217 | Ga0307407_101912172 | 318 |
| 1183 | 3300032002 | Ga0307416_100176787 | Ga0307416_1001767871 | 318 |
| 1184 | 3300032002 | Ga0307416_100295816 | Ga0307416_1002958162 | 318 |
| 1185 | 3300032004 | Ga0307414_10458513 | Ga0307414_104585131 | 318 |
| 1186 | 3300032005 | Ga0307411_10033480 | Ga0307411_100334802 | 318 |
| 1187 | 3300032168 | Ga0316593_10012354 | Ga0316593_100123542 | 318 |
| 1188 | 3300033180 | Ga0307510_10001771 | Ga0307510_100017715 | 318 |
| 1189 | 3300036647 | Ga0316582_0027234 | Ga0316582_0027234_1251_2225 | 318 |
| 1190 | 3300038705 | Ga0237819_01795 | Ga0237819_01795_3155_4111 | 318 |
| 1191 | 3300039062 | Ga0400483_112441 | Ga0400483_112441_53_1045 | 318 |
| 1192 | 3300039062 | Ga0400483_117887 | Ga0400483_117887_1245_2216 | 318 |
| 1193 | 3300039062 | Ga0400483_250036 | Ga0400483_250036_166016_166987 | 318 |
| 1194 | 3300041404 | Ga0439436_0000700 | Ga0439436_0000700_7665_8633 | 318 |
| 1195 | 3300041405 | Ga0439438_000936 | Ga0439438_000936_1927_2895 | 318 |
| 1196 | 3300041405 | Ga0439438_001200 | Ga0439438_001200_7457_8413 | 318 |
| 1197 | 3300041405 | Ga0439438_002923 | Ga0439438_002923_2682_3638 | 318 |
| 1198 | 3300041405 | Ga0439438_007572 | Ga0439438_007572_2698_3654 | 318 |
| 1199 | 3300041405 | Ga0439438_015687 | Ga0439438_015687_1032_1988 | 318 |
| 1200 | 3300041407 | Ga0439447_001502 | Ga0439447_001502_6317_7285 | 318 |
| 1201 | 3300041407 | Ga0439447_003794 | Ga0439447_003794_1929_2885 | 318 |
| 1202 | 3300041407 | Ga0439447_009195 | Ga0439447_009195_184_1140 | 318 |
| 1203 | 3300041407 | Ga0439447_016505 | Ga0439447_016505_24_980 | 318 |
| 1204 | 3300041407 | Ga0439447_037427 | Ga0439447_037427_61_1017 | 318 |
| 1205 | 3300041411 | Ga0439466_0001124 | Ga0439466_0001124_5022_5990 | 318 |
| 1206 | 3300041411 | Ga0439466_0011673 | Ga0439466_0011673_1503_2459 | 318 |
| 1207 | 3300041411 | Ga0439466_0013560 | Ga0439466_0013560_1141_2097 | 318 |
| 1208 | 3300041411 | Ga0439466_0062413 | Ga0439466_0062413_186_1145 | 318 |
| 1209 | 3300042000 | Ga0439437_000026 | Ga0439437_000026_4164_5135 | 318 |
| 1210 | 3300042006 | Ga0439432_002272 | Ga0439432_002272_4237_5193 | 318 |
| 1211 | 3300042006 | Ga0439432_002413 | Ga0439432_002413_166_1134 | 318 |
| 1212 | 3300042006 | Ga0439432_003075 | Ga0439432_003075_2459_3415 | 318 |
| 1213 | 3300042006 | Ga0439432_007431 | Ga0439432_007431_2876_3832 | 318 |
| 1214 | 3300042006 | Ga0439432_038985 | Ga0439432_038985_89_1045 | 318 |
| 1215 | 3300042009 | Ga0439451_007229 | Ga0439451_007229_395_1351 | 318 |
| 1216 | 3300042009 | Ga0439451_016810 | Ga0439451_016810_492_1448 | 318 |
| 1217 | 3300042010 | Ga0439452_000781 | Ga0439452_000781_14088_15044 | 318 |
| 1218 | 3300042010 | Ga0439452_001455 | Ga0439452_001455_8662_9618 | 318 |
| 1219 | 3300042010 | Ga0439452_002278 | Ga0439452_002278_3803_4771 | 318 |
| 1220 | 3300042010 | Ga0439452_010697 | Ga0439452_010697_53_1009 | 318 |
| 1221 | 3300042013 | Ga0439456_001479 | Ga0439456_001479_3258_4229 | 318 |
| 1222 | 3300042013 | Ga0439456_006017 | Ga0439456_006017_97_1053 | 318 |
| 1223 | 3300042016 | Ga0439463_000853 | Ga0439463_000853_1625_2584 | 318 |
| 1224 | 3300042016 | Ga0439463_001820 | Ga0439463_001820_1741_2697 | 318 |
| 1225 | 3300042115 | Ga0450911_000002 | Ga0450911_000002_181015_181986 | 318 |
| 1226 | 3300042121 | Ga0450919_003044 | Ga0450919_003044_309_1265 | 318 |
| 1227 | 3300042127 | Ga0450890_013500 | Ga0450890_013500_29_985 | 318 |
| 1228 | 3300042137 | Ga0450902_000054 | Ga0450902_000054_4640_5596 | 318 |
| 1229 | 3300042137 | Ga0450902_001351 | Ga0450902_001351_2040_2996 | 318 |
| 1230 | 3300042138 | Ga0450903_010271 | Ga0450903_010271_96_1052 | 318 |
| 1231 | 3300042139 | Ga0450904_000035 | Ga0450904_000035_6802_7773 | 318 |
| 1232 | 3300042139 | Ga0450904_003356 | Ga0450904_003356_44_1000 | 318 |
| 1233 | 3300042142 | Ga0450905_000276 | Ga0450905_000276_4904_5860 | 318 |
| 1234 | 3300042142 | Ga0450905_000679 | Ga0450905_000679_1218_2174 | 318 |
| 1235 | 3300042145 | Ga0450906_001159 | Ga0450906_001159_3170_4126 | 318 |
| 1236 | 3300042146 | Ga0450907_001598 | Ga0450907_001598_356_1312 | 318 |
| 1237 | 3300042146 | Ga0450907_001604 | Ga0450907_001604_3754_4710 | 318 |
| 1238 | 3300042146 | Ga0450907_018177 | Ga0450907_018177_184_1140 | 318 |
| 1239 | 3300042156 | Ga0439446_0000240 | Ga0439446_0000240_7478_8446 | 318 |
| 1240 | 3300042435 | Ga0439434_0001047 | Ga0439434_0001047_3309_4265 | 318 |
| 1241 | 3300042435 | Ga0439434_0001060 | Ga0439434_0001060_3858_4826 | 318 |
| 1242 | 3300042439 | Ga0439464_0004058 | Ga0439464_0004058_2511_3479 | 318 |
| 1243 | 3300042461 | Ga0439460_0000893 | Ga0439460_0000893_49_1005 | 318 |
| 1244 | 3300042461 | Ga0439460_0004840 | Ga0439460_0004840_1963_2919 | 318 |
| 1245 | 3300042532 | Ga0450893_0000791 | Ga0450893_0000791_3145_4116 | 318 |
| 1246 | 3300042533 | Ga0450901_000269 | Ga0450901_000269_4963_5919 | 318 |
| 1247 | 3300042876 | Ga0451577_0106840 | Ga0451577_0106840_996_1973 | 318 |
| 1248 | 3300042993 | Ga0439440_0013310 | Ga0439440_0013310_764_1720 | 318 |
| 1249 | 3300045051 | Ga0451576_0000077 | Ga0451576_0000077_177594_178574 | 318 |
| 1250 | 3300046452 | Ga0495617_000978 | Ga0495617_000978_171_1127 | 318 |
| 1251 | 3300046452 | Ga0495617_003030 | Ga0495617_003030_35_991 | 318 |
| 1252 | 3300046452 | Ga0495617_009176 | Ga0495617_009176_113_1069 | 318 |
| 1253 | 3300046452 | Ga0495617_011834 | Ga0495617_011834_1139_2098 | 318 |
| 1254 | 3300046452 | Ga0495617_046308 | Ga0495617_046308_49_1005 | 318 |
| 1255 | 3300046452 | Ga0495617_053111 | Ga0495617_053111_378_1334 | 318 |
| 1256 | 3300046452 | Ga0495617_086097 | Ga0495617_086097_35_991 | 318 |
| 1257 | 3300046453 | Ga0495627_000021 | Ga0495627_000021_163935_164894 | 318 |
| 1258 | 3300046453 | Ga0495627_000279 | Ga0495627_000279_20114_21070 | 318 |
| 1259 | 3300046453 | Ga0495627_000789 | Ga0495627_000789_3105_4061 | 318 |
| 1260 | 3300046453 | Ga0495627_003053 | Ga0495627_003053_834_1793 | 318 |
| 1261 | 3300046453 | Ga0495627_009390 | Ga0495627_009390_49_1005 | 318 |
| 1262 | 3300046453 | Ga0495627_017288 | Ga0495627_017288_1448_2404 | 318 |
| 1263 | 3300046453 | Ga0495627_031784 | Ga0495627_031784_674_1630 | 318 |
| 1264 | 3300046453 | Ga0495627_050072 | Ga0495627_050072_261_1220 | 318 |
| 1265 | 3300046455 | Ga0495603_0221390 | Ga0495603_0221390_71_1027 | 318 |
| 1266 | 3300046457 | Ga0495590_0003408 | Ga0495590_0003408_103_1059 | 318 |
| 1267 | 3300046457 | Ga0495590_0008914 | Ga0495590_0008914_2802_3758 | 318 |
| 1268 | 3300046457 | Ga0495590_0053248 | Ga0495590_0053248_395_1351 | 318 |
| 1269 | 3300046458 | Ga0495591_000015 | Ga0495591_000015_242283_243242 | 318 |
| 1270 | 3300046458 | Ga0495591_001085 | Ga0495591_001085_2336_3292 | 318 |
| 1271 | 3300046458 | Ga0495591_002885 | Ga0495591_002885_3195_4154 | 318 |
| 1272 | 3300046458 | Ga0495591_004439 | Ga0495591_004439_3499_4458 | 318 |
| 1273 | 3300046458 | Ga0495591_010606 | Ga0495591_010606_2564_3520 | 318 |
| 1274 | 3300046458 | Ga0495591_023321 | Ga0495591_023321_254_1210 | 318 |
| 1275 | 3300046460 | Ga0495638_0002945 | Ga0495638_0002945_8875_9831 | 318 |
| 1276 | 3300046460 | Ga0495638_0013602 | Ga0495638_0013602_2310_3266 | 318 |
| 1277 | 3300046460 | Ga0495638_0029899 | Ga0495638_0029899_116_1072 | 318 |
| 1278 | 3300046460 | Ga0495638_0058607 | Ga0495638_0058607_435_1391 | 318 |
| 1279 | 3300046460 | Ga0495638_0217287 | Ga0495638_0217287_16_972 | 318 |
| 1280 | 3300046463 | Ga0495653_0004180 | Ga0495653_0004180_1881_2837 | 318 |
| 1281 | 3300046463 | Ga0495653_0049059 | Ga0495653_0049059_2228_3184 | 318 |
| 1282 | 3300046471 | Ga0495650_0000672 | Ga0495650_0000672_25453_26412 | 318 |
| 1283 | 3300046471 | Ga0495650_0004078 | Ga0495650_0004078_6947_7906 | 318 |
| 1284 | 3300046471 | Ga0495650_0010743 | Ga0495650_0010743_3511_4467 | 318 |
| 1285 | 3300046471 | Ga0495650_0022733 | Ga0495650_0022733_2032_2988 | 318 |
| 1286 | 3300046471 | Ga0495650_0026483 | Ga0495650_0026483_1635_2591 | 318 |
| 1287 | 3300046471 | Ga0495650_0054121 | Ga0495650_0054121_191_1150 | 318 |
| 1288 | 3300046471 | Ga0495650_0079889 | Ga0495650_0079889_283_1239 | 318 |
| 1289 | 3300046474 | Ga0495605_0000016 | Ga0495605_0000016_210567_211526 | 318 |
| 1290 | 3300046474 | Ga0495605_0000031 | Ga0495605_0000031_163562_164521 | 318 |
| 1291 | 3300046474 | Ga0495605_0000523 | Ga0495605_0000523_31374_32333 | 318 |
| 1292 | 3300046474 | Ga0495605_0004855 | Ga0495605_0004855_3458_4414 | 318 |
| 1293 | 3300046474 | Ga0495605_0005949 | Ga0495605_0005949_3431_4390 | 318 |
| 1294 | 3300046474 | Ga0495605_0011368 | Ga0495605_0011368_2893_3849 | 318 |
| 1295 | 3300046474 | Ga0495605_0012213 | Ga0495605_0012213_2314_3270 | 318 |
| 1296 | 3300046474 | Ga0495605_0024757 | Ga0495605_0024757_95_1054 | 318 |
| 1297 | 3300046491 | Ga0495584_0001616 | Ga0495584_0001616_12201_13157 | 318 |
| 1298 | 3300046491 | Ga0495584_0002458 | Ga0495584_0002458_65_1021 | 318 |
| 1299 | 3300046491 | Ga0495584_0005988 | Ga0495584_0005988_2361_3320 | 318 |
| 1300 | 3300046491 | Ga0495584_0006381 | Ga0495584_0006381_5151_6107 | 318 |
| 1301 | 3300046491 | Ga0495584_0019201 | Ga0495584_0019201_219_1175 | 318 |
| 1302 | 3300046491 | Ga0495584_0043034 | Ga0495584_0043034_65_1021 | 318 |
| 1303 | 3300046491 | Ga0495584_0046731 | Ga0495584_0046731_426_1382 | 318 |
| 1304 | 3300046491 | Ga0495584_0054401 | Ga0495584_0054401_1022_1978 | 318 |
| 1305 | 3300046492 | Ga0495585_0001037 | Ga0495585_0001037_18892_19848 | 318 |
| 1306 | 3300046492 | Ga0495585_0005139 | Ga0495585_0005139_3103_4059 | 318 |
| 1307 | 3300046492 | Ga0495585_0010653 | Ga0495585_0010653_1489_2445 | 318 |
| 1308 | 3300046492 | Ga0495585_0056583 | Ga0495585_0056583_266_1222 | 318 |
| 1309 | 3300046492 | Ga0495585_0075614 | Ga0495585_0075614_801_1757 | 318 |
| 1310 | 3300046492 | Ga0495585_0181323 | Ga0495585_0181323_56_1012 | 318 |
| 1311 | 3300046499 | Ga0495594_0002644 | Ga0495594_0002644_1946_2905 | 318 |
| 1312 | 3300046499 | Ga0495594_0143250 | Ga0495594_0143250_359_1315 | 318 |
| 1313 | 3300046500 | Ga0495596_0005154 | Ga0495596_0005154_2772_3728 | 318 |
| 1314 | 3300046500 | Ga0495596_0005876 | Ga0495596_0005876_2486_3445 | 318 |
| 1315 | 3300046501 | Ga0495607_0000213 | Ga0495607_0000213_6169_7128 | 318 |
| 1316 | 3300046501 | Ga0495607_0000237 | Ga0495607_0000237_58221_59177 | 318 |
| 1317 | 3300046501 | Ga0495607_0000248 | Ga0495607_0000248_51655_52614 | 318 |
| 1318 | 3300046501 | Ga0495607_0000780 | Ga0495607_0000780_25937_26896 | 318 |
| 1319 | 3300046501 | Ga0495607_0008778 | Ga0495607_0008778_3158_4114 | 318 |
| 1320 | 3300046501 | Ga0495607_0008930 | Ga0495607_0008930_2410_3366 | 318 |
| 1321 | 3300046501 | Ga0495607_0011600 | Ga0495607_0011600_2199_3158 | 318 |
| 1322 | 3300046501 | Ga0495607_0019456 | Ga0495607_0019456_2472_3431 | 318 |
| 1323 | 3300046501 | Ga0495607_0024302 | Ga0495607_0024302_514_1470 | 318 |
| 1324 | 3300046501 | Ga0495607_0032884 | Ga0495607_0032884_1163_2122 | 318 |
| 1325 | 3300046501 | Ga0495607_0042224 | Ga0495607_0042224_940_1896 | 318 |
| 1326 | 3300046501 | Ga0495607_0056721 | Ga0495607_0056721_44_1000 | 318 |
| 1327 | 3300046506 | Ga0495583_0000041 | Ga0495583_0000041_41125_42084 | 318 |
| 1328 | 3300046506 | Ga0495583_0000698 | Ga0495583_0000698_10472_11431 | 318 |
| 1329 | 3300046506 | Ga0495583_0001956 | Ga0495583_0001956_16171_17130 | 318 |
| 1330 | 3300046506 | Ga0495583_0004463 | Ga0495583_0004463_1009_1965 | 318 |
| 1331 | 3300046506 | Ga0495583_0007614 | Ga0495583_0007614_3462_4421 | 318 |
| 1332 | 3300046506 | Ga0495583_0016954 | Ga0495583_0016954_681_1640 | 318 |
| 1333 | 3300046506 | Ga0495583_0022460 | Ga0495583_0022460_2218_3177 | 318 |
| 1334 | 3300046507 | Ga0495606_0000076 | Ga0495606_0000076_25450_26406 | 318 |
| 1335 | 3300046507 | Ga0495606_0002535 | Ga0495606_0002535_10568_11527 | 318 |
| 1336 | 3300046507 | Ga0495606_0006037 | Ga0495606_0006037_5664_6620 | 318 |
| 1337 | 3300046507 | Ga0495606_0008423 | Ga0495606_0008423_7276_8232 | 318 |
| 1338 | 3300046507 | Ga0495606_0032362 | Ga0495606_0032362_2391_3347 | 318 |
| 1339 | 3300046507 | Ga0495606_0058125 | Ga0495606_0058125_29_985 | 318 |
| 1340 | 3300046507 | Ga0495606_0117556 | Ga0495606_0117556_625_1581 | 318 |
| 1341 | 3300046512 | Ga0495610_0002616 | Ga0495610_0002616_4281_5237 | 318 |
| 1342 | 3300046512 | Ga0495610_0011574 | Ga0495610_0011574_510_1469 | 318 |
| 1343 | 3300046512 | Ga0495610_0019155 | Ga0495610_0019155_2859_3815 | 318 |
| 1344 | 3300046512 | Ga0495610_0023628 | Ga0495610_0023628_47_1003 | 318 |
| 1345 | 3300046512 | Ga0495610_0034853 | Ga0495610_0034853_79_1035 | 318 |
| 1346 | 3300046512 | Ga0495610_0038305 | Ga0495610_0038305_1136_2095 | 318 |
| 1347 | 3300046513 | Ga0495616_0002404 | Ga0495616_0002404_52_1008 | 318 |
| 1348 | 3300046513 | Ga0495616_0006595 | Ga0495616_0006595_5987_6943 | 318 |
| 1349 | 3300046513 | Ga0495616_0021752 | Ga0495616_0021752_1916_2872 | 318 |
| 1350 | 3300046513 | Ga0495616_0143417 | Ga0495616_0143417_61_1017 | 318 |
| 1351 | 3300046515 | Ga0495620_0000013 | Ga0495620_0000013_94742_95698 | 318 |
| 1352 | 3300046515 | Ga0495620_0000015 | Ga0495620_0000015_41094_42053 | 318 |
| 1353 | 3300046515 | Ga0495620_0004506 | Ga0495620_0004506_3462_4421 | 318 |
| 1354 | 3300046515 | Ga0495620_0007041 | Ga0495620_0007041_4513_5472 | 318 |
| 1355 | 3300046515 | Ga0495620_0014204 | Ga0495620_0014204_387_1343 | 318 |
| 1356 | 3300046515 | Ga0495620_0042178 | Ga0495620_0042178_67_1023 | 318 |
| 1357 | 3300046515 | Ga0495620_0053691 | Ga0495620_0053691_696_1652 | 318 |
| 1358 | 3300046515 | Ga0495620_0060381 | Ga0495620_0060381_601_1557 | 318 |
| 1359 | 3300046518 | Ga0495631_0001077 | Ga0495631_0001077_14230_15186 | 318 |
| 1360 | 3300046518 | Ga0495631_0005273 | Ga0495631_0005273_2566_3522 | 318 |
| 1361 | 3300046518 | Ga0495631_0012543 | Ga0495631_0012543_2452_3411 | 318 |
| 1362 | 3300046518 | Ga0495631_0125795 | Ga0495631_0125795_30_986 | 318 |
| 1363 | 3300046519 | Ga0495632_0000912 | Ga0495632_0000912_5069_6028 | 318 |
| 1364 | 3300046519 | Ga0495632_0000914 | Ga0495632_0000914_6303_7259 | 318 |
| 1365 | 3300046519 | Ga0495632_0001648 | Ga0495632_0001648_62_1018 | 318 |
| 1366 | 3300046519 | Ga0495632_0001676 | Ga0495632_0001676_15_971 | 318 |
| 1367 | 3300046519 | Ga0495632_0002354 | Ga0495632_0002354_11219_12175 | 318 |
| 1368 | 3300046519 | Ga0495632_0004171 | Ga0495632_0004171_8922_9878 | 318 |
| 1369 | 3300046519 | Ga0495632_0004792 | Ga0495632_0004792_2515_3474 | 318 |
| 1370 | 3300046519 | Ga0495632_0006071 | Ga0495632_0006071_6533_7492 | 318 |
| 1371 | 3300046519 | Ga0495632_0039895 | Ga0495632_0039895_1393_2349 | 318 |
| 1372 | 3300046519 | Ga0495632_0061073 | Ga0495632_0061073_277_1233 | 318 |
| 1373 | 3300046520 | Ga0495637_0000913 | Ga0495637_0000913_13_969 | 318 |
| 1374 | 3300046520 | Ga0495637_0002612 | Ga0495637_0002612_2404_3363 | 318 |
| 1375 | 3300046520 | Ga0495637_0003141 | Ga0495637_0003141_7797_8753 | 318 |
| 1376 | 3300046520 | Ga0495637_0007261 | Ga0495637_0007261_2298_3257 | 318 |
| 1377 | 3300046520 | Ga0495637_0007862 | Ga0495637_0007862_1965_2921 | 318 |
| 1378 | 3300046520 | Ga0495637_0031219 | Ga0495637_0031219_833_1792 | 318 |
| 1379 | 3300046520 | Ga0495637_0039831 | Ga0495637_0039831_975_1931 | 318 |
| 1380 | 3300046522 | Ga0495643_0000223 | Ga0495643_0000223_32872_33828 | 318 |
| 1381 | 3300046522 | Ga0495643_0000903 | Ga0495643_0000903_8617_9573 | 318 |
| 1382 | 3300046522 | Ga0495643_0005943 | Ga0495643_0005943_2433_3389 | 318 |
| 1383 | 3300046522 | Ga0495643_0010375 | Ga0495643_0010375_2410_3366 | 318 |
| 1384 | 3300046522 | Ga0495643_0018092 | Ga0495643_0018092_833_1789 | 318 |
| 1385 | 3300046522 | Ga0495643_0068346 | Ga0495643_0068346_54_1010 | 318 |
| 1386 | 3300046523 | Ga0495644_0000723 | Ga0495644_0000723_10234_11190 | 318 |
| 1387 | 3300046523 | Ga0495644_0002168 | Ga0495644_0002168_4751_5710 | 318 |
| 1388 | 3300046523 | Ga0495644_0007316 | Ga0495644_0007316_3238_4194 | 318 |
| 1389 | 3300046523 | Ga0495644_0011601 | Ga0495644_0011601_2366_3322 | 318 |
| 1390 | 3300046524 | Ga0495648_0001423 | Ga0495648_0001423_6309_7265 | 318 |
| 1391 | 3300046524 | Ga0495648_0002171 | Ga0495648_0002171_17429_18385 | 318 |
| 1392 | 3300046524 | Ga0495648_0006275 | Ga0495648_0006275_8732_9688 | 318 |
| 1393 | 3300046524 | Ga0495648_0013055 | Ga0495648_0013055_2653_3612 | 318 |
| 1394 | 3300046524 | Ga0495648_0015574 | Ga0495648_0015574_2034_2993 | 318 |
| 1395 | 3300046524 | Ga0495648_0050318 | Ga0495648_0050318_990_1949 | 318 |
| 1396 | 3300046524 | Ga0495648_0051193 | Ga0495648_0051193_1497_2453 | 318 |
| 1397 | 3300046524 | Ga0495648_0116647 | Ga0495648_0116647_84_1040 | 318 |
| 1398 | 3300046524 | Ga0495648_0130266 | Ga0495648_0130266_330_1286 | 318 |
| 1399 | 3300046526 | Ga0495666_0009905 | Ga0495666_0009905_909_1865 | 318 |
| 1400 | 3300046526 | Ga0495666_0018038 | Ga0495666_0018038_2495_3451 | 318 |
| 1401 | 3300046528 | Ga0495642_0000153 | Ga0495642_0000153_5404_6360 | 318 |
| 1402 | 3300046528 | Ga0495642_0000800 | Ga0495642_0000800_29_985 | 318 |
| 1403 | 3300046530 | Ga0495654_0001518 | Ga0495654_0001518_11703_12659 | 318 |
| 1404 | 3300046530 | Ga0495654_0001707 | Ga0495654_0001707_13763_14719 | 318 |
| 1405 | 3300046530 | Ga0495654_0002300 | Ga0495654_0002300_2780_3736 | 318 |
| 1406 | 3300046530 | Ga0495654_0003578 | Ga0495654_0003578_2534_3493 | 318 |
| 1407 | 3300046530 | Ga0495654_0005355 | Ga0495654_0005355_4659_5618 | 318 |
| 1408 | 3300046530 | Ga0495654_0009802 | Ga0495654_0009802_4221_5177 | 318 |
| 1409 | 3300046530 | Ga0495654_0015604 | Ga0495654_0015604_2550_3506 | 318 |
| 1410 | 3300046530 | Ga0495654_0016284 | Ga0495654_0016284_37_993 | 318 |
| 1411 | 3300046530 | Ga0495654_0048535 | Ga0495654_0048535_1070_2026 | 318 |
| 1412 | 3300046530 | Ga0495654_0049043 | Ga0495654_0049043_65_1024 | 318 |
| 1413 | 3300046530 | Ga0495654_0062178 | Ga0495654_0062178_59_1015 | 318 |
| 1414 | 3300046530 | Ga0495654_0121992 | Ga0495654_0121992_204_1160 | 318 |
| 1415 | 3300046536 | Ga0495587_0077495 | Ga0495587_0077495_25_981 | 318 |
| 1416 | 3300046538 | Ga0495609_0000015 | Ga0495609_0000015_280288_281247 | 318 |
| 1417 | 3300046538 | Ga0495609_0000070 | Ga0495609_0000070_95084_96043 | 318 |
| 1418 | 3300046538 | Ga0495609_0003891 | Ga0495609_0003891_2393_3352 | 318 |
| 1419 | 3300046538 | Ga0495609_0005696 | Ga0495609_0005696_5509_6465 | 318 |
| 1420 | 3300046542 | Ga0495597_0000005 | Ga0495597_0000005_182462_183421 | 318 |
| 1421 | 3300046542 | Ga0495597_0005772 | Ga0495597_0005772_1928_2884 | 318 |
| 1422 | 3300046542 | Ga0495597_0007051 | Ga0495597_0007051_2383_3342 | 318 |
| 1423 | 3300046542 | Ga0495597_0018470 | Ga0495597_0018470_68_1024 | 318 |
| 1424 | 3300046542 | Ga0495597_0033564 | Ga0495597_0033564_1174_2130 | 318 |
| 1425 | 3300046543 | Ga0495645_0030346 | Ga0495645_0030346_43_1002 | 318 |
| 1426 | 3300046558 | Ga0495633_0000060 | Ga0495633_0000060_116779_117738 | 318 |
| 1427 | 3300046615 | Ga0495656_0006796 | Ga0495656_0006796_205_1161 | 318 |
| 1428 | 3300046616 | Ga0495668_0016569 | Ga0495668_0016569_2332_3288 | 318 |
| 1429 | 3300046648 | Ga0495611_0000720 | Ga0495611_0000720_58_1014 | 318 |
| 1430 | 3300046648 | Ga0495611_0000817 | Ga0495611_0000817_3143_4102 | 318 |
| 1431 | 3300046648 | Ga0495611_0003033 | Ga0495611_0003033_67_1023 | 318 |
| 1432 | 3300046648 | Ga0495611_0003416 | Ga0495611_0003416_5522_6481 | 318 |
| 1433 | 3300046648 | Ga0495611_0069106 | Ga0495611_0069106_588_1544 | 318 |
| 1434 | 3300046660 | Ga0495625_0001491 | Ga0495625_0001491_2491_3450 | 318 |
| 1435 | 3300046660 | Ga0495625_0004073 | Ga0495625_0004073_2810_3766 | 318 |
| 1436 | 3300046660 | Ga0495625_0048065 | Ga0495625_0048065_1953_2912 | 318 |
| 1437 | 3300046660 | Ga0495625_0116723 | Ga0495625_0116723_62_1018 | 318 |
| 1438 | 3300046660 | Ga0495625_0129471 | Ga0495625_0129471_77_1033 | 318 |
| 1439 | 3300046660 | Ga0495625_0130031 | Ga0495625_0130031_168_1124 | 318 |
| 1440 | 3300046660 | Ga0495625_0262401 | Ga0495625_0262401_82_1038 | 318 |
| 1441 | 3300046663 | Ga0495635_0037354 | Ga0495635_0037354_375_1331 | 318 |
| 1442 | 3300046665 | Ga0495661_0000110 | Ga0495661_0000110_34575_35534 | 318 |
| 1443 | 3300046665 | Ga0495661_0000139 | Ga0495661_0000139_81712_82671 | 318 |
| 1444 | 3300046665 | Ga0495661_0000194 | Ga0495661_0000194_49361_50320 | 318 |
| 1445 | 3300046665 | Ga0495661_0000304 | Ga0495661_0000304_30717_31673 | 318 |
| 1446 | 3300046665 | Ga0495661_0019103 | Ga0495661_0019103_2885_3841 | 318 |
| 1447 | 3300046665 | Ga0495661_0026217 | Ga0495661_0026217_2782_3738 | 318 |
| 1448 | 3300046665 | Ga0495661_0027633 | Ga0495661_0027633_52_1008 | 318 |
| 1449 | 3300046665 | Ga0495661_0042224 | Ga0495661_0042224_219_1178 | 318 |
| 1450 | 3300046665 | Ga0495661_0153040 | Ga0495661_0153040_253_1209 | 318 |
| 1451 | 3300046665 | Ga0495661_0190255 | Ga0495661_0190255_62_1018 | 318 |
| 1452 | 3300046679 | Ga0495623_0069962 | Ga0495623_0069962_409_1365 | 318 |
| 1453 | 3300046680 | Ga0495646_0091703 | Ga0495646_0091703_27_983 | 318 |
| 1454 | 3300046684 | Ga0495669_0017189 | Ga0495669_0017189_72_1028 | 318 |
| 1455 | 3300046689 | Ga0495613_0301470 | Ga0495613_0301470_56_1012 | 318 |
| 1456 | 3300046691 | Ga0495670_0004111 | Ga0495670_0004111_6117_7073 | 318 |
| 1457 | 3300046691 | Ga0495670_0005750 | Ga0495670_0005750_2999_3955 | 318 |
| 1458 | 3300046692 | Ga0495671_0001949 | Ga0495671_0001949_73_1029 | 318 |
| 1459 | 3300046692 | Ga0495671_0006975 | Ga0495671_0006975_976_1932 | 318 |
| 1460 | 3300046692 | Ga0495671_0010944 | Ga0495671_0010944_1636_2592 | 318 |
| 1461 | 3300046692 | Ga0495671_0012308 | Ga0495671_0012308_664_1623 | 318 |
| 1462 | 3300046692 | Ga0495671_0012367 | Ga0495671_0012367_3635_4591 | 318 |
| 1463 | 3300046692 | Ga0495671_0017262 | Ga0495671_0017262_462_1418 | 318 |
| 1464 | 3300046692 | Ga0495671_0022086 | Ga0495671_0022086_759_1715 | 318 |
| 1465 | 3300046692 | Ga0495671_0056015 | Ga0495671_0056015_952_1908 | 318 |
| 1466 | 3300046692 | Ga0495671_0102462 | Ga0495671_0102462_135_1091 | 318 |
| 1467 | 3300046694 | Ga0495649_0002123 | Ga0495649_0002123_2393_3349 | 318 |
| 1468 | 3300046694 | Ga0495649_0006667 | Ga0495649_0006667_4612_5568 | 318 |
| 1469 | 3300046694 | Ga0495649_0014726 | Ga0495649_0014726_2373_3329 | 318 |
| 1470 | 3300046694 | Ga0495649_0023580 | Ga0495649_0023580_2419_3375 | 318 |
| 1471 | 3300046694 | Ga0495649_0045699 | Ga0495649_0045699_1377_2333 | 318 |
| 1472 | 3300046694 | Ga0495649_0063994 | Ga0495649_0063994_992_1948 | 318 |
| 1473 | 3300046694 | Ga0495649_0099940 | Ga0495649_0099940_529_1485 | 318 |
| 1474 | 3300046794 | Ga0495589_0005001 | Ga0495589_0005001_72_1028 | 318 |
| 1475 | 3300046794 | Ga0495589_0005441 | Ga0495589_0005441_3352_4308 | 318 |
| 1476 | 3300046794 | Ga0495589_0015046 | Ga0495589_0015046_398_1357 | 318 |
| 1477 | 3300046809 | Ga0495600_0056440 | Ga0495600_0056440_28_984 | 318 |
| 1478 | 3300046809 | Ga0495600_0103275 | Ga0495600_0103275_35_991 | 318 |
| 1479 | 3300046810 | Ga0495660_0001756 | Ga0495660_0001756_4310_5269 | 318 |
| 1480 | 3300046810 | Ga0495660_0003768 | Ga0495660_0003768_5082_6041 | 318 |
| 1481 | 3300046810 | Ga0495660_0012461 | Ga0495660_0012461_2877_3836 | 318 |
| 1482 | 3300046810 | Ga0495660_0018712 | Ga0495660_0018712_556_1515 | 318 |
| 1483 | 3300046810 | Ga0495660_0023661 | Ga0495660_0023661_2100_3059 | 318 |
| 1484 | 3300046810 | Ga0495660_0066105 | Ga0495660_0066105_887_1843 | 318 |
| 1485 | 3300046810 | Ga0495660_0113743 | Ga0495660_0113743_237_1193 | 318 |
| 1486 | 3300047318 | Ga0495636_0009371 | Ga0495636_0009371_2853_3809 | 318 |
| 1487 | 3300047320 | Ga0495672_0002745 | Ga0495672_0002745_2662_3618 | 318 |
| 1488 | 3300047320 | Ga0495672_0006543 | Ga0495672_0006543_6017_6973 | 318 |
| 1489 | 3300047320 | Ga0495672_0014337 | Ga0495672_0014337_2131_3087 | 318 |
| 1490 | 3300047320 | Ga0495672_0022683 | Ga0495672_0022683_1457_2416 | 318 |
| 1491 | 3300047320 | Ga0495672_0023110 | Ga0495672_0023110_1855_2811 | 318 |
| 1492 | 3300047320 | Ga0495672_0026253 | Ga0495672_0026253_2564_3523 | 318 |
| 1493 | 3300047320 | Ga0495672_0071400 | Ga0495672_0071400_962_1918 | 318 |
| 1494 | 3300047320 | Ga0495672_0121507 | Ga0495672_0121507_96_1055 | 318 |
| 1495 | 3300047321 | Ga0495676_0000013 | Ga0495676_0000013_209606_210565 | 318 |
| 1496 | 3300047321 | Ga0495676_0067231 | Ga0495676_0067231_1528_2484 | 318 |
| 1497 | 3300047323 | Ga0495683_0000027 | Ga0495683_0000027_111278_112237 | 318 |
| 1498 | 3300047323 | Ga0495683_0000261 | Ga0495683_0000261_13605_14561 | 318 |
| 1499 | 3300047323 | Ga0495683_0018906 | Ga0495683_0018906_2540_3496 | 318 |
| 1500 | 3300047323 | Ga0495683_0021349 | Ga0495683_0021349_2339_3295 | 318 |
| 1501 | 3300047323 | Ga0495683_0022851 | Ga0495683_0022851_53_1009 | 318 |
| 1502 | 3300047323 | Ga0495683_0084407 | Ga0495683_0084407_531_1487 | 318 |
| 1503 | 3300047323 | Ga0495683_0152496 | Ga0495683_0152496_49_1005 | 318 |
| 1504 | 3300047443 | Ga0495687_005661 | Ga0495687_005661_93_1049 | 318 |
| 1505 | 3300047444 | Ga0495675_0009682 | Ga0495675_0009682_828_1784 | 318 |
| 1506 | 3300047444 | Ga0495675_0044070 | Ga0495675_0044070_186_1142 | 318 |
| 1507 | 3300047446 | Ga0495679_000206 | Ga0495679_000206_48221_49180 | 318 |
| 1508 | 3300047446 | Ga0495679_030670 | Ga0495679_030670_717_1673 | 318 |
| 1509 | 3300047469 | Ga0495673_0001257 | Ga0495673_0001257_16034_16990 | 318 |
| 1510 | 3300047469 | Ga0495673_0002579 | Ga0495673_0002579_9249_10208 | 318 |
| 1511 | 3300047469 | Ga0495673_0003090 | Ga0495673_0003090_2445_3404 | 318 |
| 1512 | 3300047469 | Ga0495673_0005035 | Ga0495673_0005035_848_1804 | 318 |
| 1513 | 3300047469 | Ga0495673_0005632 | Ga0495673_0005632_2416_3372 | 318 |
| 1514 | 3300047469 | Ga0495673_0006585 | Ga0495673_0006585_5790_6749 | 318 |
| 1515 | 3300047469 | Ga0495673_0007928 | Ga0495673_0007928_5030_5986 | 318 |
| 1516 | 3300047469 | Ga0495673_0009812 | Ga0495673_0009812_1236_2192 | 318 |
| 1517 | 3300047469 | Ga0495673_0010469 | Ga0495673_0010469_2142_3101 | 318 |
| 1518 | 3300047469 | Ga0495673_0015057 | Ga0495673_0015057_2220_3179 | 318 |
| 1519 | 3300047469 | Ga0495673_0015965 | Ga0495673_0015965_350_1309 | 318 |
| 1520 | 3300047469 | Ga0495673_0017418 | Ga0495673_0017418_362_1318 | 318 |
| 1521 | 3300047469 | Ga0495673_0022001 | Ga0495673_0022001_2126_3082 | 318 |
| 1522 | 3300047469 | Ga0495673_0033902 | Ga0495673_0033902_1371_2327 | 318 |
| 1523 | 3300047469 | Ga0495673_0034146 | Ga0495673_0034146_1215_2174 | 318 |
| 1524 | 3300047469 | Ga0495673_0061061 | Ga0495673_0061061_445_1404 | 318 |
| 1525 | 3300047469 | Ga0495673_0074043 | Ga0495673_0074043_78_1037 | 318 |
| 1526 | 3300047470 | Ga0495681_0001327 | Ga0495681_0001327_3876_4832 | 318 |
| 1527 | 3300047470 | Ga0495681_0002119 | Ga0495681_0002119_13_969 | 318 |
| 1528 | 3300047470 | Ga0495681_0004330 | Ga0495681_0004330_8739_9695 | 318 |
| 1529 | 3300047470 | Ga0495681_0005466 | Ga0495681_0005466_2481_3440 | 318 |
| 1530 | 3300047470 | Ga0495681_0014330 | Ga0495681_0014330_2099_3055 | 318 |
| 1531 | 3300047470 | Ga0495681_0061521 | Ga0495681_0061521_118_1074 | 318 |
| 1532 | 3300047472 | Ga0495686_0088025 | Ga0495686_0088025_852_1808 | 318 |
| 1533 | 3300047472 | Ga0495686_0088724 | Ga0495686_0088724_525_1484 | 318 |
| 1534 | 3300048091 | Ga0495626_0000056 | Ga0495626_0000056_147214_148173 | 318 |
| 1535 | 3300048091 | Ga0495626_0001052 | Ga0495626_0001052_16979_17935 | 318 |
| 1536 | 3300048091 | Ga0495626_0001474 | Ga0495626_0001474_3867_4823 | 318 |
| 1537 | 3300048091 | Ga0495626_0001525 | Ga0495626_0001525_2340_3296 | 318 |
| 1538 | 3300048091 | Ga0495626_0002948 | Ga0495626_0002948_44_1000 | 318 |
| 1539 | 3300048091 | Ga0495626_0003635 | Ga0495626_0003635_19_975 | 318 |
| 1540 | 3300048091 | Ga0495626_0004137 | Ga0495626_0004137_2343_3299 | 318 |
| 1541 | 3300048091 | Ga0495626_0009473 | Ga0495626_0009473_4118_5074 | 318 |
| 1542 | 3300048091 | Ga0495626_0016825 | Ga0495626_0016825_2507_3463 | 318 |
| 1543 | 3300048091 | Ga0495626_0017201 | Ga0495626_0017201_25_981 | 318 |
| 1544 | 3300048091 | Ga0495626_0123335 | Ga0495626_0123335_72_1028 | 318 |
| 1545 | 3300048904 | Ga0496101_0267964 | Ga0496101_0267964_263_1222 | 318 |
| 1546 | 3300048905 | Ga0496102_0047483 | Ga0496102_0047483_2071_3039 | 318 |
| 1547 | 3300048913 | Ga0496110_0029079 | Ga0496110_0029079_3189_4145 | 318 |
| 1548 | 3300048917 | Ga0496114_0018708 | Ga0496114_0018708_4497_5453 | 318 |
| 1549 | 3300048917 | Ga0496114_0019375 | Ga0496114_0019375_2829_3785 | 318 |
| 1550 | 3300048919 | Ga0496116_0001669 | Ga0496116_0001669_22_978 | 318 |
| 1551 | 3300048919 | Ga0496116_0002562 | Ga0496116_0002562_13759_14715 | 318 |
| 1552 | 3300048919 | Ga0496116_0003077 | Ga0496116_0003077_3876_4832 | 318 |
| 1553 | 3300048919 | Ga0496116_0040547 | Ga0496116_0040547_1869_2825 | 318 |
| 1554 | 3300048920 | Ga0496117_0002620 | Ga0496117_0002620_4744_5700 | 318 |
| 1555 | 3300048920 | Ga0496117_0003939 | Ga0496117_0003939_3869_4825 | 318 |
| 1556 | 3300048920 | Ga0496117_0006411 | Ga0496117_0006411_6506_7462 | 318 |
| 1557 | 3300048920 | Ga0496117_0007875 | Ga0496117_0007875_2324_3280 | 318 |
| 1558 | 3300048920 | Ga0496117_0035911 | Ga0496117_0035911_96_1052 | 318 |
| 1559 | 3300048920 | Ga0496117_0125930 | Ga0496117_0125930_96_1052 | 318 |
| 1560 | 3300048921 | Ga0496118_0001807 | Ga0496118_0001807_2550_3506 | 318 |
| 1561 | 3300048921 | Ga0496118_0010787 | Ga0496118_0010787_4846_5802 | 318 |
| 1562 | 3300048921 | Ga0496118_0090361 | Ga0496118_0090361_139_1095 | 318 |
| 1563 | 3300048921 | Ga0496118_0097843 | Ga0496118_0097843_384_1343 | 318 |
| 1564 | 3300048922 | Ga0496119_0000112 | Ga0496119_0000112_100992_101948 | 318 |
| 1565 | 3300048922 | Ga0496119_0103631 | Ga0496119_0103631_531_1487 | 318 |
| 1566 | 3300048923 | Ga0496120_0004409 | Ga0496120_0004409_7124_8080 | 318 |
| 1567 | 3300048923 | Ga0496120_0166617 | Ga0496120_0166617_95_1051 | 318 |
| 1568 | 3300048924 | Ga0496121_0001283 | Ga0496121_0001283_28590_29546 | 318 |
| 1569 | 3300048924 | Ga0496121_0003009 | Ga0496121_0003009_2440_3399 | 318 |
| 1570 | 3300048924 | Ga0496121_0022025 | Ga0496121_0022025_2514_3473 | 318 |
| 1571 | 3300048924 | Ga0496121_0028786 | Ga0496121_0028786_816_1772 | 318 |
| 1572 | 3300048924 | Ga0496121_0233744 | Ga0496121_0233744_220_1176 | 318 |
| 1573 | 3300048925 | Ga0496122_0000122 | Ga0496122_0000122_179173_180132 | 318 |
| 1574 | 3300048925 | Ga0496122_0008288 | Ga0496122_0008288_7290_8246 | 318 |
| 1575 | 3300048925 | Ga0496122_0009298 | Ga0496122_0009298_635_1591 | 318 |
| 1576 | 3300048925 | Ga0496122_0026934 | Ga0496122_0026934_1100_2059 | 318 |
| 1577 | 3300048926 | Ga0496123_0000391 | Ga0496123_0000391_11870_12826 | 318 |
| 1578 | 3300048926 | Ga0496123_0000878 | Ga0496123_0000878_13570_14526 | 318 |
| 1579 | 3300048926 | Ga0496123_0001340 | Ga0496123_0001340_20833_21792 | 318 |
| 1580 | 3300048926 | Ga0496123_0012443 | Ga0496123_0012443_5506_6465 | 318 |
| 1581 | 3300048926 | Ga0496123_0046368 | Ga0496123_0046368_1950_2909 | 318 |
| 1582 | 3300048927 | Ga0496124_0000222 | Ga0496124_0000222_47920_48879 | 318 |
| 1583 | 3300048927 | Ga0496124_0001891 | Ga0496124_0001891_79_1035 | 318 |
| 1584 | 3300048927 | Ga0496124_0010141 | Ga0496124_0010141_3821_4777 | 318 |
| 1585 | 3300048927 | Ga0496124_0012924 | Ga0496124_0012924_3066_4022 | 318 |
| 1586 | 3300048927 | Ga0496124_0016180 | Ga0496124_0016180_1189_2145 | 318 |
| 1587 | 3300048927 | Ga0496124_0034180 | Ga0496124_0034180_413_1369 | 318 |
| 1588 | 3300048927 | Ga0496124_0049308 | Ga0496124_0049308_2589_3545 | 318 |
| 1589 | 3300048927 | Ga0496124_0058510 | Ga0496124_0058510_2048_3007 | 318 |
| 1590 | 3300048927 | Ga0496124_0073840 | Ga0496124_0073840_1273_2232 | 318 |
| 1591 | 3300048927 | Ga0496124_0102408 | Ga0496124_0102408_1318_2277 | 318 |
| 1592 | 3300048927 | Ga0496124_0173580 | Ga0496124_0173580_46_1002 | 318 |
| 1593 | 3300048927 | Ga0496124_0179691 | Ga0496124_0179691_28_984 | 318 |
| 1594 | 3300048928 | Ga0496125_0000908 | Ga0496125_0000908_33325_34281 | 318 |
| 1595 | 3300048928 | Ga0496125_0027866 | Ga0496125_0027866_4103_5059 | 318 |
| 1596 | 3300048928 | Ga0496125_0027889 | Ga0496125_0027889_3877_4833 | 318 |
| 1597 | 3300048928 | Ga0496125_0042239 | Ga0496125_0042239_2561_3517 | 318 |
| 1598 | 3300048928 | Ga0496125_0046158 | Ga0496125_0046158_2657_3613 | 318 |
| 1599 | 3300048928 | Ga0496125_0232512 | Ga0496125_0232512_53_1009 | 318 |
| 1600 | 3300048929 | Ga0496126_0015473 | Ga0496126_0015473_4400_5356 | 318 |
| 1601 | 3300048929 | Ga0496126_0040844 | Ga0496126_0040844_2308_3264 | 318 |
| 1602 | 3300048929 | Ga0496126_0062444 | Ga0496126_0062444_23_979 | 318 |
| 1603 | 3300049459 | Ga0495678_000031 | Ga0495678_000031_86880_87839 | 318 |
| 1604 | 3300049459 | Ga0495678_000039 | Ga0495678_000039_149415_150374 | 318 |
| 1605 | 3300049459 | Ga0495678_005928 | Ga0495678_005928_2902_3858 | 318 |
| 1606 | 3300049459 | Ga0495678_008574 | Ga0495678_008574_1060_2016 | 318 |
| 1607 | 3300049459 | Ga0495678_008769 | Ga0495678_008769_1014_1970 | 318 |
| 1608 | 3300049459 | Ga0495678_011885 | Ga0495678_011885_2149_3108 | 318 |
| 1609 | 3300049459 | Ga0495678_012838 | Ga0495678_012838_64_1020 | 318 |
| 1610 | 3300049459 | Ga0495678_015738 | Ga0495678_015738_91_1047 | 318 |
| 1611 | 3300049459 | Ga0495678_052291 | Ga0495678_052291_53_1012 | 318 |
| 1612 | 3300049459 | Ga0495678_068829 | Ga0495678_068829_20_976 | 318 |
| 1613 | 3300049459 | Ga0495678_086545 | Ga0495678_086545_81_1037 | 318 |
| 1614 | 3300049460 | Ga0495682_0000577 | Ga0495682_0000577_12468_13424 | 318 |
| 1615 | 3300049460 | Ga0495682_0004465 | Ga0495682_0004465_2529_3488 | 318 |
| 1616 | 3300049571 | Ga0501034_0000137 | Ga0501034_0000137_109530_110486 | 318 |
| 1617 | 3300049573 | Ga0501037_0042957 | Ga0501037_0042957_1728_2696 | 318 |
| 1618 | 3300053125 | Ga0500618_022861 | Ga0500618_022861_76_1032 | 318 |
| 1619 | 3300053135 | Ga0500659_0021849 | Ga0500659_0021849_2126_3082 | 318 |
| 1620 | 3300053140 | Ga0500573_0024813 | Ga0500573_0024813_1904_2863 | 318 |
| 1621 | iso_pu_bacteria | 2808606373 | 2808904592 | 318 |
| 1622 | iso_pu_bacteria | 640427133 | 640487193 | 318 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4p7c-assembly1.cif.gz_B | crystal structure of putative methyltransferase from pseudomonas syringae pv. tomato | 0.9881 | 1 | 318 |
| 4p7c-assembly1.cif.gz_B | crystal structure of putative methyltransferase from pseudomonas syringae pv. tomato | 0.9851 | 1 | 318 |
| 4qnu-assembly1.cif.gz_A | crystal structure of cmob bound with cx-sam in p21212 | 0.9574 | 1 | 318 |
| 4qnx-assembly1.cif.gz_A | crystal structure of apo-cmob | 0.9571 | 2 | 318 |
| 4qnv-assembly2.cif.gz_B | crystal structure of cx-sam bound cmob from e. coli in p6122 | 0.9564 | 1 | 318 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76291_95_323_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9802 | 94 | 318 | 3.40.50.150 |
| af_P76291_95_323_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9591 | 94 | 318 | 3.40.50.150 |
| af_K7LTE4_237_888_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.843 | 104 | 178 | 3.40.50.150 |
| af_K7KE15_1_124_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8086 | 109 | 231 | 3.40.50.150 |
| af_Q9GYH9_14_196_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.808 | 102 | 220 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A376RHE7-F1-model_v4 | Putative methyltransferase (EC 2.1.1.-) | 0.992 | 209 | 318 |
GO:0008168
GO:0032259 |
| AF-A0A352IUG6-F1-model_v4 | tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB | 0.9916 | 121 | 318 |
GO:0002098
GO:0016765 |
| AF-A0A520R8T8-F1-model_v4 | DUF1698 domain-containing protein | 0.9915 | 174 | 317 |
|
| AF-A0A657B0A0-F1-model_v4 | tRNA 5-methoxyuridine(34) synthase CmoB | 0.9837 | 46 | 318 |
GO:0002098
GO:0008168 GO:0016765 |
| AF-A0A352IUG6-F1-model_v4 | tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB | 0.9818 | 121 | 318 |
GO:0002098
GO:0016765 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar