F495085

General Info

Members Datasets Scaffolds Average Seq Length
1622 705 1189 319

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10000648|Ga0105251_1000064830
Length 338
Sequence MIDFSNFYQLIAKSPLSHWLETLPAQVAAWQRDALHGKYREWERAVEFLPEFAPYRLDLLHSVTAESETPLGEGQRLRIENLLKNLMPWRKGPFSLYGVNIDTEWRSDWKWERVLPHLSDLTGRTILDVGCGSGYHMWRMIGAGAHLAVGIDPTQLFLCQFEAVRKLLGNDQRAHLLPLGIEQLPALNAFDTVFSMGVLYHRRSPLDHLWQLKDQLVPGGELVLETLVVEGDENTVLVPGDRYAQMRNVYFIPSAAALKQWLEKCGFVDVRIVDACVTSTDEQRRTEWMTTESLADFLDPRDSSKTVEGYPAPLRAVIIASKPETQQSLAAKKTRSQG

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
4 2506520008 Serratia plymuthica AS12 Isolate Unclassified
5 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
6 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
7 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
8 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
9 2511231004 Pseudomonas sp. GM102 Isolate Nodule
10 2511231006 Pseudomonas sp. GM17 Isolate Nodule
11 2511231007 Pseudomonas sp. GM18 Isolate Nodule
12 2511231008 Pseudomonas sp. GM21 Isolate Nodule
13 2511231010 Pseudomonas sp. GM25 Isolate Nodule
14 2511231011 Pseudomonas sp. GM30 Isolate Nodule
15 2511231012 Pseudomonas sp. GM33 Isolate Nodule
16 2511231014 Pseudomonas sp. GM48 Isolate Nodule
17 2511231015 Pseudomonas sp. GM49 Isolate Nodule
18 2511231016 Pseudomonas sp. GM50 Isolate Nodule
19 2511231017 Pseudomonas sp. GM55 Isolate Nodule
20 2511231018 Pseudomonas sp. GM60 Isolate Nodule
21 2511231019 Pseudomonas sp. GM67 Isolate Nodule
22 2511231020 Pseudomonas sp. GM74 Isolate Nodule
23 2511231021 Pseudomonas sp. GM78 Isolate Nodule
24 2511231022 Pseudomonas sp. GM79 Isolate Nodule
25 2511231023 Pseudomonas sp. GM80 Isolate Nodule
26 2511231024 Pseudomonas sp. GM84 Isolate Nodule
27 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
28 2511231031 Pseudomonas sp. GM16 Isolate Nodule
29 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
30 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
31 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
32 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
33 2547132181 Kosakonia sacchari SP1 Isolate Stem
34 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
35 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
36 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
37 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
38 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
39 2561511199 Enterobacter sp. R4-368 Isolate Nodule
40 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
41 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
42 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
43 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
44 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
45 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
46 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
47 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
48 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
49 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
50 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
51 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
52 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
53 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
54 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
55 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
56 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
57 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
58 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
59 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
60 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
61 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
62 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
63 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
64 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
65 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
66 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
67 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
68 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
69 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
70 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
71 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
72 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
73 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
74 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
75 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
76 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
77 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
78 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
79 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
80 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
81 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
82 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
83 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
84 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
85 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
86 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
87 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
88 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
89 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
90 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
91 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
92 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
93 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
94 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
95 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
96 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
97 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
98 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
99 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
100 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
101 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
102 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
103 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
104 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
105 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
106 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
107 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
108 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
109 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
110 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
111 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
112 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
113 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
114 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
115 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
116 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
117 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
118 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
119 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
120 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
121 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
122 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
123 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
124 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
125 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
126 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
127 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
128 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
129 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
130 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
131 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
132 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
133 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
134 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
135 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
136 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
137 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
138 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
139 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
140 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
141 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
142 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
143 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
144 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
145 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
146 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
147 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
148 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
149 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
150 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
151 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
152 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
153 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
154 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
155 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
156 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
157 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
158 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
159 2636415599 Klebsiella variicola DX120E Isolate Unclassified
160 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
161 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
162 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
163 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
164 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
165 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
166 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
167 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
168 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
169 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
170 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
171 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
172 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
173 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
174 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
175 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
176 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
177 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
178 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
179 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
180 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
181 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
182 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
183 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
184 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
185 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
186 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
187 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
188 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
189 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
190 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
191 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
192 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
193 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
194 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
195 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
196 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
197 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
198 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
199 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
200 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
201 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
202 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
203 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
204 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
205 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
206 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
207 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
208 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
209 2751185917 Enterobacter sp. HK169 Isolate Unclassified
210 2765235841 Pseudomonas putida AA7 Isolate Unclassified
211 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
212 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
213 2773857670 Pseudomonas sp. 478 Isolate Unclassified
214 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
215 2773857673 Pseudomonas sp. 443 Isolate Unclassified
216 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
217 2775507074 Klebsiella sp. D5A Isolate Unclassified
218 2784132063 Pseudomonas sp. 424 Isolate Unclassified
219 2784132072 Pseudomonas sp. 460 Isolate Unclassified
220 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
221 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
222 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
223 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
224 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
225 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
226 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
227 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
228 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
229 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
230 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
231 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
232 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
233 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
234 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
235 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
236 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
237 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
238 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
239 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
240 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
241 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
242 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
243 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
244 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
245 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
246 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
247 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
248 2821118458 Enterobacter asburiae 609 Isolate Unclassified
249 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
250 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
251 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
252 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
253 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
254 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
255 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
256 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
257 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
258 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
259 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
260 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
261 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
262 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
263 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
264 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
265 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
266 2847085930 Erwinia persicina B64 Isolate Bulb
267 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
268 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
269 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
270 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
271 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
272 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
273 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
274 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
275 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
276 2865014394 Pantoea sp. R-71966 Isolate Unclassified
277 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
278 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
279 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
280 2876601092 Pantoea endophytica 596 Isolate Unclassified
281 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
282 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
283 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
284 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere
285 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
286 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
287 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
288 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
289 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
290 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
291 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
292 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
293 2904504865 Serratia marcescens 1822 Isolate Unclassified
294 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
295 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
296 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
297 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
298 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
299 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
300 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
301 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
302 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
303 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
304 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
305 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
306 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
307 2919150387 Rahnella aceris 1817 Isolate Unclassified
308 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
309 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
310 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
311 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
312 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
313 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
314 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
315 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
316 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
317 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
318 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
319 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
320 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
321 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
322 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
323 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
324 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
325 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
326 2927143783 Rahnella sp. 2050 Isolate Unclassified
327 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
328 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
329 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
330 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
331 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
332 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
333 2932406140 Serratia sp. 2723 Isolate Rhizosphere
334 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
335 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
336 2937539931 Pantoea sp. LS15 Isolate Unclassified
337 2937967321 Serratia sp. YC16 Isolate Unclassified
338 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
339 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
340 2939577877 Serratia sp. 509 Isolate Rhizosphere
341 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
342 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
343 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
344 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
345 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
346 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
347 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
348 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
349 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
350 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
351 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
352 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
353 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
354 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
355 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
356 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
357 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
358 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
359 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
360 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
361 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
362 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
363 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
364 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
365 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
366 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
367 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
368 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
369 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
370 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
371 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
372 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
373 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
374 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
375 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
376 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
377 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
378 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
379 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
380 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
381 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
382 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
383 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
384 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
385 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
386 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
387 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
388 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
389 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
390 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
391 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
392 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
393 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
394 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
395 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
396 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
397 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
398 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
399 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
400 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
401 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
402 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
403 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
404 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
405 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
406 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
407 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
408 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
409 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
410 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
411 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
412 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
413 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
414 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
415 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
416 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
417 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
418 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
419 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
420 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
421 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
422 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
423 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
424 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
425 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
426 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
427 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
428 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
429 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
430 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
431 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
432 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
433 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
434 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
435 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
436 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
437 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
438 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
439 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
440 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
441 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
442 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
443 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
444 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
445 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
446 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
447 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
448 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
449 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
450 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
451 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
452 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
453 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
454 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
455 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
456 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
457 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
458 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
459 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
460 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
461 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
462 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
463 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
464 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
465 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
466 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
467 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
468 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
469 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
470 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
471 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
472 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
473 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
474 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
475 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
476 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
477 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
478 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
479 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
480 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
481 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
482 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
483 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
484 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
485 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
486 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
487 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
488 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
489 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
490 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
491 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
492 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
493 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
494 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
495 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
496 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
497 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
498 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
499 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
500 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
501 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
502 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
503 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
504 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
505 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
506 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
507 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
508 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
509 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
510 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
511 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
512 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
513 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
514 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
515 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
516 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
517 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
518 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
519 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
520 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
521 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
522 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
523 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
524 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
525 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
526 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
527 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
528 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
529 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
530 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
531 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
532 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
533 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
534 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
535 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
536 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
537 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
538 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
539 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
540 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
541 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
542 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
543 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
544 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
545 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
546 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
547 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
548 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
549 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
550 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
551 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
552 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
553 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
554 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
555 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
556 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
557 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
558 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
559 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
560 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
561 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
562 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
563 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
564 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
565 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
566 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
567 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
568 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
569 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
570 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
571 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
572 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
573 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
574 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
575 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
576 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
577 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
578 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
579 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
580 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
581 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
582 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
583 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
584 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
585 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
586 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
587 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
588 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
589 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
590 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
591 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
592 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
593 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
594 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
595 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
596 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
597 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
598 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
599 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
600 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
601 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
602 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
603 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
604 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
605 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
606 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
607 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
608 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
609 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
610 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
611 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
612 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
613 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
614 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
615 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
616 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
617 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
618 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
619 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
620 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
621 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
622 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
623 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
624 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
625 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
626 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
627 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
628 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
629 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
630 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
631 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
632 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
633 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
634 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
635 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
636 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
637 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
638 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
639 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
640 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
641 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
642 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
643 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
644 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
645 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
646 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
647 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
648 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
649 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
650 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
651 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
652 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
653 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
654 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
655 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
656 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
657 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
658 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
659 640753048 Serratia proteamaculans 568 Isolate Endosphere
660 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
661 8004592986 Serratia sp. S119 Isolate Unclassified
662 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
663 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
664 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
665 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
666 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
667 8018221730 Enterobacter sp. CM29 Isolate Unclassified
668 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
669 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
670 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
671 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
672 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
673 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
674 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
675 8052494512 Pseudomonas putida LD6 Isolate Unclassified
676 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
677 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
678 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
679 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
680 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
681 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
682 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
683 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
684 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
685 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
686 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
687 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
688 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
689 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
690 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
691 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
692 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
693 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
694 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
695 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
696 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
697 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
698 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
699 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
700 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
701 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
702 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
703 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
704 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere
705 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.18
Metatranscriptomes 0.12
Isolates 26.7

Biome Distribution

Category Percentage (%)
Aerial Root 0.37
Bulb 0.06
Endosphere 5.18
Nodule 3.21
Rhizoplane 8.45
Rhizosphere 62.33
Stem 0.06
Stem Tuber 0.31
Unclassified 20.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_24676 2124908027 Bacteria 1746
2 MRS2a_Contig_35 2124908027 Bacteria 26362
3 MRS1b_contig_6647355 2162886011 Bacteria 1208
4 JGI25162J39368_1000019 3300002737 Bacteria 262053
5 JGI25162J39368_1002438 3300002737 Bacteria 7232
6 JGI25163J39215_1000079 3300002771 Bacteria 42883
7 JGI25164J39214_1000011 3300002772 Bacteria 262057
8 JGI25164J39214_1000018 3300002772 Bacteria 185215
9 JGI25164J39214_1000207 3300002772 Bacteria 50241
10 JGI25152J39213_1000482 3300002773 Bacteria 22790
11 JGI25165J46597_1000123 3300003214 Bacteria 131481
12 JGI25165J46597_1000376 3300003214 Bacteria 49186
13 rootH2_10011341 3300003320 Bacteria 15752
14 Ga0055538_1000021 3300003751 Bacteria 262057
15 Ga0055538_1000029 3300003751 Bacteria 203858
16 Ga0055539_1000026 3300003752 Bacteria 262057
17 Ga0055539_1000039 3300003752 Bacteria 203858
18 Ga0055533_1000035 3300003756 Bacteria 262057
19 Ga0055533_1000049 3300003756 Bacteria 203858
20 Ga0055532_1000049 3300003758 Bacteria 174079
21 Ga0055525_1000045 3300003759 Bacteria 262057
22 Ga0055525_1000077 3300003759 Bacteria 166608
23 Ga0055536_1000958 3300003781 Bacteria 18467
24 Ga0055536_1000968 3300003781 Bacteria 18344
25 Ga0055536_1001745 3300003781 Bacteria 12833
26 Ga0055530_10001199 3300003791 Bacteria 20031
27 Ga0055530_10001316 3300003791 Bacteria 18672
28 Ga0055530_10003779 3300003791 Bacteria 8345
29 Ga0055530_10021492 3300003791 Bacteria 1901
30 Ga0055540_1000963 3300003792 Bacteria 18672
31 Ga0055540_1001690 3300003792 Bacteria 12725
32 Ga0055540_1002538 3300003792 Bacteria 9525
33 Ga0055531_10000140 3300003794 Bacteria 82793
34 Ga0055541_1000020 3300003841 Bacteria 262057
35 Ga0055541_1000026 3300003841 Bacteria 203858
36 Ga0058692_1000085 3300003856 Bacteria 65543
37 Ga0058692_1000167 3300003856 Bacteria 40623
38 Ga0058692_1000364 3300003856 Bacteria 21856
39 Ga0058692_1000797 3300003856 Bacteria 12608
40 Ga0058692_1001265 3300003856 Bacteria 9621
41 Ga0058692_1003493 3300003856 Bacteria 4845
42 Ga0058692_1008516 3300003856 Bacteria 2645
43 Ga0058692_1012199 3300003856 Bacteria 2045
44 Ga0058692_1014733 3300003856 Bacteria 1784
45 Ga0058692_1014891 3300003856 Bacteria 1768
46 Ga0058692_1015467 3300003856 Bacteria 1718
47 Ga0058692_1027113 3300003856 Bacteria 1119
48 Ga0065703_1019293 3300005272 Bacteria 3277
49 Ga0065714_10007229 3300005288 Bacteria 3634
50 Ga0065714_10010762 3300005288 Bacteria 2251
51 Ga0065714_10012414 3300005288 Bacteria 3258
52 Ga0065714_10065016 3300005288 Bacteria 13938
53 Ga0065714_10069503 3300005288 Bacteria 4199
54 Ga0065714_10075872 3300005288 Bacteria 2855
55 Ga0065714_10076526 3300005288 Bacteria 2775
56 Ga0065714_10096328 3300005288 Bacteria 1763
57 Ga0065714_10103343 3300005288 Bacteria 1605
58 Ga0065714_10154227 3300005288 Bacteria 1081
59 Ga0065704_10000318 3300005289 Bacteria 39615
60 Ga0065704_10000359 3300005289 Bacteria 28149
61 Ga0065704_10001844 3300005289 Bacteria 6433
62 Ga0065704_10002406 3300005289 Bacteria 9195
63 Ga0065704_10084486 3300005289 Bacteria 3329
64 Ga0065704_10087552 3300005289 Bacteria 3012
65 Ga0065704_10091125 3300005289 Bacteria 2739
66 Ga0065704_10096731 3300005289 Bacteria 2427
67 Ga0065704_10099352 3300005289 Bacteria 2315
68 Ga0065704_10163380 3300005289 Bacteria 1339
69 Ga0065704_10186442 3300005289 Bacteria 1211
70 Ga0065704_10197502 3300005289 Bacteria 1161
71 Ga0065712_10085474 3300005290 Bacteria 2695
72 Ga0065712_10107913 3300005290 Bacteria 1831
73 Ga0065715_10040540 3300005293 Bacteria 1912
74 Ga0070670_100007345 3300005331 Bacteria 9353
75 Ga0070670_100019945 3300005331 Bacteria 5755
76 Ga0070661_100000066 3300005344 Bacteria 84469
77 Ga0070668_100051975 3300005347 Bacteria 3158
78 Ga0070669_100000310 3300005353 Bacteria 38441
79 Ga0070669_100009197 3300005353 Bacteria 7039
80 Ga0070659_100076066 3300005366 Bacteria 2677
81 Ga0070662_100000560 3300005457 Bacteria 22585
82 Ga0070665_100000356 3300005548 Bacteria 68816
83 Ga0070665_100014132 3300005548 Bacteria 8022
84 Ga0070665_100031477 3300005548 Bacteria 5339
85 Ga0070664_100000034 3300005564 Bacteria 82848
86 Ga0070664_100089387 3300005564 Bacteria 2665
87 Ga0068857_100001074 3300005577 Bacteria 21158
88 Ga0068854_100145094 3300005578 Bacteria 1825
89 Ga0068851_10000006 3300005834 Bacteria 258116
90 Ga0068851_10036752 3300005834 Bacteria 2453
91 Ga0075364_10002374 3300006051 Bacteria 10566
92 Ga0075364_10028598 3300006051 Bacteria 3569
93 Ga0075364_10248553 3300006051 Bacteria 1209
94 Ga0075432_10023165 3300006058 Bacteria 2126
95 Ga0075432_10035382 3300006058 Bacteria 1735
96 Ga0075432_10057284 3300006058 Bacteria 1382
97 Ga0075432_10063618 3300006058 Bacteria 1317
98 Ga0075432_10071090 3300006058 Bacteria 1250
99 Ga0075362_10004456 3300006177 Bacteria 5037
100 Ga0099823_1000054 3300006944 Bacteria 55085
101 Ga0079104_1000047 3300006946 Bacteria 182563
102 Ga0079104_1000060 3300006946 Bacteria 161936
103 Ga0079104_1000225 3300006946 Bacteria 78440
104 Ga0079104_1000475 3300006946 Bacteria 44675
105 Ga0079104_1000867 3300006946 Bacteria 25004
106 Ga0079104_1001084 3300006946 Bacteria 20407
107 Ga0079104_1001209 3300006946 Bacteria 18310
108 Ga0079104_1002173 3300006946 Bacteria 11075
109 Ga0079104_1003218 3300006946 Bacteria 7860
110 Ga0079104_1008699 3300006946 Bacteria 3514
111 Ga0079104_1012111 3300006946 Bacteria 2733
112 Ga0079104_1018323 3300006946 Bacteria 1985
113 Ga0079104_1018332 3300006946 Bacteria 1984
114 Ga0079104_1039575 3300006946 Bacteria 1110
115 Ga0099826_10002377 3300006948 Bacteria 12115
116 Ga0105251_10000004 3300009011 Bacteria 285212
117 Ga0105251_10000149 3300009011 Bacteria 71244
118 Ga0105251_10000226 3300009011 Bacteria 56731
119 Ga0105251_10000605 3300009011 Bacteria 32851
120 Ga0105251_10000648 3300009011 Bacteria 32068
121 Ga0105251_10000740 3300009011 Bacteria 29928
122 Ga0105251_10000935 3300009011 Bacteria 26139
123 Ga0105251_10002574 3300009011 Bacteria 14064
124 Ga0105251_10003255 3300009011 Bacteria 11932
125 Ga0105251_10003382 3300009011 Bacteria 11603
126 Ga0105251_10004557 3300009011 Bacteria 9382
127 Ga0105251_10005578 3300009011 Bacteria 8186
128 Ga0105251_10007670 3300009011 Bacteria 6602
129 Ga0105251_10013931 3300009011 Bacteria 4472
130 Ga0105251_10016626 3300009011 Bacteria 3967
131 Ga0105251_10017330 3300009011 Bacteria 3864
132 Ga0105251_10019782 3300009011 Bacteria 3546
133 Ga0105251_10019949 3300009011 Bacteria 3528
134 Ga0105251_10021494 3300009011 Bacteria 3367
135 Ga0105251_10053066 3300009011 Bacteria 1928
136 Ga0105251_10062773 3300009011 Bacteria 1744
137 Ga0105251_10064635 3300009011 Bacteria 1714
138 Ga0105251_10070191 3300009011 Bacteria 1632
139 Ga0105251_10090870 3300009011 Bacteria 1403
140 Ga0105251_10109261 3300009011 Bacteria 1261
141 Ga0105251_10143841 3300009011 Bacteria 1078
142 Ga0105244_10000020 3300009036 Bacteria 241021
143 Ga0105244_10000047 3300009036 Bacteria 142097
144 Ga0105244_10000141 3300009036 Bacteria 75197
145 Ga0105244_10000223 3300009036 Bacteria 58908
146 Ga0105244_10000761 3300009036 Bacteria 27525
147 Ga0105244_10000922 3300009036 Bacteria 24861
148 Ga0105244_10001402 3300009036 Bacteria 19561
149 Ga0105244_10001660 3300009036 Bacteria 17613
150 Ga0105244_10002703 3300009036 Bacteria 13261
151 Ga0105244_10002753 3300009036 Bacteria 13108
152 Ga0105244_10003421 3300009036 Bacteria 11311
153 Ga0105244_10005552 3300009036 Bacteria 8354
154 Ga0105244_10011040 3300009036 Bacteria 5443
155 Ga0105244_10012847 3300009036 Bacteria 4931
156 Ga0105244_10017503 3300009036 Bacteria 4047
157 Ga0105244_10021675 3300009036 Bacteria 3548
158 Ga0105244_10025019 3300009036 Bacteria 3250
159 Ga0105244_10025151 3300009036 Bacteria 3241
160 Ga0105244_10030409 3300009036 Bacteria 2874
161 Ga0105244_10041920 3300009036 Bacteria 2370
162 Ga0105244_10059527 3300009036 Bacteria 1925
163 Ga0105244_10059960 3300009036 Bacteria 1918
164 Ga0105244_10106047 3300009036 Bacteria 1371
165 Ga0105244_10107932 3300009036 Bacteria 1357
166 Ga0105244_10118847 3300009036 Bacteria 1281
167 Ga0105244_10130274 3300009036 Bacteria 1214
168 Ga0105250_10000001 3300009092 Bacteria 617357
169 Ga0105250_10000016 3300009092 Bacteria 256310
170 Ga0105250_10000119 3300009092 Bacteria 70121
171 Ga0105250_10000235 3300009092 Bacteria 46317
172 Ga0105250_10000847 3300009092 Bacteria 18131
173 Ga0105250_10002820 3300009092 Bacteria 8511
174 Ga0105250_10003478 3300009092 Bacteria 7450
175 Ga0105250_10004467 3300009092 Bacteria 6432
176 Ga0105250_10012686 3300009092 Bacteria 3473
177 Ga0105250_10018277 3300009092 Bacteria 2842
178 Ga0105250_10019913 3300009092 Bacteria 2714
179 Ga0105250_10023550 3300009092 Bacteria 2481
180 Ga0105250_10029050 3300009092 Bacteria 2225
181 Ga0105250_10042759 3300009092 Bacteria 1816
182 Ga0105250_10086816 3300009092 Bacteria 1270
183 Ga0105247_10000012 3300009101 Bacteria 292188
184 Ga0105243_10000133 3300009148 Bacteria 85133
185 Ga0105243_10004466 3300009148 Bacteria 11063
186 Ga0105243_10007553 3300009148 Bacteria 8359
187 Ga0105243_10008586 3300009148 Bacteria 7839
188 Ga0105243_10046604 3300009148 Bacteria 3411
189 Ga0105243_10133956 3300009148 Bacteria 2106
190 Ga0105243_10220692 3300009148 Bacteria 1675
191 Ga0105243_10333449 3300009148 Bacteria 1387
192 Ga0105241_10000001 3300009174 Bacteria 879793
193 Ga0105242_10000233 3300009176 Bacteria 43902
194 Ga0105242_10422557 3300009176 Bacteria 1249
195 Ga0105248_10122604 3300009177 Bacteria 2932
196 Ga0105237_10000160 3300009545 Bacteria 95183
197 Ga0105246_10007947 3300011119 Bacteria 6511
198 Ga0105246_10054546 3300011119 Bacteria 2755
199 Ga0105246_10107601 3300011119 Bacteria 2042
200 Ga0157345_1002802 3300012498 Bacteria 1247
201 Ga0157373_10000137 3300013100 Bacteria 57817
202 Ga0157373_10000779 3300013100 Bacteria 24578
203 Ga0157373_10001377 3300013100 Bacteria 18652
204 Ga0157373_10005333 3300013100 Bacteria 9659
205 Ga0157373_10017667 3300013100 Bacteria 5193
206 Ga0157373_10029939 3300013100 Bacteria 3919
207 Ga0157373_10088253 3300013100 Bacteria 2185
208 Ga0157373_10123513 3300013100 Bacteria 1820
209 Ga0157371_10000098 3300013102 Bacteria 134017
210 Ga0157371_10000460 3300013102 Bacteria 49750
211 Ga0157371_10000810 3300013102 Bacteria 35896
212 Ga0157371_10001729 3300013102 Bacteria 22149
213 Ga0157371_10002644 3300013102 Bacteria 16991
214 Ga0157371_10005574 3300013102 Bacteria 10581
215 Ga0157371_10032848 3300013102 Bacteria 3732
216 Ga0157371_10086528 3300013102 Bacteria 2219
217 Ga0157371_10162197 3300013102 Bacteria 1596
218 Ga0157371_10164859 3300013102 Bacteria 1583
219 Ga0157370_10000075 3300013104 Bacteria 108060
220 Ga0157370_10000301 3300013104 Bacteria 62779
221 Ga0157370_10005690 3300013104 Bacteria 13932
222 Ga0157370_10018571 3300013104 Bacteria 6989
223 Ga0157370_10154794 3300013104 Bacteria 2133
224 Ga0157370_10228312 3300013104 Bacteria 1723
225 Ga0157370_10456392 3300013104 Bacteria 1175
226 Ga0157369_10006243 3300013105 Bacteria 13828
227 Ga0157369_10020382 3300013105 Bacteria 7412
228 Ga0157369_10032725 3300013105 Bacteria 5714
229 Ga0157369_10039167 3300013105 Bacteria 5180
230 Ga0157369_10064144 3300013105 Bacteria 3956
231 Ga0157369_10065052 3300013105 Bacteria 3926
232 Ga0163162_10001088 3300013306 Bacteria 25181
233 Ga0163162_10006068 3300013306 Bacteria 11695
234 Ga0163162_10119254 3300013306 Bacteria 2741
235 Ga0163162_10460463 3300013306 Bacteria 1403
236 Ga0157372_10000815 3300013307 Bacteria 33774
237 Ga0157372_10008169 3300013307 Bacteria 11125
238 Ga0157372_10024055 3300013307 Bacteria 6609
239 Ga0157372_10045132 3300013307 Bacteria 4887
240 Ga0157372_10102711 3300013307 Bacteria 3266
241 Ga0157372_10199055 3300013307 Bacteria 2320
242 Ga0157372_10525877 3300013307 Bacteria 1379
243 Ga0182008_10000235 3300014497 Bacteria 43235
244 Ga0182008_10004762 3300014497 Bacteria 7856
245 Ga0182008_10010235 3300014497 Bacteria 5026
246 Ga0182008_10024098 3300014497 Bacteria 3100
247 Ga0182008_10032743 3300014497 Bacteria 2610
248 Ga0182008_10035354 3300014497 Bacteria 2503
249 Ga0182008_10047300 3300014497 Bacteria 2137
250 Ga0182008_10056042 3300014497 Bacteria 1948
251 Ga0182008_10072573 3300014497 Bacteria 1694
252 Ga0182006_1000087 3300015261 Bacteria 115141
253 Ga0182006_1008071 3300015261 Bacteria 4783
254 Ga0182006_1010353 3300015261 Bacteria 4148
255 Ga0182006_1023063 3300015261 Bacteria 2579
256 Ga0182006_1035094 3300015261 Bacteria 2002
257 Ga0182007_10000613 3300015262 Bacteria 20791
258 Ga0182007_10034420 3300015262 Bacteria 1712
259 Ga0182005_1000428 3300015265 Bacteria 22428
260 Ga0182005_1002342 3300015265 Bacteria 6835
261 Ga0182005_1004652 3300015265 Bacteria 4389
262 Ga0182005_1023056 3300015265 Bacteria 1704
263 Ga0182005_1024933 3300015265 Bacteria 1632
264 Ga0183366_1001 3300015679 Bacteria 2743932
265 Ga0183370_1001 3300015680 Bacteria 2743932
266 Ga0183369_1001 3300015685 Bacteria 2743932
267 Ga0183368_1001 3300015687 Bacteria 2743932
268 Ga0163161_10000001 3300017792 Bacteria 2041488
269 Ga0163161_10001062 3300017792 Bacteria 20818
270 Ga0163161_10051296 3300017792 Bacteria 2988
271 Ga0163161_10054321 3300017792 Bacteria 2907
272 Ga0163161_10306623 3300017792 Bacteria 1252
273 Ga0213876_10000016 3300021384 Bacteria 300175
274 Ga0209435_101165 3300025206 Bacteria 3593
275 Ga0209760_100004 3300025207 Bacteria 254650
276 Ga0209760_100127 3300025207 Bacteria 50815
277 Ga0209760_100144 3300025207 Bacteria 44880
278 Ga0209784_100001 3300025224 Bacteria 3600592
279 Ga0209784_100045 3300025224 Bacteria 203911
280 Ga0209566_100001 3300025225 Bacteria 3600765
281 Ga0209566_100057 3300025225 Bacteria 203960
282 Ga0209674_100002 3300025226 Bacteria 3600592
283 Ga0209674_100080 3300025226 Bacteria 203960
284 Ga0209147_100079 3300025229 Bacteria 203960
285 Ga0209563_100002 3300025230 Bacteria 2045675
286 Ga0209563_100078 3300025230 Bacteria 203960
287 Ga0209563_100284 3300025230 Bacteria 21201
288 Ga0207427_100007 3300025231 Bacteria 746220
289 Ga0207427_100012 3300025231 Bacteria 585657
290 Ga0207427_100038 3300025231 Bacteria 292975
291 Ga0209437_100001 3300025233 Bacteria 2045675
292 Ga0209437_100006 3300025233 Bacteria 1042724
293 Ga0209437_100009 3300025233 Bacteria 915954
294 Ga0209437_100155 3300025233 Bacteria 152749
295 Ga0209258_100178 3300025242 Bacteria 138843
296 Ga0209646_1000311 3300025246 Bacteria 38501
297 Ga0209677_100002 3300025253 Bacteria 2045675
298 Ga0209677_100045 3300025253 Bacteria 203960
299 Ga0209759_1002924 3300025256 Bacteria 7155
300 Ga0209129_1000004 3300025258 Bacteria 884499
301 Ga0209233_1000059 3300025261 Bacteria 414562
302 Ga0209233_1000074 3300025261 Bacteria 357367
303 Ga0209233_1001376 3300025261 Bacteria 9645
304 Ga0209676_1000006 3300025292 Bacteria 1039588
305 Ga0209676_1000010 3300025292 Bacteria 954025
306 Ga0209676_1000270 3300025292 Bacteria 108368
307 Ga0209676_1000721 3300025292 Bacteria 45474
308 Ga0209676_1003505 3300025292 Bacteria 9597
309 Ga0209050_1000019 3300025298 Bacteria 608757
310 Ga0209050_1000060 3300025298 Bacteria 321699
311 Ga0209050_1000065 3300025298 Bacteria 313668
312 Ga0209050_1001314 3300025298 Bacteria 27871
313 Ga0209051_1000037 3300025303 Bacteria 321747
314 Ga0209051_1000238 3300025303 Bacteria 92629
315 Ga0209051_1000265 3300025303 Bacteria 87617
316 Ga0209257_1000119 3300025304 Bacteria 225893
317 Ga0209257_1019834 3300025304 Bacteria 2513
318 Ga0207656_10000017 3300025321 Bacteria 117646
319 Ga0207696_1000001 3300025711 Bacteria 2579611
320 Ga0207696_1000015 3300025711 Bacteria 507848
321 Ga0207696_1000022 3300025711 Bacteria 427529
322 Ga0207696_1000030 3300025711 Bacteria 395961
323 Ga0207696_1000044 3300025711 Bacteria 300953
324 Ga0207696_1000062 3300025711 Bacteria 239603
325 Ga0207696_1000121 3300025711 Bacteria 143687
326 Ga0207696_1000179 3300025711 Bacteria 99732
327 Ga0207696_1000216 3300025711 Bacteria 84411
328 Ga0207696_1000298 3300025711 Bacteria 57382
329 Ga0207696_1000924 3300025711 Bacteria 18140
330 Ga0207696_1001803 3300025711 Bacteria 11058
331 Ga0207696_1002483 3300025711 Bacteria 9016
332 Ga0207696_1005451 3300025711 Bacteria 5279
333 Ga0207696_1018992 3300025711 Bacteria 2247
334 Ga0207696_1020773 3300025711 Bacteria 2111
335 Ga0207696_1023696 3300025711 Bacteria 1933
336 Ga0207655_1000001 3300025728 Bacteria 1866413
337 Ga0207655_1000002 3300025728 Bacteria 1148694
338 Ga0207655_1000004 3300025728 Bacteria 1021221
339 Ga0207655_1000007 3300025728 Bacteria 773492
340 Ga0207655_1000021 3300025728 Bacteria 518596
341 Ga0207655_1000086 3300025728 Bacteria 206068
342 Ga0207655_1000110 3300025728 Bacteria 171137
343 Ga0207655_1000229 3300025728 Bacteria 93185
344 Ga0207655_1000240 3300025728 Bacteria 90267
345 Ga0207655_1000296 3300025728 Bacteria 75293
346 Ga0207655_1000462 3300025728 Bacteria 53331
347 Ga0207655_1000859 3300025728 Bacteria 32375
348 Ga0207655_1000886 3300025728 Bacteria 31679
349 Ga0207655_1001511 3300025728 Bacteria 21214
350 Ga0207655_1001729 3300025728 Bacteria 19176
351 Ga0207655_1005688 3300025728 Bacteria 8429
352 Ga0207655_1008864 3300025728 Bacteria 6321
353 Ga0207655_1009864 3300025728 Bacteria 5877
354 Ga0207655_1014133 3300025728 Bacteria 4532
355 Ga0207655_1019444 3300025728 Bacteria 3549
356 Ga0207655_1026480 3300025728 Bacteria 2784
357 Ga0207655_1027259 3300025728 Bacteria 2725
358 Ga0207655_1039814 3300025728 Bacteria 2037
359 Ga0207655_1066733 3300025728 Bacteria 1358
360 Ga0207655_1071672 3300025728 Bacteria 1285
361 Ga0207655_1085168 3300025728 Bacteria 1128
362 Ga0207655_1088434 3300025728 Bacteria 1096
363 Ga0207713_1000001 3300025735 Bacteria 2295391
364 Ga0207713_1000004 3300025735 Bacteria 702781
365 Ga0207713_1000013 3300025735 Bacteria 475751
366 Ga0207713_1000015 3300025735 Bacteria 424741
367 Ga0207713_1000027 3300025735 Bacteria 312621
368 Ga0207713_1000088 3300025735 Bacteria 155734
369 Ga0207713_1000104 3300025735 Bacteria 138310
370 Ga0207713_1000356 3300025735 Bacteria 50001
371 Ga0207713_1000454 3300025735 Bacteria 42911
372 Ga0207713_1000734 3300025735 Bacteria 30649
373 Ga0207713_1000753 3300025735 Bacteria 30153
374 Ga0207713_1001064 3300025735 Bacteria 23714
375 Ga0207713_1001329 3300025735 Bacteria 20259
376 Ga0207713_1002680 3300025735 Bacteria 12738
377 Ga0207713_1006156 3300025735 Bacteria 7367
378 Ga0207713_1007324 3300025735 Bacteria 6536
379 Ga0207713_1007367 3300025735 Bacteria 6507
380 Ga0207713_1007806 3300025735 Bacteria 6243
381 Ga0207713_1009534 3300025735 Bacteria 5460
382 Ga0207713_1014251 3300025735 Bacteria 4144
383 Ga0207713_1017204 3300025735 Bacteria 3637
384 Ga0207713_1017833 3300025735 Bacteria 3537
385 Ga0207713_1021022 3300025735 Bacteria 3139
386 Ga0207713_1046323 3300025735 Bacteria 1769
387 Ga0207713_1049082 3300025735 Bacteria 1694
388 Ga0207713_1066113 3300025735 Bacteria 1355
389 Ga0207710_10000083 3300025900 Bacteria 136593
390 Ga0207654_10000004 3300025911 Bacteria 902334
391 Ga0207671_10000019 3300025914 Bacteria 317781
392 Ga0207649_10000004 3300025920 Bacteria 360726
393 Ga0207681_10000679 3300025923 Bacteria 22341
394 Ga0207681_10001883 3300025923 Bacteria 13423
395 Ga0207650_10000668 3300025925 Bacteria 26952
396 Ga0207650_10001102 3300025925 Bacteria 19910
397 Ga0207706_10001474 3300025933 Bacteria 23502
398 Ga0207706_10014803 3300025933 Bacteria 7061
399 Ga0207686_10002443 3300025934 Bacteria 10104
400 Ga0207709_10000013 3300025935 Bacteria 531977
401 Ga0207709_10003688 3300025935 Bacteria 9014
402 Ga0207709_10005522 3300025935 Bacteria 7174
403 Ga0207709_10012279 3300025935 Bacteria 4721
404 Ga0207709_10037052 3300025935 Bacteria 2895
405 Ga0207709_10048780 3300025935 Bacteria 2581
406 Ga0207709_10061528 3300025935 Bacteria 2346
407 Ga0207709_10335959 3300025935 Bacteria 1135
408 Ga0207711_10020084 3300025941 Bacteria 5568
409 Ga0207679_10000019 3300025945 Bacteria 230270
410 Ga0207712_10025540 3300025961 Bacteria 3926
411 Ga0207640_10060517 3300025981 Bacteria 2503
412 Ga0207639_10003002 3300026041 Bacteria 11354
413 Ga0207674_10027056 3300026116 Bacteria 6076
414 Ga0209281_1000001 3300027111 Bacteria 1933496
415 Ga0209281_1000003 3300027111 Bacteria 1260089
416 Ga0209281_1000004 3300027111 Bacteria 1253949
417 Ga0209281_1000006 3300027111 Bacteria 1170244
418 Ga0209281_1000010 3300027111 Bacteria 726106
419 Ga0209281_1000012 3300027111 Bacteria 684886
420 Ga0209281_1000013 3300027111 Bacteria 653449
421 Ga0209281_1000064 3300027111 Bacteria 287876
422 Ga0209281_1000071 3300027111 Bacteria 274050
423 Ga0209281_1000109 3300027111 Bacteria 216504
424 Ga0209281_1000434 3300027111 Bacteria 61798
425 Ga0209281_1001629 3300027111 Bacteria 12045
426 Ga0209281_1004175 3300027111 Bacteria 4410
427 Ga0209281_1004912 3300027111 Bacteria 3853
428 Ga0209389_1000002 3300027296 Bacteria 333932
429 Ga0209371_1000001 3300027312 Bacteria 2771503
430 Ga0209371_1000002 3300027312 Bacteria 1551985
431 Ga0209371_1000005 3300027312 Bacteria 1061740
432 Ga0209371_1000039 3300027312 Bacteria 350081
433 Ga0209371_1000052 3300027312 Bacteria 274444
434 Ga0209371_1000199 3300027312 Bacteria 87337
435 Ga0209371_1000205 3300027312 Bacteria 84439
436 Ga0209371_1000239 3300027312 Bacteria 68842
437 Ga0209371_1000253 3300027312 Bacteria 65388
438 Ga0209371_1001211 3300027312 Bacteria 18647
439 Ga0209371_1001746 3300027312 Bacteria 13702
440 Ga0209371_1002164 3300027312 Bacteria 11510
441 Ga0209371_1002408 3300027312 Bacteria 10511
442 Ga0209371_1002488 3300027312 Bacteria 10231
443 Ga0209371_1003168 3300027312 Bacteria 8324
444 Ga0209371_1004744 3300027312 Bacteria 5754
445 Ga0209371_1005029 3300027312 Bacteria 5448
446 Ga0209371_1008280 3300027312 Bacteria 3482
447 Ga0209983_1000325 3300027665 Bacteria 9954
448 Ga0209971_1001041 3300027682 Bacteria 7079
449 Ga0209974_10023657 3300027876 Bacteria 2033
450 Ga0209974_10027692 3300027876 Bacteria 1875
451 Ga0207428_10010530 3300027907 Bacteria 8256
452 Ga0207428_10025831 3300027907 Bacteria 4910
453 Ga0207428_10066757 3300027907 Bacteria 2834
454 Ga0207428_10073063 3300027907 Bacteria 2692
455 Ga0268266_10000959 3300028379 Bacteria 36713
456 Ga0268266_10003720 3300028379 Bacteria 15009
457 Ga0268256_1000001 3300030500 Bacteria 2771065
458 Ga0268256_1000002 3300030500 Bacteria 1535763
459 Ga0268256_1000006 3300030500 Bacteria 1063991
460 Ga0268256_1000033 3300030500 Bacteria 420973
461 Ga0268256_1000061 3300030500 Bacteria 216116
462 Ga0268256_1000098 3300030500 Bacteria 136395
463 Ga0268256_1000199 3300030500 Bacteria 68849
464 Ga0268256_1000367 3300030500 Bacteria 42860
465 Ga0268256_1000618 3300030500 Bacteria 27786
466 Ga0268256_1001036 3300030500 Bacteria 18647
467 Ga0268256_1001327 3300030500 Bacteria 15157
468 Ga0268256_1001446 3300030500 Bacteria 14305
469 Ga0268256_1001521 3300030500 Bacteria 13702
470 Ga0268256_1004683 3300030500 Bacteria 5585
471 Ga0268256_1005544 3300030500 Bacteria 4921
472 Ga0268256_1008497 3300030500 Bacteria 3509
473 Ga0268256_1011168 3300030500 Bacteria 2861
474 Ga0307511_10050424 3300030521 Bacteria 3352
475 Ga0316177_1108430 3300030731 Bacteria 2173
476 Ga0314311_1045991 3300030733 Bacteria 3606
477 Ga0316178_1076498 3300030735 Bacteria 31398
478 Ga0316183_1053494 3300030742 Bacteria 4078
479 Ga0316181_1247282 3300030744 Bacteria 1534
480 Ga0265331_10047402 3300031250 Bacteria 2068
481 Ga0307408_100000304 3300031548 Bacteria 47053
482 Ga0307408_100063987 3300031548 Bacteria 2692
483 Ga0307408_100473096 3300031548 Bacteria 1091
484 Ga0316576_10026621 3300031727 Bacteria 4060
485 Ga0307405_10013400 3300031731 Bacteria 4371
486 Ga0307405_10153890 3300031731 Bacteria 1620
487 Ga0307413_10033078 3300031824 Bacteria 2939
488 Ga0307407_10191217 3300031903 Bacteria 1364
489 Ga0307416_100176787 3300032002 Bacteria 1995
490 Ga0307416_100295816 3300032002 Bacteria 1606
491 Ga0307414_10458513 3300032004 Bacteria 1119
492 Ga0307411_10033480 3300032005 Bacteria 3187
493 Ga0316593_10008423 3300032168 Bacteria 2876
494 Ga0316593_10012354 3300032168 Bacteria 2505
495 Ga0307510_10001771 3300033180 Bacteria 24088
496 Ga0316574_0076175 3300035398 Bacteria 2125
497 Ga0316582_0027234 3300036647 Bacteria 3450
498 Ga0316582_0173070 3300036647 Bacteria 1467
499 Ga0316584_0125882 3300036712 Bacteria 1914
500 Ga0237819_01795 3300038705 Bacteria 5009
501 Ga0400484_12942 3300038725 Bacteria 5216
502 Ga0400484_35463 3300038725 Unclassified 1485
503 Ga0400484_40121 3300038725 Bacteria 2287
504 Ga0400490_01226 3300038726 Unclassified 2332
505 Ga0400490_06757 3300038726 Bacteria 1515
506 Ga0400490_09120 3300038726 Bacteria 2424
507 Ga0400490_21691 3300038726 Bacteria 1194
508 Ga0400490_56575 3300038726 Bacteria 1759
509 Ga0400485_20298 3300038735 Bacteria 11165
510 Ga0400488_07942 3300038741 Bacteria 5276
511 Ga0400488_39372 3300038741 Bacteria 6613
512 Ga0400486_07960 3300038742 Bacteria 30944
513 Ga0400486_09951 3300038742 Bacteria 43440
514 Ga0400483_023904 3300039062 Bacteria 7280
515 Ga0400483_072717 3300039062 Bacteria 3959
516 Ga0400483_086677 3300039062 Bacteria 66767
517 Ga0400483_112441 3300039062 Bacteria 1347
518 Ga0400483_117887 3300039062 Unclassified 3292
519 Ga0400483_189767 3300039062 Bacteria 6071
520 Ga0400483_218673 3300039062 Bacteria 21299
521 Ga0400483_220601 3300039062 Bacteria 35731
522 Ga0400483_250036 3300039062 Bacteria 396353
523 Ga0400489_26060 3300039093 Bacteria 35012
524 Ga0400489_62285 3300039093 Bacteria 27106
525 Ga0400487_15044 3300039110 Bacteria 1767
526 Ga0436365_1910565 3300039437 Bacteria 475219
527 Ga0439436_0000700 3300041404 Bacteria 9035
528 Ga0439438_000001 3300041405 Bacteria 1263568
529 Ga0439438_000936 3300041405 Bacteria 13027
530 Ga0439438_001200 3300041405 Bacteria 11505
531 Ga0439438_002923 3300041405 Bacteria 7093
532 Ga0439438_003266 3300041405 Bacteria 6626
533 Ga0439438_007572 3300041405 Bacteria 3697
534 Ga0439438_015687 3300041405 Bacteria 2220
535 Ga0439438_019352 3300041405 Bacteria 1924
536 Ga0439447_001502 3300041407 Bacteria 8543
537 Ga0439447_003794 3300041407 Bacteria 5304
538 Ga0439447_009195 3300041407 Bacteria 3010
539 Ga0439447_009543 3300041407 Bacteria 2932
540 Ga0439447_013754 3300041407 Bacteria 2288
541 Ga0439447_016505 3300041407 Bacteria 2025
542 Ga0439447_037427 3300041407 Bacteria 1195
543 Ga0439466_0000013 3300041411 Bacteria 134749
544 Ga0439466_0001124 3300041411 Bacteria 10402
545 Ga0439466_0011673 3300041411 Bacteria 3246
546 Ga0439466_0013560 3300041411 Bacteria 2982
547 Ga0439466_0062413 3300041411 Bacteria 1198
548 Ga0439437_000026 3300042000 Bacteria 11182
549 Ga0439432_001755 3300042006 Bacteria 8127
550 Ga0439432_002272 3300042006 Bacteria 7244
551 Ga0439432_002413 3300042006 Bacteria 7055
552 Ga0439432_003075 3300042006 Bacteria 6216
553 Ga0439432_005501 3300042006 Bacteria 4557
554 Ga0439432_007431 3300042006 Bacteria 3885
555 Ga0439432_008354 3300042006 Bacteria 3636
556 Ga0439432_038985 3300042006 Bacteria 1511
557 Ga0439451_007229 3300042009 Bacteria 2266
558 Ga0439451_016810 3300042009 Bacteria 1472
559 Ga0439452_000001 3300042010 Bacteria 1725439
560 Ga0439452_000002 3300042010 Bacteria 1377577
561 Ga0439452_000022 3300042010 Bacteria 267565
562 Ga0439452_000066 3300042010 Bacteria 92251
563 Ga0439452_000101 3300042010 Bacteria 72026
564 Ga0439452_000781 3300042010 Bacteria 15105
565 Ga0439452_001455 3300042010 Bacteria 9670
566 Ga0439452_002278 3300042010 Bacteria 7164
567 Ga0439452_004034 3300042010 Bacteria 4996
568 Ga0439452_010697 3300042010 Bacteria 2658
569 Ga0439452_016819 3300042010 Bacteria 1978
570 Ga0439456_000039 3300042013 Bacteria 48127
571 Ga0439456_001479 3300042013 Bacteria 4724
572 Ga0439456_006017 3300042013 Bacteria 2471
573 Ga0439463_000853 3300042016 Bacteria 8362
574 Ga0439463_001820 3300042016 Bacteria 5542
575 Ga0450911_000002 3300042115 Bacteria 277703
576 Ga0450919_003044 3300042121 Bacteria 2136
577 Ga0450890_013500 3300042127 Bacteria 1066
578 Ga0450902_000054 3300042137 Bacteria 10769
579 Ga0450902_001351 3300042137 Bacteria 3320
580 Ga0450903_010271 3300042138 Bacteria 1516
581 Ga0450904_000035 3300042139 Bacteria 30443
582 Ga0450904_003356 3300042139 Bacteria 1747
583 Ga0450905_000276 3300042142 Bacteria 6110
584 Ga0450905_000679 3300042142 Bacteria 4166
585 Ga0450906_001159 3300042145 Bacteria 5823
586 Ga0450907_001025 3300042146 Bacteria 6552
587 Ga0450907_001598 3300042146 Bacteria 4795
588 Ga0450907_001604 3300042146 Bacteria 4768
589 Ga0450907_018177 3300042146 Bacteria 1175
590 Ga0439446_0000240 3300042156 Bacteria 10126
591 Ga0450909_009403 3300042185 Bacteria 1426
592 Ga0439434_0001047 3300042435 Bacteria 8018
593 Ga0439434_0001060 3300042435 Bacteria 7982
594 Ga0439464_0004058 3300042439 Bacteria 3727
595 Ga0439464_0013200 3300042439 Bacteria 2208
596 Ga0439460_0000893 3300042461 Bacteria 6826
597 Ga0439460_0004840 3300042461 Bacteria 3291
598 Ga0450893_0000791 3300042532 Bacteria 4642
599 Ga0450893_0003075 3300042532 Bacteria 2623
600 Ga0450901_000269 3300042533 Bacteria 6307
601 Ga0451577_0000105 3300042876 Bacteria 184360
602 Ga0451577_0002122 3300042876 Bacteria 24368
603 Ga0451577_0035200 3300042876 Bacteria 4511
604 Ga0451577_0106840 3300042876 Bacteria 2502
605 Ga0439440_0013310 3300042993 Bacteria 1761
606 Ga0466981_0000008 3300044669 Bacteria 147179
607 Ga0453683_0000034 3300044673 Bacteria 235218
608 Ga0453683_0000152 3300044673 Bacteria 102028
609 Ga0453683_0002320 3300044673 Bacteria 14952
610 Ga0453683_0010577 3300044673 Bacteria 6110
611 Ga0453683_0034708 3300044673 Bacteria 3179
612 Ga0453683_0158873 3300044673 Bacteria 1430
613 Ga0453684_0000231 3300044712 Bacteria 241070
614 Ga0453684_0000713 3300044712 Bacteria 117530
615 Ga0453684_0002182 3300044712 Bacteria 48823
616 Ga0453684_0012933 3300044712 Bacteria 13664
617 Ga0453684_0023203 3300044712 Bacteria 9154
618 Ga0453684_0031819 3300044712 Bacteria 7400
619 Ga0453684_0041565 3300044712 Bacteria 6215
620 Ga0453684_0108661 3300044712 Bacteria 3375
621 Ga0453684_0235963 3300044712 Bacteria 2108
622 Ga0451576_0000077 3300045051 Bacteria 243265
623 Ga0451576_0026038 3300045051 Bacteria 6294
624 Ga0495617_000978 3300046452 Bacteria 13267
625 Ga0495617_003030 3300046452 Bacteria 6403
626 Ga0495617_009176 3300046452 Bacteria 3400
627 Ga0495617_011834 3300046452 Bacteria 2976
628 Ga0495617_046308 3300046452 Bacteria 1449
629 Ga0495617_053111 3300046452 Bacteria 1345
630 Ga0495617_086097 3300046452 Bacteria 1027
631 Ga0495627_000021 3300046453 Bacteria 282454
632 Ga0495627_000027 3300046453 Bacteria 236960
633 Ga0495627_000279 3300046453 Bacteria 51531
634 Ga0495627_000789 3300046453 Bacteria 23155
635 Ga0495627_003053 3300046453 Bacteria 7630
636 Ga0495627_009390 3300046453 Bacteria 3602
637 Ga0495627_017288 3300046453 Bacteria 2454
638 Ga0495627_031784 3300046453 Bacteria 1664
639 Ga0495627_050072 3300046453 Bacteria 1259
640 Ga0495603_0221390 3300046455 Bacteria 1092
641 Ga0495590_0003408 3300046457 Bacteria 6500
642 Ga0495590_0008914 3300046457 Bacteria 3811
643 Ga0495590_0053248 3300046457 Bacteria 1413
644 Ga0495591_000007 3300046458 Bacteria 366385
645 Ga0495591_000015 3300046458 Bacteria 252107
646 Ga0495591_000318 3300046458 Bacteria 43617
647 Ga0495591_001085 3300046458 Bacteria 18132
648 Ga0495591_002885 3300046458 Bacteria 9218
649 Ga0495591_004271 3300046458 Bacteria 7066
650 Ga0495591_004439 3300046458 Bacteria 6880
651 Ga0495591_008529 3300046458 Bacteria 4190
652 Ga0495591_010606 3300046458 Bacteria 3556
653 Ga0495591_017922 3300046458 Bacteria 2415
654 Ga0495591_023321 3300046458 Bacteria 1985
655 Ga0495638_0002945 3300046460 Bacteria 13586
656 Ga0495638_0013602 3300046460 Bacteria 5531
657 Ga0495638_0023837 3300046460 Bacteria 3997
658 Ga0495638_0029899 3300046460 Bacteria 3511
659 Ga0495638_0058607 3300046460 Bacteria 2385
660 Ga0495638_0217287 3300046460 Bacteria 1070
661 Ga0495653_0004180 3300046463 Bacteria 11682
662 Ga0495653_0009118 3300046463 Bacteria 8113
663 Ga0495653_0049059 3300046463 Bacteria 3255
664 Ga0495650_0000026 3300046471 Bacteria 476029
665 Ga0495650_0000182 3300046471 Bacteria 137031
666 Ga0495650_0000493 3300046471 Bacteria 59904
667 Ga0495650_0000672 3300046471 Bacteria 44486
668 Ga0495650_0004078 3300046471 Bacteria 10214
669 Ga0495650_0010743 3300046471 Bacteria 5086
670 Ga0495650_0022733 3300046471 Bacteria 3002
671 Ga0495650_0026483 3300046471 Bacteria 2696
672 Ga0495650_0054121 3300046471 Bacteria 1639
673 Ga0495650_0079889 3300046471 Bacteria 1263
674 Ga0495605_0000016 3300046474 Bacteria 289508
675 Ga0495605_0000031 3300046474 Bacteria 213242
676 Ga0495605_0000523 3300046474 Bacteria 32529
677 Ga0495605_0004855 3300046474 Bacteria 7863
678 Ga0495605_0005949 3300046474 Bacteria 7056
679 Ga0495605_0011368 3300046474 Bacteria 4968
680 Ga0495605_0012213 3300046474 Bacteria 4769
681 Ga0495605_0024757 3300046474 Bacteria 3137
682 Ga0495605_0083802 3300046474 Bacteria 1487
683 Ga0495584_0001616 3300046491 Bacteria 13254
684 Ga0495584_0002458 3300046491 Bacteria 10499
685 Ga0495584_0005988 3300046491 Bacteria 6406
686 Ga0495584_0006381 3300046491 Bacteria 6179
687 Ga0495584_0019201 3300046491 Bacteria 3472
688 Ga0495584_0043034 3300046491 Bacteria 2279
689 Ga0495584_0046731 3300046491 Bacteria 2183
690 Ga0495584_0048084 3300046491 Bacteria 2151
691 Ga0495584_0054401 3300046491 Bacteria 2014
692 Ga0495584_0058183 3300046491 Bacteria 1944
693 Ga0495585_0001037 3300046492 Bacteria 23052
694 Ga0495585_0005139 3300046492 Bacteria 8316
695 Ga0495585_0010653 3300046492 Bacteria 5462
696 Ga0495585_0056583 3300046492 Bacteria 2165
697 Ga0495585_0075497 3300046492 Bacteria 1832
698 Ga0495585_0075614 3300046492 Bacteria 1830
699 Ga0495585_0181323 3300046492 Bacteria 1082
700 Ga0495594_0002644 3300046499 Bacteria 9322
701 Ga0495594_0143250 3300046499 Bacteria 1356
702 Ga0495596_0005154 3300046500 Bacteria 6222
703 Ga0495596_0005876 3300046500 Bacteria 5733
704 Ga0495596_0010866 3300046500 Bacteria 3947
705 Ga0495607_0000213 3300046501 Bacteria 61906
706 Ga0495607_0000237 3300046501 Bacteria 59197
707 Ga0495607_0000248 3300046501 Bacteria 57955
708 Ga0495607_0000780 3300046501 Bacteria 30486
709 Ga0495607_0008778 3300046501 Bacteria 6884
710 Ga0495607_0008930 3300046501 Bacteria 6823
711 Ga0495607_0011600 3300046501 Bacteria 5859
712 Ga0495607_0019456 3300046501 Bacteria 4314
713 Ga0495607_0024302 3300046501 Bacteria 3780
714 Ga0495607_0032884 3300046501 Bacteria 3160
715 Ga0495607_0042224 3300046501 Bacteria 2704
716 Ga0495607_0056721 3300046501 Bacteria 2247
717 Ga0495583_0000041 3300046506 Bacteria 234707
718 Ga0495583_0000698 3300046506 Bacteria 43244
719 Ga0495583_0001956 3300046506 Bacteria 18948
720 Ga0495583_0004463 3300046506 Bacteria 10007
721 Ga0495583_0007614 3300046506 Bacteria 6759
722 Ga0495583_0016954 3300046506 Bacteria 3888
723 Ga0495583_0022460 3300046506 Bacteria 3218
724 Ga0495606_0000076 3300046507 Bacteria 166969
725 Ga0495606_0002535 3300046507 Bacteria 21017
726 Ga0495606_0004769 3300046507 Bacteria 13335
727 Ga0495606_0006037 3300046507 Bacteria 11331
728 Ga0495606_0008423 3300046507 Bacteria 8967
729 Ga0495606_0032362 3300046507 Bacteria 3623
730 Ga0495606_0036057 3300046507 Bacteria 3374
731 Ga0495606_0058125 3300046507 Bacteria 2487
732 Ga0495606_0117556 3300046507 Bacteria 1595
733 Ga0495606_0216053 3300046507 Bacteria 1083
734 Ga0495610_0002616 3300046512 Bacteria 14907
735 Ga0495610_0011574 3300046512 Bacteria 5380
736 Ga0495610_0019155 3300046512 Bacteria 3837
737 Ga0495610_0023628 3300046512 Bacteria 3335
738 Ga0495610_0034853 3300046512 Bacteria 2589
739 Ga0495610_0038305 3300046512 Bacteria 2435
740 Ga0495616_0002404 3300046513 Bacteria 12458
741 Ga0495616_0006595 3300046513 Bacteria 7013
742 Ga0495616_0021752 3300046513 Bacteria 3468
743 Ga0495616_0143417 3300046513 Bacteria 1085
744 Ga0495620_0000013 3300046515 Bacteria 160349
745 Ga0495620_0000015 3300046515 Bacteria 154625
746 Ga0495620_0004506 3300046515 Bacteria 7838
747 Ga0495620_0007041 3300046515 Bacteria 6134
748 Ga0495620_0014204 3300046515 Bacteria 4054
749 Ga0495620_0042178 3300046515 Bacteria 1995
750 Ga0495620_0052047 3300046515 Bacteria 1740
751 Ga0495620_0053691 3300046515 Bacteria 1705
752 Ga0495620_0060381 3300046515 Bacteria 1581
753 Ga0495631_0001077 3300046518 Bacteria 16951
754 Ga0495631_0005273 3300046518 Bacteria 6792
755 Ga0495631_0012543 3300046518 Bacteria 4135
756 Ga0495631_0125795 3300046518 Bacteria 1102
757 Ga0495632_0000912 3300046519 Bacteria 25920
758 Ga0495632_0000914 3300046519 Bacteria 25916
759 Ga0495632_0001648 3300046519 Bacteria 18284
760 Ga0495632_0001676 3300046519 Bacteria 18117
761 Ga0495632_0002354 3300046519 Bacteria 14486
762 Ga0495632_0004171 3300046519 Bacteria 9898
763 Ga0495632_0004792 3300046519 Bacteria 9107
764 Ga0495632_0006071 3300046519 Bacteria 7836
765 Ga0495632_0039895 3300046519 Bacteria 2367
766 Ga0495632_0061073 3300046519 Bacteria 1829
767 Ga0495637_0000913 3300046520 Bacteria 18936
768 Ga0495637_0002612 3300046520 Bacteria 9881
769 Ga0495637_0003141 3300046520 Bacteria 8816
770 Ga0495637_0007261 3300046520 Bacteria 5510
771 Ga0495637_0007862 3300046520 Bacteria 5260
772 Ga0495637_0030027 3300046520 Bacteria 2414
773 Ga0495637_0031219 3300046520 Bacteria 2358
774 Ga0495637_0039831 3300046520 Bacteria 2025
775 Ga0495637_0083328 3300046520 Bacteria 1271
776 Ga0495643_0000223 3300046522 Bacteria 86920
777 Ga0495643_0000903 3300046522 Bacteria 31380
778 Ga0495643_0005943 3300046522 Bacteria 8141
779 Ga0495643_0010375 3300046522 Bacteria 5734
780 Ga0495643_0018092 3300046522 Bacteria 4103
781 Ga0495643_0068346 3300046522 Bacteria 1870
782 Ga0495643_0084132 3300046522 Bacteria 1651
783 Ga0495643_0153275 3300046522 Bacteria 1139
784 Ga0495644_0000723 3300046523 Bacteria 13701
785 Ga0495644_0002168 3300046523 Bacteria 7885
786 Ga0495644_0007316 3300046523 Bacteria 4264
787 Ga0495644_0011601 3300046523 Bacteria 3392
788 Ga0495644_0105733 3300046523 Bacteria 1066
789 Ga0495648_0001423 3300046524 Bacteria 23410
790 Ga0495648_0002171 3300046524 Bacteria 18452
791 Ga0495648_0002708 3300046524 Bacteria 16008
792 Ga0495648_0006275 3300046524 Bacteria 9727
793 Ga0495648_0013055 3300046524 Bacteria 6162
794 Ga0495648_0015574 3300046524 Bacteria 5515
795 Ga0495648_0035683 3300046524 Bacteria 3220
796 Ga0495648_0050318 3300046524 Bacteria 2546
797 Ga0495648_0051193 3300046524 Bacteria 2518
798 Ga0495648_0116647 3300046524 Bacteria 1442
799 Ga0495648_0130266 3300046524 Bacteria 1338
800 Ga0495666_0001375 3300046526 Bacteria 11789
801 Ga0495666_0009905 3300046526 Bacteria 4760
802 Ga0495666_0018038 3300046526 Bacteria 3515
803 Ga0495642_0000153 3300046528 Bacteria 39992
804 Ga0495642_0000800 3300046528 Bacteria 15289
805 Ga0495654_0000007 3300046530 Bacteria 403529
806 Ga0495654_0000069 3300046530 Bacteria 120853
807 Ga0495654_0000356 3300046530 Bacteria 39697
808 Ga0495654_0001518 3300046530 Bacteria 15840
809 Ga0495654_0001554 3300046530 Bacteria 15582
810 Ga0495654_0001707 3300046530 Bacteria 14761
811 Ga0495654_0002300 3300046530 Bacteria 12356
812 Ga0495654_0003578 3300046530 Bacteria 9458
813 Ga0495654_0005355 3300046530 Bacteria 7476
814 Ga0495654_0009802 3300046530 Bacteria 5235
815 Ga0495654_0015604 3300046530 Bacteria 4031
816 Ga0495654_0016284 3300046530 Bacteria 3934
817 Ga0495654_0038838 3300046530 Bacteria 2378
818 Ga0495654_0048535 3300046530 Bacteria 2082
819 Ga0495654_0049043 3300046530 Bacteria 2069
820 Ga0495654_0062178 3300046530 Bacteria 1790
821 Ga0495654_0114533 3300046530 Bacteria 1226
822 Ga0495654_0121992 3300046530 Bacteria 1178
823 Ga0495587_0077495 3300046536 Bacteria 1929
824 Ga0495609_0000015 3300046538 Bacteria 322474
825 Ga0495609_0000070 3300046538 Bacteria 128181
826 Ga0495609_0003891 3300046538 Bacteria 8374
827 Ga0495609_0005696 3300046538 Bacteria 6488
828 Ga0495597_0000005 3300046542 Bacteria 286580
829 Ga0495597_0000174 3300046542 Bacteria 57170
830 Ga0495597_0005772 3300046542 Bacteria 6497
831 Ga0495597_0007051 3300046542 Bacteria 5754
832 Ga0495597_0018470 3300046542 Bacteria 3272
833 Ga0495597_0033564 3300046542 Bacteria 2323
834 Ga0495645_0030346 3300046543 Bacteria 3937
835 Ga0495622_0009062 3300046557 Bacteria 4607
836 Ga0495633_0000060 3300046558 Bacteria 144561
837 Ga0495656_0006796 3300046615 Bacteria 4021
838 Ga0495668_0016569 3300046616 Bacteria 4282
839 Ga0495668_0025217 3300046616 Bacteria 3380
840 Ga0495668_0044242 3300046616 Bacteria 2474
841 Ga0495611_0000720 3300046648 Bacteria 18678
842 Ga0495611_0000817 3300046648 Bacteria 17225
843 Ga0495611_0003033 3300046648 Bacteria 7477
844 Ga0495611_0003416 3300046648 Bacteria 7005
845 Ga0495611_0069106 3300046648 Bacteria 1613
846 Ga0495625_0001491 3300046660 Bacteria 28149
847 Ga0495625_0004073 3300046660 Bacteria 13960
848 Ga0495625_0008789 3300046660 Bacteria 8554
849 Ga0495625_0048065 3300046660 Bacteria 3074
850 Ga0495625_0116723 3300046660 Bacteria 1820
851 Ga0495625_0129471 3300046660 Bacteria 1710
852 Ga0495625_0130031 3300046660 Bacteria 1706
853 Ga0495625_0262401 3300046660 Bacteria 1117
854 Ga0495635_0037354 3300046663 Bacteria 3363
855 Ga0495661_0000110 3300046665 Bacteria 97854
856 Ga0495661_0000139 3300046665 Bacteria 85160
857 Ga0495661_0000194 3300046665 Bacteria 70173
858 Ga0495661_0000304 3300046665 Bacteria 56019
859 Ga0495661_0019103 3300046665 Bacteria 4496
860 Ga0495661_0026217 3300046665 Bacteria 3755
861 Ga0495661_0027633 3300046665 Bacteria 3639
862 Ga0495661_0042224 3300046665 Bacteria 2812
863 Ga0495661_0153040 3300046665 Bacteria 1244
864 Ga0495661_0190255 3300046665 Bacteria 1081
865 Ga0495588_0008789 3300046674 Bacteria 4642
866 Ga0495588_0040628 3300046674 Bacteria 2373
867 Ga0495623_0069962 3300046679 Bacteria 2186
868 Ga0495646_0091703 3300046680 Bacteria 1753
869 Ga0495669_0017189 3300046684 Bacteria 3101
870 Ga0495613_0301470 3300046689 Bacteria 1109
871 Ga0495670_0004111 3300046691 Bacteria 7142
872 Ga0495670_0005750 3300046691 Bacteria 6080
873 Ga0495671_0001949 3300046692 Bacteria 13244
874 Ga0495671_0006975 3300046692 Bacteria 6478
875 Ga0495671_0010944 3300046692 Bacteria 5009
876 Ga0495671_0012308 3300046692 Bacteria 4676
877 Ga0495671_0012367 3300046692 Bacteria 4665
878 Ga0495671_0017262 3300046692 Bacteria 3842
879 Ga0495671_0022086 3300046692 Bacteria 3336
880 Ga0495671_0053917 3300046692 Bacteria 1994
881 Ga0495671_0056015 3300046692 Bacteria 1952
882 Ga0495671_0102462 3300046692 Bacteria 1398
883 Ga0495649_0001408 3300046694 Bacteria 18166
884 Ga0495649_0002123 3300046694 Bacteria 14216
885 Ga0495649_0006667 3300046694 Bacteria 7166
886 Ga0495649_0006754 3300046694 Bacteria 7108
887 Ga0495649_0014726 3300046694 Bacteria 4470
888 Ga0495649_0023580 3300046694 Bacteria 3437
889 Ga0495649_0045699 3300046694 Bacteria 2386
890 Ga0495649_0063994 3300046694 Bacteria 1975
891 Ga0495649_0099940 3300046694 Bacteria 1542
892 Ga0495589_0000001 3300046794 Bacteria 888100
893 Ga0495589_0002276 3300046794 Bacteria 10787
894 Ga0495589_0005001 3300046794 Bacteria 7021
895 Ga0495589_0005441 3300046794 Bacteria 6719
896 Ga0495589_0015046 3300046794 Bacteria 3981
897 Ga0495600_0056440 3300046809 Bacteria 2565
898 Ga0495600_0103275 3300046809 Bacteria 1857
899 Ga0495660_0000004 3300046810 Bacteria 1003183
900 Ga0495660_0000016 3300046810 Bacteria 321859
901 Ga0495660_0001756 3300046810 Bacteria 14444
902 Ga0495660_0003768 3300046810 Bacteria 9298
903 Ga0495660_0012461 3300046810 Bacteria 4936
904 Ga0495660_0018712 3300046810 Bacteria 3978
905 Ga0495660_0022208 3300046810 Bacteria 3625
906 Ga0495660_0023661 3300046810 Bacteria 3504
907 Ga0495660_0066105 3300046810 Bacteria 1928
908 Ga0495660_0113743 3300046810 Bacteria 1378
909 Ga0495581_0285140 3300047315 Bacteria 965
910 Ga0495604_0167636 3300047317 Bacteria 1547
911 Ga0495604_0333389 3300047317 Bacteria 1011
912 Ga0495636_0009371 3300047318 Bacteria 3856
913 Ga0495672_0000001 3300047320 Bacteria 1458820
914 Ga0495672_0000015 3300047320 Bacteria 502855
915 Ga0495672_0000076 3300047320 Bacteria 174487
916 Ga0495672_0002745 3300047320 Bacteria 15776
917 Ga0495672_0006543 3300047320 Bacteria 8982
918 Ga0495672_0014337 3300047320 Bacteria 5432
919 Ga0495672_0022683 3300047320 Bacteria 4076
920 Ga0495672_0023110 3300047320 Bacteria 4030
921 Ga0495672_0026253 3300047320 Bacteria 3718
922 Ga0495672_0071400 3300047320 Bacteria 1965
923 Ga0495672_0121507 3300047320 Bacteria 1387
924 Ga0495676_0000013 3300047321 Bacteria 213031
925 Ga0495676_0067231 3300047321 Bacteria 2773
926 Ga0495680_0167094 3300047322 Bacteria 1594
927 Ga0495683_0000027 3300047323 Bacteria 153730
928 Ga0495683_0000261 3300047323 Bacteria 47209
929 Ga0495683_0014602 3300047323 Bacteria 4092
930 Ga0495683_0018906 3300047323 Bacteria 3557
931 Ga0495683_0021349 3300047323 Bacteria 3336
932 Ga0495683_0022851 3300047323 Bacteria 3215
933 Ga0495683_0057536 3300047323 Bacteria 1932
934 Ga0495683_0084407 3300047323 Bacteria 1545
935 Ga0495683_0152496 3300047323 Bacteria 1074
936 Ga0495687_005661 3300047443 Bacteria 7890
937 Ga0495675_0009682 3300047444 Bacteria 6006
938 Ga0495675_0044070 3300047444 Bacteria 2841
939 Ga0495679_000005 3300047446 Bacteria 455007
940 Ga0495679_000206 3300047446 Bacteria 51518
941 Ga0495679_005588 3300047446 Bacteria 5547
942 Ga0495679_024505 3300047446 Bacteria 2031
943 Ga0495679_030670 3300047446 Bacteria 1742
944 Ga0495679_033117 3300047446 Bacteria 1652
945 Ga0495673_0000007 3300047469 Bacteria 796722
946 Ga0495673_0000358 3300047469 Bacteria 56024
947 Ga0495673_0001257 3300047469 Bacteria 20926
948 Ga0495673_0002579 3300047469 Bacteria 12608
949 Ga0495673_0003090 3300047469 Bacteria 11196
950 Ga0495673_0005035 3300047469 Bacteria 8094
951 Ga0495673_0005632 3300047469 Bacteria 7526
952 Ga0495673_0006585 3300047469 Bacteria 6812
953 Ga0495673_0007928 3300047469 Bacteria 6030
954 Ga0495673_0009812 3300047469 Bacteria 5262
955 Ga0495673_0010469 3300047469 Bacteria 5038
956 Ga0495673_0015057 3300047469 Bacteria 3999
957 Ga0495673_0015965 3300047469 Bacteria 3852
958 Ga0495673_0017418 3300047469 Bacteria 3650
959 Ga0495673_0022001 3300047469 Bacteria 3133
960 Ga0495673_0033902 3300047469 Bacteria 2364
961 Ga0495673_0034146 3300047469 Bacteria 2353
962 Ga0495673_0061061 3300047469 Bacteria 1615
963 Ga0495673_0074043 3300047469 Bacteria 1426
964 Ga0495681_0001327 3300047470 Bacteria 18719
965 Ga0495681_0002119 3300047470 Bacteria 14429
966 Ga0495681_0004330 3300047470 Bacteria 9713
967 Ga0495681_0005466 3300047470 Bacteria 8496
968 Ga0495681_0009761 3300047470 Bacteria 5876
969 Ga0495681_0014330 3300047470 Bacteria 4550
970 Ga0495681_0061521 3300047470 Bacteria 1729
971 Ga0495686_0088025 3300047472 Bacteria 1888
972 Ga0495686_0088724 3300047472 Bacteria 1879
973 Ga0495626_0000056 3300048091 Bacteria 150654
974 Ga0495626_0001052 3300048091 Bacteria 23584
975 Ga0495626_0001474 3300048091 Bacteria 18588
976 Ga0495626_0001525 3300048091 Bacteria 18206
977 Ga0495626_0002948 3300048091 Bacteria 11327
978 Ga0495626_0003635 3300048091 Bacteria 9813
979 Ga0495626_0004137 3300048091 Bacteria 9005
980 Ga0495626_0009473 3300048091 Bacteria 5262
981 Ga0495626_0016825 3300048091 Bacteria 3706
982 Ga0495626_0017201 3300048091 Bacteria 3657
983 Ga0495626_0123335 3300048091 Bacteria 1111
984 Ga0496100_0014748 3300048903 Bacteria 4545
985 Ga0496101_0000093 3300048904 Bacteria 95734
986 Ga0496101_0028513 3300048904 Bacteria 3898
987 Ga0496101_0267964 3300048904 Bacteria 1333
988 Ga0496102_0006258 3300048905 Bacteria 10150
989 Ga0496102_0047483 3300048905 Bacteria 3902
990 Ga0496104_0000328 3300048907 Bacteria 42377
991 Ga0496104_0002655 3300048907 Bacteria 15391
992 Ga0496105_0004370 3300048908 Bacteria 10645
993 Ga0496110_0029079 3300048913 Bacteria 4752
994 Ga0496113_0122856 3300048916 Bacteria 2032
995 Ga0496114_0018708 3300048917 Bacteria 5605
996 Ga0496114_0019375 3300048917 Bacteria 5513
997 Ga0496116_0000001 3300048919 Bacteria 1501681
998 Ga0496116_0000086 3300048919 Bacteria 217597
999 Ga0496116_0000094 3300048919 Bacteria 205588
1000 Ga0496116_0000163 3300048919 Bacteria 134121
1001 Ga0496116_0001669 3300048919 Bacteria 24382
1002 Ga0496116_0002562 3300048919 Bacteria 18976
1003 Ga0496116_0003077 3300048919 Bacteria 16822
1004 Ga0496116_0005711 3300048919 Bacteria 11446
1005 Ga0496116_0040547 3300048919 Bacteria 3206
1006 Ga0496116_0047037 3300048919 Bacteria 2907
1007 Ga0496116_0067062 3300048919 Bacteria 2293
1008 Ga0496116_0073422 3300048919 Bacteria 2156
1009 Ga0496117_0000009 3300048920 Bacteria 613759
1010 Ga0496117_0000058 3300048920 Bacteria 264132
1011 Ga0496117_0000378 3300048920 Bacteria 76852
1012 Ga0496117_0001274 3300048920 Bacteria 37377
1013 Ga0496117_0002620 3300048920 Bacteria 22324
1014 Ga0496117_0003171 3300048920 Bacteria 19546
1015 Ga0496117_0003939 3300048920 Bacteria 16796
1016 Ga0496117_0006411 3300048920 Bacteria 11929
1017 Ga0496117_0007875 3300048920 Bacteria 10247
1018 Ga0496117_0008528 3300048920 Bacteria 9722
1019 Ga0496117_0012252 3300048920 Bacteria 7581
1020 Ga0496117_0016135 3300048920 Bacteria 6318
1021 Ga0496117_0025007 3300048920 Bacteria 4703
1022 Ga0496117_0035911 3300048920 Bacteria 3714
1023 Ga0496117_0044858 3300048920 Bacteria 3199
1024 Ga0496117_0125930 3300048920 Bacteria 1563
1025 Ga0496117_0128128 3300048920 Bacteria 1544
1026 Ga0496118_0000007 3300048921 Bacteria 650986
1027 Ga0496118_0000199 3300048921 Bacteria 105620
1028 Ga0496118_0001807 3300048921 Bacteria 30813
1029 Ga0496118_0002970 3300048921 Bacteria 21939
1030 Ga0496118_0004470 3300048921 Bacteria 16575
1031 Ga0496118_0006308 3300048921 Bacteria 13104
1032 Ga0496118_0006442 3300048921 Bacteria 12897
1033 Ga0496118_0010654 3300048921 Bacteria 9070
1034 Ga0496118_0010787 3300048921 Bacteria 9006
1035 Ga0496118_0040415 3300048921 Bacteria 3708
1036 Ga0496118_0069631 3300048921 Bacteria 2546
1037 Ga0496118_0090361 3300048921 Bacteria 2110
1038 Ga0496118_0097843 3300048921 Bacteria 1995
1039 Ga0496119_0000001 3300048922 Bacteria 789520
1040 Ga0496119_0000018 3300048922 Bacteria 306476
1041 Ga0496119_0000106 3300048922 Bacteria 116871
1042 Ga0496119_0000111 3300048922 Bacteria 114905
1043 Ga0496119_0000112 3300048922 Bacteria 114767
1044 Ga0496119_0001831 3300048922 Bacteria 24634
1045 Ga0496119_0006761 3300048922 Bacteria 10518
1046 Ga0496119_0006919 3300048922 Bacteria 10344
1047 Ga0496119_0007156 3300048922 Bacteria 10118
1048 Ga0496119_0019652 3300048922 Bacteria 4962
1049 Ga0496119_0036624 3300048922 Bacteria 3199
1050 Ga0496119_0037014 3300048922 Bacteria 3176
1051 Ga0496119_0037439 3300048922 Bacteria 3150
1052 Ga0496119_0056638 3300048922 Bacteria 2374
1053 Ga0496119_0103631 3300048922 Bacteria 1593
1054 Ga0496120_0000002 3300048923 Bacteria 547999
1055 Ga0496120_0000116 3300048923 Bacteria 135302
1056 Ga0496120_0000152 3300048923 Bacteria 114905
1057 Ga0496120_0000641 3300048923 Bacteria 51804
1058 Ga0496120_0000917 3300048923 Bacteria 41032
1059 Ga0496120_0000921 3300048923 Bacteria 40877
1060 Ga0496120_0000940 3300048923 Bacteria 40056
1061 Ga0496120_0002130 3300048923 Bacteria 21149
1062 Ga0496120_0003722 3300048923 Bacteria 13561
1063 Ga0496120_0004409 3300048923 Bacteria 11819
1064 Ga0496120_0011462 3300048923 Bacteria 6094
1065 Ga0496120_0022189 3300048923 Bacteria 3996
1066 Ga0496120_0029556 3300048923 Bacteria 3344
1067 Ga0496120_0033093 3300048923 Bacteria 3109
1068 Ga0496120_0046921 3300048923 Bacteria 2493
1069 Ga0496120_0166617 3300048923 Bacteria 1093
1070 Ga0496121_0000544 3300048924 Bacteria 71622
1071 Ga0496121_0001283 3300048924 Bacteria 43277
1072 Ga0496121_0003009 3300048924 Bacteria 24478
1073 Ga0496121_0008399 3300048924 Bacteria 12168
1074 Ga0496121_0009768 3300048924 Bacteria 10971
1075 Ga0496121_0013228 3300048924 Bacteria 8891
1076 Ga0496121_0017560 3300048924 Bacteria 7296
1077 Ga0496121_0022025 3300048924 Bacteria 6206
1078 Ga0496121_0028049 3300048924 Bacteria 5250
1079 Ga0496121_0028786 3300048924 Bacteria 5161
1080 Ga0496121_0041289 3300048924 Bacteria 4034
1081 Ga0496121_0233744 3300048924 Bacteria 1285
1082 Ga0496122_0000003 3300048925 Bacteria 645810
1083 Ga0496122_0000007 3300048925 Bacteria 606493
1084 Ga0496122_0000122 3300048925 Bacteria 181491
1085 Ga0496122_0000211 3300048925 Bacteria 130145
1086 Ga0496122_0000264 3300048925 Bacteria 117620
1087 Ga0496122_0003261 3300048925 Bacteria 21531
1088 Ga0496122_0003412 3300048925 Bacteria 20907
1089 Ga0496122_0006802 3300048925 Bacteria 12988
1090 Ga0496122_0008288 3300048925 Bacteria 11271
1091 Ga0496122_0009298 3300048925 Bacteria 10388
1092 Ga0496122_0020664 3300048925 Bacteria 5933
1093 Ga0496122_0026934 3300048925 Bacteria 4935
1094 Ga0496122_0029929 3300048925 Bacteria 4575
1095 Ga0496122_0046369 3300048925 Bacteria 3367
1096 Ga0496122_0158012 3300048925 Bacteria 1387
1097 Ga0496122_0259220 3300048925 Bacteria 966
1098 Ga0496123_0000004 3300048926 Bacteria 777230
1099 Ga0496123_0000047 3300048926 Bacteria 244302
1100 Ga0496123_0000215 3300048926 Bacteria 117620
1101 Ga0496123_0000391 3300048926 Bacteria 82015
1102 Ga0496123_0000507 3300048926 Bacteria 67803
1103 Ga0496123_0000878 3300048926 Bacteria 47732
1104 Ga0496123_0001340 3300048926 Bacteria 34830
1105 Ga0496123_0001635 3300048926 Bacteria 30148
1106 Ga0496123_0002536 3300048926 Bacteria 22362
1107 Ga0496123_0003243 3300048926 Bacteria 18515
1108 Ga0496123_0012443 3300048926 Bacteria 7253
1109 Ga0496123_0046368 3300048926 Bacteria 2949
1110 Ga0496123_0052447 3300048926 Bacteria 2706
1111 Ga0496123_0198302 3300048926 Bacteria 1031
1112 Ga0496124_0000008 3300048927 Bacteria 864372
1113 Ga0496124_0000025 3300048927 Bacteria 405471
1114 Ga0496124_0000222 3300048927 Bacteria 110854
1115 Ga0496124_0000357 3300048927 Bacteria 83170
1116 Ga0496124_0001891 3300048927 Bacteria 28792
1117 Ga0496124_0002226 3300048927 Bacteria 25820
1118 Ga0496124_0005218 3300048927 Bacteria 14743
1119 Ga0496124_0005891 3300048927 Bacteria 13570
1120 Ga0496124_0006121 3300048927 Bacteria 13215
1121 Ga0496124_0010141 3300048927 Bacteria 9589
1122 Ga0496124_0011885 3300048927 Bacteria 8668
1123 Ga0496124_0012924 3300048927 Bacteria 8190
1124 Ga0496124_0013421 3300048927 Bacteria 7995
1125 Ga0496124_0016180 3300048927 Bacteria 7110
1126 Ga0496124_0020850 3300048927 Bacteria 6047
1127 Ga0496124_0025858 3300048927 Bacteria 5305
1128 Ga0496124_0034180 3300048927 Bacteria 4465
1129 Ga0496124_0041187 3300048927 Bacteria 3989
1130 Ga0496124_0049308 3300048927 Bacteria 3593
1131 Ga0496124_0058510 3300048927 Bacteria 3240
1132 Ga0496124_0073840 3300048927 Bacteria 2821
1133 Ga0496124_0085811 3300048927 Bacteria 2578
1134 Ga0496124_0102408 3300048927 Bacteria 2317
1135 Ga0496124_0103594 3300048927 Bacteria 2302
1136 Ga0496124_0105661 3300048927 Bacteria 2274
1137 Ga0496124_0120836 3300048927 Bacteria 2093
1138 Ga0496124_0173580 3300048927 Bacteria 1666
1139 Ga0496124_0179691 3300048927 Bacteria 1629
1140 Ga0496124_0185756 3300048927 Bacteria 1595
1141 Ga0496124_0205723 3300048927 Bacteria 1493
1142 Ga0496125_0000013 3300048928 Bacteria 628761
1143 Ga0496125_0000065 3300048928 Bacteria 249830
1144 Ga0496125_0000908 3300048928 Bacteria 46824
1145 Ga0496125_0019451 3300048928 Bacteria 6403
1146 Ga0496125_0020974 3300048928 Bacteria 6111
1147 Ga0496125_0027866 3300048928 Bacteria 5112
1148 Ga0496125_0027889 3300048928 Bacteria 5109
1149 Ga0496125_0042239 3300048928 Bacteria 3886
1150 Ga0496125_0046158 3300048928 Bacteria 3657
1151 Ga0496125_0046322 3300048928 Bacteria 3648
1152 Ga0496125_0081689 3300048928 Bacteria 2467
1153 Ga0496125_0232512 3300048928 Bacteria 1177
1154 Ga0496126_0000276 3300048929 Bacteria 108459
1155 Ga0496126_0001263 3300048929 Bacteria 40762
1156 Ga0496126_0015473 3300048929 Bacteria 7672
1157 Ga0496126_0040844 3300048929 Bacteria 4298
1158 Ga0496126_0051784 3300048929 Bacteria 3736
1159 Ga0496126_0062444 3300048929 Bacteria 3342
1160 Ga0496126_0071241 3300048929 Bacteria 3094
1161 Ga0496126_0172684 3300048929 Bacteria 1840
1162 Ga0496126_0198450 3300048929 Bacteria 1695
1163 Ga0496126_0287497 3300048929 Bacteria 1360
1164 Ga0496126_0300501 3300048929 Bacteria 1324
1165 Ga0495678_000031 3300049459 Bacteria 215528
1166 Ga0495678_000039 3300049459 Bacteria 191665
1167 Ga0495678_000091 3300049459 Bacteria 114504
1168 Ga0495678_005928 3300049459 Bacteria 6606
1169 Ga0495678_008574 3300049459 Bacteria 5141
1170 Ga0495678_008769 3300049459 Bacteria 5067
1171 Ga0495678_011885 3300049459 Bacteria 4149
1172 Ga0495678_012838 3300049459 Bacteria 3953
1173 Ga0495678_015738 3300049459 Bacteria 3473
1174 Ga0495678_052291 3300049459 Bacteria 1573
1175 Ga0495678_068829 3300049459 Bacteria 1303
1176 Ga0495678_086545 3300049459 Bacteria 1114
1177 Ga0495682_0000001 3300049460 Bacteria 1559116
1178 Ga0495682_0000577 3300049460 Bacteria 24873
1179 Ga0495682_0004465 3300049460 Bacteria 5977
1180 Ga0501034_0000137 3300049571 Bacteria 136592
1181 Ga0501037_0042957 3300049573 Bacteria 3322
1182 Ga0501226_000007 3300049853 Bacteria 227827
1183 nmdc:mga00v17_14833_c1 3300050491 Bacteria 4359
1184 nmdc:mga00v17_228261_c1 3300050491 Bacteria 1206
1185 Ga0500618_022861 3300053125 Bacteria 1516
1186 Ga0500621_000002 3300053126 Bacteria 849473
1187 Ga0500659_0021849 3300053135 Bacteria 3488
1188 Ga0500573_0024813 3300053140 Bacteria 3447
1189 Ga0500634_0018308 3300053161 Bacteria 3760

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046616 Ga0495668_0044242 Ga0495668_0044242_22_828 267
2 3300046507 Ga0495606_0036057 Ga0495606_0036057_2535_3350 271
3 iso_pu_bacteria 2974298342 2974301232 280
4 3300014497 Ga0182008_10004762 Ga0182008_100047625 288
5 3300025961 Ga0207712_10025540 Ga0207712_100255405 288
6 3300036647 Ga0316582_0173070 Ga0316582_0173070_35_919 288
7 3300042010 Ga0439452_004034 Ga0439452_004034_4110_4976 288
8 3300042185 Ga0450909_009403 Ga0450909_009403_16_882 288
9 3300046458 Ga0495591_017922 Ga0495591_017922_1527_2396 288
10 3300046491 Ga0495584_0048084 Ga0495584_0048084_10_876 288
11 3300046492 Ga0495585_0075497 Ga0495585_0075497_13_879 288
12 3300046507 Ga0495606_0216053 Ga0495606_0216053_190_1059 288
13 3300046515 Ga0495620_0052047 Ga0495620_0052047_18_884 288
14 3300046520 Ga0495637_0083328 Ga0495637_0083328_377_1243 288
15 3300046526 Ga0495666_0001375 Ga0495666_0001375_23_889 288
16 3300046530 Ga0495654_0114533 Ga0495654_0114533_264_1130 288
17 3300047317 Ga0495604_0167636 Ga0495604_0167636_24_890 288
18 3300048922 Ga0496119_0056638 Ga0496119_0056638_1488_2354 288
19 3300048925 Ga0496122_0259220 Ga0496122_0259220_24_893 288
20 3300048928 Ga0496125_0046322 Ga0496125_0046322_21_887 288
21 3300046463 Ga0495653_0009118 Ga0495653_0009118_13_897 294
22 3300047315 Ga0495581_0285140 Ga0495581_0285140_67_951 294
23 3300048926 Ga0496123_0198302 Ga0496123_0198302_24_929 301
24 3300053161 Ga0500634_0018308 Ga0500634_0018308_2805_3710 301
25 3300032168 Ga0316593_10008423 Ga0316593_100084233 303
26 3300046474 Ga0495605_0083802 Ga0495605_0083802_541_1452 303
27 3300046557 Ga0495622_0009062 Ga0495622_0009062_24_935 303
28 3300046674 Ga0495588_0040628 Ga0495588_0040628_1433_2344 303
29 3300035398 Ga0316574_0076175 Ga0316574_0076175_997_1974 304
30 3300042013 Ga0439456_000039 Ga0439456_000039_122_1078 305
31 3300042876 Ga0451577_0002122 Ga0451577_0002122_17980_18912 305
32 3300038735 Ga0400485_20298 Ga0400485_20298_4211_5146 306
33 3300049853 Ga0501226_000007 Ga0501226_000007_108864_109835 306
34 3300046522 Ga0495643_0153275 Ga0495643_0153275_17_943 308
35 3300046530 Ga0495654_0038838 Ga0495654_0038838_28_954 308
36 3300047317 Ga0495604_0333389 Ga0495604_0333389_26_952 308
37 3300047322 Ga0495680_0167094 Ga0495680_0167094_650_1576 308
38 3300047446 Ga0495679_033117 Ga0495679_033117_715_1641 308
39 3300048927 Ga0496124_0013421 Ga0496124_0013421_3523_4479 311
40 iso_pu_bacteria 2847085930 2847087278 311
41 iso_pu_bacteria 2908669403 2908669409 311
42 3300038725 Ga0400484_12942 Ga0400484_12942_1298_2254 312
43 3300039062 Ga0400483_023904 Ga0400483_023904_2619_3572 312
44 3300039062 Ga0400483_218673 Ga0400483_218673_19699_20652 312
45 iso_pu_bacteria 2511231025 2511382943 312
46 iso_pu_bacteria 2511231035 2511435056 312
47 iso_pu_bacteria 2599185299 2599926000 312
48 iso_pu_bacteria 2608642108 2608669768 312
49 iso_pu_bacteria 2648501693 2650896432 312
50 iso_pu_bacteria 2684622997 2686353712 312
51 iso_pu_bacteria 2690315857 2691329960 312
52 iso_pu_bacteria 2808606414 2809124988 312
53 iso_pu_bacteria 2844528606 2844528737 312
54 iso_pu_bacteria 2847797336 2847799501 312
55 iso_pu_bacteria 2865014394 2865018377 312
56 iso_pu_bacteria 2876601092 2876603880 312
57 iso_pu_bacteria 2881609920 2881611555 312
58 iso_pu_bacteria 2881714928 2881716291 312
59 iso_pu_bacteria 2884086401 2884088324 312
60 iso_pu_bacteria 2919534386 2919537804 312
61 iso_pu_bacteria 2919688452 2919690783 312
62 iso_pu_bacteria 2939573065 2939573250 312
63 iso_pu_bacteria 2939602548 2939606094 312
64 iso_pu_bacteria 2945951305 2945952623 312
65 iso_pu_bacteria 2978975091 2978979192 312
66 iso_pu_bacteria 2984494565 2984497001 312
67 iso_pu_bacteria 2990261002 2990262417 312
68 iso_pu_bacteria 8016733728 8016735574 312
69 iso_pu_bacteria 8019499862 8019501038 312
70 3300038725 Ga0400484_35463 Ga0400484_35463_474_1466 313
71 3300038725 Ga0400484_40121 Ga0400484_40121_336_1295 313
72 3300038726 Ga0400490_01226 Ga0400490_01226_335_1294 313
73 3300038726 Ga0400490_06757 Ga0400490_06757_403_1362 313
74 3300038726 Ga0400490_09120 Ga0400490_09120_31_1023 313
75 3300038726 Ga0400490_21691 Ga0400490_21691_105_1073 313
76 3300038726 Ga0400490_56575 Ga0400490_56575_572_1531 313
77 3300038741 Ga0400488_07942 Ga0400488_07942_275_1234 313
78 3300038741 Ga0400488_39372 Ga0400488_39372_4555_5514 313
79 3300038742 Ga0400486_07960 Ga0400486_07960_2555_3514 313
80 3300038742 Ga0400486_09951 Ga0400486_09951_30403_31362 313
81 3300039062 Ga0400483_072717 Ga0400483_072717_509_1507 313
82 3300039062 Ga0400483_086677 Ga0400483_086677_21233_22192 313
83 3300039062 Ga0400483_220601 Ga0400483_220601_11942_12901 313
84 3300039093 Ga0400489_26060 Ga0400489_26060_27902_28861 313
85 3300039093 Ga0400489_62285 Ga0400489_62285_10456_11415 313
86 iso_pu_bacteria 2506520007 2506578952 313
87 iso_pu_bacteria 2506520008 2506584091 313
88 iso_pu_bacteria 2508501071 2508852825 313
89 iso_pu_bacteria 2537561728 2538424375 313
90 iso_pu_bacteria 2547132181 2547695532 313
91 iso_pu_bacteria 2547132416 2548650422 313
92 iso_pu_bacteria 2554235234 2555261036 313
93 iso_pu_bacteria 2561511199 2562463154 313
94 iso_pu_bacteria 2565956521 2566038430 313
95 iso_pu_bacteria 2585427591 2585827606 313
96 iso_pu_bacteria 2585427592 2585832326 313
97 iso_pu_bacteria 2599185169 2599408671 313
98 iso_pu_bacteria 2600255254 2601522817 313
99 iso_pu_bacteria 2600255255 2601527844 313
100 iso_pu_bacteria 2600255256 2601533368 313
101 iso_pu_bacteria 2600255257 2601541014 313
102 iso_pu_bacteria 2600255280 2601614675 313
103 iso_pu_bacteria 2600255281 2601619395 313
104 iso_pu_bacteria 2600255287 2601642011 313
105 iso_pu_bacteria 2600255288 2601646847 313
106 iso_pu_bacteria 2600255289 2601652822 313
107 iso_pu_bacteria 2600255290 2601658148 313
108 iso_pu_bacteria 2600255291 2601661833 313
109 iso_pu_bacteria 2600255298 2601694791 313
110 iso_pu_bacteria 2600255299 2601701754 313
111 iso_pu_bacteria 2600255300 2601706669 313
112 iso_pu_bacteria 2600255301 2601710973 313
113 iso_pu_bacteria 2600255302 2601715987 313
114 iso_pu_bacteria 2600255303 2601719818 313
115 iso_pu_bacteria 2600255304 2601726393 313
116 iso_pu_bacteria 2600255305 2601730934 313
117 iso_pu_bacteria 2600255306 2601735949 313
118 iso_pu_bacteria 2600255307 2601741213 313
119 iso_pu_bacteria 2600255309 2601751144 313
120 iso_pu_bacteria 2600255310 2601759512 313
121 iso_pu_bacteria 2600255311 2601763425 313
122 iso_pu_bacteria 2600255392 2602018397 313
123 iso_pu_bacteria 2602042046 2603637301 313
124 iso_pu_bacteria 2602042047 2603645189 313
125 iso_pu_bacteria 2602042052 2603661513 313
126 iso_pu_bacteria 2602042053 2603664467 313
127 iso_pu_bacteria 2602042066 2603698977 313
128 iso_pu_bacteria 2602042067 2603702379 313
129 iso_pu_bacteria 2602042103 2603838328 313
130 iso_pu_bacteria 2602042104 2603843406 313
131 iso_pu_bacteria 2602042105 2603848479 313
132 iso_pu_bacteria 2602042106 2603853552 313
133 iso_pu_bacteria 2602042109 2603868888 313
134 iso_pu_bacteria 2602042110 2603871606 313
135 iso_pu_bacteria 2602042111 2603876506 313
136 iso_pu_bacteria 2603880178 2606048797 313
137 iso_pu_bacteria 2603880184 2606068899 313
138 iso_pu_bacteria 2603880202 2606144690 313
139 iso_pu_bacteria 2603880211 2606176199 313
140 iso_pu_bacteria 2609459761 2609910623 313
141 iso_pu_bacteria 2636415599 2637224472 313
142 iso_pu_bacteria 2648501241 2649121063 313
143 iso_pu_bacteria 2651869818 2652974596 313
144 iso_pu_bacteria 2654587920 2656279825 313
145 iso_pu_bacteria 2667528172 2671101541 313
146 iso_pu_bacteria 2667528173 2671108690 313
147 iso_pu_bacteria 2671180115 2671588351 313
148 iso_pu_bacteria 2675903046 2676405810 313
149 iso_pu_bacteria 2681812866 2681998223 313
150 iso_pu_bacteria 2681812869 2682006011 313
151 iso_pu_bacteria 2687453601 2689445404 313
152 iso_pu_bacteria 2706794495 2707099007 313
153 iso_pu_bacteria 2711768156 2712469264 313
154 iso_pu_bacteria 2751185917 2753856552 313
155 iso_pu_bacteria 2765235842 2765589582 313
156 iso_pu_bacteria 2772190666 2772439377 313
157 iso_pu_bacteria 2775506706 2775539583 313
158 iso_pu_bacteria 2775507074 2777023121 313
159 iso_pu_bacteria 2791354903 2791921724 313
160 iso_pu_bacteria 2791355010 2792310537 313
161 iso_pu_bacteria 2791355275 2793405134 313
162 iso_pu_bacteria 2806310673 2807179797 313
163 iso_pu_bacteria 2811995292 2813728347 313
164 iso_pu_bacteria 2814123068 2814695856 313
165 iso_pu_bacteria 2821118458 2821121732 313
166 iso_pu_bacteria 2823373977 2823375304 313
167 iso_pu_bacteria 2844425489 2844428017 313
168 iso_pu_bacteria 2846540461 2846543697 313
169 iso_pu_bacteria 2852103415 2852104537 313
170 iso_pu_bacteria 2855195626 2855198797 313
171 iso_pu_bacteria 2858466076 2858467061 313
172 iso_pu_bacteria 2869551831 2869554852 313
173 iso_pu_bacteria 2871272651 2871275221 313
174 iso_pu_bacteria 2871282230 2871285173 313
175 iso_pu_bacteria 2887630918 2887631465 313
176 iso_pu_bacteria 2888366609 2888369437 313
177 iso_pu_bacteria 2888373701 2888377921 313
178 iso_pu_bacteria 2891670763 2891671231 313
179 iso_pu_bacteria 2894510363 2894513083 313
180 iso_pu_bacteria 2900051742 2900052223 313
181 iso_pu_bacteria 2904474040 2904475615 313
182 iso_pu_bacteria 2904504865 2904507562 313
183 iso_pu_bacteria 2904513164 2904514596 313
184 iso_pu_bacteria 2916178963 2916182953 313
185 iso_pu_bacteria 2919108558 2919111440 313
186 iso_pu_bacteria 2919150387 2919151784 313
187 iso_pu_bacteria 2919493220 2919497159 313
188 iso_pu_bacteria 2919497567 2919500080 313
189 iso_pu_bacteria 2919543075 2919544467 313
190 iso_pu_bacteria 2923525760 2923527770 313
191 iso_pu_bacteria 2923634449 2923635468 313
192 iso_pu_bacteria 2927143783 2927144453 313
193 iso_pu_bacteria 2927833300 2927833558 313
194 iso_pu_bacteria 2932406140 2932407866 313
195 iso_pu_bacteria 2935625433 2935626191 313
196 iso_pu_bacteria 2937539931 2937542153 313
197 iso_pu_bacteria 2937967321 2937968009 313
198 iso_pu_bacteria 2939568625 2939569617 313
199 iso_pu_bacteria 2939577877 2939580271 313
200 iso_pu_bacteria 2939607340 2939609027 313
201 iso_pu_bacteria 2939617950 2939618113 313
202 iso_pu_bacteria 2939642701 2939643363 313
203 iso_pu_bacteria 2945874760 2945878552 313
204 iso_pu_bacteria 2969079654 2969081511 313
205 iso_pu_bacteria 2971820967 2971822952 313
206 iso_pu_bacteria 2974310843 2974311488 313
207 iso_pu_bacteria 2974435778 2974438891 313
208 iso_pu_bacteria 2984559226 2984563926 313
209 iso_pu_bacteria 2984595703 2984596659 313
210 iso_pu_bacteria 2989392574 2989393300 313
211 iso_pu_bacteria 3000376612 3000379483 313
212 iso_pu_bacteria 640753048 640938328 313
213 iso_pu_bacteria 8004592986 8004596975 313
214 iso_pu_bacteria 8015394850 8015395568 313
215 iso_pu_bacteria 8018221730 8018222693 313
216 iso_pu_bacteria 8018405270 8018409696 313
217 iso_pu_bacteria 8019504834 8019505550 313
218 iso_pu_bacteria 8054357960 8054359966 313
219 iso_pu_bacteria 8054844752 8054848991 313
220 iso_pu_bacteria 8054849141 8054849250 313
221 iso_pu_bacteria 8055087960 8055090417 313
222 iso_pu_bacteria 8055092621 8055095129 313
223 iso_pu_bacteria 8055097453 8055098571 313
224 iso_pu_bacteria 8055693939 8055695853 313
225 iso_pu_bacteria 8057304971 8057307152 313
226 iso_pu_bacteria 2511231004 2511256631 314
227 iso_pu_bacteria 2511231006 2511267516 314
228 iso_pu_bacteria 2511231007 2511273451 314
229 iso_pu_bacteria 2511231008 2511276460 314
230 iso_pu_bacteria 2511231010 2511291120 314
231 iso_pu_bacteria 2511231011 2511295742 314
232 iso_pu_bacteria 2511231012 2511300117 314
233 iso_pu_bacteria 2511231014 2511313457 314
234 iso_pu_bacteria 2511231015 2511317326 314
235 iso_pu_bacteria 2511231016 2511329195 314
236 iso_pu_bacteria 2511231017 2511330768 314
237 iso_pu_bacteria 2511231018 2511336586 314
238 iso_pu_bacteria 2511231019 2511346079 314
239 iso_pu_bacteria 2511231020 2511352532 314
240 iso_pu_bacteria 2511231021 2511355778 314
241 iso_pu_bacteria 2511231022 2511362537 314
242 iso_pu_bacteria 2511231023 2511369591 314
243 iso_pu_bacteria 2511231024 2511375557 314
244 iso_pu_bacteria 2511231031 2511414837 314
245 iso_pu_bacteria 2511231156 2511823037 314
246 iso_pu_bacteria 2512047018 2512324260 314
247 iso_pu_bacteria 2554235231 2555244603 314
248 iso_pu_bacteria 2554235341 2555671854 314
249 iso_pu_bacteria 2582580891 2583794348 314
250 iso_pu_bacteria 2597489887 2597859939 314
251 iso_pu_bacteria 2597489888 2597862333 314
252 iso_pu_bacteria 2597489889 2597868055 314
253 iso_pu_bacteria 2599185155 2599330100 314
254 iso_pu_bacteria 2599185160 2599353991 314
255 iso_pu_bacteria 2599185161 2599360330 314
256 iso_pu_bacteria 2599185162 2599366652 314
257 iso_pu_bacteria 2599185163 2599373441 314
258 iso_pu_bacteria 2599185164 2599379099 314
259 iso_pu_bacteria 2599185165 2599385923 314
260 iso_pu_bacteria 2599185166 2599392300 314
261 iso_pu_bacteria 2599185167 2599397061 314
262 iso_pu_bacteria 2599185168 2599404066 314
263 iso_pu_bacteria 2599185179 2599449054 314
264 iso_pu_bacteria 2599185181 2599460825 314
265 iso_pu_bacteria 2599185182 2599470372 314
266 iso_pu_bacteria 2599185185 2599482767 314
267 iso_pu_bacteria 2599185186 2599489846 314
268 iso_pu_bacteria 2599185188 2599501143 314
269 iso_pu_bacteria 2599185189 2599508828 314
270 iso_pu_bacteria 2599185190 2599511202 314
271 iso_pu_bacteria 2599185191 2599519307 314
272 iso_pu_bacteria 2599185212 2599613896 314
273 iso_pu_bacteria 2599185248 2599770786 314
274 iso_pu_bacteria 2599185257 2599803507 314
275 iso_pu_bacteria 2599185288 2599879649 314
276 iso_pu_bacteria 2599185289 2599886665 314
277 iso_pu_bacteria 2599185290 2599890576 314
278 iso_pu_bacteria 2599185291 2599897035 314
279 iso_pu_bacteria 2599185300 2599934698 314
280 iso_pu_bacteria 2599185302 2599943035 314
281 iso_pu_bacteria 2599185303 2599948148 314
282 iso_pu_bacteria 2599185304 2599953926 314
283 iso_pu_bacteria 2599185305 2599959435 314
284 iso_pu_bacteria 2599185306 2599968043 314
285 iso_pu_bacteria 2599185307 2599974111 314
286 iso_pu_bacteria 2599185308 2599979234 314
287 iso_pu_bacteria 2599185309 2599985331 314
288 iso_pu_bacteria 2599185310 2599987255 314
289 iso_pu_bacteria 2599185311 2599995434 314
290 iso_pu_bacteria 2599185312 2599999916 314
291 iso_pu_bacteria 2599185313 2600008825 314
292 iso_pu_bacteria 2599185314 2600013119 314
293 iso_pu_bacteria 2599185315 2600016630 314
294 iso_pu_bacteria 2599185316 2600025348 314
295 iso_pu_bacteria 2599185317 2600029596 314
296 iso_pu_bacteria 2599185318 2600035512 314
297 iso_pu_bacteria 2599185319 2600041360 314
298 iso_pu_bacteria 2599185320 2600045582 314
299 iso_pu_bacteria 2599185321 2600056600 314
300 iso_pu_bacteria 2599185322 2600058490 314
301 iso_pu_bacteria 2599185323 2600063841 314
302 iso_pu_bacteria 2599185324 2600074165 314
303 iso_pu_bacteria 2599185325 2600079807 314
304 iso_pu_bacteria 2599185356 2600213440 314
305 iso_pu_bacteria 2600254930 2600358274 314
306 iso_pu_bacteria 2600254931 2600365210 314
307 iso_pu_bacteria 2600255283 2601625730 314
308 iso_pu_bacteria 2600255296 2601690918 314
309 iso_pu_bacteria 2600255313 2601773607 314
310 iso_pu_bacteria 2600255318 2601799803 314
311 iso_pu_bacteria 2603880185 2606074011 314
312 iso_pu_bacteria 2603880199 2606126344 314
313 iso_pu_bacteria 2619619299 2621301542 314
314 iso_pu_bacteria 2623620443 2624482554 314
315 iso_pu_bacteria 2623620446 2624494076 314
316 iso_pu_bacteria 2643221565 2643844267 314
317 iso_pu_bacteria 2643221571 2643868896 314
318 iso_pu_bacteria 2643221589 2643952282 314
319 iso_pu_bacteria 2643221602 2644023956 314
320 iso_pu_bacteria 2643221633 2644188047 314
321 iso_pu_bacteria 2643221650 2644281582 314
322 iso_pu_bacteria 2643221713 2644624009 314
323 iso_pu_bacteria 2651869719 2652548335 314
324 iso_pu_bacteria 2667528170 2671094467 314
325 iso_pu_bacteria 2667528171 2671096573 314
326 iso_pu_bacteria 2667528176 2671127919 314
327 iso_pu_bacteria 2671180172 2671770925 314
328 iso_pu_bacteria 2675903420 2677898170 314
329 iso_pu_bacteria 2675903515 2678261568 314
330 iso_pu_bacteria 2713897148 2715752120 314
331 iso_pu_bacteria 2713897149 2715755048 314
332 iso_pu_bacteria 2718217725 2718635756 314
333 iso_pu_bacteria 2721755607 2723247224 314
334 iso_pu_bacteria 2738541265 2738673762 314
335 iso_pu_bacteria 2738541271 2738691548 314
336 iso_pu_bacteria 2738541282 2738752155 314
337 iso_pu_bacteria 2738541294 2738809107 314
338 iso_pu_bacteria 2738541303 2738861196 314
339 iso_pu_bacteria 2738541309 2738896467 314
340 iso_pu_bacteria 2738543004 2739198383 314
341 iso_pu_bacteria 2738543015 2739256848 314
342 iso_pu_bacteria 2738543016 2739267323 314
343 iso_pu_bacteria 2738543020 2739286200 314
344 iso_pu_bacteria 2738543021 2739291513 314
345 iso_pu_bacteria 2738543025 2739315546 314
346 iso_pu_bacteria 2740892503 2743739481 314
347 iso_pu_bacteria 2744054620 2745007917 314
348 iso_pu_bacteria 2765235841 2765585687 314
349 iso_pu_bacteria 2773857670 2774120624 314
350 iso_pu_bacteria 2773857673 2774133435 314
351 iso_pu_bacteria 2784132063 2784262683 314
352 iso_pu_bacteria 2784132072 2784313541 314
353 iso_pu_bacteria 2791355520 2794594365 314
354 iso_pu_bacteria 2806310737 2807406927 314
355 iso_pu_bacteria 2806310745 2807455259 314
356 iso_pu_bacteria 2808606361 2808854089 314
357 iso_pu_bacteria 2808606376 2808923380 314
358 iso_pu_bacteria 2808606377 2808930392 314
359 iso_pu_bacteria 2808606378 2808934121 314
360 iso_pu_bacteria 2808606380 2808945345 314
361 iso_pu_bacteria 2808606381 2808952514 314
362 iso_pu_bacteria 2808606382 2808956685 314
363 iso_pu_bacteria 2808606383 2808962478 314
364 iso_pu_bacteria 2808606385 2808975247 314
365 iso_pu_bacteria 2808606388 2808991114 314
366 iso_pu_bacteria 2808606389 2808997481 314
367 iso_pu_bacteria 2808606445 2809218433 314
368 iso_pu_bacteria 2816332298 2817489104 314
369 iso_pu_bacteria 2818991456 2819656241 314
370 iso_pu_bacteria 2818991464 2819701666 314
371 iso_pu_bacteria 2825651385 2825653709 314
372 iso_pu_bacteria 2826581358 2826585739 314
373 iso_pu_bacteria 2834028612 2834029007 314
374 iso_pu_bacteria 2842805378 2842805629 314
375 iso_pu_bacteria 2842815866 2842818609 314
376 iso_pu_bacteria 2842826826 2842828724 314
377 iso_pu_bacteria 2842832357 2842837400 314
378 iso_pu_bacteria 2842837860 2842843212 314
379 iso_pu_bacteria 2842843487 2842845195 314
380 iso_pu_bacteria 2842849001 2842853831 314
381 iso_pu_bacteria 2842854478 2842857262 314
382 iso_pu_bacteria 2844665904 2844666019 314
383 iso_pu_bacteria 2852612431 2852615508 314
384 iso_pu_bacteria 2852657418 2852660705 314
385 iso_pu_bacteria 2852667396 2852670476 314
386 iso_pu_bacteria 2860339153 2860344393 314
387 iso_pu_bacteria 2860867994 2860869036 314
388 iso_pu_bacteria 2878029506 2878034486 314
389 iso_pu_bacteria 2880230671 2880235128 314
390 iso_pu_bacteria 2904518522 2904521496 314
391 iso_pu_bacteria 2904550169 2904551130 314
392 iso_pu_bacteria 2908446538 2908447829 314
393 iso_pu_bacteria 2912963787 2912967948 314
394 iso_pu_bacteria 2913036834 2913037909 314
395 iso_pu_bacteria 2917070673 2917075724 314
396 iso_pu_bacteria 2919063839 2919066455 314
397 iso_pu_bacteria 2919155634 2919159286 314
398 iso_pu_bacteria 2919385768 2919388553 314
399 iso_pu_bacteria 2919456309 2919459523 314
400 iso_pu_bacteria 2919481497 2919482816 314
401 iso_pu_bacteria 2919487758 2919490125 314
402 iso_pu_bacteria 2919697872 2919700005 314
403 iso_pu_bacteria 2923153595 2923158566 314
404 iso_pu_bacteria 2923586266 2923591779 314
405 iso_pu_bacteria 2929144301 2929145360 314
406 iso_pu_bacteria 2929189879 2929191033 314
407 iso_pu_bacteria 2931369376 2931371299 314
408 iso_pu_bacteria 2931390751 2931392038 314
409 iso_pu_bacteria 2931396565 2931397170 314
410 iso_pu_bacteria 2935353572 2935356714 314
411 iso_pu_bacteria 2939636861 2939638100 314
412 iso_pu_bacteria 2939651529 2939652377 314
413 iso_pu_bacteria 2945928738 2945929547 314
414 iso_pu_bacteria 2945961074 2945961264 314
415 iso_pu_bacteria 2946006987 2946011826 314
416 iso_pu_bacteria 2946027586 2946029282 314
417 iso_pu_bacteria 2947233263 2947235830 314
418 iso_pu_bacteria 2969304461 2969309269 314
419 iso_pu_bacteria 2974289157 2974289371 314
420 iso_pu_bacteria 2984286254 2984287604 314
421 iso_pu_bacteria 2988728565 2988732905 314
422 iso_pu_bacteria 2990196909 2990198317 314
423 iso_pu_bacteria 2998139840 2998144537 314
424 iso_pu_bacteria 3007419365 3007424925 314
425 iso_pu_bacteria 3007511990 3007512420 314
426 iso_pu_bacteria 3007614139 3007618453 314
427 iso_pu_bacteria 3007619802 3007624352 314
428 iso_pu_bacteria 3007718800 3007719451 314
429 iso_pu_bacteria 3007803356 3007808406 314
430 iso_pu_bacteria 3007855910 3007858479 314
431 iso_pu_bacteria 3007861166 3007866000 314
432 iso_pu_bacteria 3007866637 3007871260 314
433 iso_pu_bacteria 3007872151 3007875433 314
434 iso_pu_bacteria 637000220 637322262 314
435 iso_pu_bacteria 8015687852 8015692650 314
436 iso_pu_bacteria 8019769354 8019771633 314
437 iso_pu_bacteria 8019775933 8019776672 314
438 iso_pu_bacteria 8029995093 8029996342 314
439 iso_pu_bacteria 8052494512 8052495674 314
440 iso_pu_bacteria 8054285046 8054286233 314
441 iso_pu_bacteria 8054347763 8054352550 314
442 iso_pu_bacteria 8054503363 8054504617 314
443 iso_pu_bacteria 8054929484 8054933243 314
444 iso_pu_bacteria 8055770955 8055775884 314
445 iso_pu_bacteria 8055817908 8055819058 314
446 iso_pu_bacteria 8055878733 8055884073 314
447 iso_pu_bacteria 8056115690 8056117443 314
448 iso_pu_bacteria 8056120720 8056124771 314
449 iso_pu_bacteria 8056125926 8056127110 314
450 iso_pu_bacteria 8056131705 8056132927 314
451 iso_pu_bacteria 8056137416 8056138581 314
452 iso_pu_bacteria 8056143049 8056147919 314
453 iso_pu_bacteria 8056148874 8056149143 314
454 iso_pu_bacteria 8056155041 8056155525 314
455 iso_pu_bacteria 8056161164 8056161198 314
456 iso_pu_bacteria 8056166840 8056172035 314
457 iso_pu_bacteria 8056172158 8056172696 314
458 iso_pu_bacteria 8056177738 8056180548 314
459 iso_pu_bacteria 8056569372 8056574535 314
460 iso_pu_bacteria 8057160832 8057163013 314
461 iso_pu_bacteria 8057798959 8057804738 314
462 3300003856 Ga0058692_1012199 Ga0058692_10121992 315
463 3300013307 Ga0157372_10008169 Ga0157372_1000816912 315
464 3300027312 Ga0209371_1002408 Ga0209371_10024082 315
465 3300030500 Ga0268256_1001327 Ga0268256_10013276 315
466 3300036712 Ga0316584_0125882 Ga0316584_0125882_664_1635 315
467 3300041405 Ga0439438_019352 Ga0439438_019352_600_1565 315
468 3300046458 Ga0495591_000318 Ga0495591_000318_21261_22229 315
469 3300046471 Ga0495650_0000026 Ga0495650_0000026_442602_443570 315
470 3300046491 Ga0495584_0058183 Ga0495584_0058183_75_1043 315
471 3300046507 Ga0495606_0004769 Ga0495606_0004769_9136_10104 315
472 3300046523 Ga0495644_0105733 Ga0495644_0105733_50_1018 315
473 3300046524 Ga0495648_0002708 Ga0495648_0002708_4643_5611 315
474 3300046530 Ga0495654_0000069 Ga0495654_0000069_69506_70474 315
475 3300046692 Ga0495671_0053917 Ga0495671_0053917_188_1156 315
476 3300046794 Ga0495589_0002276 Ga0495589_0002276_4041_5009 315
477 3300046810 Ga0495660_0000016 Ga0495660_0000016_257259_258227 315
478 3300047320 Ga0495672_0000001 Ga0495672_0000001_487279_488247 315
479 3300047323 Ga0495683_0014602 Ga0495683_0014602_2930_3898 315
480 3300047323 Ga0495683_0057536 Ga0495683_0057536_782_1750 315
481 3300047469 Ga0495673_0000358 Ga0495673_0000358_8136_9104 315
482 3300048919 Ga0496116_0000086 Ga0496116_0000086_26397_27362 315
483 3300048922 Ga0496119_0000018 Ga0496119_0000018_281835_282800 315
484 3300048922 Ga0496119_0006919 Ga0496119_0006919_4282_5247 315
485 3300048923 Ga0496120_0000002 Ga0496120_0000002_53376_54341 315
486 3300048923 Ga0496120_0000917 Ga0496120_0000917_25151_26116 315
487 3300049459 Ga0495678_000091 Ga0495678_000091_67583_68551 315
488 3300049460 Ga0495682_0000001 Ga0495682_0000001_612280_613248 315
489 3300053126 Ga0500621_000002 Ga0500621_000002_618997_619965 315
490 iso_pu_bacteria 2510065053 2510280852 315
491 iso_pu_bacteria 2510065055 2510295018 315
492 iso_pu_bacteria 2510065058 2510308999 315
493 iso_pu_bacteria 2728369097 2729145893 315
494 iso_pu_bacteria 2773857672 2774132199 315
495 iso_pu_bacteria 2917832318 2917835153 315
496 iso_pu_bacteria 2919125081 2919130048 315
497 iso_pu_bacteria 2984499530 2984503709 315
498 iso_pu_bacteria 2984504281 2984507711 315
499 iso_pu_bacteria 651053060 651175070 315
500 iso_pu_bacteria 8016728285 8016730144 315
501 3300002737 JGI25162J39368_1002438 JGI25162J39368_10024385 316
502 3300003856 Ga0058692_1000085 Ga0058692_100008551 316
503 3300003856 Ga0058692_1000167 Ga0058692_100016733 316
504 3300003856 Ga0058692_1000364 Ga0058692_10003645 316
505 3300003856 Ga0058692_1000797 Ga0058692_100079714 316
506 3300003856 Ga0058692_1001265 Ga0058692_10012659 316
507 3300003856 Ga0058692_1003493 Ga0058692_10034932 316
508 3300003856 Ga0058692_1015467 Ga0058692_10154671 316
509 3300003856 Ga0058692_1027113 Ga0058692_10271131 316
510 3300005347 Ga0070668_100051975 Ga0070668_1000519753 316
511 3300006946 Ga0079104_1000225 Ga0079104_100022533 316
512 3300009011 Ga0105251_10004557 Ga0105251_100045575 316
513 3300009011 Ga0105251_10143841 Ga0105251_101438412 316
514 3300009036 Ga0105244_10000020 Ga0105244_10000020164 316
515 3300009036 Ga0105244_10000761 Ga0105244_1000076120 316
516 3300009036 Ga0105244_10001402 Ga0105244_1000140217 316
517 3300009092 Ga0105250_10000119 Ga0105250_1000011924 316
518 3300009092 Ga0105250_10029050 Ga0105250_100290503 316
519 3300009092 Ga0105250_10042759 Ga0105250_100427592 316
520 3300009148 Ga0105243_10133956 Ga0105243_101339562 316
521 3300011119 Ga0105246_10107601 Ga0105246_101076013 316
522 3300013100 Ga0157373_10000137 Ga0157373_1000013737 316
523 3300013102 Ga0157371_10000810 Ga0157371_1000081024 316
524 3300013102 Ga0157371_10001729 Ga0157371_100017297 316
525 3300013104 Ga0157370_10000301 Ga0157370_1000030135 316
526 3300013105 Ga0157369_10032725 Ga0157369_100327252 316
527 3300013306 Ga0163162_10460463 Ga0163162_104604631 316
528 3300013307 Ga0157372_10045132 Ga0157372_100451322 316
529 3300013307 Ga0157372_10199055 Ga0157372_101990552 316
530 3300015261 Ga0182006_1023063 Ga0182006_10230632 316
531 3300025233 Ga0209437_100155 Ga0209437_10015538 316
532 3300025711 Ga0207696_1000062 Ga0207696_100006269 316
533 3300025711 Ga0207696_1000216 Ga0207696_100021626 316
534 3300025728 Ga0207655_1000004 Ga0207655_1000004618 316
535 3300025728 Ga0207655_1000007 Ga0207655_1000007186 316
536 3300025728 Ga0207655_1085168 Ga0207655_10851682 316
537 3300025728 Ga0207655_1088434 Ga0207655_10884341 316
538 3300025735 Ga0207713_1000001 Ga0207713_10000011437 316
539 3300025735 Ga0207713_1066113 Ga0207713_10661131 316
540 3300027111 Ga0209281_1000001 Ga0209281_1000001254 316
541 3300027312 Ga0209371_1000005 Ga0209371_1000005526 316
542 3300027312 Ga0209371_1000039 Ga0209371_1000039308 316
543 3300027312 Ga0209371_1000199 Ga0209371_100019966 316
544 3300027312 Ga0209371_1000205 Ga0209371_10002056 316
545 3300027312 Ga0209371_1001746 Ga0209371_10017465 316
546 3300027312 Ga0209371_1002164 Ga0209371_10021649 316
547 3300027312 Ga0209371_1002488 Ga0209371_10024889 316
548 3300027312 Ga0209371_1008280 Ga0209371_10082802 316
549 3300030500 Ga0268256_1000006 Ga0268256_1000006531 316
550 3300030500 Ga0268256_1000033 Ga0268256_100003354 316
551 3300030500 Ga0268256_1000098 Ga0268256_100009823 316
552 3300030500 Ga0268256_1000618 Ga0268256_100061813 316
553 3300030500 Ga0268256_1001521 Ga0268256_100152112 316
554 3300030500 Ga0268256_1005544 Ga0268256_10055443 316
555 3300039110 Ga0400487_15044 Ga0400487_15044_389_1348 316
556 3300041405 Ga0439438_000001 Ga0439438_000001_1189170_1190138 316
557 3300041407 Ga0439447_009543 Ga0439447_009543_1217_2185 316
558 3300041407 Ga0439447_013754 Ga0439447_013754_223_1191 316
559 3300041411 Ga0439466_0000013 Ga0439466_0000013_42950_43918 316
560 3300042006 Ga0439432_001755 Ga0439432_001755_2584_3552 316
561 3300042006 Ga0439432_005501 Ga0439432_005501_3146_4114 316
562 3300042010 Ga0439452_000001 Ga0439452_000001_1252298_1253266 316
563 3300042146 Ga0450907_001025 Ga0450907_001025_5186_6154 316
564 3300046458 Ga0495591_000007 Ga0495591_000007_318349_319317 316
565 3300046500 Ga0495596_0010866 Ga0495596_0010866_882_1850 316
566 3300046522 Ga0495643_0084132 Ga0495643_0084132_267_1235 316
567 3300046524 Ga0495648_0035683 Ga0495648_0035683_1542_2510 316
568 3300046530 Ga0495654_0000007 Ga0495654_0000007_355485_356453 316
569 3300046616 Ga0495668_0025217 Ga0495668_0025217_1745_2713 316
570 3300046810 Ga0495660_0022208 Ga0495660_0022208_2030_2998 316
571 3300047320 Ga0495672_0000015 Ga0495672_0000015_192398_193366 316
572 3300047446 Ga0495679_005588 Ga0495679_005588_386_1354 316
573 3300048903 Ga0496100_0014748 Ga0496100_0014748_2831_3799 316
574 3300048904 Ga0496101_0000093 Ga0496101_0000093_58479_59447 316
575 3300048905 Ga0496102_0006258 Ga0496102_0006258_3669_4637 316
576 3300048908 Ga0496105_0004370 Ga0496105_0004370_6676_7644 316
577 3300048919 Ga0496116_0000163 Ga0496116_0000163_60863_61831 316
578 3300048919 Ga0496116_0005711 Ga0496116_0005711_7431_8399 316
579 3300048920 Ga0496117_0000009 Ga0496117_0000009_26643_27611 316
580 3300048920 Ga0496117_0000058 Ga0496117_0000058_71961_72929 316
581 3300048920 Ga0496117_0000378 Ga0496117_0000378_6869_7837 316
582 3300048921 Ga0496118_0000007 Ga0496118_0000007_613188_614156 316
583 3300048921 Ga0496118_0000199 Ga0496118_0000199_62974_63942 316
584 3300048921 Ga0496118_0006442 Ga0496118_0006442_8692_9660 316
585 3300048922 Ga0496119_0000106 Ga0496119_0000106_66468_67436 316
586 3300048922 Ga0496119_0000111 Ga0496119_0000111_40303_41271 316
587 3300048922 Ga0496119_0007156 Ga0496119_0007156_1766_2734 316
588 3300048923 Ga0496120_0000116 Ga0496120_0000116_72859_73827 316
589 3300048923 Ga0496120_0000152 Ga0496120_0000152_40303_41271 316
590 3300048923 Ga0496120_0000921 Ga0496120_0000921_351_1319 316
591 3300048923 Ga0496120_0046921 Ga0496120_0046921_848_1816 316
592 3300048924 Ga0496121_0000544 Ga0496121_0000544_48078_49046 316
593 3300048925 Ga0496122_0003261 Ga0496122_0003261_8152_9120 316
594 3300048925 Ga0496122_0003412 Ga0496122_0003412_6890_7858 316
595 3300048925 Ga0496122_0046369 Ga0496122_0046369_1842_2810 316
596 3300048926 Ga0496123_0002536 Ga0496123_0002536_14505_15473 316
597 3300048926 Ga0496123_0003243 Ga0496123_0003243_8789_9757 316
598 3300048927 Ga0496124_0000357 Ga0496124_0000357_39580_40548 316
599 3300048927 Ga0496124_0005891 Ga0496124_0005891_3848_4816 316
600 3300048927 Ga0496124_0006121 Ga0496124_0006121_519_1487 316
601 3300048927 Ga0496124_0011885 Ga0496124_0011885_4134_5102 316
602 3300048927 Ga0496124_0041187 Ga0496124_0041187_1198_2166 316
603 3300048927 Ga0496124_0085811 Ga0496124_0085811_1563_2531 316
604 3300048927 Ga0496124_0205723 Ga0496124_0205723_156_1124 316
605 3300048928 Ga0496125_0000065 Ga0496125_0000065_239362_240330 316
606 3300048928 Ga0496125_0020974 Ga0496125_0020974_2018_2986 316
607 3300048929 Ga0496126_0051784 Ga0496126_0051784_924_1892 316
608 3300048929 Ga0496126_0172684 Ga0496126_0172684_184_1152 316
609 3300048929 Ga0496126_0287497 Ga0496126_0287497_231_1199 316
610 3300050491 nmdc:mga00v17_228261_c1 nmdc:mga00v17_228261_c1_169_1137 316
611 iso_pu_bacteria 2687453129 2687578174 316
612 iso_pu_bacteria 3007395558 3007398192 316
613 3300002737 JGI25162J39368_1000019 JGI25162J39368_1000019223 317
614 3300002771 JGI25163J39215_1000079 JGI25163J39215_100007920 317
615 3300002772 JGI25164J39214_1000011 JGI25164J39214_100001151 317
616 3300002773 JGI25152J39213_1000482 JGI25152J39213_100048211 317
617 3300003320 rootH2_10011341 rootH2_100113416 317
618 3300003751 Ga0055538_1000021 Ga0055538_100002151 317
619 3300003752 Ga0055539_1000026 Ga0055539_1000026223 317
620 3300003756 Ga0055533_1000035 Ga0055533_100003551 317
621 3300003759 Ga0055525_1000045 Ga0055525_100004551 317
622 3300003841 Ga0055541_1000020 Ga0055541_100002051 317
623 3300003856 Ga0058692_1014733 Ga0058692_10147331 317
624 3300003856 Ga0058692_1014891 Ga0058692_10148911 317
625 3300005272 Ga0065703_1019293 Ga0065703_10192933 317
626 3300005288 Ga0065714_10096328 Ga0065714_100963282 317
627 3300005289 Ga0065704_10000318 Ga0065704_1000031811 317
628 3300005289 Ga0065704_10002406 Ga0065704_100024067 317
629 3300005289 Ga0065704_10084486 Ga0065704_100844862 317
630 3300005289 Ga0065704_10091125 Ga0065704_100911252 317
631 3300005289 Ga0065704_10096731 Ga0065704_100967312 317
632 3300005366 Ga0070659_100076066 Ga0070659_1000760663 317
633 3300005548 Ga0070665_100000356 Ga0070665_1000003564 317
634 3300005577 Ga0068857_100001074 Ga0068857_10000107412 317
635 3300005834 Ga0068851_10036752 Ga0068851_100367522 317
636 3300006051 Ga0075364_10002374 Ga0075364_100023748 317
637 3300006051 Ga0075364_10028598 Ga0075364_100285982 317
638 3300006946 Ga0079104_1000047 Ga0079104_1000047102 317
639 3300006946 Ga0079104_1000060 Ga0079104_100006027 317
640 3300006946 Ga0079104_1000475 Ga0079104_100047517 317
641 3300006946 Ga0079104_1001084 Ga0079104_10010842 317
642 3300006946 Ga0079104_1002173 Ga0079104_10021736 317
643 3300006946 Ga0079104_1003218 Ga0079104_10032185 317
644 3300006946 Ga0079104_1008699 Ga0079104_10086995 317
645 3300006946 Ga0079104_1012111 Ga0079104_10121112 317
646 3300006946 Ga0079104_1018323 Ga0079104_10183231 317
647 3300006946 Ga0079104_1018332 Ga0079104_10183322 317
648 3300009011 Ga0105251_10000226 Ga0105251_1000022634 317
649 3300009011 Ga0105251_10000648 Ga0105251_1000064830 317
650 3300009011 Ga0105251_10000740 Ga0105251_100007408 317
651 3300009011 Ga0105251_10002574 Ga0105251_1000257414 317
652 3300009011 Ga0105251_10003382 Ga0105251_100033826 317
653 3300009011 Ga0105251_10007670 Ga0105251_100076705 317
654 3300009011 Ga0105251_10053066 Ga0105251_100530662 317
655 3300009036 Ga0105244_10000047 Ga0105244_1000004732 317
656 3300009036 Ga0105244_10000141 Ga0105244_1000014166 317
657 3300009036 Ga0105244_10000223 Ga0105244_100002232 317
658 3300009036 Ga0105244_10001660 Ga0105244_1000166018 317
659 3300009036 Ga0105244_10011040 Ga0105244_100110403 317
660 3300009036 Ga0105244_10021675 Ga0105244_100216753 317
661 3300009036 Ga0105244_10025019 Ga0105244_100250193 317
662 3300009036 Ga0105244_10130274 Ga0105244_101302741 317
663 3300009092 Ga0105250_10000001 Ga0105250_10000001202 317
664 3300009092 Ga0105250_10000016 Ga0105250_1000001654 317
665 3300009092 Ga0105250_10000847 Ga0105250_1000084712 317
666 3300009092 Ga0105250_10002820 Ga0105250_100028205 317
667 3300009092 Ga0105250_10012686 Ga0105250_100126862 317
668 3300009092 Ga0105250_10018277 Ga0105250_100182771 317
669 3300009101 Ga0105247_10000012 Ga0105247_10000012149 317
670 3300009174 Ga0105241_10000001 Ga0105241_10000001163 317
671 3300009176 Ga0105242_10422557 Ga0105242_104225571 317
672 3300013100 Ga0157373_10000779 Ga0157373_1000077910 317
673 3300013100 Ga0157373_10017667 Ga0157373_100176673 317
674 3300013102 Ga0157371_10000098 Ga0157371_1000009861 317
675 3300013102 Ga0157371_10032848 Ga0157371_100328482 317
676 3300013104 Ga0157370_10000075 Ga0157370_1000007595 317
677 3300013104 Ga0157370_10018571 Ga0157370_100185716 317
678 3300013105 Ga0157369_10006243 Ga0157369_1000624315 317
679 3300013306 Ga0163162_10006068 Ga0163162_1000606811 317
680 3300013307 Ga0157372_10102711 Ga0157372_101027112 317
681 3300014497 Ga0182008_10024098 Ga0182008_100240983 317
682 3300015261 Ga0182006_1000087 Ga0182006_100008766 317
683 3300015679 Ga0183366_1001 Ga0183366_10011994 317
684 3300015680 Ga0183370_1001 Ga0183370_10011994 317
685 3300015685 Ga0183369_1001 Ga0183369_10011994 317
686 3300015687 Ga0183368_1001 Ga0183368_10011994 317
687 3300017792 Ga0163161_10000001 Ga0163161_100000011623 317
688 3300021384 Ga0213876_10000016 Ga0213876_10000016129 317
689 3300025207 Ga0209760_100004 Ga0209760_10000451 317
690 3300025224 Ga0209784_100001 Ga0209784_1000012538 317
691 3300025225 Ga0209566_100001 Ga0209566_1000012538 317
692 3300025226 Ga0209674_100002 Ga0209674_1000022538 317
693 3300025230 Ga0209563_100002 Ga0209563_1000021073 317
694 3300025231 Ga0207427_100012 Ga0207427_100012278 317
695 3300025233 Ga0209437_100001 Ga0209437_1000011073 317
696 3300025253 Ga0209677_100002 Ga0209677_1000021073 317
697 3300025258 Ga0209129_1000004 Ga0209129_1000004772 317
698 3300025261 Ga0209233_1001376 Ga0209233_10013764 317
699 3300025711 Ga0207696_1000001 Ga0207696_10000011704 317
700 3300025711 Ga0207696_1000015 Ga0207696_1000015379 317
701 3300025711 Ga0207696_1000030 Ga0207696_1000030129 317
702 3300025711 Ga0207696_1000298 Ga0207696_100029828 317
703 3300025711 Ga0207696_1002483 Ga0207696_10024836 317
704 3300025711 Ga0207696_1005451 Ga0207696_10054512 317
705 3300025711 Ga0207696_1023696 Ga0207696_10236962 317
706 3300025728 Ga0207655_1000001 Ga0207655_10000011824 317
707 3300025728 Ga0207655_1000002 Ga0207655_1000002635 317
708 3300025728 Ga0207655_1000110 Ga0207655_100011017 317
709 3300025728 Ga0207655_1000229 Ga0207655_100022931 317
710 3300025728 Ga0207655_1000296 Ga0207655_100029665 317
711 3300025728 Ga0207655_1000886 Ga0207655_100088616 317
712 3300025728 Ga0207655_1019444 Ga0207655_10194442 317
713 3300025735 Ga0207713_1000004 Ga0207713_1000004269 317
714 3300025735 Ga0207713_1000015 Ga0207713_1000015242 317
715 3300025735 Ga0207713_1000027 Ga0207713_100002797 317
716 3300025735 Ga0207713_1000088 Ga0207713_1000088129 317
717 3300025735 Ga0207713_1000753 Ga0207713_100075327 317
718 3300025735 Ga0207713_1001329 Ga0207713_100132917 317
719 3300025735 Ga0207713_1009534 Ga0207713_10095341 317
720 3300025735 Ga0207713_1046323 Ga0207713_10463232 317
721 3300025900 Ga0207710_10000083 Ga0207710_1000008362 317
722 3300025911 Ga0207654_10000004 Ga0207654_10000004191 317
723 3300025935 Ga0207709_10037052 Ga0207709_100370524 317
724 3300026116 Ga0207674_10027056 Ga0207674_100270565 317
725 3300027111 Ga0209281_1000003 Ga0209281_1000003804 317
726 3300027111 Ga0209281_1000004 Ga0209281_1000004595 317
727 3300027111 Ga0209281_1000006 Ga0209281_1000006356 317
728 3300027111 Ga0209281_1000012 Ga0209281_1000012547 317
729 3300027111 Ga0209281_1000064 Ga0209281_100006428 317
730 3300027111 Ga0209281_1000071 Ga0209281_1000071210 317
731 3300027111 Ga0209281_1000109 Ga0209281_100010976 317
732 3300027111 Ga0209281_1000434 Ga0209281_100043417 317
733 3300027111 Ga0209281_1001629 Ga0209281_10016296 317
734 3300027111 Ga0209281_1004912 Ga0209281_10049122 317
735 3300027312 Ga0209371_1000001 Ga0209371_10000011982 317
736 3300027312 Ga0209371_1000002 Ga0209371_10000021048 317
737 3300027312 Ga0209371_1000052 Ga0209371_100005269 317
738 3300027312 Ga0209371_1001211 Ga0209371_100121116 317
739 3300027312 Ga0209371_1003168 Ga0209371_10031682 317
740 3300027312 Ga0209371_1004744 Ga0209371_10047446 317
741 3300027312 Ga0209371_1005029 Ga0209371_10050295 317
742 3300028379 Ga0268266_10000959 Ga0268266_1000095931 317
743 3300030500 Ga0268256_1000001 Ga0268256_1000001658 317
744 3300030500 Ga0268256_1000002 Ga0268256_1000002414 317
745 3300030500 Ga0268256_1000061 Ga0268256_100006135 317
746 3300030500 Ga0268256_1001036 Ga0268256_10010362 317
747 3300030500 Ga0268256_1001446 Ga0268256_10014468 317
748 3300030500 Ga0268256_1004683 Ga0268256_10046832 317
749 3300030500 Ga0268256_1008497 Ga0268256_10084972 317
750 3300030500 Ga0268256_1011168 Ga0268256_10111682 317
751 3300031250 Ga0265331_10047402 Ga0265331_100474023 317
752 3300039062 Ga0400483_189767 Ga0400483_189767_1533_2513 317
753 3300039437 Ga0436365_1910565 Ga0436365_1910565_341296_342267 317
754 3300041405 Ga0439438_003266 Ga0439438_003266_3178_4149 317
755 3300042006 Ga0439432_008354 Ga0439432_008354_1442_2413 317
756 3300042010 Ga0439452_000002 Ga0439452_000002_662838_663809 317
757 3300042010 Ga0439452_000022 Ga0439452_000022_121471_122442 317
758 3300042010 Ga0439452_000066 Ga0439452_000066_52646_53617 317
759 3300042010 Ga0439452_000101 Ga0439452_000101_3310_4281 317
760 3300042010 Ga0439452_016819 Ga0439452_016819_87_1058 317
761 3300042439 Ga0439464_0013200 Ga0439464_0013200_527_1498 317
762 3300042532 Ga0450893_0003075 Ga0450893_0003075_212_1183 317
763 3300042876 Ga0451577_0000105 Ga0451577_0000105_182306_183277 317
764 3300042876 Ga0451577_0035200 Ga0451577_0035200_1284_2255 317
765 3300044669 Ga0466981_0000008 Ga0466981_0000008_3317_4288 317
766 3300044673 Ga0453683_0000034 Ga0453683_0000034_155380_156351 317
767 3300044673 Ga0453683_0000152 Ga0453683_0000152_9212_10183 317
768 3300044673 Ga0453683_0002320 Ga0453683_0002320_9947_10918 317
769 3300044673 Ga0453683_0010577 Ga0453683_0010577_1967_2938 317
770 3300044673 Ga0453683_0034708 Ga0453683_0034708_1427_2404 317
771 3300044673 Ga0453683_0158873 Ga0453683_0158873_297_1268 317
772 3300044712 Ga0453684_0000231 Ga0453684_0000231_17256_18227 317
773 3300044712 Ga0453684_0000713 Ga0453684_0000713_114927_115898 317
774 3300044712 Ga0453684_0002182 Ga0453684_0002182_2313_3284 317
775 3300044712 Ga0453684_0012933 Ga0453684_0012933_2445_3416 317
776 3300044712 Ga0453684_0023203 Ga0453684_0023203_5472_6449 317
777 3300044712 Ga0453684_0031819 Ga0453684_0031819_2196_3167 317
778 3300044712 Ga0453684_0041565 Ga0453684_0041565_1723_2694 317
779 3300044712 Ga0453684_0108661 Ga0453684_0108661_2164_3135 317
780 3300044712 Ga0453684_0235963 Ga0453684_0235963_78_1049 317
781 3300045051 Ga0451576_0026038 Ga0451576_0026038_2328_3299 317
782 3300046453 Ga0495627_000027 Ga0495627_000027_202207_203178 317
783 3300046458 Ga0495591_004271 Ga0495591_004271_3389_4360 317
784 3300046458 Ga0495591_008529 Ga0495591_008529_951_1925 317
785 3300046460 Ga0495638_0023837 Ga0495638_0023837_2411_3385 317
786 3300046471 Ga0495650_0000182 Ga0495650_0000182_101527_102498 317
787 3300046471 Ga0495650_0000493 Ga0495650_0000493_3339_4310 317
788 3300046520 Ga0495637_0030027 Ga0495637_0030027_1281_2252 317
789 3300046530 Ga0495654_0000356 Ga0495654_0000356_31554_32525 317
790 3300046530 Ga0495654_0001554 Ga0495654_0001554_11011_11982 317
791 3300046542 Ga0495597_0000174 Ga0495597_0000174_25906_26877 317
792 3300046660 Ga0495625_0008789 Ga0495625_0008789_3321_4292 317
793 3300046674 Ga0495588_0008789 Ga0495588_0008789_1155_2126 317
794 3300046694 Ga0495649_0001408 Ga0495649_0001408_2391_3365 317
795 3300046694 Ga0495649_0006754 Ga0495649_0006754_3055_4029 317
796 3300046794 Ga0495589_0000001 Ga0495589_0000001_260843_261814 317
797 3300046810 Ga0495660_0000004 Ga0495660_0000004_825080_826051 317
798 3300047320 Ga0495672_0000076 Ga0495672_0000076_109925_110896 317
799 3300047446 Ga0495679_000005 Ga0495679_000005_363504_364475 317
800 3300047446 Ga0495679_024505 Ga0495679_024505_405_1379 317
801 3300047469 Ga0495673_0000007 Ga0495673_0000007_308756_309727 317
802 3300047470 Ga0495681_0009761 Ga0495681_0009761_4351_5322 317
803 3300048904 Ga0496101_0028513 Ga0496101_0028513_767_1738 317
804 3300048907 Ga0496104_0000328 Ga0496104_0000328_38043_39014 317
805 3300048907 Ga0496104_0002655 Ga0496104_0002655_9796_10767 317
806 3300048916 Ga0496113_0122856 Ga0496113_0122856_52_1023 317
807 3300048919 Ga0496116_0000001 Ga0496116_0000001_1138774_1139745 317
808 3300048919 Ga0496116_0000094 Ga0496116_0000094_50491_51462 317
809 3300048919 Ga0496116_0047037 Ga0496116_0047037_83_1054 317
810 3300048919 Ga0496116_0067062 Ga0496116_0067062_89_1060 317
811 3300048919 Ga0496116_0073422 Ga0496116_0073422_348_1319 317
812 3300048920 Ga0496117_0001274 Ga0496117_0001274_28319_29290 317
813 3300048920 Ga0496117_0003171 Ga0496117_0003171_2363_3334 317
814 3300048920 Ga0496117_0008528 Ga0496117_0008528_6373_7344 317
815 3300048920 Ga0496117_0012252 Ga0496117_0012252_4250_5221 317
816 3300048920 Ga0496117_0016135 Ga0496117_0016135_2170_3141 317
817 3300048920 Ga0496117_0025007 Ga0496117_0025007_1857_2828 317
818 3300048920 Ga0496117_0044858 Ga0496117_0044858_425_1396 317
819 3300048920 Ga0496117_0128128 Ga0496117_0128128_22_993 317
820 3300048921 Ga0496118_0002970 Ga0496118_0002970_17722_18693 317
821 3300048921 Ga0496118_0004470 Ga0496118_0004470_11580_12551 317
822 3300048921 Ga0496118_0006308 Ga0496118_0006308_2915_3886 317
823 3300048921 Ga0496118_0010654 Ga0496118_0010654_7052_8023 317
824 3300048921 Ga0496118_0040415 Ga0496118_0040415_192_1163 317
825 3300048921 Ga0496118_0069631 Ga0496118_0069631_1468_2439 317
826 3300048922 Ga0496119_0000001 Ga0496119_0000001_112200_113171 317
827 3300048922 Ga0496119_0001831 Ga0496119_0001831_5209_6180 317
828 3300048922 Ga0496119_0006761 Ga0496119_0006761_6723_7694 317
829 3300048922 Ga0496119_0019652 Ga0496119_0019652_832_1803 317
830 3300048922 Ga0496119_0036624 Ga0496119_0036624_62_1066 317
831 3300048922 Ga0496119_0037014 Ga0496119_0037014_150_1121 317
832 3300048922 Ga0496119_0037439 Ga0496119_0037439_644_1615 317
833 3300048923 Ga0496120_0000641 Ga0496120_0000641_10777_11748 317
834 3300048923 Ga0496120_0000940 Ga0496120_0000940_28306_29277 317
835 3300048923 Ga0496120_0002130 Ga0496120_0002130_2617_3588 317
836 3300048923 Ga0496120_0003722 Ga0496120_0003722_2798_3769 317
837 3300048923 Ga0496120_0011462 Ga0496120_0011462_2106_3110 317
838 3300048923 Ga0496120_0022189 Ga0496120_0022189_2798_3769 317
839 3300048923 Ga0496120_0029556 Ga0496120_0029556_1702_2673 317
840 3300048923 Ga0496120_0033093 Ga0496120_0033093_2071_3042 317
841 3300048924 Ga0496121_0008399 Ga0496121_0008399_10549_11520 317
842 3300048924 Ga0496121_0009768 Ga0496121_0009768_2961_3932 317
843 3300048924 Ga0496121_0013228 Ga0496121_0013228_7840_8811 317
844 3300048924 Ga0496121_0017560 Ga0496121_0017560_4290_5261 317
845 3300048924 Ga0496121_0028049 Ga0496121_0028049_1267_2238 317
846 3300048924 Ga0496121_0041289 Ga0496121_0041289_637_1608 317
847 3300048925 Ga0496122_0000003 Ga0496122_0000003_110206_111177 317
848 3300048925 Ga0496122_0000007 Ga0496122_0000007_333611_334582 317
849 3300048925 Ga0496122_0000211 Ga0496122_0000211_125813_126784 317
850 3300048925 Ga0496122_0000264 Ga0496122_0000264_28039_29010 317
851 3300048925 Ga0496122_0006802 Ga0496122_0006802_4178_5149 317
852 3300048925 Ga0496122_0020664 Ga0496122_0020664_4571_5542 317
853 3300048925 Ga0496122_0029929 Ga0496122_0029929_127_1098 317
854 3300048925 Ga0496122_0158012 Ga0496122_0158012_43_1014 317
855 3300048926 Ga0496123_0000004 Ga0496123_0000004_442648_443619 317
856 3300048926 Ga0496123_0000047 Ga0496123_0000047_109589_110560 317
857 3300048926 Ga0496123_0000215 Ga0496123_0000215_88611_89582 317
858 3300048926 Ga0496123_0000507 Ga0496123_0000507_62685_63656 317
859 3300048926 Ga0496123_0001635 Ga0496123_0001635_10819_11790 317
860 3300048926 Ga0496123_0052447 Ga0496123_0052447_192_1163 317
861 3300048927 Ga0496124_0000008 Ga0496124_0000008_467994_468965 317
862 3300048927 Ga0496124_0000025 Ga0496124_0000025_149610_150581 317
863 3300048927 Ga0496124_0002226 Ga0496124_0002226_1468_2439 317
864 3300048927 Ga0496124_0005218 Ga0496124_0005218_2463_3437 317
865 3300048927 Ga0496124_0020850 Ga0496124_0020850_2013_2984 317
866 3300048927 Ga0496124_0025858 Ga0496124_0025858_4154_5125 317
867 3300048927 Ga0496124_0103594 Ga0496124_0103594_787_1800 317
868 3300048927 Ga0496124_0105661 Ga0496124_0105661_54_1025 317
869 3300048927 Ga0496124_0120836 Ga0496124_0120836_485_1456 317
870 3300048927 Ga0496124_0185756 Ga0496124_0185756_165_1136 317
871 3300048928 Ga0496125_0000013 Ga0496125_0000013_246869_247840 317
872 3300048928 Ga0496125_0019451 Ga0496125_0019451_1980_2951 317
873 3300048928 Ga0496125_0081689 Ga0496125_0081689_1266_2237 317
874 3300048929 Ga0496126_0000276 Ga0496126_0000276_50721_51692 317
875 3300048929 Ga0496126_0001263 Ga0496126_0001263_16734_17705 317
876 3300048929 Ga0496126_0071241 Ga0496126_0071241_620_1591 317
877 3300048929 Ga0496126_0198450 Ga0496126_0198450_266_1279 317
878 3300048929 Ga0496126_0300501 Ga0496126_0300501_28_999 317
879 3300050491 nmdc:mga00v17_14833_c1 nmdc:mga00v17_14833_c1_3136_4107 317
880 iso_pu_bacteria 2554235132 2554817002 317
881 iso_pu_bacteria 2600254954 2600442956 317
882 iso_pu_bacteria 2600255389 2602009568 317
883 iso_pu_bacteria 2606217733 2608379679 317
884 iso_pu_bacteria 2808606379 2808941658 317
885 iso_pu_bacteria 2811994881 2812368111 317
886 iso_pu_bacteria 2823421272 2823424585 317
887 iso_pu_bacteria 2919501602 2919504315 317
888 iso_pu_bacteria 2923519811 2923522164 317
889 iso_pu_bacteria 2926063275 2926065112 317
890 iso_pu_bacteria 3007252601 3007253686 317
891 iso_pu_bacteria 3007315729 3007317540 317
892 iso_pu_bacteria 8011350971 8011353175 317
893 iso_pu_bacteria 8034962539 8034962570 317
894 2124908027 MRS2a_Contig_24676 MRS2a_00536150 318
895 2124908027 MRS2a_Contig_35 MRS2a_00246670 318
896 2162886011 MRS1b_contig_6647355 MRS1b_0149.00002970 318
897 3300002772 JGI25164J39214_1000018 JGI25164J39214_100001885 318
898 3300002772 JGI25164J39214_1000207 JGI25164J39214_10002076 318
899 3300003214 JGI25165J46597_1000123 JGI25165J46597_100012341 318
900 3300003214 JGI25165J46597_1000376 JGI25165J46597_100037640 318
901 3300003751 Ga0055538_1000029 Ga0055538_100002970 318
902 3300003752 Ga0055539_1000039 Ga0055539_100003970 318
903 3300003756 Ga0055533_1000049 Ga0055533_100004998 318
904 3300003758 Ga0055532_1000049 Ga0055532_100004971 318
905 3300003759 Ga0055525_1000077 Ga0055525_100007771 318
906 3300003781 Ga0055536_1000958 Ga0055536_100095814 318
907 3300003781 Ga0055536_1000968 Ga0055536_100096815 318
908 3300003781 Ga0055536_1001745 Ga0055536_10017456 318
909 3300003791 Ga0055530_10001199 Ga0055530_100011995 318
910 3300003791 Ga0055530_10001316 Ga0055530_100013169 318
911 3300003791 Ga0055530_10003779 Ga0055530_100037794 318
912 3300003791 Ga0055530_10021492 Ga0055530_100214922 318
913 3300003792 Ga0055540_1000963 Ga0055540_10009639 318
914 3300003792 Ga0055540_1001690 Ga0055540_10016906 318
915 3300003792 Ga0055540_1002538 Ga0055540_10025385 318
916 3300003794 Ga0055531_10000140 Ga0055531_1000014022 318
917 3300003841 Ga0055541_1000026 Ga0055541_100002698 318
918 3300003856 Ga0058692_1008516 Ga0058692_10085162 318
919 3300005288 Ga0065714_10007229 Ga0065714_100072291 318
920 3300005288 Ga0065714_10010762 Ga0065714_100107622 318
921 3300005288 Ga0065714_10012414 Ga0065714_100124142 318
922 3300005288 Ga0065714_10065016 Ga0065714_1006501611 318
923 3300005288 Ga0065714_10069503 Ga0065714_100695034 318
924 3300005288 Ga0065714_10075872 Ga0065714_100758722 318
925 3300005288 Ga0065714_10076526 Ga0065714_100765262 318
926 3300005288 Ga0065714_10103343 Ga0065714_101033432 318
927 3300005288 Ga0065714_10154227 Ga0065714_101542271 318
928 3300005289 Ga0065704_10000359 Ga0065704_1000035910 318
929 3300005289 Ga0065704_10001844 Ga0065704_100018444 318
930 3300005289 Ga0065704_10087552 Ga0065704_100875522 318
931 3300005289 Ga0065704_10099352 Ga0065704_100993522 318
932 3300005289 Ga0065704_10163380 Ga0065704_101633801 318
933 3300005289 Ga0065704_10186442 Ga0065704_101864421 318
934 3300005289 Ga0065704_10197502 Ga0065704_101975021 318
935 3300005290 Ga0065712_10085474 Ga0065712_100854743 318
936 3300005290 Ga0065712_10107913 Ga0065712_101079133 318
937 3300005293 Ga0065715_10040540 Ga0065715_100405401 318
938 3300005331 Ga0070670_100007345 Ga0070670_1000073455 318
939 3300005331 Ga0070670_100019945 Ga0070670_1000199456 318
940 3300005344 Ga0070661_100000066 Ga0070661_10000006657 318
941 3300005353 Ga0070669_100000310 Ga0070669_1000003107 318
942 3300005353 Ga0070669_100009197 Ga0070669_1000091977 318
943 3300005457 Ga0070662_100000560 Ga0070662_1000005608 318
944 3300005548 Ga0070665_100014132 Ga0070665_1000141326 318
945 3300005548 Ga0070665_100031477 Ga0070665_1000314775 318
946 3300005564 Ga0070664_100000034 Ga0070664_1000000347 318
947 3300005564 Ga0070664_100089387 Ga0070664_1000893874 318
948 3300005578 Ga0068854_100145094 Ga0068854_1001450941 318
949 3300005834 Ga0068851_10000006 Ga0068851_1000000691 318
950 3300006051 Ga0075364_10248553 Ga0075364_102485531 318
951 3300006058 Ga0075432_10023165 Ga0075432_100231652 318
952 3300006058 Ga0075432_10035382 Ga0075432_100353822 318
953 3300006058 Ga0075432_10057284 Ga0075432_100572842 318
954 3300006058 Ga0075432_10063618 Ga0075432_100636182 318
955 3300006058 Ga0075432_10071090 Ga0075432_100710901 318
956 3300006177 Ga0075362_10004456 Ga0075362_100044562 318
957 3300006944 Ga0099823_1000054 Ga0099823_100005410 318
958 3300006946 Ga0079104_1000867 Ga0079104_100086721 318
959 3300006946 Ga0079104_1001209 Ga0079104_10012099 318
960 3300006946 Ga0079104_1039575 Ga0079104_10395752 318
961 3300006948 Ga0099826_10002377 Ga0099826_100023775 318
962 3300009011 Ga0105251_10000004 Ga0105251_1000000497 318
963 3300009011 Ga0105251_10000149 Ga0105251_1000014956 318
964 3300009011 Ga0105251_10000605 Ga0105251_100006056 318
965 3300009011 Ga0105251_10000935 Ga0105251_1000093514 318
966 3300009011 Ga0105251_10003255 Ga0105251_1000325512 318
967 3300009011 Ga0105251_10005578 Ga0105251_100055786 318
968 3300009011 Ga0105251_10013931 Ga0105251_100139312 318
969 3300009011 Ga0105251_10016626 Ga0105251_100166262 318
970 3300009011 Ga0105251_10017330 Ga0105251_100173304 318
971 3300009011 Ga0105251_10019782 Ga0105251_100197823 318
972 3300009011 Ga0105251_10019949 Ga0105251_100199494 318
973 3300009011 Ga0105251_10021494 Ga0105251_100214944 318
974 3300009011 Ga0105251_10062773 Ga0105251_100627732 318
975 3300009011 Ga0105251_10064635 Ga0105251_100646351 318
976 3300009011 Ga0105251_10070191 Ga0105251_100701912 318
977 3300009011 Ga0105251_10090870 Ga0105251_100908701 318
978 3300009011 Ga0105251_10109261 Ga0105251_101092612 318
979 3300009036 Ga0105244_10000922 Ga0105244_100009228 318
980 3300009036 Ga0105244_10002703 Ga0105244_1000270310 318
981 3300009036 Ga0105244_10002753 Ga0105244_100027537 318
982 3300009036 Ga0105244_10003421 Ga0105244_100034211 318
983 3300009036 Ga0105244_10005552 Ga0105244_100055526 318
984 3300009036 Ga0105244_10012847 Ga0105244_100128474 318
985 3300009036 Ga0105244_10017503 Ga0105244_100175034 318
986 3300009036 Ga0105244_10025151 Ga0105244_100251512 318
987 3300009036 Ga0105244_10030409 Ga0105244_100304093 318
988 3300009036 Ga0105244_10041920 Ga0105244_100419201 318
989 3300009036 Ga0105244_10059527 Ga0105244_100595272 318
990 3300009036 Ga0105244_10059960 Ga0105244_100599602 318
991 3300009036 Ga0105244_10106047 Ga0105244_101060471 318
992 3300009036 Ga0105244_10107932 Ga0105244_101079321 318
993 3300009036 Ga0105244_10118847 Ga0105244_101188472 318
994 3300009092 Ga0105250_10000235 Ga0105250_1000023521 318
995 3300009092 Ga0105250_10003478 Ga0105250_100034786 318
996 3300009092 Ga0105250_10004467 Ga0105250_100044677 318
997 3300009092 Ga0105250_10019913 Ga0105250_100199133 318
998 3300009092 Ga0105250_10023550 Ga0105250_100235502 318
999 3300009092 Ga0105250_10086816 Ga0105250_100868162 318
1000 3300009148 Ga0105243_10000133 Ga0105243_1000013376 318
1001 3300009148 Ga0105243_10004466 Ga0105243_100044662 318
1002 3300009148 Ga0105243_10007553 Ga0105243_100075536 318
1003 3300009148 Ga0105243_10008586 Ga0105243_100085864 318
1004 3300009148 Ga0105243_10046604 Ga0105243_100466042 318
1005 3300009148 Ga0105243_10220692 Ga0105243_102206922 318
1006 3300009148 Ga0105243_10333449 Ga0105243_103334492 318
1007 3300009176 Ga0105242_10000233 Ga0105242_1000023310 318
1008 3300009177 Ga0105248_10122604 Ga0105248_101226043 318
1009 3300009545 Ga0105237_10000160 Ga0105237_1000016065 318
1010 3300011119 Ga0105246_10007947 Ga0105246_100079476 318
1011 3300011119 Ga0105246_10054546 Ga0105246_100545462 318
1012 3300012498 Ga0157345_1002802 Ga0157345_10028021 318
1013 3300013100 Ga0157373_10001377 Ga0157373_100013772 318
1014 3300013100 Ga0157373_10005333 Ga0157373_100053333 318
1015 3300013100 Ga0157373_10029939 Ga0157373_100299392 318
1016 3300013100 Ga0157373_10088253 Ga0157373_100882532 318
1017 3300013100 Ga0157373_10123513 Ga0157373_101235132 318
1018 3300013102 Ga0157371_10000460 Ga0157371_1000046026 318
1019 3300013102 Ga0157371_10002644 Ga0157371_1000264412 318
1020 3300013102 Ga0157371_10005574 Ga0157371_100055745 318
1021 3300013102 Ga0157371_10086528 Ga0157371_100865282 318
1022 3300013102 Ga0157371_10162197 Ga0157371_101621973 318
1023 3300013102 Ga0157371_10164859 Ga0157371_101648592 318
1024 3300013104 Ga0157370_10005690 Ga0157370_100056907 318
1025 3300013104 Ga0157370_10154794 Ga0157370_101547943 318
1026 3300013104 Ga0157370_10228312 Ga0157370_102283121 318
1027 3300013104 Ga0157370_10456392 Ga0157370_104563921 318
1028 3300013105 Ga0157369_10020382 Ga0157369_100203826 318
1029 3300013105 Ga0157369_10039167 Ga0157369_100391671 318
1030 3300013105 Ga0157369_10064144 Ga0157369_100641444 318
1031 3300013105 Ga0157369_10065052 Ga0157369_100650522 318
1032 3300013306 Ga0163162_10001088 Ga0163162_100010886 318
1033 3300013306 Ga0163162_10119254 Ga0163162_101192541 318
1034 3300013307 Ga0157372_10000815 Ga0157372_1000081514 318
1035 3300013307 Ga0157372_10024055 Ga0157372_100240555 318
1036 3300013307 Ga0157372_10525877 Ga0157372_105258772 318
1037 3300014497 Ga0182008_10000235 Ga0182008_1000023514 318
1038 3300014497 Ga0182008_10010235 Ga0182008_100102351 318
1039 3300014497 Ga0182008_10032743 Ga0182008_100327433 318
1040 3300014497 Ga0182008_10035354 Ga0182008_100353543 318
1041 3300014497 Ga0182008_10047300 Ga0182008_100473003 318
1042 3300014497 Ga0182008_10056042 Ga0182008_100560423 318
1043 3300014497 Ga0182008_10072573 Ga0182008_100725732 318
1044 3300015261 Ga0182006_1008071 Ga0182006_10080714 318
1045 3300015261 Ga0182006_1010353 Ga0182006_10103531 318
1046 3300015261 Ga0182006_1035094 Ga0182006_10350942 318
1047 3300015262 Ga0182007_10000613 Ga0182007_1000061312 318
1048 3300015262 Ga0182007_10034420 Ga0182007_100344203 318
1049 3300015265 Ga0182005_1000428 Ga0182005_100042811 318
1050 3300015265 Ga0182005_1002342 Ga0182005_10023425 318
1051 3300015265 Ga0182005_1004652 Ga0182005_10046524 318
1052 3300015265 Ga0182005_1023056 Ga0182005_10230563 318
1053 3300015265 Ga0182005_1024933 Ga0182005_10249332 318
1054 3300017792 Ga0163161_10001062 Ga0163161_1000106213 318
1055 3300017792 Ga0163161_10051296 Ga0163161_100512963 318
1056 3300017792 Ga0163161_10054321 Ga0163161_100543212 318
1057 3300017792 Ga0163161_10306623 Ga0163161_103066231 318
1058 3300025206 Ga0209435_101165 Ga0209435_1011653 318
1059 3300025207 Ga0209760_100127 Ga0209760_10012715 318
1060 3300025207 Ga0209760_100144 Ga0209760_10014443 318
1061 3300025224 Ga0209784_100045 Ga0209784_10004598 318
1062 3300025225 Ga0209566_100057 Ga0209566_10005798 318
1063 3300025226 Ga0209674_100080 Ga0209674_10008098 318
1064 3300025229 Ga0209147_100079 Ga0209147_10007998 318
1065 3300025230 Ga0209563_100078 Ga0209563_10007898 318
1066 3300025230 Ga0209563_100284 Ga0209563_10028411 318
1067 3300025231 Ga0207427_100007 Ga0207427_100007445 318
1068 3300025231 Ga0207427_100038 Ga0207427_10003880 318
1069 3300025233 Ga0209437_100006 Ga0209437_100006711 318
1070 3300025233 Ga0209437_100009 Ga0209437_100009707 318
1071 3300025242 Ga0209258_100178 Ga0209258_10017857 318
1072 3300025246 Ga0209646_1000311 Ga0209646_100031117 318
1073 3300025253 Ga0209677_100045 Ga0209677_10004598 318
1074 3300025256 Ga0209759_1002924 Ga0209759_10029246 318
1075 3300025261 Ga0209233_1000059 Ga0209233_1000059284 318
1076 3300025261 Ga0209233_1000074 Ga0209233_100007480 318
1077 3300025292 Ga0209676_1000006 Ga0209676_1000006692 318
1078 3300025292 Ga0209676_1000010 Ga0209676_1000010683 318
1079 3300025292 Ga0209676_1000270 Ga0209676_100027063 318
1080 3300025292 Ga0209676_1000721 Ga0209676_100072143 318
1081 3300025292 Ga0209676_1003505 Ga0209676_10035053 318
1082 3300025298 Ga0209050_1000019 Ga0209050_1000019180 318
1083 3300025298 Ga0209050_1000060 Ga0209050_100006092 318
1084 3300025298 Ga0209050_1000065 Ga0209050_1000065174 318
1085 3300025298 Ga0209050_1001314 Ga0209050_100131422 318
1086 3300025303 Ga0209051_1000037 Ga0209051_100003793 318
1087 3300025303 Ga0209051_1000238 Ga0209051_100023860 318
1088 3300025303 Ga0209051_1000265 Ga0209051_100026514 318
1089 3300025304 Ga0209257_1000119 Ga0209257_100011988 318
1090 3300025304 Ga0209257_1019834 Ga0209257_10198342 318
1091 3300025321 Ga0207656_10000017 Ga0207656_1000001742 318
1092 3300025711 Ga0207696_1000022 Ga0207696_100002280 318
1093 3300025711 Ga0207696_1000044 Ga0207696_1000044120 318
1094 3300025711 Ga0207696_1000121 Ga0207696_100012161 318
1095 3300025711 Ga0207696_1000179 Ga0207696_100017912 318
1096 3300025711 Ga0207696_1000924 Ga0207696_100092415 318
1097 3300025711 Ga0207696_1001803 Ga0207696_10018035 318
1098 3300025711 Ga0207696_1018992 Ga0207696_10189923 318
1099 3300025711 Ga0207696_1020773 Ga0207696_10207732 318
1100 3300025728 Ga0207655_1000021 Ga0207655_1000021270 318
1101 3300025728 Ga0207655_1000086 Ga0207655_100008695 318
1102 3300025728 Ga0207655_1000240 Ga0207655_100024027 318
1103 3300025728 Ga0207655_1000462 Ga0207655_100046210 318
1104 3300025728 Ga0207655_1000859 Ga0207655_100085922 318
1105 3300025728 Ga0207655_1001511 Ga0207655_100151116 318
1106 3300025728 Ga0207655_1001729 Ga0207655_100172911 318
1107 3300025728 Ga0207655_1005688 Ga0207655_10056885 318
1108 3300025728 Ga0207655_1008864 Ga0207655_10088645 318
1109 3300025728 Ga0207655_1009864 Ga0207655_10098644 318
1110 3300025728 Ga0207655_1014133 Ga0207655_10141332 318
1111 3300025728 Ga0207655_1026480 Ga0207655_10264804 318
1112 3300025728 Ga0207655_1027259 Ga0207655_10272593 318
1113 3300025728 Ga0207655_1039814 Ga0207655_10398143 318
1114 3300025728 Ga0207655_1066733 Ga0207655_10667332 318
1115 3300025728 Ga0207655_1071672 Ga0207655_10716722 318
1116 3300025735 Ga0207713_1000013 Ga0207713_1000013142 318
1117 3300025735 Ga0207713_1000104 Ga0207713_10001049 318
1118 3300025735 Ga0207713_1000356 Ga0207713_100035627 318
1119 3300025735 Ga0207713_1000454 Ga0207713_100045431 318
1120 3300025735 Ga0207713_1000734 Ga0207713_100073419 318
1121 3300025735 Ga0207713_1001064 Ga0207713_10010642 318
1122 3300025735 Ga0207713_1002680 Ga0207713_10026802 318
1123 3300025735 Ga0207713_1006156 Ga0207713_10061566 318
1124 3300025735 Ga0207713_1007324 Ga0207713_10073242 318
1125 3300025735 Ga0207713_1007367 Ga0207713_10073673 318
1126 3300025735 Ga0207713_1007806 Ga0207713_10078062 318
1127 3300025735 Ga0207713_1014251 Ga0207713_10142515 318
1128 3300025735 Ga0207713_1017204 Ga0207713_10172042 318
1129 3300025735 Ga0207713_1017833 Ga0207713_10178332 318
1130 3300025735 Ga0207713_1021022 Ga0207713_10210223 318
1131 3300025735 Ga0207713_1049082 Ga0207713_10490821 318
1132 3300025914 Ga0207671_10000019 Ga0207671_1000001978 318
1133 3300025920 Ga0207649_10000004 Ga0207649_10000004225 318
1134 3300025923 Ga0207681_10000679 Ga0207681_100006799 318
1135 3300025923 Ga0207681_10001883 Ga0207681_100018836 318
1136 3300025925 Ga0207650_10000668 Ga0207650_100006689 318
1137 3300025925 Ga0207650_10001102 Ga0207650_1000110211 318
1138 3300025933 Ga0207706_10001474 Ga0207706_1000147415 318
1139 3300025933 Ga0207706_10014803 Ga0207706_100148037 318
1140 3300025934 Ga0207686_10002443 Ga0207686_100024435 318
1141 3300025935 Ga0207709_10000013 Ga0207709_10000013433 318
1142 3300025935 Ga0207709_10003688 Ga0207709_100036887 318
1143 3300025935 Ga0207709_10005522 Ga0207709_100055225 318
1144 3300025935 Ga0207709_10012279 Ga0207709_100122794 318
1145 3300025935 Ga0207709_10048780 Ga0207709_100487803 318
1146 3300025935 Ga0207709_10061528 Ga0207709_100615283 318
1147 3300025935 Ga0207709_10335959 Ga0207709_103359591 318
1148 3300025941 Ga0207711_10020084 Ga0207711_100200842 318
1149 3300025945 Ga0207679_10000019 Ga0207679_1000001996 318
1150 3300025981 Ga0207640_10060517 Ga0207640_100605173 318
1151 3300026041 Ga0207639_10003002 Ga0207639_100030023 318
1152 3300027111 Ga0209281_1000010 Ga0209281_1000010148 318
1153 3300027111 Ga0209281_1000013 Ga0209281_1000013261 318
1154 3300027111 Ga0209281_1004175 Ga0209281_10041755 318
1155 3300027296 Ga0209389_1000002 Ga0209389_1000002271 318
1156 3300027312 Ga0209371_1000239 Ga0209371_100023934 318
1157 3300027312 Ga0209371_1000253 Ga0209371_100025311 318
1158 3300027665 Ga0209983_1000325 Ga0209983_10003258 318
1159 3300027682 Ga0209971_1001041 Ga0209971_10010413 318
1160 3300027876 Ga0209974_10023657 Ga0209974_100236572 318
1161 3300027876 Ga0209974_10027692 Ga0209974_100276922 318
1162 3300027907 Ga0207428_10010530 Ga0207428_100105304 318
1163 3300027907 Ga0207428_10025831 Ga0207428_100258311 318
1164 3300027907 Ga0207428_10066757 Ga0207428_100667571 318
1165 3300027907 Ga0207428_10073063 Ga0207428_100730633 318
1166 3300028379 Ga0268266_10003720 Ga0268266_100037208 318
1167 3300030500 Ga0268256_1000199 Ga0268256_100019934 318
1168 3300030500 Ga0268256_1000367 Ga0268256_100036726 318
1169 3300030521 Ga0307511_10050424 Ga0307511_100504242 318
1170 3300030731 Ga0316177_1108430 Ga0316177_11084303 318
1171 3300030733 Ga0314311_1045991 Ga0314311_10459914 318
1172 3300030735 Ga0316178_1076498 Ga0316178_107649822 318
1173 3300030742 Ga0316183_1053494 Ga0316183_10534944 318
1174 3300030744 Ga0316181_1247282 Ga0316181_12472822 318
1175 3300031548 Ga0307408_100000304 Ga0307408_1000003043 318
1176 3300031548 Ga0307408_100063987 Ga0307408_1000639872 318
1177 3300031548 Ga0307408_100473096 Ga0307408_1004730961 318
1178 3300031727 Ga0316576_10026621 Ga0316576_100266213 318
1179 3300031731 Ga0307405_10013400 Ga0307405_100134005 318
1180 3300031731 Ga0307405_10153890 Ga0307405_101538903 318
1181 3300031824 Ga0307413_10033078 Ga0307413_100330783 318
1182 3300031903 Ga0307407_10191217 Ga0307407_101912172 318
1183 3300032002 Ga0307416_100176787 Ga0307416_1001767871 318
1184 3300032002 Ga0307416_100295816 Ga0307416_1002958162 318
1185 3300032004 Ga0307414_10458513 Ga0307414_104585131 318
1186 3300032005 Ga0307411_10033480 Ga0307411_100334802 318
1187 3300032168 Ga0316593_10012354 Ga0316593_100123542 318
1188 3300033180 Ga0307510_10001771 Ga0307510_100017715 318
1189 3300036647 Ga0316582_0027234 Ga0316582_0027234_1251_2225 318
1190 3300038705 Ga0237819_01795 Ga0237819_01795_3155_4111 318
1191 3300039062 Ga0400483_112441 Ga0400483_112441_53_1045 318
1192 3300039062 Ga0400483_117887 Ga0400483_117887_1245_2216 318
1193 3300039062 Ga0400483_250036 Ga0400483_250036_166016_166987 318
1194 3300041404 Ga0439436_0000700 Ga0439436_0000700_7665_8633 318
1195 3300041405 Ga0439438_000936 Ga0439438_000936_1927_2895 318
1196 3300041405 Ga0439438_001200 Ga0439438_001200_7457_8413 318
1197 3300041405 Ga0439438_002923 Ga0439438_002923_2682_3638 318
1198 3300041405 Ga0439438_007572 Ga0439438_007572_2698_3654 318
1199 3300041405 Ga0439438_015687 Ga0439438_015687_1032_1988 318
1200 3300041407 Ga0439447_001502 Ga0439447_001502_6317_7285 318
1201 3300041407 Ga0439447_003794 Ga0439447_003794_1929_2885 318
1202 3300041407 Ga0439447_009195 Ga0439447_009195_184_1140 318
1203 3300041407 Ga0439447_016505 Ga0439447_016505_24_980 318
1204 3300041407 Ga0439447_037427 Ga0439447_037427_61_1017 318
1205 3300041411 Ga0439466_0001124 Ga0439466_0001124_5022_5990 318
1206 3300041411 Ga0439466_0011673 Ga0439466_0011673_1503_2459 318
1207 3300041411 Ga0439466_0013560 Ga0439466_0013560_1141_2097 318
1208 3300041411 Ga0439466_0062413 Ga0439466_0062413_186_1145 318
1209 3300042000 Ga0439437_000026 Ga0439437_000026_4164_5135 318
1210 3300042006 Ga0439432_002272 Ga0439432_002272_4237_5193 318
1211 3300042006 Ga0439432_002413 Ga0439432_002413_166_1134 318
1212 3300042006 Ga0439432_003075 Ga0439432_003075_2459_3415 318
1213 3300042006 Ga0439432_007431 Ga0439432_007431_2876_3832 318
1214 3300042006 Ga0439432_038985 Ga0439432_038985_89_1045 318
1215 3300042009 Ga0439451_007229 Ga0439451_007229_395_1351 318
1216 3300042009 Ga0439451_016810 Ga0439451_016810_492_1448 318
1217 3300042010 Ga0439452_000781 Ga0439452_000781_14088_15044 318
1218 3300042010 Ga0439452_001455 Ga0439452_001455_8662_9618 318
1219 3300042010 Ga0439452_002278 Ga0439452_002278_3803_4771 318
1220 3300042010 Ga0439452_010697 Ga0439452_010697_53_1009 318
1221 3300042013 Ga0439456_001479 Ga0439456_001479_3258_4229 318
1222 3300042013 Ga0439456_006017 Ga0439456_006017_97_1053 318
1223 3300042016 Ga0439463_000853 Ga0439463_000853_1625_2584 318
1224 3300042016 Ga0439463_001820 Ga0439463_001820_1741_2697 318
1225 3300042115 Ga0450911_000002 Ga0450911_000002_181015_181986 318
1226 3300042121 Ga0450919_003044 Ga0450919_003044_309_1265 318
1227 3300042127 Ga0450890_013500 Ga0450890_013500_29_985 318
1228 3300042137 Ga0450902_000054 Ga0450902_000054_4640_5596 318
1229 3300042137 Ga0450902_001351 Ga0450902_001351_2040_2996 318
1230 3300042138 Ga0450903_010271 Ga0450903_010271_96_1052 318
1231 3300042139 Ga0450904_000035 Ga0450904_000035_6802_7773 318
1232 3300042139 Ga0450904_003356 Ga0450904_003356_44_1000 318
1233 3300042142 Ga0450905_000276 Ga0450905_000276_4904_5860 318
1234 3300042142 Ga0450905_000679 Ga0450905_000679_1218_2174 318
1235 3300042145 Ga0450906_001159 Ga0450906_001159_3170_4126 318
1236 3300042146 Ga0450907_001598 Ga0450907_001598_356_1312 318
1237 3300042146 Ga0450907_001604 Ga0450907_001604_3754_4710 318
1238 3300042146 Ga0450907_018177 Ga0450907_018177_184_1140 318
1239 3300042156 Ga0439446_0000240 Ga0439446_0000240_7478_8446 318
1240 3300042435 Ga0439434_0001047 Ga0439434_0001047_3309_4265 318
1241 3300042435 Ga0439434_0001060 Ga0439434_0001060_3858_4826 318
1242 3300042439 Ga0439464_0004058 Ga0439464_0004058_2511_3479 318
1243 3300042461 Ga0439460_0000893 Ga0439460_0000893_49_1005 318
1244 3300042461 Ga0439460_0004840 Ga0439460_0004840_1963_2919 318
1245 3300042532 Ga0450893_0000791 Ga0450893_0000791_3145_4116 318
1246 3300042533 Ga0450901_000269 Ga0450901_000269_4963_5919 318
1247 3300042876 Ga0451577_0106840 Ga0451577_0106840_996_1973 318
1248 3300042993 Ga0439440_0013310 Ga0439440_0013310_764_1720 318
1249 3300045051 Ga0451576_0000077 Ga0451576_0000077_177594_178574 318
1250 3300046452 Ga0495617_000978 Ga0495617_000978_171_1127 318
1251 3300046452 Ga0495617_003030 Ga0495617_003030_35_991 318
1252 3300046452 Ga0495617_009176 Ga0495617_009176_113_1069 318
1253 3300046452 Ga0495617_011834 Ga0495617_011834_1139_2098 318
1254 3300046452 Ga0495617_046308 Ga0495617_046308_49_1005 318
1255 3300046452 Ga0495617_053111 Ga0495617_053111_378_1334 318
1256 3300046452 Ga0495617_086097 Ga0495617_086097_35_991 318
1257 3300046453 Ga0495627_000021 Ga0495627_000021_163935_164894 318
1258 3300046453 Ga0495627_000279 Ga0495627_000279_20114_21070 318
1259 3300046453 Ga0495627_000789 Ga0495627_000789_3105_4061 318
1260 3300046453 Ga0495627_003053 Ga0495627_003053_834_1793 318
1261 3300046453 Ga0495627_009390 Ga0495627_009390_49_1005 318
1262 3300046453 Ga0495627_017288 Ga0495627_017288_1448_2404 318
1263 3300046453 Ga0495627_031784 Ga0495627_031784_674_1630 318
1264 3300046453 Ga0495627_050072 Ga0495627_050072_261_1220 318
1265 3300046455 Ga0495603_0221390 Ga0495603_0221390_71_1027 318
1266 3300046457 Ga0495590_0003408 Ga0495590_0003408_103_1059 318
1267 3300046457 Ga0495590_0008914 Ga0495590_0008914_2802_3758 318
1268 3300046457 Ga0495590_0053248 Ga0495590_0053248_395_1351 318
1269 3300046458 Ga0495591_000015 Ga0495591_000015_242283_243242 318
1270 3300046458 Ga0495591_001085 Ga0495591_001085_2336_3292 318
1271 3300046458 Ga0495591_002885 Ga0495591_002885_3195_4154 318
1272 3300046458 Ga0495591_004439 Ga0495591_004439_3499_4458 318
1273 3300046458 Ga0495591_010606 Ga0495591_010606_2564_3520 318
1274 3300046458 Ga0495591_023321 Ga0495591_023321_254_1210 318
1275 3300046460 Ga0495638_0002945 Ga0495638_0002945_8875_9831 318
1276 3300046460 Ga0495638_0013602 Ga0495638_0013602_2310_3266 318
1277 3300046460 Ga0495638_0029899 Ga0495638_0029899_116_1072 318
1278 3300046460 Ga0495638_0058607 Ga0495638_0058607_435_1391 318
1279 3300046460 Ga0495638_0217287 Ga0495638_0217287_16_972 318
1280 3300046463 Ga0495653_0004180 Ga0495653_0004180_1881_2837 318
1281 3300046463 Ga0495653_0049059 Ga0495653_0049059_2228_3184 318
1282 3300046471 Ga0495650_0000672 Ga0495650_0000672_25453_26412 318
1283 3300046471 Ga0495650_0004078 Ga0495650_0004078_6947_7906 318
1284 3300046471 Ga0495650_0010743 Ga0495650_0010743_3511_4467 318
1285 3300046471 Ga0495650_0022733 Ga0495650_0022733_2032_2988 318
1286 3300046471 Ga0495650_0026483 Ga0495650_0026483_1635_2591 318
1287 3300046471 Ga0495650_0054121 Ga0495650_0054121_191_1150 318
1288 3300046471 Ga0495650_0079889 Ga0495650_0079889_283_1239 318
1289 3300046474 Ga0495605_0000016 Ga0495605_0000016_210567_211526 318
1290 3300046474 Ga0495605_0000031 Ga0495605_0000031_163562_164521 318
1291 3300046474 Ga0495605_0000523 Ga0495605_0000523_31374_32333 318
1292 3300046474 Ga0495605_0004855 Ga0495605_0004855_3458_4414 318
1293 3300046474 Ga0495605_0005949 Ga0495605_0005949_3431_4390 318
1294 3300046474 Ga0495605_0011368 Ga0495605_0011368_2893_3849 318
1295 3300046474 Ga0495605_0012213 Ga0495605_0012213_2314_3270 318
1296 3300046474 Ga0495605_0024757 Ga0495605_0024757_95_1054 318
1297 3300046491 Ga0495584_0001616 Ga0495584_0001616_12201_13157 318
1298 3300046491 Ga0495584_0002458 Ga0495584_0002458_65_1021 318
1299 3300046491 Ga0495584_0005988 Ga0495584_0005988_2361_3320 318
1300 3300046491 Ga0495584_0006381 Ga0495584_0006381_5151_6107 318
1301 3300046491 Ga0495584_0019201 Ga0495584_0019201_219_1175 318
1302 3300046491 Ga0495584_0043034 Ga0495584_0043034_65_1021 318
1303 3300046491 Ga0495584_0046731 Ga0495584_0046731_426_1382 318
1304 3300046491 Ga0495584_0054401 Ga0495584_0054401_1022_1978 318
1305 3300046492 Ga0495585_0001037 Ga0495585_0001037_18892_19848 318
1306 3300046492 Ga0495585_0005139 Ga0495585_0005139_3103_4059 318
1307 3300046492 Ga0495585_0010653 Ga0495585_0010653_1489_2445 318
1308 3300046492 Ga0495585_0056583 Ga0495585_0056583_266_1222 318
1309 3300046492 Ga0495585_0075614 Ga0495585_0075614_801_1757 318
1310 3300046492 Ga0495585_0181323 Ga0495585_0181323_56_1012 318
1311 3300046499 Ga0495594_0002644 Ga0495594_0002644_1946_2905 318
1312 3300046499 Ga0495594_0143250 Ga0495594_0143250_359_1315 318
1313 3300046500 Ga0495596_0005154 Ga0495596_0005154_2772_3728 318
1314 3300046500 Ga0495596_0005876 Ga0495596_0005876_2486_3445 318
1315 3300046501 Ga0495607_0000213 Ga0495607_0000213_6169_7128 318
1316 3300046501 Ga0495607_0000237 Ga0495607_0000237_58221_59177 318
1317 3300046501 Ga0495607_0000248 Ga0495607_0000248_51655_52614 318
1318 3300046501 Ga0495607_0000780 Ga0495607_0000780_25937_26896 318
1319 3300046501 Ga0495607_0008778 Ga0495607_0008778_3158_4114 318
1320 3300046501 Ga0495607_0008930 Ga0495607_0008930_2410_3366 318
1321 3300046501 Ga0495607_0011600 Ga0495607_0011600_2199_3158 318
1322 3300046501 Ga0495607_0019456 Ga0495607_0019456_2472_3431 318
1323 3300046501 Ga0495607_0024302 Ga0495607_0024302_514_1470 318
1324 3300046501 Ga0495607_0032884 Ga0495607_0032884_1163_2122 318
1325 3300046501 Ga0495607_0042224 Ga0495607_0042224_940_1896 318
1326 3300046501 Ga0495607_0056721 Ga0495607_0056721_44_1000 318
1327 3300046506 Ga0495583_0000041 Ga0495583_0000041_41125_42084 318
1328 3300046506 Ga0495583_0000698 Ga0495583_0000698_10472_11431 318
1329 3300046506 Ga0495583_0001956 Ga0495583_0001956_16171_17130 318
1330 3300046506 Ga0495583_0004463 Ga0495583_0004463_1009_1965 318
1331 3300046506 Ga0495583_0007614 Ga0495583_0007614_3462_4421 318
1332 3300046506 Ga0495583_0016954 Ga0495583_0016954_681_1640 318
1333 3300046506 Ga0495583_0022460 Ga0495583_0022460_2218_3177 318
1334 3300046507 Ga0495606_0000076 Ga0495606_0000076_25450_26406 318
1335 3300046507 Ga0495606_0002535 Ga0495606_0002535_10568_11527 318
1336 3300046507 Ga0495606_0006037 Ga0495606_0006037_5664_6620 318
1337 3300046507 Ga0495606_0008423 Ga0495606_0008423_7276_8232 318
1338 3300046507 Ga0495606_0032362 Ga0495606_0032362_2391_3347 318
1339 3300046507 Ga0495606_0058125 Ga0495606_0058125_29_985 318
1340 3300046507 Ga0495606_0117556 Ga0495606_0117556_625_1581 318
1341 3300046512 Ga0495610_0002616 Ga0495610_0002616_4281_5237 318
1342 3300046512 Ga0495610_0011574 Ga0495610_0011574_510_1469 318
1343 3300046512 Ga0495610_0019155 Ga0495610_0019155_2859_3815 318
1344 3300046512 Ga0495610_0023628 Ga0495610_0023628_47_1003 318
1345 3300046512 Ga0495610_0034853 Ga0495610_0034853_79_1035 318
1346 3300046512 Ga0495610_0038305 Ga0495610_0038305_1136_2095 318
1347 3300046513 Ga0495616_0002404 Ga0495616_0002404_52_1008 318
1348 3300046513 Ga0495616_0006595 Ga0495616_0006595_5987_6943 318
1349 3300046513 Ga0495616_0021752 Ga0495616_0021752_1916_2872 318
1350 3300046513 Ga0495616_0143417 Ga0495616_0143417_61_1017 318
1351 3300046515 Ga0495620_0000013 Ga0495620_0000013_94742_95698 318
1352 3300046515 Ga0495620_0000015 Ga0495620_0000015_41094_42053 318
1353 3300046515 Ga0495620_0004506 Ga0495620_0004506_3462_4421 318
1354 3300046515 Ga0495620_0007041 Ga0495620_0007041_4513_5472 318
1355 3300046515 Ga0495620_0014204 Ga0495620_0014204_387_1343 318
1356 3300046515 Ga0495620_0042178 Ga0495620_0042178_67_1023 318
1357 3300046515 Ga0495620_0053691 Ga0495620_0053691_696_1652 318
1358 3300046515 Ga0495620_0060381 Ga0495620_0060381_601_1557 318
1359 3300046518 Ga0495631_0001077 Ga0495631_0001077_14230_15186 318
1360 3300046518 Ga0495631_0005273 Ga0495631_0005273_2566_3522 318
1361 3300046518 Ga0495631_0012543 Ga0495631_0012543_2452_3411 318
1362 3300046518 Ga0495631_0125795 Ga0495631_0125795_30_986 318
1363 3300046519 Ga0495632_0000912 Ga0495632_0000912_5069_6028 318
1364 3300046519 Ga0495632_0000914 Ga0495632_0000914_6303_7259 318
1365 3300046519 Ga0495632_0001648 Ga0495632_0001648_62_1018 318
1366 3300046519 Ga0495632_0001676 Ga0495632_0001676_15_971 318
1367 3300046519 Ga0495632_0002354 Ga0495632_0002354_11219_12175 318
1368 3300046519 Ga0495632_0004171 Ga0495632_0004171_8922_9878 318
1369 3300046519 Ga0495632_0004792 Ga0495632_0004792_2515_3474 318
1370 3300046519 Ga0495632_0006071 Ga0495632_0006071_6533_7492 318
1371 3300046519 Ga0495632_0039895 Ga0495632_0039895_1393_2349 318
1372 3300046519 Ga0495632_0061073 Ga0495632_0061073_277_1233 318
1373 3300046520 Ga0495637_0000913 Ga0495637_0000913_13_969 318
1374 3300046520 Ga0495637_0002612 Ga0495637_0002612_2404_3363 318
1375 3300046520 Ga0495637_0003141 Ga0495637_0003141_7797_8753 318
1376 3300046520 Ga0495637_0007261 Ga0495637_0007261_2298_3257 318
1377 3300046520 Ga0495637_0007862 Ga0495637_0007862_1965_2921 318
1378 3300046520 Ga0495637_0031219 Ga0495637_0031219_833_1792 318
1379 3300046520 Ga0495637_0039831 Ga0495637_0039831_975_1931 318
1380 3300046522 Ga0495643_0000223 Ga0495643_0000223_32872_33828 318
1381 3300046522 Ga0495643_0000903 Ga0495643_0000903_8617_9573 318
1382 3300046522 Ga0495643_0005943 Ga0495643_0005943_2433_3389 318
1383 3300046522 Ga0495643_0010375 Ga0495643_0010375_2410_3366 318
1384 3300046522 Ga0495643_0018092 Ga0495643_0018092_833_1789 318
1385 3300046522 Ga0495643_0068346 Ga0495643_0068346_54_1010 318
1386 3300046523 Ga0495644_0000723 Ga0495644_0000723_10234_11190 318
1387 3300046523 Ga0495644_0002168 Ga0495644_0002168_4751_5710 318
1388 3300046523 Ga0495644_0007316 Ga0495644_0007316_3238_4194 318
1389 3300046523 Ga0495644_0011601 Ga0495644_0011601_2366_3322 318
1390 3300046524 Ga0495648_0001423 Ga0495648_0001423_6309_7265 318
1391 3300046524 Ga0495648_0002171 Ga0495648_0002171_17429_18385 318
1392 3300046524 Ga0495648_0006275 Ga0495648_0006275_8732_9688 318
1393 3300046524 Ga0495648_0013055 Ga0495648_0013055_2653_3612 318
1394 3300046524 Ga0495648_0015574 Ga0495648_0015574_2034_2993 318
1395 3300046524 Ga0495648_0050318 Ga0495648_0050318_990_1949 318
1396 3300046524 Ga0495648_0051193 Ga0495648_0051193_1497_2453 318
1397 3300046524 Ga0495648_0116647 Ga0495648_0116647_84_1040 318
1398 3300046524 Ga0495648_0130266 Ga0495648_0130266_330_1286 318
1399 3300046526 Ga0495666_0009905 Ga0495666_0009905_909_1865 318
1400 3300046526 Ga0495666_0018038 Ga0495666_0018038_2495_3451 318
1401 3300046528 Ga0495642_0000153 Ga0495642_0000153_5404_6360 318
1402 3300046528 Ga0495642_0000800 Ga0495642_0000800_29_985 318
1403 3300046530 Ga0495654_0001518 Ga0495654_0001518_11703_12659 318
1404 3300046530 Ga0495654_0001707 Ga0495654_0001707_13763_14719 318
1405 3300046530 Ga0495654_0002300 Ga0495654_0002300_2780_3736 318
1406 3300046530 Ga0495654_0003578 Ga0495654_0003578_2534_3493 318
1407 3300046530 Ga0495654_0005355 Ga0495654_0005355_4659_5618 318
1408 3300046530 Ga0495654_0009802 Ga0495654_0009802_4221_5177 318
1409 3300046530 Ga0495654_0015604 Ga0495654_0015604_2550_3506 318
1410 3300046530 Ga0495654_0016284 Ga0495654_0016284_37_993 318
1411 3300046530 Ga0495654_0048535 Ga0495654_0048535_1070_2026 318
1412 3300046530 Ga0495654_0049043 Ga0495654_0049043_65_1024 318
1413 3300046530 Ga0495654_0062178 Ga0495654_0062178_59_1015 318
1414 3300046530 Ga0495654_0121992 Ga0495654_0121992_204_1160 318
1415 3300046536 Ga0495587_0077495 Ga0495587_0077495_25_981 318
1416 3300046538 Ga0495609_0000015 Ga0495609_0000015_280288_281247 318
1417 3300046538 Ga0495609_0000070 Ga0495609_0000070_95084_96043 318
1418 3300046538 Ga0495609_0003891 Ga0495609_0003891_2393_3352 318
1419 3300046538 Ga0495609_0005696 Ga0495609_0005696_5509_6465 318
1420 3300046542 Ga0495597_0000005 Ga0495597_0000005_182462_183421 318
1421 3300046542 Ga0495597_0005772 Ga0495597_0005772_1928_2884 318
1422 3300046542 Ga0495597_0007051 Ga0495597_0007051_2383_3342 318
1423 3300046542 Ga0495597_0018470 Ga0495597_0018470_68_1024 318
1424 3300046542 Ga0495597_0033564 Ga0495597_0033564_1174_2130 318
1425 3300046543 Ga0495645_0030346 Ga0495645_0030346_43_1002 318
1426 3300046558 Ga0495633_0000060 Ga0495633_0000060_116779_117738 318
1427 3300046615 Ga0495656_0006796 Ga0495656_0006796_205_1161 318
1428 3300046616 Ga0495668_0016569 Ga0495668_0016569_2332_3288 318
1429 3300046648 Ga0495611_0000720 Ga0495611_0000720_58_1014 318
1430 3300046648 Ga0495611_0000817 Ga0495611_0000817_3143_4102 318
1431 3300046648 Ga0495611_0003033 Ga0495611_0003033_67_1023 318
1432 3300046648 Ga0495611_0003416 Ga0495611_0003416_5522_6481 318
1433 3300046648 Ga0495611_0069106 Ga0495611_0069106_588_1544 318
1434 3300046660 Ga0495625_0001491 Ga0495625_0001491_2491_3450 318
1435 3300046660 Ga0495625_0004073 Ga0495625_0004073_2810_3766 318
1436 3300046660 Ga0495625_0048065 Ga0495625_0048065_1953_2912 318
1437 3300046660 Ga0495625_0116723 Ga0495625_0116723_62_1018 318
1438 3300046660 Ga0495625_0129471 Ga0495625_0129471_77_1033 318
1439 3300046660 Ga0495625_0130031 Ga0495625_0130031_168_1124 318
1440 3300046660 Ga0495625_0262401 Ga0495625_0262401_82_1038 318
1441 3300046663 Ga0495635_0037354 Ga0495635_0037354_375_1331 318
1442 3300046665 Ga0495661_0000110 Ga0495661_0000110_34575_35534 318
1443 3300046665 Ga0495661_0000139 Ga0495661_0000139_81712_82671 318
1444 3300046665 Ga0495661_0000194 Ga0495661_0000194_49361_50320 318
1445 3300046665 Ga0495661_0000304 Ga0495661_0000304_30717_31673 318
1446 3300046665 Ga0495661_0019103 Ga0495661_0019103_2885_3841 318
1447 3300046665 Ga0495661_0026217 Ga0495661_0026217_2782_3738 318
1448 3300046665 Ga0495661_0027633 Ga0495661_0027633_52_1008 318
1449 3300046665 Ga0495661_0042224 Ga0495661_0042224_219_1178 318
1450 3300046665 Ga0495661_0153040 Ga0495661_0153040_253_1209 318
1451 3300046665 Ga0495661_0190255 Ga0495661_0190255_62_1018 318
1452 3300046679 Ga0495623_0069962 Ga0495623_0069962_409_1365 318
1453 3300046680 Ga0495646_0091703 Ga0495646_0091703_27_983 318
1454 3300046684 Ga0495669_0017189 Ga0495669_0017189_72_1028 318
1455 3300046689 Ga0495613_0301470 Ga0495613_0301470_56_1012 318
1456 3300046691 Ga0495670_0004111 Ga0495670_0004111_6117_7073 318
1457 3300046691 Ga0495670_0005750 Ga0495670_0005750_2999_3955 318
1458 3300046692 Ga0495671_0001949 Ga0495671_0001949_73_1029 318
1459 3300046692 Ga0495671_0006975 Ga0495671_0006975_976_1932 318
1460 3300046692 Ga0495671_0010944 Ga0495671_0010944_1636_2592 318
1461 3300046692 Ga0495671_0012308 Ga0495671_0012308_664_1623 318
1462 3300046692 Ga0495671_0012367 Ga0495671_0012367_3635_4591 318
1463 3300046692 Ga0495671_0017262 Ga0495671_0017262_462_1418 318
1464 3300046692 Ga0495671_0022086 Ga0495671_0022086_759_1715 318
1465 3300046692 Ga0495671_0056015 Ga0495671_0056015_952_1908 318
1466 3300046692 Ga0495671_0102462 Ga0495671_0102462_135_1091 318
1467 3300046694 Ga0495649_0002123 Ga0495649_0002123_2393_3349 318
1468 3300046694 Ga0495649_0006667 Ga0495649_0006667_4612_5568 318
1469 3300046694 Ga0495649_0014726 Ga0495649_0014726_2373_3329 318
1470 3300046694 Ga0495649_0023580 Ga0495649_0023580_2419_3375 318
1471 3300046694 Ga0495649_0045699 Ga0495649_0045699_1377_2333 318
1472 3300046694 Ga0495649_0063994 Ga0495649_0063994_992_1948 318
1473 3300046694 Ga0495649_0099940 Ga0495649_0099940_529_1485 318
1474 3300046794 Ga0495589_0005001 Ga0495589_0005001_72_1028 318
1475 3300046794 Ga0495589_0005441 Ga0495589_0005441_3352_4308 318
1476 3300046794 Ga0495589_0015046 Ga0495589_0015046_398_1357 318
1477 3300046809 Ga0495600_0056440 Ga0495600_0056440_28_984 318
1478 3300046809 Ga0495600_0103275 Ga0495600_0103275_35_991 318
1479 3300046810 Ga0495660_0001756 Ga0495660_0001756_4310_5269 318
1480 3300046810 Ga0495660_0003768 Ga0495660_0003768_5082_6041 318
1481 3300046810 Ga0495660_0012461 Ga0495660_0012461_2877_3836 318
1482 3300046810 Ga0495660_0018712 Ga0495660_0018712_556_1515 318
1483 3300046810 Ga0495660_0023661 Ga0495660_0023661_2100_3059 318
1484 3300046810 Ga0495660_0066105 Ga0495660_0066105_887_1843 318
1485 3300046810 Ga0495660_0113743 Ga0495660_0113743_237_1193 318
1486 3300047318 Ga0495636_0009371 Ga0495636_0009371_2853_3809 318
1487 3300047320 Ga0495672_0002745 Ga0495672_0002745_2662_3618 318
1488 3300047320 Ga0495672_0006543 Ga0495672_0006543_6017_6973 318
1489 3300047320 Ga0495672_0014337 Ga0495672_0014337_2131_3087 318
1490 3300047320 Ga0495672_0022683 Ga0495672_0022683_1457_2416 318
1491 3300047320 Ga0495672_0023110 Ga0495672_0023110_1855_2811 318
1492 3300047320 Ga0495672_0026253 Ga0495672_0026253_2564_3523 318
1493 3300047320 Ga0495672_0071400 Ga0495672_0071400_962_1918 318
1494 3300047320 Ga0495672_0121507 Ga0495672_0121507_96_1055 318
1495 3300047321 Ga0495676_0000013 Ga0495676_0000013_209606_210565 318
1496 3300047321 Ga0495676_0067231 Ga0495676_0067231_1528_2484 318
1497 3300047323 Ga0495683_0000027 Ga0495683_0000027_111278_112237 318
1498 3300047323 Ga0495683_0000261 Ga0495683_0000261_13605_14561 318
1499 3300047323 Ga0495683_0018906 Ga0495683_0018906_2540_3496 318
1500 3300047323 Ga0495683_0021349 Ga0495683_0021349_2339_3295 318
1501 3300047323 Ga0495683_0022851 Ga0495683_0022851_53_1009 318
1502 3300047323 Ga0495683_0084407 Ga0495683_0084407_531_1487 318
1503 3300047323 Ga0495683_0152496 Ga0495683_0152496_49_1005 318
1504 3300047443 Ga0495687_005661 Ga0495687_005661_93_1049 318
1505 3300047444 Ga0495675_0009682 Ga0495675_0009682_828_1784 318
1506 3300047444 Ga0495675_0044070 Ga0495675_0044070_186_1142 318
1507 3300047446 Ga0495679_000206 Ga0495679_000206_48221_49180 318
1508 3300047446 Ga0495679_030670 Ga0495679_030670_717_1673 318
1509 3300047469 Ga0495673_0001257 Ga0495673_0001257_16034_16990 318
1510 3300047469 Ga0495673_0002579 Ga0495673_0002579_9249_10208 318
1511 3300047469 Ga0495673_0003090 Ga0495673_0003090_2445_3404 318
1512 3300047469 Ga0495673_0005035 Ga0495673_0005035_848_1804 318
1513 3300047469 Ga0495673_0005632 Ga0495673_0005632_2416_3372 318
1514 3300047469 Ga0495673_0006585 Ga0495673_0006585_5790_6749 318
1515 3300047469 Ga0495673_0007928 Ga0495673_0007928_5030_5986 318
1516 3300047469 Ga0495673_0009812 Ga0495673_0009812_1236_2192 318
1517 3300047469 Ga0495673_0010469 Ga0495673_0010469_2142_3101 318
1518 3300047469 Ga0495673_0015057 Ga0495673_0015057_2220_3179 318
1519 3300047469 Ga0495673_0015965 Ga0495673_0015965_350_1309 318
1520 3300047469 Ga0495673_0017418 Ga0495673_0017418_362_1318 318
1521 3300047469 Ga0495673_0022001 Ga0495673_0022001_2126_3082 318
1522 3300047469 Ga0495673_0033902 Ga0495673_0033902_1371_2327 318
1523 3300047469 Ga0495673_0034146 Ga0495673_0034146_1215_2174 318
1524 3300047469 Ga0495673_0061061 Ga0495673_0061061_445_1404 318
1525 3300047469 Ga0495673_0074043 Ga0495673_0074043_78_1037 318
1526 3300047470 Ga0495681_0001327 Ga0495681_0001327_3876_4832 318
1527 3300047470 Ga0495681_0002119 Ga0495681_0002119_13_969 318
1528 3300047470 Ga0495681_0004330 Ga0495681_0004330_8739_9695 318
1529 3300047470 Ga0495681_0005466 Ga0495681_0005466_2481_3440 318
1530 3300047470 Ga0495681_0014330 Ga0495681_0014330_2099_3055 318
1531 3300047470 Ga0495681_0061521 Ga0495681_0061521_118_1074 318
1532 3300047472 Ga0495686_0088025 Ga0495686_0088025_852_1808 318
1533 3300047472 Ga0495686_0088724 Ga0495686_0088724_525_1484 318
1534 3300048091 Ga0495626_0000056 Ga0495626_0000056_147214_148173 318
1535 3300048091 Ga0495626_0001052 Ga0495626_0001052_16979_17935 318
1536 3300048091 Ga0495626_0001474 Ga0495626_0001474_3867_4823 318
1537 3300048091 Ga0495626_0001525 Ga0495626_0001525_2340_3296 318
1538 3300048091 Ga0495626_0002948 Ga0495626_0002948_44_1000 318
1539 3300048091 Ga0495626_0003635 Ga0495626_0003635_19_975 318
1540 3300048091 Ga0495626_0004137 Ga0495626_0004137_2343_3299 318
1541 3300048091 Ga0495626_0009473 Ga0495626_0009473_4118_5074 318
1542 3300048091 Ga0495626_0016825 Ga0495626_0016825_2507_3463 318
1543 3300048091 Ga0495626_0017201 Ga0495626_0017201_25_981 318
1544 3300048091 Ga0495626_0123335 Ga0495626_0123335_72_1028 318
1545 3300048904 Ga0496101_0267964 Ga0496101_0267964_263_1222 318
1546 3300048905 Ga0496102_0047483 Ga0496102_0047483_2071_3039 318
1547 3300048913 Ga0496110_0029079 Ga0496110_0029079_3189_4145 318
1548 3300048917 Ga0496114_0018708 Ga0496114_0018708_4497_5453 318
1549 3300048917 Ga0496114_0019375 Ga0496114_0019375_2829_3785 318
1550 3300048919 Ga0496116_0001669 Ga0496116_0001669_22_978 318
1551 3300048919 Ga0496116_0002562 Ga0496116_0002562_13759_14715 318
1552 3300048919 Ga0496116_0003077 Ga0496116_0003077_3876_4832 318
1553 3300048919 Ga0496116_0040547 Ga0496116_0040547_1869_2825 318
1554 3300048920 Ga0496117_0002620 Ga0496117_0002620_4744_5700 318
1555 3300048920 Ga0496117_0003939 Ga0496117_0003939_3869_4825 318
1556 3300048920 Ga0496117_0006411 Ga0496117_0006411_6506_7462 318
1557 3300048920 Ga0496117_0007875 Ga0496117_0007875_2324_3280 318
1558 3300048920 Ga0496117_0035911 Ga0496117_0035911_96_1052 318
1559 3300048920 Ga0496117_0125930 Ga0496117_0125930_96_1052 318
1560 3300048921 Ga0496118_0001807 Ga0496118_0001807_2550_3506 318
1561 3300048921 Ga0496118_0010787 Ga0496118_0010787_4846_5802 318
1562 3300048921 Ga0496118_0090361 Ga0496118_0090361_139_1095 318
1563 3300048921 Ga0496118_0097843 Ga0496118_0097843_384_1343 318
1564 3300048922 Ga0496119_0000112 Ga0496119_0000112_100992_101948 318
1565 3300048922 Ga0496119_0103631 Ga0496119_0103631_531_1487 318
1566 3300048923 Ga0496120_0004409 Ga0496120_0004409_7124_8080 318
1567 3300048923 Ga0496120_0166617 Ga0496120_0166617_95_1051 318
1568 3300048924 Ga0496121_0001283 Ga0496121_0001283_28590_29546 318
1569 3300048924 Ga0496121_0003009 Ga0496121_0003009_2440_3399 318
1570 3300048924 Ga0496121_0022025 Ga0496121_0022025_2514_3473 318
1571 3300048924 Ga0496121_0028786 Ga0496121_0028786_816_1772 318
1572 3300048924 Ga0496121_0233744 Ga0496121_0233744_220_1176 318
1573 3300048925 Ga0496122_0000122 Ga0496122_0000122_179173_180132 318
1574 3300048925 Ga0496122_0008288 Ga0496122_0008288_7290_8246 318
1575 3300048925 Ga0496122_0009298 Ga0496122_0009298_635_1591 318
1576 3300048925 Ga0496122_0026934 Ga0496122_0026934_1100_2059 318
1577 3300048926 Ga0496123_0000391 Ga0496123_0000391_11870_12826 318
1578 3300048926 Ga0496123_0000878 Ga0496123_0000878_13570_14526 318
1579 3300048926 Ga0496123_0001340 Ga0496123_0001340_20833_21792 318
1580 3300048926 Ga0496123_0012443 Ga0496123_0012443_5506_6465 318
1581 3300048926 Ga0496123_0046368 Ga0496123_0046368_1950_2909 318
1582 3300048927 Ga0496124_0000222 Ga0496124_0000222_47920_48879 318
1583 3300048927 Ga0496124_0001891 Ga0496124_0001891_79_1035 318
1584 3300048927 Ga0496124_0010141 Ga0496124_0010141_3821_4777 318
1585 3300048927 Ga0496124_0012924 Ga0496124_0012924_3066_4022 318
1586 3300048927 Ga0496124_0016180 Ga0496124_0016180_1189_2145 318
1587 3300048927 Ga0496124_0034180 Ga0496124_0034180_413_1369 318
1588 3300048927 Ga0496124_0049308 Ga0496124_0049308_2589_3545 318
1589 3300048927 Ga0496124_0058510 Ga0496124_0058510_2048_3007 318
1590 3300048927 Ga0496124_0073840 Ga0496124_0073840_1273_2232 318
1591 3300048927 Ga0496124_0102408 Ga0496124_0102408_1318_2277 318
1592 3300048927 Ga0496124_0173580 Ga0496124_0173580_46_1002 318
1593 3300048927 Ga0496124_0179691 Ga0496124_0179691_28_984 318
1594 3300048928 Ga0496125_0000908 Ga0496125_0000908_33325_34281 318
1595 3300048928 Ga0496125_0027866 Ga0496125_0027866_4103_5059 318
1596 3300048928 Ga0496125_0027889 Ga0496125_0027889_3877_4833 318
1597 3300048928 Ga0496125_0042239 Ga0496125_0042239_2561_3517 318
1598 3300048928 Ga0496125_0046158 Ga0496125_0046158_2657_3613 318
1599 3300048928 Ga0496125_0232512 Ga0496125_0232512_53_1009 318
1600 3300048929 Ga0496126_0015473 Ga0496126_0015473_4400_5356 318
1601 3300048929 Ga0496126_0040844 Ga0496126_0040844_2308_3264 318
1602 3300048929 Ga0496126_0062444 Ga0496126_0062444_23_979 318
1603 3300049459 Ga0495678_000031 Ga0495678_000031_86880_87839 318
1604 3300049459 Ga0495678_000039 Ga0495678_000039_149415_150374 318
1605 3300049459 Ga0495678_005928 Ga0495678_005928_2902_3858 318
1606 3300049459 Ga0495678_008574 Ga0495678_008574_1060_2016 318
1607 3300049459 Ga0495678_008769 Ga0495678_008769_1014_1970 318
1608 3300049459 Ga0495678_011885 Ga0495678_011885_2149_3108 318
1609 3300049459 Ga0495678_012838 Ga0495678_012838_64_1020 318
1610 3300049459 Ga0495678_015738 Ga0495678_015738_91_1047 318
1611 3300049459 Ga0495678_052291 Ga0495678_052291_53_1012 318
1612 3300049459 Ga0495678_068829 Ga0495678_068829_20_976 318
1613 3300049459 Ga0495678_086545 Ga0495678_086545_81_1037 318
1614 3300049460 Ga0495682_0000577 Ga0495682_0000577_12468_13424 318
1615 3300049460 Ga0495682_0004465 Ga0495682_0004465_2529_3488 318
1616 3300049571 Ga0501034_0000137 Ga0501034_0000137_109530_110486 318
1617 3300049573 Ga0501037_0042957 Ga0501037_0042957_1728_2696 318
1618 3300053125 Ga0500618_022861 Ga0500618_022861_76_1032 318
1619 3300053135 Ga0500659_0021849 Ga0500659_0021849_2126_3082 318
1620 3300053140 Ga0500573_0024813 Ga0500573_0024813_1904_2863 318
1621 iso_pu_bacteria 2808606373 2808904592 318
1622 iso_pu_bacteria 640427133 640487193 318

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08003

Methyltransf_9

Protein of unknown function (DUF1698)

7

322

0.99

PF08241

Methyltransf_11

Methyltransferase domain

127

224

0.89

PF13649

Methyltransf_25

Methyltransferase domain

126

220

0.83

PF13847

Methyltransf_31

Methyltransferase domain

121

292

0.81

PF13489

Methyltransf_23

Methyltransferase domain

104

272

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p7c-assembly1.cif.gz_B crystal structure of putative methyltransferase from pseudomonas syringae pv. tomato 0.9881 1 318
4p7c-assembly1.cif.gz_B crystal structure of putative methyltransferase from pseudomonas syringae pv. tomato 0.9851 1 318
4qnu-assembly1.cif.gz_A crystal structure of cmob bound with cx-sam in p21212 0.9574 1 318
4qnx-assembly1.cif.gz_A crystal structure of apo-cmob 0.9571 2 318
4qnv-assembly2.cif.gz_B crystal structure of cx-sam bound cmob from e. coli in p6122 0.9564 1 318
ID Description Score Start End Superfamily
af_P76291_95_323_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9802 94 318 3.40.50.150
af_P76291_95_323_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9591 94 318 3.40.50.150
af_K7LTE4_237_888_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.843 104 178 3.40.50.150
af_K7KE15_1_124_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8086 109 231 3.40.50.150
af_Q9GYH9_14_196_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.808 102 220 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A376RHE7-F1-model_v4 Putative methyltransferase (EC 2.1.1.-) 0.992 209 318 GO:0008168
GO:0032259
AF-A0A352IUG6-F1-model_v4 tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB 0.9916 121 318 GO:0002098
GO:0016765
AF-A0A520R8T8-F1-model_v4 DUF1698 domain-containing protein 0.9915 174 317
AF-A0A657B0A0-F1-model_v4 tRNA 5-methoxyuridine(34) synthase CmoB 0.9837 46 318 GO:0002098
GO:0008168
GO:0016765
AF-A0A352IUG6-F1-model_v4 tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB 0.9818 121 318 GO:0002098
GO:0016765

Feature Viewer

pLDDT pTM Quality
95.64 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map