metagRoot

F495092

General Info

Members	Datasets	Scaffolds	Average Seq Length
1624	688	1432	124

Family's Representative Sequence

Representative Sequence	3300015262\|Ga0182007_10008889\|Ga0182007_100088892
Length	151
Sequence	MTGFSIALALHTPGEIMFDHVKFGVSDYAASKAFFLKALEPLGVAIDTDWPQTCGVELIGPTSKASLCLYQTEEKPARLHLAFTAKNRQQVDAFYRAALEAGGKDNGAPGLRPRYHANYYAAFVIGPDGHNIEVVCQEYDEESAGLAMQPR

Samples

	Sample ID	Description	Type	Environment
1	2510065057	Sinorhizobium meliloti WSM1022	Isolate	Nodule
2	2511231052	Sinorhizobium meliloti AK58	Isolate	Nodule
3	2512047086	Sinorhizobium arboris LMG 14919	Isolate	Nodule
4	2512875026	Sinorhizobium medicae WSM1115	Isolate	Nodule
5	2513237086	Sinorhizobium meliloti MVII-I	Isolate	Nodule
6	2513237089	Sinorhizobium medicae DI28	Isolate	Nodule
7	2513237140	Sinorhizobium meliloti GVPV12	Isolate	Nodule
8	2513237143	Sinorhizobium meliloti Mlalz-1	Isolate	Nodule
9	2513237156	Sinorhizobium medicae WSM1369	Isolate	Nodule
10	2513237160	Sinorhizobium medicae WSM244	Isolate	Nodule
11	2515154107	Sinorhizobium meliloti 4H41	Isolate	Nodule
12	2516653046	Sinorhizobium meliloti BO21CC	Isolate	Nodule
13	2517487022	Sinorhizobium medicae WSM4191	Isolate	Nodule
14	2524023207	Ensifer sp. USDA 6670	Isolate	Nodule
15	2551306084	Sinorhizobium meliloti 5A14	Isolate	Nodule
16	2551306085	Sinorhizobium meliloti AE608H	Isolate	Nodule
17	2551306086	Sinorhizobium meliloti AK11	Isolate	Nodule
18	2551306087	Sinorhizobium meliloti A0643DD	Isolate	Nodule
19	2551306089	Sinorhizobium meliloti 1A42	Isolate	Nodule
20	2551306090	Sinorhizobium meliloti A0641M	Isolate	Nodule
21	2551306092	Sinorhizobium meliloti AK75	Isolate	Nodule
22	2551306093	Sinorhizobium meliloti C0438LL	Isolate	Nodule
23	2582581306	Rhizobium sp. YR295	Isolate	Rhizosphere
24	2582581865	Rhizobium sp. CF258	Isolate	Rhizosphere
25	2599185239	Burkholderia sp. NFACC38-1	Isolate	Rhizoplane
26	2643221618	Ensifer sp. Root231	Isolate	Unclassified
27	2643221626	Ensifer sp. Root31	Isolate	Unclassified
28	2643221655	Ensifer sp. Root1252	Isolate	Unclassified
29	2643221659	Ensifer sp. Root127	Isolate	Unclassified
30	2643221698	Ensifer sp. Root142	Isolate	Unclassified
31	2643221712	Ensifer sp. Root258	Isolate	Unclassified
32	2767802442	Phyllobacterium brassicacearum 29-15	Isolate	Rhizoplane
33	2775506902	Phyllobacterium zundukense Tri-48	Isolate	Unclassified
34	2775506904	Phyllobacterium zundukense Tri-38	Isolate	Unclassified
35	2791355091	Sinorhizobium sp. FG01	Isolate	Nodule
36	2791355092	Sinorhizobium sp. NG07B	Isolate	Nodule
37	2802428858	Sinorhizobium medicae M14-1	Isolate	Nodule
38	2802428861	Sinorhizobium medicae USDA1037	Isolate	Nodule
39	2802428862	Sinorhizobium medicae M7-4	Isolate	Nodule
40	2802428863	Sinorhizobium medicae M26-2	Isolate	Nodule
41	2831265667	Variovorax guangxiensis DSM 27352	Isolate	Rhizosphere
42	2838054893	Variovorax guangxiensis 34/80	Isolate	Nodule
43	2838074704	Sinorhizobium terangae SEMIA 6460	Isolate	Unclassified
44	2839993093	Phyllobacterium endophyticum PEPV15	Isolate	Unclassified
45	2840764183	Phyllobacterium sophorae CCBAU 03422	Isolate	Unclassified
46	2844163670	Ensifer sp. 1H6	Isolate	Unclassified
47	2855825444	Sinorhizobium meliloti CXM1-105	Isolate	Nodule
48	2855839649	Sinorhizobium meliloti AK555	Isolate	Unclassified
49	2858800743	Sinorhizobium meliloti AK170	Isolate	Unclassified
50	2885192300	Variovorax sp. MHTC-1	Isolate	Rhizosphere
51	2896384573	Ensifer sp. MPMI2T	Isolate	Unclassified
52	2904578770	Phyllobacterium sp. 586	Isolate	Unclassified
53	2915980308	Sinorhizobium medicae USDA1149	Isolate	Nodule
54	2915986958	Sinorhizobium meliloti USDA1659	Isolate	Nodule
55	2915993759	Sinorhizobium meliloti USDA1336	Isolate	Nodule
56	2916007675	Sinorhizobium meliloti USDA1289	Isolate	Nodule
57	2916014648	Sinorhizobium meliloti USDA1583	Isolate	Nodule
58	2916021584	Sinorhizobium meliloti USDA1550	Isolate	Nodule
59	2916035215	Sinorhizobium meliloti 3011	Isolate	Nodule
60	2916041962	Sinorhizobium meliloti USDA1795	Isolate	Nodule
61	2916048683	Sinorhizobium meliloti USDA1796	Isolate	Nodule
62	2916061851	Sinorhizobium medicae USDA1638	Isolate	Nodule
63	2916068649	Sinorhizobium meliloti USDA1220	Isolate	Nodule
64	2916076590	Sinorhizobium meliloti USDA1661	Isolate	Nodule
65	2919119836	Phyllobacterium sp. 1468	Isolate	Rhizosphere
66	2921201388	Sinorhizobium meliloti USDA1692	Isolate	Nodule
67	2921208531	Sinorhizobium meliloti USDA1660	Isolate	Nodule
68	2921237296	Sinorhizobium meliloti USDA1508	Isolate	Nodule
69	2921244191	Sinorhizobium meliloti 2119	Isolate	Nodule
70	2921250672	Sinorhizobium medicae USDA1169	Isolate	Nodule
71	2921282425	Sinorhizobium meliloti USDA1203	Isolate	Nodule
72	2921289301	Sinorhizobium meliloti USDA1730	Isolate	Nodule
73	2921296804	Sinorhizobium meliloti USDA1200	Isolate	Nodule
74	2924144063	Sinorhizobium meliloti USDA1022	Isolate	Nodule
75	2924150972	Sinorhizobium meliloti USDA1700	Isolate	Nodule
76	2924158325	Sinorhizobium meliloti USDA1146	Isolate	Nodule
77	2924165586	Sinorhizobium meliloti USDA1264	Isolate	Nodule
78	2924186466	Sinorhizobium meliloti USDA1389	Isolate	Nodule
79	2924193448	Sinorhizobium meliloti USDA1158	Isolate	Nodule
80	2924200457	Sinorhizobium meliloti USDA1007	Isolate	Nodule
81	2924214083	Sinorhizobium meliloti USDA1702	Isolate	Nodule
82	2924221636	Sinorhizobium meliloti USDA1416	Isolate	Nodule
83	2924228884	Sinorhizobium meliloti USDA1581	Isolate	Nodule
84	2936996657	Sinorhizobium meliloti USDA1025	Isolate	Nodule
85	2937002841	Sinorhizobium meliloti USDA1006	Isolate	Nodule
86	2937009748	Sinorhizobium meliloti USDA1162	Isolate	Nodule
87	2937016420	Sinorhizobium meliloti USDA1027	Isolate	Nodule
88	2937029754	Sinorhizobium medicae USDA1624	Isolate	Nodule
89	2937036028	Sinorhizobium medicae USDA1608	Isolate	Nodule
90	2937049772	Sinorhizobium meliloti USDA1691	Isolate	Nodule
91	2937056579	Sinorhizobium meliloti USDA1357	Isolate	Nodule
92	2937063883	Sinorhizobium meliloti USDA1808	Isolate	Nodule
93	2937071275	Sinorhizobium meliloti USDA1623	Isolate	Nodule
94	2937078374	Sinorhizobium medicae USDA1004	Isolate	Nodule
95	2937084907	Sinorhizobium medicae USDA1664	Isolate	Nodule
96	2937091812	Sinorhizobium meliloti USDA1221	Isolate	Nodule
97	2937098957	Sinorhizobium meliloti USDA1519	Isolate	Nodule
98	2937106411	Sinorhizobium meliloti USDA1214	Isolate	Nodule
99	2937113482	Sinorhizobium meliloti USDA1180	Isolate	Nodule
100	2937119839	Sinorhizobium meliloti USDA1790	Isolate	Nodule
101	2957375807	Sinorhizobium medicae USDA1632	Isolate	Nodule
102	2957382221	Sinorhizobium meliloti USDA1919	Isolate	Nodule
103	2957388812	Sinorhizobium meliloti USDA1195	Isolate	Nodule
104	2957402308	Sinorhizobium meliloti USDA1794	Isolate	Nodule
105	2957408893	Sinorhizobium meliloti USDA1163	Isolate	Nodule
106	2957415311	Sinorhizobium meliloti USDA1724	Isolate	Nodule
107	2957422303	Sinorhizobium meliloti USDA1497	Isolate	Nodule
108	2957430029	Sinorhizobium meliloti USDA1590	Isolate	Nodule
109	2957437181	Sinorhizobium medicae USDA1694	Isolate	Nodule
110	2957443900	Sinorhizobium meliloti USDA1734	Isolate	Nodule
111	2957450854	Sinorhizobium meliloti USDA1655	Isolate	Nodule
112	2957457609	Sinorhizobium meliloti USDA1751	Isolate	Nodule
113	2957464669	Sinorhizobium meliloti USDA1520	Isolate	Nodule
114	2957471148	Sinorhizobium meliloti USDA1204	Isolate	Nodule
115	2957484790	Sinorhizobium meliloti USDA1464	Isolate	Nodule
116	2957491536	Sinorhizobium meliloti USDA1804	Isolate	Nodule
117	2957498199	Sinorhizobium meliloti USDA1561	Isolate	Nodule
118	2957505466	Sinorhizobium meliloti USDA1696	Isolate	Nodule
119	2960584000	Sinorhizobium meliloti USDA1530	Isolate	Nodule
120	2960591022	Sinorhizobium medicae USDA1066	Isolate	Nodule
121	2960597568	Sinorhizobium meliloti 3085	Isolate	Nodule
122	2960603979	Sinorhizobium meliloti USDA1580	Isolate	Nodule
123	2960610863	Sinorhizobium meliloti USDA1792	Isolate	Nodule
124	2960617483	Sinorhizobium meliloti USDA1719	Isolate	Nodule
125	2960631154	Sinorhizobium medicae USDA1629	Isolate	Nodule
126	2960637947	Sinorhizobium meliloti USDA1202	Isolate	Nodule
127	2960645483	Sinorhizobium meliloti USDA1703	Isolate	Nodule
128	2960652885	Sinorhizobium meliloti USDA1199	Isolate	Nodule
129	2960660292	Sinorhizobium meliloti USDA1883	Isolate	Nodule
130	2960667422	Sinorhizobium meliloti USDA1170	Isolate	Nodule
131	2960674078	Sinorhizobium meliloti USDA1666	Isolate	Nodule
132	2960680706	Sinorhizobium medicae USDA1150	Isolate	Nodule
133	2960687367	Sinorhizobium meliloti USDA1462	Isolate	Nodule
134	2960693952	Sinorhizobium medicae USDA1630	Isolate	Nodule
135	2964607997	Sinorhizobium meliloti USDA1212	Isolate	Nodule
136	2964621998	Sinorhizobium meliloti USDA1235	Isolate	Nodule
137	2964636051	Sinorhizobium meliloti USDA1594	Isolate	Nodule
138	2964643177	Sinorhizobium meliloti USDA1760	Isolate	Nodule
139	2964649959	Sinorhizobium meliloti USDA1591	Isolate	Nodule
140	2964656573	Sinorhizobium meliloti USDA1308	Isolate	Nodule
141	2964678106	Sinorhizobium meliloti USDA1210	Isolate	Nodule
142	2964685014	Sinorhizobium meliloti USDA1232	Isolate	Nodule
143	2964698721	Sinorhizobium meliloti USDA1656	Isolate	Nodule
144	2964705432	Sinorhizobium meliloti USDA1614	Isolate	Nodule
145	2964712639	Sinorhizobium meliloti USDA1616	Isolate	Nodule
146	2964719344	Sinorhizobium meliloti USDA1456	Isolate	Nodule
147	2967664464	Sinorhizobium meliloti USDA1208	Isolate	Nodule
148	2967671571	Sinorhizobium meliloti USDA1496	Isolate	Nodule
149	2967678726	Sinorhizobium meliloti USDA1467	Isolate	Nodule
150	2967686174	Sinorhizobium medicae USDA1641	Isolate	Nodule
151	2967693043	Sinorhizobium meliloti USDA1183	Isolate	Nodule
152	2967706974	Sinorhizobium meliloti USDA1206	Isolate	Nodule
153	2967714385	Sinorhizobium meliloti USDA1023	Isolate	Nodule
154	2967721400	Sinorhizobium meliloti USDA1742	Isolate	Nodule
155	2967728569	Sinorhizobium medicae USDA1607	Isolate	Nodule
156	2967735183	Sinorhizobium meliloti USDA1710	Isolate	Nodule
157	2967742019	Sinorhizobium meliloti USDA1676	Isolate	Nodule
158	2967748971	Sinorhizobium meliloti USDA1024A	Isolate	Nodule
159	2967769361	Sinorhizobium meliloti USDA1005	Isolate	Nodule
160	2970019648	Sinorhizobium meliloti USDA1603	Isolate	Nodule
161	2970026789	Sinorhizobium medicae USDA1611	Isolate	Nodule
162	2970033650	Sinorhizobium meliloti USDA1565	Isolate	Nodule
163	2970040964	Sinorhizobium meliloti USDA1501	Isolate	Nodule
164	2970047711	Sinorhizobium meliloti USDA1793	Isolate	Nodule
165	2970054988	Sinorhizobium meliloti USDA1031	Isolate	Nodule
166	2970061556	Sinorhizobium meliloti USDA1810	Isolate	Nodule
167	2970068827	Sinorhizobium meliloti USDA1227	Isolate	Nodule
168	2970076120	Sinorhizobium meliloti USDA1706	Isolate	Nodule
169	2970088815	Sinorhizobium meliloti USDA1819	Isolate	Nodule
170	2970109326	Sinorhizobium meliloti USDA1186	Isolate	Nodule
171	2970116247	Sinorhizobium meliloti USDA1566	Isolate	Nodule
172	2970122695	Sinorhizobium medicae 3082	Isolate	Nodule
173	2970129317	Sinorhizobium meliloti USDA1008	Isolate	Nodule
174	2970136068	Sinorhizobium meliloti USDA1699	Isolate	Nodule
175	2970143518	Sinorhizobium medicae USDA1652	Isolate	Nodule
176	2970149975	Sinorhizobium meliloti USDA1215	Isolate	Nodule
177	2970156795	Sinorhizobium meliloti USDA1491	Isolate	Nodule
178	2970170962	Sinorhizobium meliloti USDA1571	Isolate	Nodule
179	2970177841	Sinorhizobium meliloti USDA1533	Isolate	Nodule
180	2970184632	Sinorhizobium meliloti USDA1593	Isolate	Nodule
181	2970191845	Sinorhizobium meliloti USDA1187	Isolate	Nodule
182	2977516862	Sinorhizobium meliloti USDA1791	Isolate	Nodule
183	2977523885	Sinorhizobium meliloti USDA1777	Isolate	Nodule
184	2977530762	Sinorhizobium medicae USDA1606	Isolate	Nodule
185	2977537788	Sinorhizobium meliloti USDA1184	Isolate	Nodule
186	2977544691	Sinorhizobium medicae USDA1631	Isolate	Nodule
187	2977551784	Sinorhizobium meliloti USDA1035	Isolate	Nodule
188	2977558990	Sinorhizobium meliloti USDA1222	Isolate	Nodule
189	2977572785	Sinorhizobium meliloti USDA1767	Isolate	Nodule
190	2977579622	Sinorhizobium meliloti USDA1161	Isolate	Nodule
191	3300001915	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7	Metagenome	Rhizosphere
192	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
193	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
194	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
195	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
196	3300002126	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5	Metagenome	Rhizosphere
197	3300002155	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7	Metagenome	Rhizosphere
198	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
199	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
200	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
201	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
202	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
203	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
204	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
205	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
206	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
207	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
208	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
209	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
210	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
211	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
212	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
213	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
214	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
215	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
216	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
217	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
218	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
219	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
220	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
221	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
222	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
223	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
224	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
225	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
226	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
227	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
228	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
229	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
230	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
231	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
232	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
233	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
234	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
235	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
236	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
237	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
238	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
239	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
240	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
241	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
242	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
243	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
244	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
245	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
246	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
247	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
248	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
249	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
250	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
251	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
252	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
253	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
254	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
255	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
256	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
257	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
258	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
259	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
260	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
261	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
262	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
263	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
264	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
265	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
266	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
267	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
268	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
269	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
270	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
271	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
272	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
273	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
274	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
275	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
276	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
277	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
278	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
279	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
280	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
281	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
282	3300005507	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2)	Metagenome	Rhizosphere
283	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
284	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
285	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
286	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
287	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
288	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
289	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
290	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
291	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
292	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
293	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
294	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
295	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
296	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
297	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
298	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
299	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
300	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
301	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
302	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
303	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
304	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
305	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
306	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
307	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
308	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
309	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
310	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
311	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
312	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
313	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
314	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
315	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
316	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
317	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
318	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
319	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
320	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
321	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
322	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
323	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
324	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
325	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
326	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
327	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
328	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
329	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
330	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
331	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
332	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
333	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
334	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
335	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
336	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
337	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
338	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
339	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
340	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
341	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
342	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
343	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
344	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
345	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
346	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
347	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
348	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
349	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
350	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
351	3300012491	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610	Metagenome	Rhizosphere
352	3300012500	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610	Metagenome	Rhizosphere
353	3300012503	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R	Metagenome	Rhizosphere
354	3300012508	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510	Metagenome	Rhizosphere
355	3300012513	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510	Metagenome	Rhizosphere
356	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
357	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
358	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
359	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
360	3300013249	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06	Metagenome	Rhizosphere
361	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
362	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
363	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
364	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
365	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
366	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
367	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
368	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
369	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
370	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
371	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
372	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
373	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
374	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
375	3300015690	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05	Metagenome	Rhizosphere
376	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
377	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
378	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
379	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
380	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
381	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
382	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
383	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
384	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
385	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
386	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
387	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
388	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
389	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
390	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
391	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
392	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
393	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
394	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
395	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
396	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
397	3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
398	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
399	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
400	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
401	3300025290	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2)	Metagenome	Rhizosphere
402	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
403	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
404	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
405	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
406	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
407	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
408	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
409	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
410	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
411	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
412	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
413	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
414	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
415	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
416	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
417	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
418	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
419	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
420	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
421	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
422	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
423	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
424	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
425	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
426	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
427	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
428	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
429	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
430	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
431	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
432	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
433	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
434	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
435	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
436	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
437	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
438	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
439	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
440	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
441	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
442	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
443	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
444	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
445	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
446	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
447	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
448	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
449	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
450	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
451	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
452	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
453	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
454	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
455	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
456	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
457	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
458	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
459	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
460	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
461	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
462	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
463	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
464	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
465	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
466	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
467	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
468	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
469	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
470	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
471	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
472	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
473	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
474	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
475	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
476	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
477	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
478	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
479	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
480	3300027424	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
481	3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2)	Metagenome	Rhizosphere
482	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
483	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
484	3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
485	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
486	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
487	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
488	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
489	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
490	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
491	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
492	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
493	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
494	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
495	3300030763	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
496	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
497	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
498	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
499	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
500	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
501	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
502	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
503	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
504	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
505	3300031889	Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO	Metagenome	Rhizosphere
506	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
507	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
508	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
509	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
510	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
511	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
512	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
513	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
514	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
515	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
516	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
517	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
518	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
519	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
520	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
521	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
522	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
523	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
524	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
525	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
526	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
527	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
528	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
529	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
530	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
531	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
532	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
533	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
534	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
535	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
536	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
537	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
538	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
539	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
540	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
541	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
542	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
543	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
544	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
545	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
546	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
547	3300041463	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG	Metagenome	Rhizoplane
548	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
549	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
550	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
551	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
552	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
553	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
554	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
555	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
556	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
557	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
558	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
559	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
560	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
561	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
562	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
563	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
564	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
565	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
566	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
567	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
568	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
569	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
570	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
571	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
572	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
573	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
574	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
575	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
576	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
577	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
578	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
579	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
580	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
581	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
582	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
583	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
584	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
585	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
586	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
587	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
588	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
589	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
590	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
591	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
592	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
593	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
594	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
595	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
596	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
597	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
598	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
599	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
600	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
601	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
602	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
603	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
604	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
605	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
606	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
607	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
608	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
609	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
610	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
611	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
612	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
613	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
614	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
615	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
616	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
617	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
618	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
619	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
620	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
621	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
622	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
623	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
624	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
625	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
626	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
627	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
628	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
629	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
630	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
631	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
632	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
633	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
634	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
635	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
636	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
637	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
638	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
639	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
640	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
641	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
642	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
643	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
644	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
645	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
646	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
647	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
648	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
649	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
650	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
651	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
652	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
653	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
654	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
655	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
656	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
657	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
658	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
659	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
660	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
661	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
662	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
663	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
664	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
665	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
666	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
667	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
668	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
669	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
670	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
671	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
672	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
673	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
674	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
675	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
676	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
677	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
678	3300053144	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere	Metagenome	Endosphere
679	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
680	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
681	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
682	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
683	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
684	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
685	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
686	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
687	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
688	8003999396	Sinorhizobium medicae WSM1115	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	87.87
Metatranscriptomes	0.31
Isolates	11.82

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	10.59
Nodule	10.65
Rhizoplane	3.14
Rhizosphere	71.49
Stem	0
Stem Tuber	0
Unclassified	4.13

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24741J21665_1003721	3300001915	Bacteria	3555
2	JGI24743J22301_10010877	3300001991	Bacteria	1629
3	JGI24735J21928_10047634	3300002067	Bacteria	1242
4	JGI24750J21931_1024712	3300002070	Bacteria	858
5	JGI24749J21850_1003526	3300002076	Bacteria	2185
6	JGI24035J26624_1036167	3300002126	Bacteria	546
7	JGI24033J26618_1025896	3300002155	Bacteria	771
8	JGI24034J26672_10115352	3300002239	Bacteria	516
9	JGI24751J29686_10029346	3300002459	Bacteria	1142
10	JGI25156J39149_1001320	3300002705	Bacteria	10722
11	JGI25162J39368_1000709	3300002737	Bacteria	23155
12	JGI25154J39366_1008173	3300002738	Bacteria	1368
13	JGI25158J39367_1008708	3300002739	Bacteria	1404
14	JGI25157J39369_1000682	3300002741	Bacteria	18475
15	JGI25157J39369_1000870	3300002741	Bacteria	14626
16	JGI25157J39369_1000987	3300002741	Bacteria	13315
17	JGI25164J39214_1000149	3300002772	Bacteria	67364
18	JGI25152J39213_1001782	3300002773	Bacteria	8760
19	JGI25159J45721_1000010	3300002987	Bacteria	162590
20	JGI25159J45721_1008606	3300002987	Bacteria	2786
21	JGI25151J46595_10016204	3300003187	Bacteria	3264
22	JGI25151J46595_10016935	3300003187	Bacteria	3176
23	JGI25151J46595_10056894	3300003187	Bacteria	1279
24	JGI25165J46597_1000088	3300003214	Bacteria	169821
25	JGI25153J46596_10000074	3300003215	Bacteria	114400
26	JGI25153J46596_10012678	3300003215	Bacteria	3613
27	rootL2_10172026	3300003322	Bacteria	4145
28	rootH1_10268562	3300003323	Bacteria	1609
29	JGI25160J50197_1000038	3300003354	Bacteria	162590
30	JGI25160J50197_1009866	3300003354	Bacteria	3502
31	JGI25161J50226_1001278	3300003374	Bacteria	8011
32	JGI25161J50226_1001392	3300003374	Bacteria	7365
33	Ga0006562J51391_1079420	3300003578	Bacteria	1619
34	Ga0055539_1001744	3300003752	Bacteria	3779
35	Ga0055525_1000132	3300003759	Bacteria	109752
36	Ga0055527_1000056	3300003760	Bacteria	97841
37	Ga0055527_1000073	3300003760	Bacteria	83327
38	Ga0055527_1002693	3300003760	Bacteria	2889
39	Ga0055535_1000080	3300003761	Bacteria	108370
40	Ga0055535_1001006	3300003761	Bacteria	18023
41	Ga0055535_1001047	3300003761	Bacteria	17347
42	Ga0055542_1000130	3300003762	Bacteria	97841
43	Ga0055542_1000155	3300003762	Bacteria	86663
44	Ga0055542_1000165	3300003762	Bacteria	83314
45	Ga0055529_1000182	3300003763	Bacteria	86667
46	Ga0055529_1000194	3300003763	Bacteria	83314
47	Ga0055529_1001217	3300003763	Bacteria	10025
48	Ga0055529_1001571	3300003763	Bacteria	6393
49	Ga0055526_1001706	3300003771	Bacteria	15332
50	Ga0055526_1009175	3300003771	Bacteria	4807
51	Ga0055526_1015717	3300003771	Bacteria	3019
52	Ga0055526_1026815	3300003771	Bacteria	1803
53	Ga0055537_1000022	3300003773	Bacteria	114484
54	Ga0055537_1003070	3300003773	Bacteria	5260
55	Ga0055524_1001073	3300003775	Bacteria	16793
56	Ga0055536_1002194	3300003781	Bacteria	11122
57	Ga0055536_1022344	3300003781	Bacteria	1890
58	Ga0055536_1064444	3300003781	Bacteria	746
59	Ga0055534_1000067	3300003784	Bacteria	80905
60	Ga0055534_1007604	3300003784	Bacteria	2558
61	Ga0055534_1053727	3300003784	Bacteria	569
62	Ga0055528_1000037	3300003790	Bacteria	116318
63	Ga0055528_1016768	3300003790	Bacteria	2570
64	Ga0055530_10000342	3300003791	Bacteria	42139
65	Ga0055540_1001923	3300003792	Bacteria	11609
66	Ga0055531_10002643	3300003794	Bacteria	11837
67	JGI25405J52794_10092026	3300003911	Bacteria	672
68	Ga0055543_1000170	3300004625	Bacteria	54692
69	Ga0055543_1000674	3300004625	Bacteria	17821
70	Ga0065165_1000077	3300005262	Bacteria	162630
71	Ga0065714_10130868	3300005288	Bacteria	1212
72	Ga0065704_10006391	3300005289	Bacteria	5105
73	Ga0065704_10167588	3300005289	Bacteria	1312
74	Ga0065704_10406949	3300005289	Bacteria	726
75	Ga0065712_10031730	3300005290	Bacteria	830
76	Ga0065712_10041918	3300005290	Bacteria	898
77	Ga0065712_10042483	3300005290	Bacteria	799
78	Ga0065712_10052520	3300005290	Bacteria	807
79	Ga0065712_10122246	3300005290	Bacteria	1654
80	Ga0065712_10216933	3300005290	Bacteria	1054
81	Ga0065715_10153311	3300005293	Bacteria	1704
82	Ga0065715_10198402	3300005293	Bacteria	1375
83	Ga0065715_10225666	3300005293	Bacteria	1254
84	Ga0065715_10243472	3300005293	Bacteria	1191
85	Ga0065715_10899125	3300005293	Bacteria	563
86	Ga0065707_10125710	3300005295	Bacteria	2018
87	Ga0065707_10211743	3300005295	Bacteria	1262
88	Ga0065707_10576670	3300005295	Bacteria	693
89	Ga0070658_10253542	3300005327	Bacteria	1493
90	Ga0070658_10407202	3300005327	Bacteria	1169
91	Ga0070676_10008189	3300005328	Bacteria	5625
92	Ga0070676_10011526	3300005328	Bacteria	4807
93	Ga0070676_10100288	3300005328	Bacteria	1787
94	Ga0070676_10169899	3300005328	Bacteria	1409
95	Ga0070676_10173774	3300005328	Bacteria	1396
96	Ga0070676_10668756	3300005328	Bacteria	755
97	Ga0070683_100007568	3300005329	Bacteria	9183
98	Ga0070683_100154332	3300005329	Bacteria	2177
99	Ga0070683_101821431	3300005329	Bacteria	585
100	Ga0070690_100034876	3300005330	Bacteria	3155
101	Ga0070690_100128150	3300005330	Bacteria	1711
102	Ga0070690_100718028	3300005330	Bacteria	769
103	Ga0070670_100015973	3300005331	Bacteria	6442
104	Ga0070670_100019356	3300005331	Bacteria	5840
105	Ga0070670_100019822	3300005331	Bacteria	5774
106	Ga0070670_100021476	3300005331	Bacteria	5553
107	Ga0070670_100037020	3300005331	Bacteria	4198
108	Ga0070670_100049079	3300005331	Bacteria	3630
109	Ga0070670_100052905	3300005331	Bacteria	3487
110	Ga0070670_100516439	3300005331	Bacteria	1063
111	Ga0070677_10004027	3300005333	Bacteria	4773
112	Ga0070677_10004579	3300005333	Bacteria	4521
113	Ga0070677_10018102	3300005333	Bacteria	2533
114	Ga0070677_10040230	3300005333	Bacteria	1839
115	Ga0070677_10310329	3300005333	Bacteria	804
116	Ga0068869_100013980	3300005334	Bacteria	5354
117	Ga0068869_100019057	3300005334	Bacteria	4681
118	Ga0068869_100021719	3300005334	Bacteria	4417
119	Ga0068869_100073415	3300005334	Bacteria	2536
120	Ga0068869_100286660	3300005334	Bacteria	1326
121	Ga0070666_10009277	3300005335	Bacteria	6131
122	Ga0070666_10086446	3300005335	Bacteria	2148
123	Ga0070666_10117890	3300005335	Bacteria	1839
124	Ga0070666_10593946	3300005335	Bacteria	807
125	Ga0070680_100294389	3300005336	Bacteria	1376
126	Ga0070680_101376523	3300005336	Bacteria	611
127	Ga0070682_100022804	3300005337	Bacteria	3712
128	Ga0070682_100830984	3300005337	Bacteria	753
129	Ga0068868_100007539	3300005338	Bacteria	7749
130	Ga0068868_100066903	3300005338	Bacteria	2858
131	Ga0068868_100103776	3300005338	Bacteria	2303
132	Ga0068868_100145907	3300005338	Bacteria	1946
133	Ga0068868_100312576	3300005338	Bacteria	1337
134	Ga0068868_101203360	3300005338	Bacteria	701
135	Ga0068868_101229499	3300005338	Bacteria	693
136	Ga0068868_101554309	3300005338	Bacteria	621
137	Ga0070660_100019117	3300005339	Bacteria	5015
138	Ga0070660_100047825	3300005339	Bacteria	3284
139	Ga0070660_100111707	3300005339	Bacteria	2174
140	Ga0070660_100398686	3300005339	Bacteria	1137
141	Ga0070689_100015605	3300005340	Bacteria	5543
142	Ga0070689_100072515	3300005340	Bacteria	2691
143	Ga0070689_100118176	3300005340	Bacteria	2115
144	Ga0070689_100167182	3300005340	Bacteria	1781
145	Ga0070689_100349045	3300005340	Bacteria	1241
146	Ga0070689_100490573	3300005340	Bacteria	1051
147	Ga0070689_101238278	3300005340	Bacteria	671
148	Ga0070689_101366899	3300005340	Bacteria	639
149	Ga0070691_10005697	3300005341	Bacteria	5680
150	Ga0070691_10061048	3300005341	Bacteria	1813
151	Ga0070661_100003044	3300005344	Bacteria	11533
152	Ga0070661_100076042	3300005344	Bacteria	2475
153	Ga0070661_100691354	3300005344	Bacteria	830
154	Ga0070661_101064759	3300005344	Bacteria	673
155	Ga0070692_10107587	3300005345	Bacteria	1538
156	Ga0070692_10475712	3300005345	Bacteria	805
157	Ga0070668_100000491	3300005347	Bacteria	26147
158	Ga0070668_100054846	3300005347	Bacteria	3075
159	Ga0070668_100116601	3300005347	Bacteria	2130
160	Ga0070668_100144957	3300005347	Bacteria	1916
161	Ga0070668_100798208	3300005347	Bacteria	838
162	Ga0070669_100003095	3300005353	Bacteria	11969
163	Ga0070669_100049822	3300005353	Bacteria	3058
164	Ga0070669_100101141	3300005353	Bacteria	2174
165	Ga0070669_100176603	3300005353	Bacteria	1668
166	Ga0070669_100181526	3300005353	Bacteria	1646
167	Ga0070669_100502816	3300005353	Bacteria	1005
168	Ga0070669_100628739	3300005353	Bacteria	901
169	Ga0070669_100826116	3300005353	Bacteria	788
170	Ga0070669_101298308	3300005353	Bacteria	630
171	Ga0070675_100000918	3300005354	Bacteria	20968
172	Ga0070675_100000947	3300005354	Bacteria	20682
173	Ga0070675_100005561	3300005354	Bacteria	9648
174	Ga0070675_100011847	3300005354	Bacteria	6831
175	Ga0070675_100042787	3300005354	Bacteria	3701
176	Ga0070675_100097014	3300005354	Bacteria	2478
177	Ga0070675_100112504	3300005354	Bacteria	2305
178	Ga0070675_100142344	3300005354	Bacteria	2050
179	Ga0070675_100272197	3300005354	Bacteria	1486
180	Ga0070675_100505316	3300005354	Bacteria	1089
181	Ga0070675_100715288	3300005354	Bacteria	913
182	Ga0070675_100794995	3300005354	Bacteria	864
183	Ga0070671_100000507	3300005355	Bacteria	27204
184	Ga0070671_100000783	3300005355	Bacteria	22895
185	Ga0070671_100003070	3300005355	Bacteria	12982
186	Ga0070671_100010464	3300005355	Bacteria	7441
187	Ga0070671_100034578	3300005355	Bacteria	4183
188	Ga0070671_100079314	3300005355	Bacteria	2744
189	Ga0070671_100105263	3300005355	Bacteria	2368
190	Ga0070671_100336278	3300005355	Bacteria	1287
191	Ga0070671_100553001	3300005355	Bacteria	992
192	Ga0070671_101024099	3300005355	Bacteria	724
193	Ga0070671_101323168	3300005355	Bacteria	636
194	Ga0070674_100037757	3300005356	Bacteria	3251
195	Ga0070674_100059229	3300005356	Bacteria	2665
196	Ga0070674_100071892	3300005356	Bacteria	2448
197	Ga0070674_100733543	3300005356	Bacteria	847
198	Ga0070674_100840476	3300005356	Bacteria	796
199	Ga0070673_100013837	3300005364	Bacteria	5598
200	Ga0070673_100032258	3300005364	Bacteria	3942
201	Ga0070673_100053608	3300005364	Bacteria	3169
202	Ga0070673_100154542	3300005364	Bacteria	1946
203	Ga0070673_100157909	3300005364	Bacteria	1926
204	Ga0070673_100995309	3300005364	Bacteria	780
205	Ga0070688_100008641	3300005365	Bacteria	5543
206	Ga0070688_100008726	3300005365	Bacteria	5513
207	Ga0070688_100066192	3300005365	Bacteria	2299
208	Ga0070688_100140582	3300005365	Bacteria	1639
209	Ga0070688_100263868	3300005365	Bacteria	1231
210	Ga0070659_100001896	3300005366	Bacteria	14963
211	Ga0070659_100002053	3300005366	Bacteria	14376
212	Ga0070659_100112097	3300005366	Bacteria	2202
213	Ga0070659_100160380	3300005366	Bacteria	1838
214	Ga0070659_100341696	3300005366	Bacteria	1254
215	Ga0070659_100639338	3300005366	Bacteria	917
216	Ga0070667_100004706	3300005367	Bacteria	11444
217	Ga0070667_100018557	3300005367	Bacteria	5771
218	Ga0070667_100118897	3300005367	Bacteria	2297
219	Ga0070667_100148441	3300005367	Bacteria	2058
220	Ga0070667_100236420	3300005367	Bacteria	1630
221	Ga0070667_100285561	3300005367	Bacteria	1483
222	Ga0070667_100555070	3300005367	Bacteria	1056
223	Ga0070667_101095340	3300005367	Bacteria	744
224	Ga0070667_102232395	3300005367	Bacteria	515
225	Ga0070709_10442725	3300005434	Bacteria	977
226	Ga0070709_10501995	3300005434	Bacteria	921
227	Ga0070709_10626551	3300005434	Bacteria	830
228	Ga0070714_100017695	3300005435	Bacteria	5779
229	Ga0070714_100158971	3300005435	Bacteria	2043
230	Ga0070714_100213902	3300005435	Bacteria	1768
231	Ga0070714_100686337	3300005435	Bacteria	987
232	Ga0070713_100068890	3300005436	Bacteria	2982
233	Ga0070713_100101565	3300005436	Bacteria	2492
234	Ga0070713_100682531	3300005436	Bacteria	980
235	Ga0070713_102440110	3300005436	Bacteria	505
236	Ga0070710_10034831	3300005437	Bacteria	2741
237	Ga0070710_10237448	3300005437	Bacteria	1166
238	Ga0070710_10350253	3300005437	Bacteria	977
239	Ga0070711_100055697	3300005439	Bacteria	2732
240	Ga0070711_100084191	3300005439	Bacteria	2274
241	Ga0070705_100077113	3300005440	Bacteria	2034
242	Ga0070705_100394538	3300005440	Bacteria	1023
243	Ga0070700_100007013	3300005441	Bacteria	6051
244	Ga0070700_100010857	3300005441	Bacteria	5035
245	Ga0070700_100651458	3300005441	Bacteria	832
246	Ga0070700_101320981	3300005441	Bacteria	607
247	Ga0070694_100128240	3300005444	Bacteria	1829
248	Ga0070694_100240697	3300005444	Bacteria	1365
249	Ga0070694_100830784	3300005444	Bacteria	759
250	Ga0070708_100032399	3300005445	Bacteria	4534
251	Ga0070708_100358333	3300005445	Bacteria	1375
252	Ga0070708_100384999	3300005445	Bacteria	1322
253	Ga0070663_100220138	3300005455	Bacteria	1490
254	Ga0070663_100372798	3300005455	Bacteria	1161
255	Ga0070663_100447335	3300005455	Bacteria	1064
256	Ga0070678_100001053	3300005456	Bacteria	14439
257	Ga0070678_100006261	3300005456	Bacteria	6966
258	Ga0070678_100006494	3300005456	Bacteria	6867
259	Ga0070678_100007993	3300005456	Bacteria	6305
260	Ga0070678_100093381	3300005456	Bacteria	2313
261	Ga0070678_100201353	3300005456	Bacteria	1643
262	Ga0070678_101099120	3300005456	Bacteria	734
263	Ga0070662_100021365	3300005457	Bacteria	4418
264	Ga0070662_100044573	3300005457	Bacteria	3178
265	Ga0070662_100138720	3300005457	Bacteria	1882
266	Ga0070662_100318620	3300005457	Bacteria	1267
267	Ga0070662_100423124	3300005457	Bacteria	1102
268	Ga0070662_101407303	3300005457	Bacteria	601
269	Ga0070681_10010356	3300005458	Bacteria	9206
270	Ga0070681_10054517	3300005458	Bacteria	3984
271	Ga0070681_10272024	3300005458	Bacteria	1605
272	Ga0068867_100007738	3300005459	Bacteria	7597
273	Ga0068867_100012784	3300005459	Bacteria	5938
274	Ga0068867_100016651	3300005459	Bacteria	5221
275	Ga0068867_100382908	3300005459	Bacteria	1182
276	Ga0068867_100418463	3300005459	Bacteria	1134
277	Ga0068867_101046145	3300005459	Bacteria	743
278	Ga0068867_102213849	3300005459	Bacteria	522
279	Ga0070685_10006717	3300005466	Bacteria	5871
280	Ga0070685_10770485	3300005466	Bacteria	707
281	Ga0070706_100005592	3300005467	Bacteria	11957
282	Ga0070706_100551249	3300005467	Bacteria	1072
283	Ga0070707_100202975	3300005468	Bacteria	1932
284	Ga0070707_100579467	3300005468	Bacteria	1084
285	Ga0070698_100030290	3300005471	Bacteria	5611
286	Ga0070698_100083490	3300005471	Bacteria	3183
287	Ga0074259_11066839	3300005507	Bacteria	501
288	Ga0070699_100025260	3300005518	Bacteria	5122
289	Ga0070699_100637099	3300005518	Bacteria	973
290	Ga0070699_100639691	3300005518	Bacteria	971
291	Ga0070679_100064847	3300005530	Bacteria	3641
292	Ga0070679_100193774	3300005530	Bacteria	2000
293	Ga0070684_100008101	3300005535	Bacteria	8203
294	Ga0070684_100027650	3300005535	Bacteria	4790
295	Ga0070684_100080336	3300005535	Bacteria	2884
296	Ga0070684_100476996	3300005535	Bacteria	1154
297	Ga0070684_101968049	3300005535	Bacteria	552
298	Ga0070697_100644935	3300005536	Bacteria	932
299	Ga0068853_100020673	3300005539	Bacteria	5475
300	Ga0068853_100054356	3300005539	Bacteria	3450
301	Ga0068853_100232249	3300005539	Bacteria	1688
302	Ga0068853_102084012	3300005539	Bacteria	550
303	Ga0068853_102463840	3300005539	Bacteria	504
304	Ga0070672_100095925	3300005543	Bacteria	2399
305	Ga0070672_100258925	3300005543	Bacteria	1467
306	Ga0070672_100569796	3300005543	Bacteria	984
307	Ga0070672_100575293	3300005543	Bacteria	980
308	Ga0070672_100999452	3300005543	Bacteria	741
309	Ga0070686_100023620	3300005544	Bacteria	3677
310	Ga0070686_100044936	3300005544	Bacteria	2780
311	Ga0070686_100414435	3300005544	Bacteria	1028
312	Ga0070686_100635388	3300005544	Bacteria	845
313	Ga0070695_101321938	3300005545	Bacteria	596
314	Ga0070696_100051196	3300005546	Bacteria	2872
315	Ga0070696_100069218	3300005546	Bacteria	2479
316	Ga0070696_100824073	3300005546	Bacteria	765
317	Ga0070696_101017165	3300005546	Bacteria	693
318	Ga0070693_100004136	3300005547	Bacteria	6839
319	Ga0070693_100008092	3300005547	Bacteria	5163
320	Ga0070693_100034187	3300005547	Bacteria	2811
321	Ga0070693_100286783	3300005547	Bacteria	1105
322	Ga0070665_100017826	3300005548	Bacteria	7128
323	Ga0070665_100053676	3300005548	Bacteria	4042
324	Ga0070665_100067768	3300005548	Bacteria	3579
325	Ga0070665_100085420	3300005548	Bacteria	3161
326	Ga0070665_101138756	3300005548	Bacteria	791
327	Ga0070704_100035912	3300005549	Bacteria	3372
328	Ga0070704_100665542	3300005549	Bacteria	920
329	Ga0068855_100007796	3300005563	Bacteria	12932
330	Ga0068855_100015542	3300005563	Bacteria	9164
331	Ga0068855_100103709	3300005563	Bacteria	3272
332	Ga0068855_100524960	3300005563	Bacteria	1284
333	Ga0070664_100079343	3300005564	Bacteria	2825
334	Ga0070664_100134092	3300005564	Bacteria	2176
335	Ga0070664_100157942	3300005564	Bacteria	2005
336	Ga0070664_100217018	3300005564	Bacteria	1711
337	Ga0070664_100255966	3300005564	Bacteria	1575
338	Ga0070664_100916689	3300005564	Bacteria	822
339	Ga0070664_101492673	3300005564	Bacteria	639
340	Ga0068857_100055991	3300005577	Bacteria	3499
341	Ga0068857_100119480	3300005577	Bacteria	2372
342	Ga0068857_101045437	3300005577	Bacteria	787
343	Ga0068854_100031623	3300005578	Bacteria	3679
344	Ga0068854_100052642	3300005578	Bacteria	2920
345	Ga0068854_100163303	3300005578	Bacteria	1727
346	Ga0068854_100219572	3300005578	Bacteria	1503
347	Ga0068854_100321592	3300005578	Bacteria	1257
348	Ga0068854_100615377	3300005578	Bacteria	929
349	Ga0068854_100757113	3300005578	Bacteria	843
350	Ga0068854_101377336	3300005578	Bacteria	637
351	Ga0068856_100013142	3300005614	Bacteria	8021
352	Ga0068856_100049361	3300005614	Bacteria	4148
353	Ga0068856_100471292	3300005614	Bacteria	1276
354	Ga0068856_100522102	3300005614	Bacteria	1209
355	Ga0070702_100004431	3300005615	Bacteria	6412
356	Ga0070702_100031544	3300005615	Bacteria	2901
357	Ga0070702_100322699	3300005615	Bacteria	1077
358	Ga0068852_100002689	3300005616	Bacteria	12283
359	Ga0068852_100008728	3300005616	Bacteria	7493
360	Ga0068852_100161458	3300005616	Bacteria	2093
361	Ga0068852_100165757	3300005616	Bacteria	2067
362	Ga0068852_100590599	3300005616	Bacteria	1114
363	Ga0068852_100995917	3300005616	Bacteria	857
364	Ga0068852_101253611	3300005616	Bacteria	763
365	Ga0068852_101433060	3300005616	Bacteria	713
366	Ga0068852_101457152	3300005616	Bacteria	707
367	Ga0068859_100016585	3300005617	Bacteria	7396
368	Ga0068859_100019496	3300005617	Bacteria	6813
369	Ga0068859_100079301	3300005617	Bacteria	3323
370	Ga0068859_100179662	3300005617	Bacteria	2199
371	Ga0068859_100235221	3300005617	Bacteria	1920
372	Ga0068859_100727561	3300005617	Bacteria	1082
373	Ga0068859_100729663	3300005617	Bacteria	1080
374	Ga0068864_100002422	3300005618	Bacteria	15417
375	Ga0068864_100007276	3300005618	Bacteria	9103
376	Ga0068864_100016159	3300005618	Bacteria	6212
377	Ga0068864_100020881	3300005618	Bacteria	5481
378	Ga0068864_100525780	3300005618	Bacteria	1141
379	Ga0068864_100918945	3300005618	Bacteria	865
380	Ga0068866_10002879	3300005718	Bacteria	7086
381	Ga0068866_10003214	3300005718	Bacteria	6738
382	Ga0068866_10071389	3300005718	Bacteria	1836
383	Ga0068866_10205682	3300005718	Bacteria	1179
384	Ga0068861_100151615	3300005719	Bacteria	1903
385	Ga0068861_100259659	3300005719	Bacteria	1486
386	Ga0068861_100535295	3300005719	Bacteria	1065
387	Ga0068861_100650150	3300005719	Bacteria	974
388	Ga0068861_101012699	3300005719	Bacteria	793
389	Ga0068851_10015759	3300005834	Bacteria	3607
390	Ga0068851_10037917	3300005834	Bacteria	2417
391	Ga0068851_11082813	3300005834	Bacteria	508
392	Ga0068870_10005697	3300005840	Bacteria	5453
393	Ga0068870_10087270	3300005840	Bacteria	1737
394	Ga0068870_10123164	3300005840	Bacteria	1496
395	Ga0068870_10258988	3300005840	Bacteria	1081
396	Ga0068863_100012363	3300005841	Bacteria	8244
397	Ga0068863_100173515	3300005841	Bacteria	2069
398	Ga0068863_100197118	3300005841	Bacteria	1936
399	Ga0068863_100229195	3300005841	Bacteria	1791
400	Ga0068863_100251037	3300005841	Bacteria	1709
401	Ga0068863_100281086	3300005841	Bacteria	1612
402	Ga0068863_100478278	3300005841	Bacteria	1224
403	Ga0068863_100674163	3300005841	Bacteria	1026
404	Ga0068858_100004925	3300005842	Bacteria	13082
405	Ga0068858_100050249	3300005842	Bacteria	3859
406	Ga0068858_100230839	3300005842	Bacteria	1754
407	Ga0068858_100333637	3300005842	Bacteria	1451
408	Ga0068860_100019324	3300005843	Bacteria	6611
409	Ga0068860_100032398	3300005843	Bacteria	5022
410	Ga0068860_100333038	3300005843	Bacteria	1491
411	Ga0068862_100013472	3300005844	Bacteria	6769
412	Ga0068862_100236067	3300005844	Bacteria	1660
413	Ga0068862_100668146	3300005844	Bacteria	1004
414	Ga0068862_102247167	3300005844	Bacteria	557
415	Ga0068862_102394826	3300005844	Bacteria	540
416	Ga0081455_10005191	3300005937	Bacteria	14329
417	Ga0081455_10178363	3300005937	Bacteria	1611
418	Ga0081538_10162071	3300005981	Bacteria	992
419	Ga0081540_1003476	3300005983	Bacteria	12430
420	Ga0081539_10001350	3300005985	Bacteria	42708
421	Ga0081539_10046349	3300005985	Bacteria	2491
422	Ga0070717_10010419	3300006028	Bacteria	7019
423	Ga0075368_10435697	3300006042	Bacteria	579
424	Ga0075363_100517050	3300006048	Bacteria	710
425	Ga0075363_100548989	3300006048	Bacteria	689
426	Ga0075364_11260373	3300006051	Bacteria	501
427	Ga0070715_10264041	3300006163	Bacteria	905
428	Ga0070715_10361758	3300006163	Bacteria	796
429	Ga0070712_100181258	3300006175	Bacteria	1641
430	Ga0070712_100360914	3300006175	Bacteria	1191
431	Ga0070712_100978872	3300006175	Bacteria	731
432	Ga0075362_10372835	3300006177	Bacteria	717
433	Ga0075362_10561508	3300006177	Bacteria	587
434	Ga0075366_10043852	3300006195	Bacteria	2650
435	Ga0075366_10053491	3300006195	Bacteria	2398
436	Ga0075366_10067280	3300006195	Bacteria	2132
437	Ga0075366_10177863	3300006195	Bacteria	1292
438	Ga0075366_10788463	3300006195	Bacteria	591
439	Ga0097621_100011459	3300006237	Bacteria	6530
440	Ga0097621_100035492	3300006237	Bacteria	3985
441	Ga0097621_100041083	3300006237	Bacteria	3721
442	Ga0097621_100052853	3300006237	Bacteria	3310
443	Ga0097621_100102499	3300006237	Bacteria	2409
444	Ga0097621_100522570	3300006237	Bacteria	1077
445	Ga0075370_10003187	3300006353	Bacteria	7764
446	Ga0075370_10103505	3300006353	Bacteria	1649
447	Ga0075370_10266437	3300006353	Bacteria	1016
448	Ga0068871_100001983	3300006358	Bacteria	13870
449	Ga0068871_100007969	3300006358	Bacteria	7599
450	Ga0068871_100031166	3300006358	Bacteria	4203
451	Ga0068871_100182354	3300006358	Bacteria	1805
452	Ga0068871_100283213	3300006358	Bacteria	1450
453	Ga0068871_100583119	3300006358	Bacteria	1015
454	Ga0068871_101497377	3300006358	Bacteria	637
455	Ga0068871_101686408	3300006358	Bacteria	601
456	Ga0068871_101799924	3300006358	Bacteria	581
457	Ga0075428_100035549	3300006844	Bacteria	5492
458	Ga0075431_100907499	3300006847	Bacteria	850
459	Ga0075433_10008737	3300006852	Bacteria	8082
460	Ga0075434_100287196	3300006871	Bacteria	1665
461	Ga0075434_100665919	3300006871	Bacteria	1059
462	Ga0075434_100878373	3300006871	Bacteria	912
463	Ga0075429_100192544	3300006880	Bacteria	1786
464	Ga0075429_101822993	3300006880	Bacteria	528
465	Ga0068865_100389662	3300006881	Bacteria	1138
466	Ga0068865_101007643	3300006881	Bacteria	730
467	Ga0068865_101706610	3300006881	Bacteria	568
468	Ga0097620_100016585	3300006931	Bacteria	7396
469	Ga0097620_100019496	3300006931	Bacteria	6813
470	Ga0097620_100079300	3300006931	Bacteria	3323
471	Ga0097620_100179653	3300006931	Bacteria	2199
472	Ga0097620_100235227	3300006931	Bacteria	1920
473	Ga0097620_100727598	3300006931	Bacteria	1082
474	Ga0097620_100729746	3300006931	Bacteria	1080
475	Ga0079104_1018047	3300006946	Bacteria	2009
476	Ga0105251_10005500	3300009011	Bacteria	8254
477	Ga0105251_10052161	3300009011	Bacteria	1948
478	Ga0105244_10177104	3300009036	Bacteria	1013
479	Ga0105240_10003598	3300009093	Bacteria	24007
480	Ga0105240_10029664	3300009093	Bacteria	7120
481	Ga0105240_10037050	3300009093	Bacteria	6269
482	Ga0105240_10040538	3300009093	Bacteria	5954
483	Ga0105240_10308610	3300009093	Bacteria	1807
484	Ga0105240_10447370	3300009093	Bacteria	1446
485	Ga0105240_10453738	3300009093	Bacteria	1434
486	Ga0105240_11011613	3300009093	Bacteria	888
487	Ga0105240_11122616	3300009093	Bacteria	836
488	Ga0105240_12549639	3300009093	Bacteria	528
489	Ga0111539_10043351	3300009094	Bacteria	5394
490	Ga0111539_10080888	3300009094	Bacteria	3821
491	Ga0111539_10092734	3300009094	Bacteria	3549
492	Ga0111539_10131318	3300009094	Bacteria	2932
493	Ga0111539_11094840	3300009094	Bacteria	926
494	Ga0105245_10039067	3300009098	Bacteria	4224
495	Ga0105245_10039618	3300009098	Bacteria	4194
496	Ga0105245_10160271	3300009098	Bacteria	2134
497	Ga0105245_10164167	3300009098	Bacteria	2109
498	Ga0105245_10362181	3300009098	Bacteria	1439
499	Ga0105245_10399772	3300009098	Bacteria	1373
500	Ga0105245_10421791	3300009098	Bacteria	1337
501	Ga0105245_10512834	3300009098	Bacteria	1217
502	Ga0105245_10842644	3300009098	Bacteria	957
503	Ga0105245_10911775	3300009098	Bacteria	921
504	Ga0105245_11502654	3300009098	Bacteria	724
505	Ga0105247_10018586	3300009101	Bacteria	4171
506	Ga0105247_10960422	3300009101	Bacteria	664
507	Ga0114129_10009318	3300009147	Bacteria	14007
508	Ga0114129_10265936	3300009147	Bacteria	2296
509	Ga0114129_10493121	3300009147	Bacteria	1601
510	Ga0105243_10018886	3300009148	Bacteria	5227
511	Ga0105243_10055168	3300009148	Bacteria	3157
512	Ga0105243_10110314	3300009148	Bacteria	2300
513	Ga0105243_10123954	3300009148	Bacteria	2183
514	Ga0105241_10051261	3300009174	Bacteria	3147
515	Ga0105241_10066269	3300009174	Bacteria	2792
516	Ga0105241_10562190	3300009174	Bacteria	1026
517	Ga0105242_10018435	3300009176	Bacteria	5456
518	Ga0105242_10018779	3300009176	Bacteria	5410
519	Ga0105242_10024603	3300009176	Bacteria	4757
520	Ga0105242_10041581	3300009176	Bacteria	3708
521	Ga0105242_10043335	3300009176	Bacteria	3640
522	Ga0105242_10345377	3300009176	Bacteria	1373
523	Ga0105242_11072140	3300009176	Bacteria	818
524	Ga0105242_12962464	3300009176	Bacteria	525
525	Ga0105248_10002483	3300009177	Bacteria	20492
526	Ga0105248_10002724	3300009177	Bacteria	19629
527	Ga0105248_10016657	3300009177	Bacteria	8091
528	Ga0105248_10050902	3300009177	Bacteria	4647
529	Ga0105248_10086812	3300009177	Bacteria	3521
530	Ga0105248_10218249	3300009177	Bacteria	2147
531	Ga0105248_10357129	3300009177	Bacteria	1645
532	Ga0105248_10403251	3300009177	Bacteria	1540
533	Ga0105248_11024762	3300009177	Bacteria	932
534	Ga0105248_12839823	3300009177	Bacteria	552
535	Ga0105248_12904197	3300009177	Bacteria	546
536	Ga0105237_10002537	3300009545	Bacteria	22597
537	Ga0105237_10073808	3300009545	Bacteria	3403
538	Ga0105237_10101048	3300009545	Bacteria	2876
539	Ga0105237_10432249	3300009545	Bacteria	1322
540	Ga0105237_11577090	3300009545	Bacteria	663
541	Ga0105238_10002915	3300009551	Bacteria	17083
542	Ga0105238_10429190	3300009551	Bacteria	1317
543	Ga0105249_10104560	3300009553	Bacteria	2668
544	Ga0105249_10139137	3300009553	Bacteria	2326
545	Ga0105249_10649520	3300009553	Bacteria	1112
546	Ga0105239_10312245	3300010375	Bacteria	1772
547	Ga0105239_11475381	3300010375	Bacteria	786
548	Ga0105246_10031580	3300011119	Bacteria	3506
549	Ga0105246_10083834	3300011119	Bacteria	2279
550	Ga0157329_1026872	3300012491	Bacteria	576
551	Ga0157314_1036159	3300012500	Bacteria	577
552	Ga0157313_1009643	3300012503	Bacteria	804
553	Ga0157315_1003387	3300012508	Bacteria	1071
554	Ga0157326_1000630	3300012513	Bacteria	4133
555	Ga0157373_10004318	3300013100	Bacteria	10700
556	Ga0157373_10370070	3300013100	Bacteria	1024
557	Ga0157373_10443329	3300013100	Bacteria	934
558	Ga0157373_10456861	3300013100	Bacteria	919
559	Ga0157371_10010943	3300013102	Bacteria	7031
560	Ga0157371_10077292	3300013102	Bacteria	2357
561	Ga0157370_10012695	3300013104	Bacteria	8718
562	Ga0157370_10150104	3300013104	Bacteria	2169
563	Ga0157370_10246371	3300013104	Bacteria	1653
564	Ga0157369_10029525	3300013105	Bacteria	6058
565	Ga0157369_10100322	3300013105	Bacteria	3086
566	Ga0157369_10366724	3300013105	Bacteria	1495
567	Ga0157369_10835370	3300013105	Bacteria	946
568	Ga0157369_11199124	3300013105	Bacteria	775
569	Ga0171463_1012	3300013249	Bacteria	176554
570	Ga0157374_10002352	3300013296	Bacteria	15958
571	Ga0157374_10034498	3300013296	Bacteria	4622
572	Ga0157374_10106479	3300013296	Bacteria	2694
573	Ga0157374_10275292	3300013296	Bacteria	1660
574	Ga0157374_10561448	3300013296	Bacteria	1150
575	Ga0157374_10637020	3300013296	Bacteria	1077
576	Ga0157374_12834191	3300013296	Bacteria	512
577	Ga0157378_10022427	3300013297	Bacteria	5558
578	Ga0157378_10048143	3300013297	Bacteria	3790
579	Ga0157378_10214363	3300013297	Bacteria	1827
580	Ga0157378_10236082	3300013297	Bacteria	1745
581	Ga0157378_10626403	3300013297	Bacteria	1089
582	Ga0163162_10030019	3300013306	Bacteria	5383
583	Ga0163162_10053101	3300013306	Bacteria	4072
584	Ga0163162_10337068	3300013306	Bacteria	1640
585	Ga0163162_10472959	3300013306	Bacteria	1385
586	Ga0163162_10554396	3300013306	Bacteria	1277
587	Ga0163162_10949722	3300013306	Bacteria	971
588	Ga0163162_11450683	3300013306	Bacteria	781
589	Ga0157372_10004355	3300013307	Bacteria	15120
590	Ga0157372_10084055	3300013307	Bacteria	3606
591	Ga0157372_10096933	3300013307	Bacteria	3362
592	Ga0157372_10468783	3300013307	Bacteria	1468
593	Ga0157372_10546173	3300013307	Bacteria	1351
594	Ga0157372_11684444	3300013307	Bacteria	730
595	Ga0157372_12013148	3300013307	Bacteria	664
596	Ga0157375_10000470	3300013308	Bacteria	36719
597	Ga0157375_10119266	3300013308	Bacteria	2746
598	Ga0157375_10132215	3300013308	Bacteria	2616
599	Ga0157375_10213723	3300013308	Bacteria	2086
600	Ga0157375_10561691	3300013308	Bacteria	1302
601	Ga0157375_11105173	3300013308	Bacteria	928
602	Ga0157375_11179750	3300013308	Bacteria	898
603	Ga0157375_11334233	3300013308	Bacteria	844
604	Ga0157375_12683144	3300013308	Bacteria	595
605	Ga0157375_13378574	3300013308	Bacteria	532
606	Ga0163163_10003566	3300014325	Bacteria	13215
607	Ga0163163_10018583	3300014325	Bacteria	6512
608	Ga0163163_10026804	3300014325	Bacteria	5512
609	Ga0163163_10093148	3300014325	Bacteria	3029
610	Ga0163163_10093549	3300014325	Bacteria	3023
611	Ga0163163_10157204	3300014325	Bacteria	2318
612	Ga0163163_10782393	3300014325	Bacteria	1018
613	Ga0157380_10024216	3300014326	Bacteria	4591
614	Ga0157380_10040367	3300014326	Bacteria	3634
615	Ga0157380_10210218	3300014326	Bacteria	1733
616	Ga0157380_10344491	3300014326	Bacteria	1392
617	Ga0157380_10823976	3300014326	Bacteria	947
618	Ga0157380_11107020	3300014326	Bacteria	831
619	Ga0157380_11453609	3300014326	Bacteria	737
620	Ga0182008_10159415	3300014497	Bacteria	1135
621	Ga0182008_10467165	3300014497	Bacteria	689
622	Ga0157377_10007665	3300014745	Bacteria	5227
623	Ga0157377_10036979	3300014745	Bacteria	2689
624	Ga0157377_11032077	3300014745	Bacteria	625
625	Ga0157379_10003561	3300014968	Bacteria	13196
626	Ga0157379_10005327	3300014968	Bacteria	11050
627	Ga0157379_10037039	3300014968	Bacteria	4349
628	Ga0157379_10163966	3300014968	Bacteria	2006
629	Ga0157379_10415898	3300014968	Bacteria	1238
630	Ga0157376_10035738	3300014969	Bacteria	4021
631	Ga0157376_10157258	3300014969	Bacteria	2056
632	Ga0157376_10404896	3300014969	Bacteria	1320
633	Ga0157376_11149917	3300014969	Bacteria	803
634	Ga0157376_11291273	3300014969	Bacteria	760
635	Ga0157376_12102345	3300014969	Bacteria	603
636	Ga0182006_1066188	3300015261	Bacteria	1351
637	Ga0182007_10001460	3300015262	Bacteria	12687
638	Ga0182007_10008889	3300015262	Bacteria	4094
639	Ga0182007_10009622	3300015262	Bacteria	3881
640	Ga0182007_10019040	3300015262	Bacteria	2475
641	Ga0182005_1033151	3300015265	Bacteria	1405
642	Ga0183363_1205	3300015690	Bacteria	12138
643	Ga0163161_10015923	3300017792	Bacteria	5246
644	Ga0163161_10033003	3300017792	Bacteria	3699
645	Ga0163161_10052328	3300017792	Bacteria	2960
646	Ga0163161_10099077	3300017792	Bacteria	2167
647	Ga0206356_10688538	3300020070	Bacteria	923
648	Ga0206353_11675778	3300020082	Bacteria	1287
649	Ga0213872_10118197	3300021361	Bacteria	1173
650	Ga0213876_10503762	3300021384	Bacteria	644
651	Ga0209436_100256	3300025208	Bacteria	24507
652	Ga0209436_101114	3300025208	Bacteria	9960
653	Ga0209674_100175	3300025226	Bacteria	80049
654	Ga0209674_100457	3300025226	Bacteria	18594
655	Ga0209672_100018	3300025228	Bacteria	432924
656	Ga0209672_100048	3300025228	Bacteria	240458
657	Ga0209672_100682	3300025228	Bacteria	17057
658	Ga0209563_100065	3300025230	Bacteria	257430
659	Ga0207427_100021	3300025231	Bacteria	494115
660	Ga0207427_114301	3300025231	Bacteria	765
661	Ga0209437_100087	3300025233	Bacteria	253432
662	Ga0209258_100024	3300025242	Bacteria	542096
663	Ga0209258_100086	3300025242	Bacteria	240458
664	Ga0209258_100275	3300025242	Bacteria	86719
665	Ga0209258_129863	3300025242	Bacteria	513
666	Ga0207425_1006259	3300025245	Bacteria	3275
667	Ga0207425_1048343	3300025245	Bacteria	785
668	Ga0209646_1000858	3300025246	Bacteria	10164
669	Ga0209646_1005801	3300025246	Bacteria	2121
670	Ga0209026_1000090	3300025250	Bacteria	172829
671	Ga0209026_1000284	3300025250	Bacteria	58265
672	Ga0209026_1000370	3300025250	Bacteria	41493
673	Ga0209026_1004022	3300025250	Bacteria	4557
674	Ga0209026_1005932	3300025250	Bacteria	3130
675	Ga0209677_101623	3300025253	Bacteria	9484
676	Ga0209148_1000009	3300025254	Bacteria	1395625
677	Ga0209148_1000095	3300025254	Bacteria	240458
678	Ga0209148_1000245	3300025254	Bacteria	86719
679	Ga0209759_1000616	3300025256	Bacteria	34040
680	Ga0209759_1001142	3300025256	Bacteria	16934
681	Ga0209759_1001994	3300025256	Bacteria	9740
682	Ga0209759_1019162	3300025256	Bacteria	1631
683	Ga0209129_1000425	3300025258	Bacteria	32039
684	Ga0209233_1000023	3300025261	Bacteria	738870
685	Ga0209565_1000015	3300025263	Bacteria	494091
686	Ga0209565_1000556	3300025263	Bacteria	25784
687	Ga0209565_1000820	3300025263	Bacteria	17662
688	Ga0207666_1021168	3300025271	Bacteria	957
689	Ga0207666_1084167	3300025271	Bacteria	514
690	Ga0209455_1000029	3300025272	Bacteria	542096
691	Ga0209455_1000087	3300025272	Bacteria	240458
692	Ga0209455_1000189	3300025272	Bacteria	92877
693	Ga0209455_1000202	3300025272	Bacteria	86719
694	Ga0209673_1000017	3300025273	Bacteria	492994
695	Ga0209673_1000454	3300025273	Bacteria	69331
696	Ga0209130_1000054	3300025284	Bacteria	212299
697	Ga0209130_1000924	3300025284	Bacteria	23585
698	Ga0209130_1004551	3300025284	Bacteria	5214
699	Ga0207673_1000661	3300025290	Bacteria	3663
700	Ga0209675_1000012	3300025291	Bacteria	494061
701	Ga0209675_1019764	3300025291	Bacteria	1844
702	Ga0209675_1035001	3300025291	Bacteria	1149
703	Ga0209676_1000111	3300025292	Bacteria	213411
704	Ga0209676_1024688	3300025292	Bacteria	1940
705	Ga0209676_1025951	3300025292	Bacteria	1870
706	Ga0209676_1055168	3300025292	Bacteria	1019
707	Ga0209025_1000392	3300025294	Bacteria	90826
708	Ga0209025_1007626	3300025294	Bacteria	8008
709	Ga0209025_1025331	3300025294	Bacteria	3024
710	Ga0209564_1000016	3300025295	Bacteria	613131
711	Ga0209564_1000070	3300025295	Bacteria	303126
712	Ga0209564_1004843	3300025295	Bacteria	8004
713	Ga0209564_1005711	3300025295	Bacteria	6969
714	Ga0209758_1000136	3300025297	Bacteria	177081
715	Ga0209758_1032976	3300025297	Bacteria	2090
716	Ga0209050_1000111	3300025298	Bacteria	213411
717	Ga0209050_1039682	3300025298	Bacteria	1323
718	Ga0209256_1000047	3300025299	Bacteria	314709
719	Ga0209256_1000076	3300025299	Bacteria	234735
720	Ga0209256_1031405	3300025299	Bacteria	1453
721	Ga0207426_1000127	3300025302	Bacteria	212942
722	Ga0207426_1000194	3300025302	Bacteria	150009
723	Ga0209051_1000340	3300025303	Bacteria	70080
724	Ga0209051_1008130	3300025303	Bacteria	5605
725	Ga0209051_1064154	3300025303	Bacteria	1140
726	Ga0209257_1000690	3300025304	Bacteria	52373
727	Ga0209257_1007256	3300025304	Bacteria	6773
728	Ga0209257_1026679	3300025304	Bacteria	1940
729	Ga0209257_1072311	3300025304	Bacteria	905
730	Ga0207697_10000008	3300025315	Bacteria	71181
731	Ga0207697_10012101	3300025315	Bacteria	3631
732	Ga0207697_10042956	3300025315	Bacteria	1858
733	Ga0207697_10121626	3300025315	Bacteria	1124
734	Ga0207697_10234324	3300025315	Bacteria	811
735	Ga0207656_10008670	3300025321	Bacteria	3751
736	Ga0207656_10141711	3300025321	Bacteria	1133
737	Ga0207713_1003655	3300025735	Bacteria	10354
738	Ga0207682_10001587	3300025893	Bacteria	10453
739	Ga0207682_10003188	3300025893	Bacteria	7181
740	Ga0207682_10056093	3300025893	Bacteria	1640
741	Ga0207682_10074598	3300025893	Bacteria	1443
742	Ga0207682_10131590	3300025893	Bacteria	1117
743	Ga0207692_10188343	3300025898	Bacteria	1206
744	Ga0207642_10122414	3300025899	Bacteria	1344
745	Ga0207642_10258699	3300025899	Bacteria	991
746	Ga0207642_10406577	3300025899	Bacteria	816
747	Ga0207642_10905212	3300025899	Bacteria	565
748	Ga0207688_10099552	3300025901	Bacteria	1677
749	Ga0207688_10906857	3300025901	Bacteria	558
750	Ga0207680_10004859	3300025903	Bacteria	6394
751	Ga0207680_10108473	3300025903	Bacteria	1796
752	Ga0207680_10209199	3300025903	Bacteria	1333
753	Ga0207680_10246303	3300025903	Bacteria	1233
754	Ga0207680_10474166	3300025903	Bacteria	890
755	Ga0207680_10545578	3300025903	Bacteria	827
756	Ga0207680_10909022	3300025903	Bacteria	631
757	Ga0207680_11032866	3300025903	Bacteria	588
758	Ga0207647_10055498	3300025904	Bacteria	2434
759	Ga0207647_10109940	3300025904	Bacteria	1630
760	Ga0207699_10014838	3300025906	Bacteria	4031
761	Ga0207699_10307252	3300025906	Bacteria	1109
762	Ga0207699_11064733	3300025906	Bacteria	598
763	Ga0207645_10008084	3300025907	Bacteria	7379
764	Ga0207645_10047247	3300025907	Bacteria	2749
765	Ga0207645_10089012	3300025907	Bacteria	1985
766	Ga0207645_10281425	3300025907	Bacteria	1104
767	Ga0207645_10454959	3300025907	Bacteria	864
768	Ga0207643_10006817	3300025908	Bacteria	6130
769	Ga0207643_10017754	3300025908	Bacteria	3895
770	Ga0207643_10112450	3300025908	Bacteria	1605
771	Ga0207643_10335175	3300025908	Bacteria	947
772	Ga0207705_10145082	3300025909	Bacteria	1775
773	Ga0207705_10179167	3300025909	Bacteria	1599
774	Ga0207705_10229447	3300025909	Bacteria	1412
775	Ga0207705_10317923	3300025909	Bacteria	1196
776	Ga0207684_10004303	3300025910	Bacteria	13472
777	Ga0207684_10012597	3300025910	Bacteria	7350
778	Ga0207684_10014747	3300025910	Bacteria	6731
779	Ga0207654_10017882	3300025911	Bacteria	3715
780	Ga0207654_10207925	3300025911	Bacteria	1292
781	Ga0207654_10459234	3300025911	Bacteria	894
782	Ga0207707_10007928	3300025912	Bacteria	9238
783	Ga0207707_11217054	3300025912	Bacteria	609
784	Ga0207695_10000114	3300025913	Bacteria	242465
785	Ga0207695_10010992	3300025913	Bacteria	10997
786	Ga0207695_10030358	3300025913	Bacteria	5950
787	Ga0207695_10069765	3300025913	Bacteria	3595
788	Ga0207695_10352048	3300025913	Bacteria	1360
789	Ga0207695_10944886	3300025913	Bacteria	742
790	Ga0207671_10000697	3300025914	Bacteria	43453
791	Ga0207671_10268403	3300025914	Bacteria	1344
792	Ga0207671_10348357	3300025914	Bacteria	1174
793	Ga0207663_11612362	3300025916	Bacteria	522
794	Ga0207660_10010901	3300025917	Bacteria	5908
795	Ga0207660_10055048	3300025917	Bacteria	2841
796	Ga0207660_10662561	3300025917	Bacteria	851
797	Ga0207660_10948960	3300025917	Bacteria	702
798	Ga0207662_10125169	3300025918	Bacteria	1616
799	Ga0207662_10144391	3300025918	Bacteria	1509
800	Ga0207662_10169590	3300025918	Bacteria	1399
801	Ga0207657_10011681	3300025919	Bacteria	8702
802	Ga0207657_10041708	3300025919	Bacteria	4055
803	Ga0207657_10304376	3300025919	Bacteria	1262
804	Ga0207657_10520046	3300025919	Bacteria	931
805	Ga0207657_10882966	3300025919	Bacteria	689
806	Ga0207649_10041926	3300025920	Bacteria	2789
807	Ga0207649_10295831	3300025920	Bacteria	1182
808	Ga0207649_10538415	3300025920	Bacteria	892
809	Ga0207652_10048221	3300025921	Bacteria	3641
810	Ga0207652_10177532	3300025921	Bacteria	1913
811	Ga0207652_10337161	3300025921	Bacteria	1361
812	Ga0207646_11148622	3300025922	Bacteria	682
813	Ga0207681_10039017	3300025923	Bacteria	3150
814	Ga0207681_10042489	3300025923	Bacteria	3037
815	Ga0207681_10070420	3300025923	Bacteria	2435
816	Ga0207681_10133205	3300025923	Bacteria	1840
817	Ga0207681_10207712	3300025923	Bacteria	1507
818	Ga0207681_10573001	3300025923	Bacteria	931
819	Ga0207681_10876125	3300025923	Bacteria	751
820	Ga0207694_10106155	3300025924	Bacteria	2230
821	Ga0207694_10353111	3300025924	Bacteria	1217
822	Ga0207650_10002149	3300025925	Bacteria	13775
823	Ga0207650_10002444	3300025925	Bacteria	12937
824	Ga0207650_10023179	3300025925	Bacteria	4402
825	Ga0207650_10059199	3300025925	Bacteria	2854
826	Ga0207650_10126868	3300025925	Bacteria	1993
827	Ga0207650_10323059	3300025925	Bacteria	1264
828	Ga0207650_10336977	3300025925	Bacteria	1238
829	Ga0207659_10013750	3300025926	Bacteria	5198
830	Ga0207659_10014752	3300025926	Bacteria	5049
831	Ga0207659_10047150	3300025926	Bacteria	3047
832	Ga0207659_10125826	3300025926	Bacteria	1971
833	Ga0207659_10182090	3300025926	Bacteria	1665
834	Ga0207659_10274396	3300025926	Bacteria	1376
835	Ga0207659_10466000	3300025926	Bacteria	1066
836	Ga0207659_10572640	3300025926	Bacteria	961
837	Ga0207659_10579420	3300025926	Bacteria	955
838	Ga0207659_11337310	3300025926	Bacteria	615
839	Ga0207659_11491875	3300025926	Bacteria	578
840	Ga0207687_10034895	3300025927	Bacteria	3419
841	Ga0207687_10133832	3300025927	Bacteria	1872
842	Ga0207687_10592864	3300025927	Bacteria	933
843	Ga0207687_10620657	3300025927	Bacteria	913
844	Ga0207687_10960179	3300025927	Bacteria	732
845	Ga0207687_11113556	3300025927	Bacteria	678
846	Ga0207700_10049234	3300025928	Bacteria	3134
847	Ga0207700_11081220	3300025928	Bacteria	717
848	Ga0207664_10128348	3300025929	Bacteria	2131
849	Ga0207664_10152105	3300025929	Bacteria	1966
850	Ga0207664_10247799	3300025929	Bacteria	1554
851	Ga0207644_10000751	3300025931	Bacteria	20562
852	Ga0207644_10002580	3300025931	Bacteria	11656
853	Ga0207644_10002881	3300025931	Bacteria	11083
854	Ga0207644_10076610	3300025931	Bacteria	2461
855	Ga0207644_10087869	3300025931	Bacteria	2311
856	Ga0207644_10094052	3300025931	Bacteria	2238
857	Ga0207644_10104076	3300025931	Bacteria	2137
858	Ga0207644_10138682	3300025931	Bacteria	1870
859	Ga0207644_10335412	3300025931	Bacteria	1225
860	Ga0207644_10849460	3300025931	Bacteria	764
861	Ga0207690_10001623	3300025932	Bacteria	13976
862	Ga0207690_10064367	3300025932	Bacteria	2504
863	Ga0207690_10266299	3300025932	Bacteria	1329
864	Ga0207690_10312875	3300025932	Bacteria	1232
865	Ga0207706_10014113	3300025933	Bacteria	7244
866	Ga0207706_10036657	3300025933	Bacteria	4356
867	Ga0207706_10140490	3300025933	Bacteria	2124
868	Ga0207706_10615554	3300025933	Bacteria	932
869	Ga0207706_10759785	3300025933	Bacteria	825
870	Ga0207706_10979339	3300025933	Bacteria	711
871	Ga0207706_11597439	3300025933	Bacteria	528
872	Ga0207686_10003571	3300025934	Bacteria	8345
873	Ga0207686_10005536	3300025934	Bacteria	6771
874	Ga0207686_10013775	3300025934	Bacteria	4485
875	Ga0207686_10178090	3300025934	Bacteria	1505
876	Ga0207686_10655882	3300025934	Bacteria	831
877	Ga0207709_10009959	3300025935	Bacteria	5235
878	Ga0207709_10147066	3300025935	Bacteria	1627
879	Ga0207709_10341155	3300025935	Bacteria	1128
880	Ga0207670_10080096	3300025936	Bacteria	2282
881	Ga0207670_10094302	3300025936	Bacteria	2123
882	Ga0207670_10097029	3300025936	Bacteria	2097
883	Ga0207670_10228582	3300025936	Bacteria	1427
884	Ga0207670_10343680	3300025936	Bacteria	1180
885	Ga0207670_10788493	3300025936	Bacteria	791
886	Ga0207669_10053182	3300025937	Bacteria	2437
887	Ga0207669_10097530	3300025937	Bacteria	1933
888	Ga0207669_10262537	3300025937	Bacteria	1292
889	Ga0207669_10684752	3300025937	Bacteria	841
890	Ga0207669_11148457	3300025937	Bacteria	657
891	Ga0207669_11728679	3300025937	Bacteria	534
892	Ga0207704_10236014	3300025938	Bacteria	1363
893	Ga0207704_10290578	3300025938	Bacteria	1247
894	Ga0207704_10447067	3300025938	Bacteria	1031
895	Ga0207704_11030068	3300025938	Bacteria	697
896	Ga0207704_11295693	3300025938	Bacteria	623
897	Ga0207704_11894544	3300025938	Bacteria	513
898	Ga0207665_10003589	3300025939	Bacteria	10361
899	Ga0207691_10011536	3300025940	Bacteria	8483
900	Ga0207691_10027564	3300025940	Bacteria	5325
901	Ga0207691_10052579	3300025940	Bacteria	3720
902	Ga0207691_10058408	3300025940	Bacteria	3508
903	Ga0207691_10079350	3300025940	Bacteria	2954
904	Ga0207691_10304343	3300025940	Bacteria	1369
905	Ga0207691_11665825	3300025940	Bacteria	517
906	Ga0207711_10000392	3300025941	Bacteria	46482
907	Ga0207711_10000865	3300025941	Bacteria	29296
908	Ga0207711_10012503	3300025941	Bacteria	7055
909	Ga0207711_10103161	3300025941	Bacteria	2525
910	Ga0207711_10111886	3300025941	Bacteria	2429
911	Ga0207711_10159734	3300025941	Bacteria	2039
912	Ga0207711_10279668	3300025941	Bacteria	1537
913	Ga0207689_10005992	3300025942	Bacteria	10752
914	Ga0207689_10022940	3300025942	Bacteria	5242
915	Ga0207689_10080250	3300025942	Bacteria	2682
916	Ga0207689_10168434	3300025942	Bacteria	1805
917	Ga0207689_10303692	3300025942	Bacteria	1323
918	Ga0207689_11392140	3300025942	Bacteria	588
919	Ga0207661_10001271	3300025944	Bacteria	16866
920	Ga0207661_10045498	3300025944	Bacteria	3474
921	Ga0207661_10414122	3300025944	Bacteria	1223
922	Ga0207661_10615566	3300025944	Bacteria	997
923	Ga0207661_10638306	3300025944	Bacteria	978
924	Ga0207679_10044679	3300025945	Bacteria	3198
925	Ga0207679_10052949	3300025945	Bacteria	2979
926	Ga0207679_10095502	3300025945	Bacteria	2311
927	Ga0207679_10097874	3300025945	Bacteria	2286
928	Ga0207679_10125191	3300025945	Bacteria	2052
929	Ga0207679_10288677	3300025945	Bacteria	1409
930	Ga0207667_10003980	3300025949	Bacteria	18160
931	Ga0207667_10068634	3300025949	Bacteria	3691
932	Ga0207667_10187146	3300025949	Bacteria	2125
933	Ga0207667_10303782	3300025949	Bacteria	1630
934	Ga0207667_10517264	3300025949	Bacteria	1209
935	Ga0207667_10871241	3300025949	Bacteria	894
936	Ga0207651_10001236	3300025960	Bacteria	11477
937	Ga0207651_10030369	3300025960	Bacteria	3440
938	Ga0207651_10062288	3300025960	Bacteria	2599
939	Ga0207651_10106694	3300025960	Bacteria	2092
940	Ga0207651_12087361	3300025960	Bacteria	509
941	Ga0207712_10024611	3300025961	Bacteria	3990
942	Ga0207712_10038813	3300025961	Bacteria	3258
943	Ga0207712_10181596	3300025961	Bacteria	1653
944	Ga0207712_10213509	3300025961	Bacteria	1538
945	Ga0207712_10560689	3300025961	Bacteria	984
946	Ga0207668_10098924	3300025972	Bacteria	2162
947	Ga0207668_10280294	3300025972	Bacteria	1366
948	Ga0207668_10798245	3300025972	Bacteria	835
949	Ga0207640_10023844	3300025981	Bacteria	3683
950	Ga0207640_10079058	3300025981	Bacteria	2241
951	Ga0207640_10344955	3300025981	Bacteria	1194
952	Ga0207640_10350923	3300025981	Bacteria	1185
953	Ga0207640_10898260	3300025981	Bacteria	774
954	Ga0207640_11252919	3300025981	Bacteria	661
955	Ga0207658_10023584	3300025986	Bacteria	4297
956	Ga0207658_10090039	3300025986	Bacteria	2377
957	Ga0207658_10104585	3300025986	Bacteria	2225
958	Ga0207658_10215836	3300025986	Bacteria	1611
959	Ga0207658_10243795	3300025986	Bacteria	1524
960	Ga0207658_10623224	3300025986	Bacteria	970
961	Ga0207658_10706196	3300025986	Bacteria	911
962	Ga0207658_10757638	3300025986	Bacteria	879
963	Ga0207658_11230678	3300025986	Bacteria	684
964	Ga0207658_11661014	3300025986	Bacteria	584
965	Ga0207677_10003011	3300026023	Bacteria	8903
966	Ga0207677_10019843	3300026023	Bacteria	4069
967	Ga0207677_10558212	3300026023	Bacteria	999
968	Ga0207677_10760045	3300026023	Bacteria	865
969	Ga0207677_10951106	3300026023	Bacteria	777
970	Ga0207677_11588206	3300026023	Bacteria	605
971	Ga0207703_10000361	3300026035	Bacteria	48627
972	Ga0207703_10254070	3300026035	Bacteria	1586
973	Ga0207703_10282380	3300026035	Bacteria	1508
974	Ga0207703_10340078	3300026035	Bacteria	1379
975	Ga0207703_10488385	3300026035	Bacteria	1154
976	Ga0207639_10059898	3300026041	Bacteria	2935
977	Ga0207639_10156405	3300026041	Bacteria	1915
978	Ga0207639_10217395	3300026041	Bacteria	1648
979	Ga0207639_10355959	3300026041	Bacteria	1309
980	Ga0207639_10412335	3300026041	Bacteria	1219
981	Ga0207639_10439067	3300026041	Bacteria	1183
982	Ga0207678_10004505	3300026067	Bacteria	12522
983	Ga0207678_10231700	3300026067	Bacteria	1581
984	Ga0207678_10323151	3300026067	Bacteria	1328
985	Ga0207678_10620861	3300026067	Bacteria	948
986	Ga0207678_11520963	3300026067	Bacteria	591
987	Ga0207708_10002339	3300026075	Bacteria	13917
988	Ga0207708_10013642	3300026075	Bacteria	6070
989	Ga0207708_10099328	3300026075	Bacteria	2251
990	Ga0207702_10002486	3300026078	Bacteria	17406
991	Ga0207702_10025249	3300026078	Bacteria	4930
992	Ga0207702_10642504	3300026078	Bacteria	1043
993	Ga0207702_10783335	3300026078	Bacteria	942
994	Ga0207641_10056497	3300026088	Bacteria	3336
995	Ga0207641_10057396	3300026088	Bacteria	3310
996	Ga0207641_10077359	3300026088	Bacteria	2879
997	Ga0207641_10137202	3300026088	Bacteria	2203
998	Ga0207641_10184641	3300026088	Bacteria	1912
999	Ga0207641_11005786	3300026088	Bacteria	830
1000	Ga0207641_11314087	3300026088	Bacteria	724
1001	Ga0207641_11459217	3300026088	Bacteria	685
1002	Ga0207648_10001508	3300026089	Bacteria	25663
1003	Ga0207648_10013369	3300026089	Bacteria	7640
1004	Ga0207648_10026252	3300026089	Bacteria	5178
1005	Ga0207648_10076009	3300026089	Bacteria	2927
1006	Ga0207648_10078401	3300026089	Bacteria	2882
1007	Ga0207648_10224672	3300026089	Bacteria	1669
1008	Ga0207648_10243377	3300026089	Bacteria	1602
1009	Ga0207648_11357997	3300026089	Bacteria	668
1010	Ga0207648_11588431	3300026089	Bacteria	615
1011	Ga0207676_10007187	3300026095	Bacteria	7880
1012	Ga0207676_10012292	3300026095	Bacteria	6129
1013	Ga0207676_10017084	3300026095	Bacteria	5257
1014	Ga0207676_10054936	3300026095	Bacteria	3123
1015	Ga0207676_10167164	3300026095	Bacteria	1912
1016	Ga0207676_10192124	3300026095	Bacteria	1797
1017	Ga0207676_10375714	3300026095	Bacteria	1321
1018	Ga0207676_10951013	3300026095	Bacteria	845
1019	Ga0207676_11339174	3300026095	Bacteria	711
1020	Ga0207674_10003021	3300026116	Bacteria	20858
1021	Ga0207674_10017139	3300026116	Bacteria	7907
1022	Ga0207674_10871835	3300026116	Bacteria	868
1023	Ga0207675_100008669	3300026118	Bacteria	9560
1024	Ga0207675_100025064	3300026118	Bacteria	5551
1025	Ga0207675_100131361	3300026118	Bacteria	2375
1026	Ga0207675_100280111	3300026118	Bacteria	1620
1027	Ga0207675_100444413	3300026118	Bacteria	1284
1028	Ga0207675_100512120	3300026118	Bacteria	1195
1029	Ga0207675_100716319	3300026118	Bacteria	1010
1030	Ga0207683_10000942	3300026121	Bacteria	26671
1031	Ga0207683_10000995	3300026121	Bacteria	25942
1032	Ga0207683_10001084	3300026121	Bacteria	24821
1033	Ga0207683_10010839	3300026121	Bacteria	7774
1034	Ga0207683_10013606	3300026121	Bacteria	6940
1035	Ga0207683_10015493	3300026121	Bacteria	6490
1036	Ga0207698_10132904	3300026142	Bacteria	2130
1037	Ga0207698_10182992	3300026142	Bacteria	1858
1038	Ga0207698_10650519	3300026142	Bacteria	1044
1039	Ga0207698_10661171	3300026142	Bacteria	1036
1040	Ga0207698_12354929	3300026142	Bacteria	544
1041	Ga0209281_1000329	3300027111	Bacteria	82668
1042	Ga0209281_1016011	3300027111	Bacteria	1551
1043	Ga0209281_1017300	3300027111	Bacteria	1465
1044	Ga0209981_1019922	3300027378	Bacteria	955
1045	Ga0209996_1044419	3300027395	Bacteria	665
1046	Ga0209984_1000717	3300027424	Bacteria	3550
1047	Ga0210000_1031135	3300027462	Bacteria	834
1048	Ga0209995_1047014	3300027471	Bacteria	731
1049	Ga0209999_1085856	3300027543	Bacteria	608
1050	Ga0209982_1001736	3300027552	Bacteria	3000
1051	Ga0209970_1034396	3300027614	Bacteria	889
1052	Ga0209970_1035471	3300027614	Bacteria	876
1053	Ga0210002_1000683	3300027617	Bacteria	4586
1054	Ga0209983_1007279	3300027665	Bacteria	2269
1055	Ga0209971_1005261	3300027682	Bacteria	3075
1056	Ga0209998_10068289	3300027717	Bacteria	847
1057	Ga0207428_10016385	3300027907	Bacteria	6376
1058	Ga0207428_10292624	3300027907	Bacteria	1206
1059	Ga0268266_10009485	3300028379	Bacteria	8563
1060	Ga0268266_10050272	3300028379	Bacteria	3577
1061	Ga0268266_12119934	3300028379	Bacteria	535
1062	Ga0268265_10178621	3300028380	Bacteria	1822
1063	Ga0268265_10230256	3300028380	Bacteria	1628
1064	Ga0268264_10133625	3300028381	Bacteria	2203
1065	Ga0268264_10318684	3300028381	Bacteria	1469
1066	Ga0268264_10633412	3300028381	Bacteria	1057
1067	Ga0268264_10726848	3300028381	Bacteria	988
1068	Ga0307515_10001657	3300028794	Bacteria	49606
1069	Ga0307515_10009209	3300028794	Bacteria	19123
1070	Ga0307515_10016418	3300028794	Bacteria	13553
1071	Ga0307515_10019184	3300028794	Bacteria	12328
1072	Ga0307515_10027465	3300028794	Bacteria	9728
1073	Ga0307515_10241537	3300028794	Bacteria	1576
1074	Ga0265763_1004159	3300030763	Bacteria	1176
1075	Ga0265760_10183532	3300031090	Bacteria	700
1076	Ga0307513_10001052	3300031456	Bacteria	40103
1077	Ga0307513_10093110	3300031456	Bacteria	3064
1078	Ga0307513_10199250	3300031456	Bacteria	1845
1079	Ga0307513_10444546	3300031456	Bacteria	1022
1080	Ga0307513_10620333	3300031456	Bacteria	790
1081	Ga0307513_10849529	3300031456	Bacteria	619
1082	Ga0307509_10060780	3300031507	Bacteria	3992
1083	Ga0307509_10062017	3300031507	Bacteria	3944
1084	Ga0307509_10261182	3300031507	Bacteria	1507
1085	Ga0307408_100003341	3300031548	Bacteria	11015
1086	Ga0307408_100133020	3300031548	Bacteria	1943
1087	Ga0307408_100466147	3300031548	Bacteria	1099
1088	Ga0307408_101612003	3300031548	Bacteria	616
1089	Ga0307508_10110603	3300031616	Bacteria	2347
1090	Ga0307508_10199553	3300031616	Bacteria	1601
1091	Ga0307508_10244100	3300031616	Bacteria	1393
1092	Ga0307516_10267870	3300031730	Bacteria	1396
1093	Ga0307405_10051505	3300031731	Bacteria	2555
1094	Ga0307405_10779623	3300031731	Bacteria	799
1095	Ga0307405_11234845	3300031731	Bacteria	648
1096	Ga0307413_10086572	3300031824	Bacteria	2026
1097	Ga0307413_10131696	3300031824	Bacteria	1713
1098	Ga0307410_10007868	3300031852	Bacteria	5869
1099	Ga0307410_10908575	3300031852	Bacteria	755
1100	Ga0326468_10016974	3300031889	Bacteria	824
1101	Ga0307406_10067737	3300031901	Bacteria	2328
1102	Ga0307406_10518419	3300031901	Bacteria	970
1103	Ga0307407_10023971	3300031903	Bacteria	3192
1104	Ga0307412_11584883	3300031911	Bacteria	597
1105	Ga0307409_100001463	3300031995	Bacteria	11617
1106	Ga0307409_100019105	3300031995	Bacteria	4630
1107	Ga0307409_100313152	3300031995	Bacteria	1466
1108	Ga0307409_100813537	3300031995	Bacteria	943
1109	Ga0307409_101236199	3300031995	Bacteria	771
1110	Ga0307416_100071131	3300032002	Bacteria	2888
1111	Ga0307416_100574054	3300032002	Bacteria	1204
1112	Ga0307416_102645513	3300032002	Bacteria	599
1113	Ga0307416_103740964	3300032002	Bacteria	509
1114	Ga0307411_10033248	3300032005	Bacteria	3197
1115	Ga0307415_100013697	3300032126	Bacteria	4742
1116	Ga0373958_0164773	3300034819	Bacteria	563
1117	Ga0373938_0231170	3300034957	Bacteria	523
1118	Ga0373928_0069604	3300035084	Bacteria	867
1119	Ga0373940_0280693	3300035088	Bacteria	569
1120	Ga0373923_0489564	3300035111	Bacteria	599
1121	Ga0373936_0028091	3300035113	Bacteria	2210
1122	Ga0373941_0022478	3300035115	Bacteria	1790
1123	Ga0373941_0353953	3300035115	Bacteria	598
1124	Ga0373945_0214898	3300035116	Bacteria	803
1125	Ga0373945_0512927	3300035116	Bacteria	535
1126	Ga0373957_0164782	3300035120	Bacteria	914
1127	Ga0373960_0152246	3300035121	Bacteria	791
1128	Ga0373943_0255061	3300035170	Bacteria	986
1129	Ga0373955_0173877	3300035172	Bacteria	1276
1130	Ga0373961_0000083	3300035241	Bacteria	50796
1131	Ga0373962_0256188	3300035242	Bacteria	609
1132	Ga0373931_1202372	3300035691	Bacteria	519
1133	Ga0373935_0416404	3300035692	Bacteria	967
1134	Ga0373927_0012998	3300035695	Bacteria	5536
1135	Ga0373927_0109897	3300035695	Bacteria	1796
1136	Ga0373933_0471555	3300035724	Bacteria	822
1137	Ga0373947_0153016	3300035725	Bacteria	1486
1138	Ga0373947_0348830	3300035725	Bacteria	993
1139	Ga0373937_0044574	3300036401	Bacteria	4052
1140	Ga0373937_0468639	3300036401	Bacteria	1196
1141	Ga0373937_0516546	3300036401	Bacteria	1135
1142	Ga0373925_0101281	3300037068	Bacteria	2215
1143	Ga0373925_0834449	3300037068	Bacteria	760
1144	Ga0395899_0000119	3300037312	Bacteria	127184
1145	Ga0395899_0027537	3300037312	Bacteria	4284
1146	Ga0395899_0059442	3300037312	Bacteria	2818
1147	Ga0395899_0106334	3300037312	Bacteria	2020
1148	Ga0395900_0000333	3300037418	Bacteria	69342
1149	Ga0395900_0024547	3300037418	Bacteria	6172
1150	Ga0395900_0080600	3300037418	Bacteria	3345
1151	Ga0395900_0227732	3300037418	Bacteria	1876
1152	Ga0395900_0436817	3300037418	Bacteria	1267
1153	Ga0395900_0616324	3300037418	Bacteria	1024
1154	Ga0395900_1532702	3300037418	Bacteria	578
1155	Ga0395898_0000211	3300037466	Bacteria	149301
1156	Ga0395898_0008391	3300037466	Bacteria	10925
1157	Ga0395898_0009575	3300037466	Bacteria	10174
1158	Ga0395898_0037284	3300037466	Bacteria	4824
1159	Ga0395898_0044349	3300037466	Bacteria	4378
1160	Ga0395898_0083726	3300037466	Bacteria	3074
1161	Ga0395905_0016084	3300037471	Bacteria	7111
1162	Ga0395905_0016113	3300037471	Bacteria	7106
1163	Ga0395905_0164532	3300037471	Bacteria	2084
1164	Ga0395905_0424854	3300037471	Bacteria	1225
1165	Ga0395901_0006902	3300038443	Bacteria	11470
1166	Ga0395901_0056683	3300038443	Bacteria	4076
1167	Ga0395901_0117049	3300038443	Bacteria	2800
1168	Ga0395901_0155298	3300038443	Bacteria	2403
1169	Ga0395901_1144514	3300038443	Bacteria	746
1170	Ga0436365_0816611	3300039437	Bacteria	3257
1171	Ga0436360_0485462	3300039438	Bacteria	743
1172	Ga0436361_0024497	3300039447	Bacteria	4044
1173	Ga0439436_0035245	3300041404	Bacteria	1446
1174	Ga0439439_0133926	3300041406	Bacteria	697
1175	Ga0439439_0223918	3300041406	Bacteria	552
1176	Ga0439465_0044058	3300041413	Bacteria	1449
1177	Ga0439465_0413215	3300041413	Bacteria	514
1178	Ga0451797_1565710	3300041453	Bacteria	615
1179	Ga0451802_1345392	3300041460	Bacteria	518
1180	Ga0451804_0071397	3300041463	Bacteria	1119
1181	Ga0451804_0918015	3300041463	Bacteria	586
1182	Ga0451807_0432443	3300041486	Bacteria	886
1183	Ga0451853_0439069	3300041512	Bacteria	597
1184	Ga0451853_0517740	3300041512	Bacteria	700
1185	Ga0451853_1544785	3300041512	Bacteria	2138
1186	Ga0439445_0061281	3300042004	Bacteria	1029
1187	Ga0439432_043815	3300042006	Bacteria	1411
1188	Ga0439449_0026545	3300042007	Bacteria	2161
1189	Ga0439449_0092792	3300042007	Bacteria	1115
1190	Ga0439455_0001294	3300042012	Bacteria	4114
1191	Ga0439457_051594	3300042014	Bacteria	924
1192	Ga0450898_026825	3300042134	Bacteria	1040
1193	Ga0450907_071311	3300042146	Bacteria	602
1194	Ga0439435_0280212	3300042436	Bacteria	567
1195	Ga0451577_0089001	3300042876	Bacteria	2755
1196	Ga0466972_0000084	3300044658	Bacteria	86336
1197	Ga0466961_0065027	3300044693	Bacteria	2318
1198	Ga0466968_0573646	3300044735	Bacteria	568
1199	Ga0466957_0002234	3300044842	Bacteria	10386
1200	Ga0451576_0466476	3300045051	Bacteria	1326
1201	Ga0495592_0076221	3300046454	Bacteria	2433
1202	Ga0495638_0225529	3300046460	Bacteria	1045
1203	Ga0495641_0328102	3300046461	Bacteria	691
1204	Ga0495651_0004151	3300046462	Bacteria	11095
1205	Ga0495651_0109847	3300046462	Bacteria	2041
1206	Ga0495653_0149748	3300046463	Bacteria	1632
1207	Ga0495585_0003091	3300046492	Bacteria	11443
1208	Ga0495606_0534668	3300046507	Bacteria	586
1209	Ga0495608_0031265	3300046511	Bacteria	3601
1210	Ga0495608_0285560	3300046511	Bacteria	1023
1211	Ga0495616_0443102	3300046513	Bacteria	527
1212	Ga0495620_0043594	3300046515	Bacteria	1953
1213	Ga0495620_0083271	3300046515	Bacteria	1291
1214	Ga0495628_0026278	3300046516	Bacteria	4749
1215	Ga0495628_0035691	3300046516	Bacteria	3994
1216	Ga0495628_0359951	3300046516	Bacteria	1068
1217	Ga0495630_0099159	3300046517	Bacteria	2204
1218	Ga0495666_0239782	3300046526	Bacteria	828
1219	Ga0495642_0027738	3300046528	Bacteria	2254
1220	Ga0495642_0082612	3300046528	Bacteria	1354
1221	Ga0495652_0009284	3300046529	Bacteria	8940
1222	Ga0495652_0021508	3300046529	Bacteria	5732
1223	Ga0495652_0042709	3300046529	Bacteria	3909
1224	Ga0495640_0247357	3300046533	Bacteria	1118
1225	Ga0495587_0030836	3300046536	Bacteria	3250
1226	Ga0495598_0092111	3300046537	Bacteria	990
1227	Ga0495598_0275649	3300046537	Bacteria	630
1228	Ga0495621_0001969	3300046539	Bacteria	5406
1229	Ga0495621_0072254	3300046539	Bacteria	1273
1230	Ga0495621_0094598	3300046539	Bacteria	1130
1231	Ga0495621_0133617	3300046539	Bacteria	967
1232	Ga0495621_0175938	3300046539	Bacteria	852
1233	Ga0495621_0434303	3300046539	Bacteria	560
1234	Ga0495621_0486794	3300046539	Bacteria	531
1235	Ga0495645_0000808	3300046543	Bacteria	21464
1236	Ga0495645_0002184	3300046543	Bacteria	13296
1237	Ga0495645_0010794	3300046543	Bacteria	6417
1238	Ga0495645_0238411	3300046543	Bacteria	1215
1239	Ga0495622_0193273	3300046557	Bacteria	909
1240	Ga0495633_0073668	3300046558	Bacteria	1592
1241	Ga0495667_0973278	3300046559	Bacteria	518
1242	Ga0495656_0287708	3300046615	Bacteria	839
1243	Ga0495635_0360445	3300046663	Bacteria	969
1244	Ga0495659_0055643	3300046664	Bacteria	1450
1245	Ga0495657_0251529	3300046675	Bacteria	1064
1246	Ga0495657_0663542	3300046675	Bacteria	601
1247	Ga0495599_0000841	3300046678	Bacteria	17299
1248	Ga0495623_0017798	3300046679	Bacteria	4590
1249	Ga0495646_0003195	3300046680	Bacteria	10175
1250	Ga0495646_0021937	3300046680	Bacteria	4031
1251	Ga0495658_0143558	3300046683	Bacteria	1461
1252	Ga0495658_0975702	3300046683	Bacteria	541
1253	Ga0495624_0070386	3300046690	Bacteria	2178
1254	Ga0495624_0083293	3300046690	Bacteria	1978
1255	Ga0495660_0028666	3300046810	Bacteria	3143
1256	Ga0495604_0975635	3300047317	Bacteria	526
1257	Ga0495636_0031848	3300047318	Bacteria	2162
1258	Ga0495674_0125298	3300047319	Bacteria	2168
1259	Ga0495676_0012456	3300047321	Bacteria	7660
1260	Ga0495676_0803897	3300047321	Bacteria	605
1261	Ga0495683_0043814	3300047323	Bacteria	2252
1262	Ga0495675_0100920	3300047444	Bacteria	1806
1263	Ga0495684_0424572	3300047471	Bacteria	929
1264	Ga0495593_0053118	3300047673	Bacteria	2139
1265	Ga0495602_0107327	3300048088	Bacteria	2276
1266	Ga0495602_0132946	3300048088	Bacteria	1981
1267	Ga0496100_0198943	3300048903	Bacteria	1459
1268	Ga0496100_0541969	3300048903	Bacteria	899
1269	Ga0496100_0605872	3300048903	Bacteria	851
1270	Ga0496101_0034634	3300048904	Bacteria	3568
1271	Ga0496101_0052525	3300048904	Bacteria	2939
1272	Ga0496101_0123328	3300048904	Bacteria	1961
1273	Ga0496102_0316002	3300048905	Bacteria	1472
1274	Ga0496103_0060319	3300048906	Bacteria	2358
1275	Ga0496103_0384766	3300048906	Bacteria	901
1276	Ga0496104_0047505	3300048907	Bacteria	4046
1277	Ga0496104_0067843	3300048907	Bacteria	3389
1278	Ga0496104_0400546	3300048907	Bacteria	1285
1279	Ga0496104_1101062	3300048907	Bacteria	698
1280	Ga0496106_0069339	3300048909	Bacteria	2691
1281	Ga0496106_0102681	3300048909	Bacteria	2218
1282	Ga0496106_0524292	3300048909	Bacteria	951
1283	Ga0496106_1023536	3300048909	Bacteria	649
1284	Ga0496106_1503652	3300048909	Bacteria	518
1285	Ga0496107_0040774	3300048910	Bacteria	3333
1286	Ga0496107_0190648	3300048910	Bacteria	1523
1287	Ga0496107_0222957	3300048910	Bacteria	1403
1288	Ga0496107_0394454	3300048910	Bacteria	1029
1289	Ga0496107_0746973	3300048910	Bacteria	718
1290	Ga0496108_0070998	3300048911	Bacteria	2938
1291	Ga0496108_0180613	3300048911	Bacteria	1827
1292	Ga0496108_0510394	3300048911	Bacteria	1050
1293	Ga0496108_1077072	3300048911	Bacteria	684
1294	Ga0496108_1590048	3300048911	Bacteria	541
1295	Ga0496109_0190835	3300048912	Bacteria	1925
1296	Ga0496109_0437049	3300048912	Bacteria	1236
1297	Ga0496109_1828767	3300048912	Bacteria	540
1298	Ga0496110_0086416	3300048913	Bacteria	2800
1299	Ga0496110_0705071	3300048913	Bacteria	911
1300	Ga0496110_1588857	3300048913	Bacteria	564
1301	Ga0496112_0183530	3300048915	Bacteria	2056
1302	Ga0496112_0434833	3300048915	Bacteria	1250
1303	Ga0496112_1253482	3300048915	Bacteria	658
1304	Ga0496114_0031536	3300048917	Bacteria	4361
1305	Ga0496114_0186186	3300048917	Bacteria	1814
1306	Ga0496114_1133801	3300048917	Bacteria	667
1307	Ga0496115_0009430	3300048918	Bacteria	7253
1308	Ga0496115_0032721	3300048918	Bacteria	4103
1309	Ga0496115_0086056	3300048918	Bacteria	2564
1310	Ga0496115_0245056	3300048918	Bacteria	1477
1311	Ga0496116_0274777	3300048919	Bacteria	820
1312	Ga0496117_0004101	3300048920	Bacteria	16328
1313	Ga0496117_0030685	3300048920	Bacteria	4119
1314	Ga0496117_0148039	3300048920	Bacteria	1394
1315	Ga0496118_0004682	3300048921	Bacteria	16037
1316	Ga0496118_0005239	3300048921	Bacteria	14827
1317	Ga0496118_0177558	3300048921	Bacteria	1291
1318	Ga0496121_0054315	3300048924	Bacteria	3348
1319	Ga0501033_0219162	3300049570	Bacteria	1355
1320	Ga0501033_0295277	3300049570	Bacteria	1142
1321	Ga0501034_0378774	3300049571	Bacteria	1340
1322	Ga0501036_0971028	3300049572	Bacteria	696
1323	Ga0501037_0182861	3300049573	Bacteria	1487
1324	Ga0501038_0500856	3300049574	Bacteria	929
1325	Ga0501040_0644018	3300049576	Bacteria	766
1326	Ga0501042_1102363	3300049578	Bacteria	579
1327	Ga0501046_1016346	3300049580	Bacteria	575
1328	Ga0501047_0020169	3300049581	Bacteria	6399
1329	Ga0501047_0821557	3300049581	Bacteria	744
1330	Ga0501067_0429325	3300049583	Bacteria	738
1331	Ga0501068_0193073	3300049584	Bacteria	1290
1332	Ga0501069_0001198	3300049585	Bacteria	12629
1333	Ga0501069_0113287	3300049585	Bacteria	1546
1334	Ga0501070_0007428	3300049586	Bacteria	9306
1335	Ga0501070_0052083	3300049586	Bacteria	3397
1336	Ga0501070_0167601	3300049586	Bacteria	1810
1337	Ga0501070_0333945	3300049586	Bacteria	1232
1338	Ga0501070_0593318	3300049586	Bacteria	883
1339	Ga0501071_1363433	3300049587	Bacteria	548
1340	Ga0501072_0089516	3300049588	Bacteria	2443
1341	Ga0501072_0405502	3300049588	Bacteria	1081
1342	Ga0501072_0664788	3300049588	Bacteria	820
1343	Ga0501073_0005888	3300049589	Bacteria	9149
1344	Ga0501074_0001066	3300049590	Bacteria	17874
1345	Ga0501076_0061533	3300049592	Bacteria	2988
1346	Ga0501076_0261072	3300049592	Bacteria	1418
1347	Ga0501076_1612326	3300049592	Bacteria	532
1348	Ga0501077_0004844	3300049593	Bacteria	8179
1349	Ga0501079_0007531	3300049741	Bacteria	8239
1350	Ga0501079_0497855	3300049741	Bacteria	958
1351	Ga0501080_0003596	3300049742	Bacteria	13648
1352	Ga0501080_0314435	3300049742	Bacteria	1419
1353	Ga0501080_1354385	3300049742	Bacteria	608
1354	Ga0501083_0002695	3300049744	Bacteria	12241
1355	Ga0501083_0337630	3300049744	Bacteria	980
1356	Ga0501035_0021848	3300049822	Bacteria	5880
1357	Ga0501035_0147762	3300049822	Bacteria	2041
1358	Ga0501035_0437196	3300049822	Bacteria	1084
1359	Ga0501044_0006400	3300049823	Bacteria	13016
1360	Ga0501044_0174498	3300049823	Bacteria	2119
1361	Ga0501044_0221010	3300049823	Bacteria	1845
1362	Ga0501044_1465516	3300049823	Bacteria	548
1363	Ga0501045_0428560	3300049824	Bacteria	984
1364	nmdc:mga03683_281237_c1	3300050489	Bacteria	777
1365	nmdc:mga03683_515123_c1	3300050489	Bacteria	580
1366	nmdc:mga0k408_104216_c1	3300050493	Bacteria	1674
1367	nmdc:mga0k408_250867_c1	3300050493	Bacteria	1057
1368	nmdc:mga0k408_345832_c1	3300050493	Bacteria	887
1369	nmdc:mga0k408_395787_c1	3300050493	Bacteria	822
1370	nmdc:mga0k408_41704_c1	3300050493	Bacteria	2642
1371	nmdc:mga0k408_77360_c1	3300050493	Bacteria	1946
1372	nmdc:mga07m45_100079_c1	3300050496	Bacteria	1665
1373	nmdc:mga07m45_1462_c1	3300050496	Bacteria	10840
1374	nmdc:mga07m45_246819_c1	3300050496	Bacteria	1039
1375	nmdc:mga07m45_884970_c1	3300050496	Bacteria	511
1376	nmdc:mga05p37_431342_c1	3300050507	Bacteria	1531
1377	nmdc:mga05p37_97096_c1	3300050507	Bacteria	3630
1378	nmdc:mga09592_1468229_c1	3300050508	Bacteria	556
1379	nmdc:mga08y16_1483565_c1	3300050511	Bacteria	639
1380	nmdc:mga08y16_1488511_c1	3300050511	Bacteria	638
1381	nmdc:mga08y16_236341_c1	3300050511	Bacteria	1889
1382	nmdc:mga08y16_249226_c1	3300050511	Bacteria	1835
1383	nmdc:mga08y16_36491_c1	3300050511	Bacteria	5163
1384	nmdc:mga08y16_61937_c1	3300050511	Bacteria	3907
1385	nmdc:mga0n895_1712523_c1	3300050512	Bacteria	591
1386	nmdc:mga0n895_309129_c1	3300050512	Bacteria	1602
1387	nmdc:mga0n895_395221_c1	3300050512	Bacteria	1398
1388	nmdc:mga0n895_664491_c1	3300050512	Bacteria	1040
1389	nmdc:mga0rr50_1417753_c1	3300050513	Bacteria	588
1390	nmdc:mga0rr50_1489610_c1	3300050513	Bacteria	572
1391	nmdc:mga0rr50_334838_c1	3300050513	Bacteria	1271
1392	nmdc:mga08x19_144919_c1	3300050514	Bacteria	1606
1393	nmdc:mga08x19_167623_c1	3300050514	Bacteria	1494
1394	nmdc:mga0a205_1078370_c1	3300050515	Bacteria	650
1395	nmdc:mga0a205_18502_c1	3300050515	Bacteria	6552
1396	Ga0495601_0335499	3300053077	Bacteria	984
1397	Ga0500635_0015220	3300053080	Bacteria	2268
1398	Ga0495655_0131907	3300053083	Bacteria	770
1399	Ga0495595_0545931	3300053084	Bacteria	592
1400	Ga0500578_0078030	3300053086	Bacteria	2108
1401	Ga0500578_0155315	3300053086	Bacteria	1423
1402	Ga0500578_0520587	3300053086	Bacteria	666
1403	Ga0500644_0006415	3300053088	Bacteria	3014
1404	Ga0500646_0037604	3300053090	Bacteria	1352
1405	Ga0500583_0000830	3300053092	Bacteria	8898
1406	Ga0500651_0022908	3300053093	Bacteria	3906
1407	Ga0500566_0002584	3300053094	Bacteria	10772
1408	Ga0500566_0165937	3300053094	Bacteria	1146
1409	Ga0500641_0029713	3300053096	Bacteria	2143
1410	Ga0500641_0104997	3300053096	Bacteria	1213
1411	Ga0500555_005319	3300053103	Bacteria	3651
1412	Ga0500556_0404890	3300053104	Bacteria	523
1413	Ga0500593_000739	3300053117	Bacteria	12327
1414	Ga0500595_022290	3300053119	Bacteria	2245
1415	Ga0500614_019705	3300053123	Bacteria	1549
1416	Ga0500642_0333374	3300053130	Bacteria	677
1417	Ga0500652_157972	3300053131	Bacteria	938
1418	Ga0500658_0023848	3300053134	Bacteria	2340
1419	Ga0500658_0260176	3300053134	Bacteria	798
1420	Ga0500577_0147011	3300053142	Bacteria	998
1421	Ga0500585_065593	3300053144	Bacteria	1309
1422	Ga0500588_0037272	3300053146	Bacteria	1443
1423	Ga0500603_002055	3300053150	Bacteria	4446
1424	Ga0500604_0009122	3300053151	Bacteria	2640
1425	Ga0500616_0002693	3300053153	Bacteria	14446
1426	Ga0500616_0237552	3300053153	Bacteria	785
1427	Ga0500622_0003735	3300053156	Bacteria	9964
1428	Ga0501084_0018430	3300054114	Bacteria	5811
1429	Ga0501082_0039532	3300060353	Bacteria	4069
1430	Ga0501082_1989982	3300060353	Bacteria	507
1431	Ga0466962_0127586	3300061719	Bacteria	1229
1432	Ga0530510_0493192	3300061734	Bacteria	928

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300003771	Ga0055526_1015717	Ga0055526_10157172	100
2	3300012513	Ga0157326_1000630	Ga0157326_10006308	100
3	3300025291	Ga0209675_1035001	Ga0209675_10350012	100
4	3300025295	Ga0209564_1004843	Ga0209564_10048432	100
5	3300005616	Ga0068852_100995917	Ga0068852_1009959172	105
6	3300037466	Ga0395898_0037284	Ga0395898_0037284_734_1153	110
7	3300037471	Ga0395905_0016113	Ga0395905_0016113_2079_2498	110
8	3300038443	Ga0395901_0155298	Ga0395901_0155298_930_1349	110
9	iso_pu_bacteria	2960693952	2960700612	111
10	3300049822	Ga0501035_0021848	Ga0501035_0021848_5175_5543	112
11	3300049823	Ga0501044_0006400	Ga0501044_0006400_4505_4873	112
12	iso_pu_bacteria	2515154107	2515609887	112
13	3300003322	rootL2_10172026	rootL2_101720263	113
14	3300005616	Ga0068852_100590599	Ga0068852_1005905991	113
15	3300037471	Ga0395905_0164532	Ga0395905_0164532_700_1074	113
16	3300050515	nmdc:mga0a205_1078370_c1	nmdc:mga0a205_1078370_c1_11_355	114
17	3300005459	Ga0068867_100016651	Ga0068867_1000166516	115
18	3300009148	Ga0105243_10018886	Ga0105243_100188864	115
19	3300014745	Ga0157377_10007665	Ga0157377_100076654	115
20	3300025935	Ga0207709_10009959	Ga0207709_100099598	115
21	3300026089	Ga0207648_10026252	Ga0207648_100262528	115
22	3300005355	Ga0070671_101024099	Ga0070671_1010240992	116
23	3300026088	Ga0207641_11314087	Ga0207641_113140871	116
24	iso_pu_bacteria	2510065057	2510304611	117
25	iso_pu_bacteria	2511231052	2511499780	117
26	iso_pu_bacteria	2512047086	2512530202	117
27	iso_pu_bacteria	2512875026	2512974990	117
28	iso_pu_bacteria	2513237086	2513584880	117
29	iso_pu_bacteria	2513237089	2513605027	117
30	iso_pu_bacteria	2513237140	2513883045	117
31	iso_pu_bacteria	2513237143	2513903100	117
32	iso_pu_bacteria	2513237156	2513986955	117
33	iso_pu_bacteria	2513237160	2514004365	117
34	iso_pu_bacteria	2516653046	2516897370	117
35	iso_pu_bacteria	2517487022	2517567636	117
36	iso_pu_bacteria	2524023207	2524449513	117
37	iso_pu_bacteria	2551306084	2551678519	117
38	iso_pu_bacteria	2551306084	2551681550	117
39	iso_pu_bacteria	2551306085	2551688894	117
40	iso_pu_bacteria	2551306086	2551695907	117
41	iso_pu_bacteria	2551306087	2551702709	117
42	iso_pu_bacteria	2551306089	2551714936	117
43	iso_pu_bacteria	2551306090	2551723415	117
44	iso_pu_bacteria	2551306092	2551739122	117
45	iso_pu_bacteria	2551306093	2551742823	117
46	iso_pu_bacteria	2582581306	2585266892	117
47	iso_pu_bacteria	2582581865	2585387935	117
48	iso_pu_bacteria	2599185239	2599735893	117
49	iso_pu_bacteria	2643221618	2644106023	117
50	iso_pu_bacteria	2643221626	2644147014	117
51	iso_pu_bacteria	2643221655	2644310634	117
52	iso_pu_bacteria	2643221659	2644334579	117
53	iso_pu_bacteria	2643221698	2644545222	117
54	iso_pu_bacteria	2643221712	2644616468	117
55	iso_pu_bacteria	2767802442	2770200446	117
56	iso_pu_bacteria	2775506902	2776271606	117
57	iso_pu_bacteria	2775506904	2776279881	117
58	iso_pu_bacteria	2791355091	2792622855	117
59	iso_pu_bacteria	2791355092	2792629108	117
60	iso_pu_bacteria	2802428858	2802718169	117
61	iso_pu_bacteria	2802428861	2802736553	117
62	iso_pu_bacteria	2802428862	2802744529	117
63	iso_pu_bacteria	2802428863	2802749882	117
64	iso_pu_bacteria	2831265667	2831267463	117
65	iso_pu_bacteria	2838054893	2838060416	117
66	iso_pu_bacteria	2838074704	2838076059	117
67	iso_pu_bacteria	2839993093	2839997289	117
68	iso_pu_bacteria	2840764183	2840765271	117
69	iso_pu_bacteria	2844163670	2844165727	117
70	iso_pu_bacteria	2855825444	2855830758	117
71	iso_pu_bacteria	2855839649	2855845470	117
72	iso_pu_bacteria	2858800743	2858805337	117
73	iso_pu_bacteria	2885192300	2885197817	117
74	iso_pu_bacteria	2896384573	2896391342	117
75	iso_pu_bacteria	2915980308	2915986827	117
76	iso_pu_bacteria	2915986958	2915989769	117
77	iso_pu_bacteria	2915993759	2915997565	117
78	iso_pu_bacteria	2916007675	2916011466	117
79	iso_pu_bacteria	2916014648	2916019254	117
80	iso_pu_bacteria	2916021584	2916025697	117
81	iso_pu_bacteria	2916035215	2916039582	117
82	iso_pu_bacteria	2916041962	2916043871	117
83	iso_pu_bacteria	2916048683	2916053029	117
84	iso_pu_bacteria	2916061851	2916063836	117
85	iso_pu_bacteria	2916068649	2916071943	117
86	iso_pu_bacteria	2916076590	2916082228	117
87	iso_pu_bacteria	2919119836	2919124940	117
88	iso_pu_bacteria	2921201388	2921201558	117
89	iso_pu_bacteria	2921208531	2921211501	117
90	iso_pu_bacteria	2921237296	2921243165	117
91	iso_pu_bacteria	2921244191	2921250566	117
92	iso_pu_bacteria	2921250672	2921253518	117
93	iso_pu_bacteria	2921282425	2921286580	117
94	iso_pu_bacteria	2921289301	2921293041	117
95	iso_pu_bacteria	2921296804	2921302790	117
96	iso_pu_bacteria	2924144063	2924149351	117
97	iso_pu_bacteria	2924150972	2924155159	117
98	iso_pu_bacteria	2924158325	2924162588	117
99	iso_pu_bacteria	2924165586	2924166858	117
100	iso_pu_bacteria	2924186466	2924188660	117
101	iso_pu_bacteria	2924193448	2924197061	117
102	iso_pu_bacteria	2924200457	2924206326	117
103	iso_pu_bacteria	2924214083	2924218454	117
104	iso_pu_bacteria	2924221636	2924222226	117
105	iso_pu_bacteria	2924228884	2924231515	117
106	iso_pu_bacteria	2936996657	2937000322	117
107	iso_pu_bacteria	2937002841	2937009142	117
108	iso_pu_bacteria	2937009748	2937011467	117
109	iso_pu_bacteria	2937016420	2937017257	117
110	iso_pu_bacteria	2937029754	2937035377	117
111	iso_pu_bacteria	2937036028	2937040036	117
112	iso_pu_bacteria	2937049772	2937054923	117
113	iso_pu_bacteria	2937056579	2937060659	117
114	iso_pu_bacteria	2937063883	2937067332	117
115	iso_pu_bacteria	2937071275	2937074513	117
116	iso_pu_bacteria	2937078374	2937079061	117
117	iso_pu_bacteria	2937084907	2937084976	117
118	iso_pu_bacteria	2937091812	2937095124	117
119	iso_pu_bacteria	2937098957	2937103753	117
120	iso_pu_bacteria	2937106411	2937109300	117
121	iso_pu_bacteria	2937113482	2937117380	117
122	iso_pu_bacteria	2937119839	2937120834	117
123	iso_pu_bacteria	2957375807	2957376215	117
124	iso_pu_bacteria	2957382221	2957386767	117
125	iso_pu_bacteria	2957388812	2957391622	117
126	iso_pu_bacteria	2957402308	2957407069	117
127	iso_pu_bacteria	2957408893	2957409314	117
128	iso_pu_bacteria	2957415311	2957418828	117
129	iso_pu_bacteria	2957422303	2957425101	117
130	iso_pu_bacteria	2957430029	2957435602	117
131	iso_pu_bacteria	2957437181	2957440939	117
132	iso_pu_bacteria	2957443900	2957444674	117
133	iso_pu_bacteria	2957450854	2957453039	117
134	iso_pu_bacteria	2957457609	2957463134	117
135	iso_pu_bacteria	2957464669	2957470784	117
136	iso_pu_bacteria	2957471148	2957476060	117
137	iso_pu_bacteria	2957484790	2957489403	117
138	iso_pu_bacteria	2957491536	2957495377	117
139	iso_pu_bacteria	2957498199	2957502822	117
140	iso_pu_bacteria	2957505466	2957508987	117
141	iso_pu_bacteria	2960584000	2960590198	117
142	iso_pu_bacteria	2960591022	2960597488	117
143	iso_pu_bacteria	2960597568	2960600505	117
144	iso_pu_bacteria	2960603979	2960606881	117
145	iso_pu_bacteria	2960610863	2960612763	117
146	iso_pu_bacteria	2960617483	2960618410	117
147	iso_pu_bacteria	2960631154	2960636684	117
148	iso_pu_bacteria	2960637947	2960643414	117
149	iso_pu_bacteria	2960645483	2960651825	117
150	iso_pu_bacteria	2960652885	2960660236	117
151	iso_pu_bacteria	2960660292	2960661297	117
152	iso_pu_bacteria	2960667422	2960670606	117
153	iso_pu_bacteria	2960674078	2960676187	117
154	iso_pu_bacteria	2960680706	2960686188	117
155	iso_pu_bacteria	2960687367	2960689701	117
156	iso_pu_bacteria	2964607997	2964612349	117
157	iso_pu_bacteria	2964621998	2964628371	117
158	iso_pu_bacteria	2964636051	2964637950	117
159	iso_pu_bacteria	2964643177	2964647128	117
160	iso_pu_bacteria	2964649959	2964654419	117
161	iso_pu_bacteria	2964656573	2964660950	117
162	iso_pu_bacteria	2964678106	2964683208	117
163	iso_pu_bacteria	2964685014	2964691195	117
164	iso_pu_bacteria	2964698721	2964699723	117
165	iso_pu_bacteria	2964705432	2964709056	117
166	iso_pu_bacteria	2964712639	2964716405	117
167	iso_pu_bacteria	2964719344	2964724803	117
168	iso_pu_bacteria	2967664464	2967668857	117
169	iso_pu_bacteria	2967671571	2967675748	117
170	iso_pu_bacteria	2967678726	2967683508	117
171	iso_pu_bacteria	2967686174	2967690871	117
172	iso_pu_bacteria	2967693043	2967697330	117
173	iso_pu_bacteria	2967706974	2967707528	117
174	iso_pu_bacteria	2967714385	2967719305	117
175	iso_pu_bacteria	2967721400	2967724076	117
176	iso_pu_bacteria	2967728569	2967733207	117
177	iso_pu_bacteria	2967735183	2967741254	117
178	iso_pu_bacteria	2967742019	2967745068	117
179	iso_pu_bacteria	2967748971	2967755203	117
180	iso_pu_bacteria	2967769361	2967773902	117
181	iso_pu_bacteria	2970019648	2970024246	117
182	iso_pu_bacteria	2970026789	2970031203	117
183	iso_pu_bacteria	2970033650	2970039368	117
184	iso_pu_bacteria	2970040964	2970043631	117
185	iso_pu_bacteria	2970047711	2970052254	117
186	iso_pu_bacteria	2970054988	2970057465	117
187	iso_pu_bacteria	2970061556	2970065815	117
188	iso_pu_bacteria	2970068827	2970071466	117
189	iso_pu_bacteria	2970076120	2970080363	117
190	iso_pu_bacteria	2970088815	2970093368	117
191	iso_pu_bacteria	2970109326	2970112689	117
192	iso_pu_bacteria	2970116247	2970119184	117
193	iso_pu_bacteria	2970122695	2970126949	117
194	iso_pu_bacteria	2970129317	2970133238	117
195	iso_pu_bacteria	2970136068	2970140414	117
196	iso_pu_bacteria	2970143518	2970147961	117
197	iso_pu_bacteria	2970149975	2970153517	117
198	iso_pu_bacteria	2970156795	2970163835	117
199	iso_pu_bacteria	2970170962	2970177257	117
200	iso_pu_bacteria	2970177841	2970184244	117
201	iso_pu_bacteria	2970184632	2970191232	117
202	iso_pu_bacteria	2970191845	2970194595	117
203	iso_pu_bacteria	2977516862	2977520185	117
204	iso_pu_bacteria	2977523885	2977527582	117
205	iso_pu_bacteria	2977530762	2977535327	117
206	iso_pu_bacteria	2977537788	2977542877	117
207	iso_pu_bacteria	2977544691	2977548752	117
208	iso_pu_bacteria	2977551784	2977556418	117
209	iso_pu_bacteria	2977558990	2977562263	117
210	iso_pu_bacteria	2977572785	2977576121	117
211	iso_pu_bacteria	2977579622	2977582123	117
212	iso_pu_bacteria	8003999396	8004005179	117
213	3300041463	Ga0451804_0071397	Ga0451804_0071397_650_1018	118
214	iso_pu_bacteria	2904578770	2904583971	118
215	3300003773	Ga0055537_1003070	Ga0055537_10030706	119
216	3300003784	Ga0055534_1053727	Ga0055534_10537271	119
217	3300005546	Ga0070696_100069218	Ga0070696_1000692185	119
218	3300005985	Ga0081539_10046349	Ga0081539_100463494	119
219	3300006048	Ga0075363_100517050	Ga0075363_1005170502	119
220	3300006051	Ga0075364_11260373	Ga0075364_112603731	119
221	3300009093	Ga0105240_12549639	Ga0105240_125496391	119
222	3300009551	Ga0105238_10429190	Ga0105238_104291903	119
223	3300025263	Ga0209565_1000556	Ga0209565_10005568	119
224	3300025291	Ga0209675_1019764	Ga0209675_10197643	119
225	3300025299	Ga0209256_1031405	Ga0209256_10314052	119
226	3300025917	Ga0207660_10055048	Ga0207660_100550482	119
227	3300050493	nmdc:mga0k408_395787_c1	nmdc:mga0k408_395787_c1_34_402	119
228	3300050511	nmdc:mga08y16_1488511_c1	nmdc:mga08y16_1488511_c1_242_616	119
229	3300002741	JGI25157J39369_1000870	JGI25157J39369_100087017	120
230	3300005295	Ga0065707_10211743	Ga0065707_102117431	120
231	3300005334	Ga0068869_100286660	Ga0068869_1002866602	120
232	3300005340	Ga0070689_100490573	Ga0070689_1004905731	120
233	3300005353	Ga0070669_100502816	Ga0070669_1005028161	120
234	3300005354	Ga0070675_100715288	Ga0070675_1007152881	120
235	3300005365	Ga0070688_100140582	Ga0070688_1001405822	120
236	3300005434	Ga0070709_10501995	Ga0070709_105019952	120
237	3300005444	Ga0070694_100240697	Ga0070694_1002406972	120
238	3300005445	Ga0070708_100032399	Ga0070708_1000323991	120
239	3300005543	Ga0070672_100999452	Ga0070672_1009994521	120
240	3300005544	Ga0070686_100635388	Ga0070686_1006353882	120
241	3300005615	Ga0070702_100322699	Ga0070702_1003226992	120
242	3300005617	Ga0068859_100079301	Ga0068859_1000793014	120
243	3300005719	Ga0068861_100650150	Ga0068861_1006501502	120
244	3300005842	Ga0068858_100333637	Ga0068858_1003336373	120
245	3300006844	Ga0075428_100035549	Ga0075428_1000355497	120
246	3300006881	Ga0068865_101007643	Ga0068865_1010076432	120
247	3300006931	Ga0097620_100079300	Ga0097620_1000793002	120
248	3300009094	Ga0111539_10092734	Ga0111539_100927348	120
249	3300009098	Ga0105245_10512834	Ga0105245_105128342	120
250	3300012491	Ga0157329_1026872	Ga0157329_10268721	120
251	3300013297	Ga0157378_10022427	Ga0157378_100224273	120
252	3300013306	Ga0163162_10554396	Ga0163162_105543962	120
253	3300013306	Ga0163162_10949722	Ga0163162_109497222	120
254	3300013308	Ga0157375_10119266	Ga0157375_101192662	120
255	3300014326	Ga0157380_11107020	Ga0157380_111070201	120
256	3300025231	Ga0207427_114301	Ga0207427_1143012	120
257	3300025250	Ga0209026_1000090	Ga0209026_100009099	120
258	3300025256	Ga0209759_1019162	Ga0209759_10191622	120
259	3300025906	Ga0207699_10014838	Ga0207699_100148383	120
260	3300025923	Ga0207681_10573001	Ga0207681_105730012	120
261	3300025940	Ga0207691_11665825	Ga0207691_116658251	120
262	3300025942	Ga0207689_10303692	Ga0207689_103036922	120
263	3300025960	Ga0207651_12087361	Ga0207651_120873611	120
264	3300026035	Ga0207703_10254070	Ga0207703_102540701	120
265	3300026095	Ga0207676_11339174	Ga0207676_113391742	120
266	3300026118	Ga0207675_100280111	Ga0207675_1002801111	120
267	3300026118	Ga0207675_100444413	Ga0207675_1004444133	120
268	3300028794	Ga0307515_10019184	Ga0307515_100191842	120
269	3300031616	Ga0307508_10244100	Ga0307508_102441002	120
270	3300046511	Ga0495608_0285560	Ga0495608_0285560_543_962	120
271	3300046516	Ga0495628_0035691	Ga0495628_0035691_2557_2976	120
272	3300046529	Ga0495652_0042709	Ga0495652_0042709_1194_1613	120
273	3300046537	Ga0495598_0275649	Ga0495598_0275649_238_609	120
274	3300046543	Ga0495645_0000808	Ga0495645_0000808_20815_21186	120
275	3300046559	Ga0495667_0973278	Ga0495667_0973278_131_502	120
276	3300046679	Ga0495623_0017798	Ga0495623_0017798_2603_3022	120
277	3300048088	Ga0495602_0132946	Ga0495602_0132946_680_1099	120
278	3300048906	Ga0496103_0384766	Ga0496103_0384766_496_867	120
279	3300050511	nmdc:mga08y16_1483565_c1	nmdc:mga08y16_1483565_c1_246_617	120
280	3300050512	nmdc:mga0n895_1712523_c1	nmdc:mga0n895_1712523_c1_38_409	120
281	3300053080	Ga0500635_0015220	Ga0500635_0015220_704_1081	120
282	3300053086	Ga0500578_0078030	Ga0500578_0078030_1220_1588	120
283	3300053086	Ga0500578_0155315	Ga0500578_0155315_757_1134	120
284	3300053094	Ga0500566_0002584	Ga0500566_0002584_5378_5755	120
285	3300053096	Ga0500641_0104997	Ga0500641_0104997_767_1135	120
286	3300053134	Ga0500658_0023848	Ga0500658_0023848_1641_2009	120
287	3300053144	Ga0500585_065593	Ga0500585_065593_178_555	120
288	3300053150	Ga0500603_002055	Ga0500603_002055_3113_3490	120
289	3300053153	Ga0500616_0002693	Ga0500616_0002693_1693_2061	120
290	3300002067	JGI24735J21928_10047634	JGI24735J21928_100476342	121
291	3300002126	JGI24035J26624_1036167	JGI24035J26624_10361671	121
292	3300002739	JGI25158J39367_1008708	JGI25158J39367_10087082	121
293	3300002773	JGI25152J39213_1001782	JGI25152J39213_10017822	121
294	3300002987	JGI25159J45721_1000010	JGI25159J45721_100001096	121
295	3300002987	JGI25159J45721_1008606	JGI25159J45721_10086063	121
296	3300003187	JGI25151J46595_10016204	JGI25151J46595_100162044	121
297	3300003187	JGI25151J46595_10016935	JGI25151J46595_100169354	121
298	3300003187	JGI25151J46595_10056894	JGI25151J46595_100568941	121
299	3300003215	JGI25153J46596_10012678	JGI25153J46596_100126785	121
300	3300003354	JGI25160J50197_1000038	JGI25160J50197_100003896	121
301	3300003354	JGI25160J50197_1009866	JGI25160J50197_10098665	121
302	3300003374	JGI25161J50226_1001278	JGI25161J50226_10012787	121
303	3300003374	JGI25161J50226_1001392	JGI25161J50226_10013928	121
304	3300003578	Ga0006562J51391_1079420	Ga0006562J51391_10794203	121
305	3300003771	Ga0055526_1001706	Ga0055526_100170620	121
306	3300003771	Ga0055526_1009175	Ga0055526_10091754	121
307	3300003771	Ga0055526_1026815	Ga0055526_10268154	121
308	3300003773	Ga0055537_1000022	Ga0055537_100002287	121
309	3300003775	Ga0055524_1001073	Ga0055524_100107314	121
310	3300003781	Ga0055536_1002194	Ga0055536_10021946	121
311	3300003781	Ga0055536_1022344	Ga0055536_10223442	121
312	3300003781	Ga0055536_1064444	Ga0055536_10644441	121
313	3300003784	Ga0055534_1000067	Ga0055534_10000677	121
314	3300003784	Ga0055534_1007604	Ga0055534_10076044	121
315	3300003790	Ga0055528_1000037	Ga0055528_1000037109	121
316	3300003790	Ga0055528_1016768	Ga0055528_10167682	121
317	3300003791	Ga0055530_10000342	Ga0055530_1000034237	121
318	3300003792	Ga0055540_1001923	Ga0055540_10019236	121
319	3300003794	Ga0055531_10002643	Ga0055531_100026436	121
320	3300003911	JGI25405J52794_10092026	JGI25405J52794_100920261	121
321	3300004625	Ga0055543_1000170	Ga0055543_100017051	121
322	3300004625	Ga0055543_1000674	Ga0055543_100067416	121
323	3300005262	Ga0065165_1000077	Ga0065165_100007751	121
324	3300005288	Ga0065714_10130868	Ga0065714_101308682	121
325	3300005289	Ga0065704_10006391	Ga0065704_100063915	121
326	3300005289	Ga0065704_10406949	Ga0065704_104069492	121
327	3300005290	Ga0065712_10031730	Ga0065712_100317301	121
328	3300005290	Ga0065712_10041918	Ga0065712_100419181	121
329	3300005290	Ga0065712_10042483	Ga0065712_100424831	121
330	3300005290	Ga0065712_10052520	Ga0065712_100525201	121
331	3300005290	Ga0065712_10216933	Ga0065712_102169331	121
332	3300005293	Ga0065715_10198402	Ga0065715_101984022	121
333	3300005293	Ga0065715_10225666	Ga0065715_102256662	121
334	3300005293	Ga0065715_10243472	Ga0065715_102434721	121
335	3300005293	Ga0065715_10899125	Ga0065715_108991251	121
336	3300005328	Ga0070676_10008189	Ga0070676_100081899	121
337	3300005328	Ga0070676_10011526	Ga0070676_100115263	121
338	3300005328	Ga0070676_10100288	Ga0070676_101002882	121
339	3300005328	Ga0070676_10169899	Ga0070676_101698991	121
340	3300005328	Ga0070676_10668756	Ga0070676_106687561	121
341	3300005329	Ga0070683_101821431	Ga0070683_1018214311	121
342	3300005330	Ga0070690_100034876	Ga0070690_1000348764	121
343	3300005330	Ga0070690_100718028	Ga0070690_1007180282	121
344	3300005331	Ga0070670_100015973	Ga0070670_10001597310	121
345	3300005331	Ga0070670_100021476	Ga0070670_1000214767	121
346	3300005331	Ga0070670_100037020	Ga0070670_1000370204	121
347	3300005331	Ga0070670_100516439	Ga0070670_1005164392	121
348	3300005333	Ga0070677_10004027	Ga0070677_100040276	121
349	3300005333	Ga0070677_10310329	Ga0070677_103103292	121
350	3300005334	Ga0068869_100013980	Ga0068869_1000139803	121
351	3300005334	Ga0068869_100021719	Ga0068869_1000217193	121
352	3300005334	Ga0068869_100073415	Ga0068869_1000734153	121
353	3300005335	Ga0070666_10009277	Ga0070666_100092774	121
354	3300005335	Ga0070666_10086446	Ga0070666_100864462	121
355	3300005335	Ga0070666_10117890	Ga0070666_101178902	121
356	3300005335	Ga0070666_10593946	Ga0070666_105939461	121
357	3300005338	Ga0068868_100007539	Ga0068868_1000075396	121
358	3300005338	Ga0068868_100066903	Ga0068868_1000669032	121
359	3300005338	Ga0068868_100103776	Ga0068868_1001037764	121
360	3300005338	Ga0068868_100145907	Ga0068868_1001459073	121
361	3300005338	Ga0068868_100312576	Ga0068868_1003125762	121
362	3300005338	Ga0068868_101203360	Ga0068868_1012033601	121
363	3300005338	Ga0068868_101229499	Ga0068868_1012294991	121
364	3300005338	Ga0068868_101554309	Ga0068868_1015543091	121
365	3300005339	Ga0070660_100398686	Ga0070660_1003986861	121
366	3300005340	Ga0070689_100072515	Ga0070689_1000725151	121
367	3300005340	Ga0070689_101238278	Ga0070689_1012382781	121
368	3300005341	Ga0070691_10061048	Ga0070691_100610483	121
369	3300005344	Ga0070661_100076042	Ga0070661_1000760425	121
370	3300005347	Ga0070668_100000491	Ga0070668_1000004919	121
371	3300005347	Ga0070668_100054846	Ga0070668_1000548463	121
372	3300005347	Ga0070668_100116601	Ga0070668_1001166012	121
373	3300005347	Ga0070668_100144957	Ga0070668_1001449574	121
374	3300005353	Ga0070669_100003095	Ga0070669_10000309510	121
375	3300005353	Ga0070669_100101141	Ga0070669_1001011412	121
376	3300005353	Ga0070669_100176603	Ga0070669_1001766033	121
377	3300005353	Ga0070669_100181526	Ga0070669_1001815262	121
378	3300005353	Ga0070669_100826116	Ga0070669_1008261161	121
379	3300005353	Ga0070669_101298308	Ga0070669_1012983081	121
380	3300005354	Ga0070675_100000918	Ga0070675_10000091829	121
381	3300005354	Ga0070675_100000947	Ga0070675_10000094715	121
382	3300005354	Ga0070675_100042787	Ga0070675_1000427872	121
383	3300005354	Ga0070675_100112504	Ga0070675_1001125044	121
384	3300005354	Ga0070675_100272197	Ga0070675_1002721972	121
385	3300005354	Ga0070675_100505316	Ga0070675_1005053162	121
386	3300005354	Ga0070675_100794995	Ga0070675_1007949952	121
387	3300005355	Ga0070671_100000507	Ga0070671_1000005075	121
388	3300005355	Ga0070671_100000783	Ga0070671_10000078333	121
389	3300005355	Ga0070671_100010464	Ga0070671_1000104645	121
390	3300005355	Ga0070671_100034578	Ga0070671_1000345782	121
391	3300005355	Ga0070671_100336278	Ga0070671_1003362781	121
392	3300005355	Ga0070671_100553001	Ga0070671_1005530012	121
393	3300005356	Ga0070674_100037757	Ga0070674_1000377574	121
394	3300005356	Ga0070674_100059229	Ga0070674_1000592293	121
395	3300005356	Ga0070674_100071892	Ga0070674_1000718924	121
396	3300005356	Ga0070674_100733543	Ga0070674_1007335432	121
397	3300005356	Ga0070674_100840476	Ga0070674_1008404762	121
398	3300005364	Ga0070673_100032258	Ga0070673_1000322583	121
399	3300005364	Ga0070673_100053608	Ga0070673_1000536086	121
400	3300005364	Ga0070673_100154542	Ga0070673_1001545422	121
401	3300005364	Ga0070673_100995309	Ga0070673_1009953091	121
402	3300005365	Ga0070688_100008641	Ga0070688_1000086414	121
403	3300005365	Ga0070688_100066192	Ga0070688_1000661922	121
404	3300005365	Ga0070688_100263868	Ga0070688_1002638682	121
405	3300005366	Ga0070659_100160380	Ga0070659_1001603802	121
406	3300005366	Ga0070659_100639338	Ga0070659_1006393382	121
407	3300005367	Ga0070667_100004706	Ga0070667_1000047064	121
408	3300005367	Ga0070667_100018557	Ga0070667_1000185577	121
409	3300005367	Ga0070667_100148441	Ga0070667_1001484412	121
410	3300005367	Ga0070667_100236420	Ga0070667_1002364203	121
411	3300005367	Ga0070667_100285561	Ga0070667_1002855612	121
412	3300005367	Ga0070667_102232395	Ga0070667_1022323951	121
413	3300005434	Ga0070709_10626551	Ga0070709_106265511	121
414	3300005435	Ga0070714_100213902	Ga0070714_1002139022	121
415	3300005436	Ga0070713_100682531	Ga0070713_1006825311	121
416	3300005436	Ga0070713_102440110	Ga0070713_1024401101	121
417	3300005437	Ga0070710_10034831	Ga0070710_100348314	121
418	3300005437	Ga0070710_10237448	Ga0070710_102374481	121
419	3300005437	Ga0070710_10350253	Ga0070710_103502532	121
420	3300005439	Ga0070711_100055697	Ga0070711_1000556974	121
421	3300005439	Ga0070711_100084191	Ga0070711_1000841912	121
422	3300005440	Ga0070705_100077113	Ga0070705_1000771131	121
423	3300005440	Ga0070705_100394538	Ga0070705_1003945382	121
424	3300005441	Ga0070700_100651458	Ga0070700_1006514581	121
425	3300005441	Ga0070700_101320981	Ga0070700_1013209812	121
426	3300005444	Ga0070694_100128240	Ga0070694_1001282402	121
427	3300005445	Ga0070708_100358333	Ga0070708_1003583333	121
428	3300005445	Ga0070708_100384999	Ga0070708_1003849991	121
429	3300005455	Ga0070663_100220138	Ga0070663_1002201382	121
430	3300005455	Ga0070663_100372798	Ga0070663_1003727982	121
431	3300005456	Ga0070678_100001053	Ga0070678_10000105320	121
432	3300005456	Ga0070678_100006261	Ga0070678_1000062612	121
433	3300005456	Ga0070678_100006494	Ga0070678_10000649410	121
434	3300005456	Ga0070678_100007993	Ga0070678_1000079935	121
435	3300005456	Ga0070678_100093381	Ga0070678_1000933812	121
436	3300005456	Ga0070678_100201353	Ga0070678_1002013533	121
437	3300005456	Ga0070678_101099120	Ga0070678_1010991201	121
438	3300005457	Ga0070662_100021365	Ga0070662_1000213656	121
439	3300005457	Ga0070662_100044573	Ga0070662_1000445734	121
440	3300005457	Ga0070662_100423124	Ga0070662_1004231243	121
441	3300005458	Ga0070681_10054517	Ga0070681_100545175	121
442	3300005459	Ga0068867_100007738	Ga0068867_1000077383	121
443	3300005459	Ga0068867_100382908	Ga0068867_1003829081	121
444	3300005459	Ga0068867_100418463	Ga0068867_1004184632	121
445	3300005459	Ga0068867_101046145	Ga0068867_1010461451	121
446	3300005466	Ga0070685_10770485	Ga0070685_107704852	121
447	3300005467	Ga0070706_100005592	Ga0070706_1000055927	121
448	3300005467	Ga0070706_100551249	Ga0070706_1005512491	121
449	3300005468	Ga0070707_100202975	Ga0070707_1002029754	121
450	3300005468	Ga0070707_100579467	Ga0070707_1005794672	121
451	3300005471	Ga0070698_100030290	Ga0070698_1000302902	121
452	3300005471	Ga0070698_100083490	Ga0070698_1000834905	121
453	3300005507	Ga0074259_11066839	Ga0074259_110668391	121
454	3300005518	Ga0070699_100025260	Ga0070699_1000252602	121
455	3300005518	Ga0070699_100639691	Ga0070699_1006396912	121
456	3300005535	Ga0070684_100027650	Ga0070684_10002765011	121
457	3300005535	Ga0070684_100080336	Ga0070684_1000803364	121
458	3300005535	Ga0070684_100476996	Ga0070684_1004769962	121
459	3300005536	Ga0070697_100644935	Ga0070697_1006449351	121
460	3300005539	Ga0068853_100232249	Ga0068853_1002322492	121
461	3300005539	Ga0068853_102084012	Ga0068853_1020840121	121
462	3300005543	Ga0070672_100095925	Ga0070672_1000959253	121
463	3300005543	Ga0070672_100258925	Ga0070672_1002589252	121
464	3300005543	Ga0070672_100575293	Ga0070672_1005752932	121
465	3300005544	Ga0070686_100044936	Ga0070686_1000449364	121
466	3300005544	Ga0070686_100414435	Ga0070686_1004144351	121
467	3300005545	Ga0070695_101321938	Ga0070695_1013219381	121
468	3300005546	Ga0070696_100051196	Ga0070696_1000511964	121
469	3300005547	Ga0070693_100004136	Ga0070693_1000041364	121
470	3300005548	Ga0070665_100017826	Ga0070665_10001782612	121
471	3300005548	Ga0070665_100067768	Ga0070665_1000677683	121
472	3300005548	Ga0070665_101138756	Ga0070665_1011387561	121
473	3300005549	Ga0070704_100035912	Ga0070704_1000359122	121
474	3300005549	Ga0070704_100665542	Ga0070704_1006655421	121
475	3300005563	Ga0068855_100015542	Ga0068855_10001554212	121
476	3300005563	Ga0068855_100524960	Ga0068855_1005249603	121
477	3300005564	Ga0070664_100255966	Ga0070664_1002559662	121
478	3300005564	Ga0070664_101492673	Ga0070664_1014926732	121
479	3300005578	Ga0068854_100052642	Ga0068854_1000526426	121
480	3300005578	Ga0068854_100163303	Ga0068854_1001633032	121
481	3300005578	Ga0068854_100321592	Ga0068854_1003215921	121
482	3300005578	Ga0068854_100615377	Ga0068854_1006153772	121
483	3300005578	Ga0068854_100757113	Ga0068854_1007571132	121
484	3300005615	Ga0070702_100004431	Ga0070702_1000044319	121
485	3300005615	Ga0070702_100031544	Ga0070702_1000315442	121
486	3300005616	Ga0068852_100008728	Ga0068852_1000087282	121
487	3300005616	Ga0068852_100161458	Ga0068852_1001614585	121
488	3300005616	Ga0068852_100165757	Ga0068852_1001657574	121
489	3300005616	Ga0068852_101433060	Ga0068852_1014330602	121
490	3300005617	Ga0068859_100016585	Ga0068859_1000165856	121
491	3300005617	Ga0068859_100019496	Ga0068859_10001949612	121
492	3300005618	Ga0068864_100007276	Ga0068864_10000727611	121
493	3300005618	Ga0068864_100016159	Ga0068864_1000161595	121
494	3300005618	Ga0068864_100020881	Ga0068864_1000208816	121
495	3300005618	Ga0068864_100525780	Ga0068864_1005257802	121
496	3300005718	Ga0068866_10003214	Ga0068866_1000321410	121
497	3300005718	Ga0068866_10071389	Ga0068866_100713892	121
498	3300005719	Ga0068861_100151615	Ga0068861_1001516153	121
499	3300005719	Ga0068861_100259659	Ga0068861_1002596592	121
500	3300005719	Ga0068861_100535295	Ga0068861_1005352951	121
501	3300005719	Ga0068861_101012699	Ga0068861_1010126992	121
502	3300005840	Ga0068870_10087270	Ga0068870_100872704	121
503	3300005840	Ga0068870_10258988	Ga0068870_102589882	121
504	3300005841	Ga0068863_100173515	Ga0068863_1001735152	121
505	3300005841	Ga0068863_100197118	Ga0068863_1001971184	121
506	3300005841	Ga0068863_100229195	Ga0068863_1002291952	121
507	3300005841	Ga0068863_100251037	Ga0068863_1002510371	121
508	3300005841	Ga0068863_100281086	Ga0068863_1002810861	121
509	3300005841	Ga0068863_100478278	Ga0068863_1004782783	121
510	3300005842	Ga0068858_100004925	Ga0068858_10000492511	121
511	3300005842	Ga0068858_100050249	Ga0068858_1000502495	121
512	3300005843	Ga0068860_100019324	Ga0068860_1000193244	121
513	3300005843	Ga0068860_100032398	Ga0068860_1000323988	121
514	3300005843	Ga0068860_100333038	Ga0068860_1003330382	121
515	3300005844	Ga0068862_100236067	Ga0068862_1002360672	121
516	3300005844	Ga0068862_100668146	Ga0068862_1006681462	121
517	3300005844	Ga0068862_102394826	Ga0068862_1023948262	121
518	3300005937	Ga0081455_10005191	Ga0081455_1000519111	121
519	3300005937	Ga0081455_10178363	Ga0081455_101783632	121
520	3300005981	Ga0081538_10162071	Ga0081538_101620712	121
521	3300005985	Ga0081539_10001350	Ga0081539_100013504	121
522	3300006028	Ga0070717_10010419	Ga0070717_100104196	121
523	3300006042	Ga0075368_10435697	Ga0075368_104356971	121
524	3300006048	Ga0075363_100548989	Ga0075363_1005489892	121
525	3300006163	Ga0070715_10264041	Ga0070715_102640412	121
526	3300006163	Ga0070715_10361758	Ga0070715_103617582	121
527	3300006175	Ga0070712_100181258	Ga0070712_1001812581	121
528	3300006175	Ga0070712_100978872	Ga0070712_1009788722	121
529	3300006195	Ga0075366_10053491	Ga0075366_100534913	121
530	3300006195	Ga0075366_10067280	Ga0075366_100672802	121
531	3300006195	Ga0075366_10788463	Ga0075366_107884632	121
532	3300006237	Ga0097621_100011459	Ga0097621_1000114597	121
533	3300006237	Ga0097621_100035492	Ga0097621_1000354922	121
534	3300006237	Ga0097621_100041083	Ga0097621_1000410834	121
535	3300006237	Ga0097621_100052853	Ga0097621_1000528534	121
536	3300006237	Ga0097621_100102499	Ga0097621_1001024995	121
537	3300006237	Ga0097621_100522570	Ga0097621_1005225701	121
538	3300006353	Ga0075370_10103505	Ga0075370_101035052	121
539	3300006353	Ga0075370_10266437	Ga0075370_102664372	121
540	3300006358	Ga0068871_100001983	Ga0068871_10000198320	121
541	3300006358	Ga0068871_100007969	Ga0068871_1000079696	121
542	3300006358	Ga0068871_100182354	Ga0068871_1001823543	121
543	3300006358	Ga0068871_100283213	Ga0068871_1002832132	121
544	3300006358	Ga0068871_100583119	Ga0068871_1005831191	121
545	3300006358	Ga0068871_101497377	Ga0068871_1014973771	121
546	3300006358	Ga0068871_101799924	Ga0068871_1017999241	121
547	3300006847	Ga0075431_100907499	Ga0075431_1009074992	121
548	3300006852	Ga0075433_10008737	Ga0075433_100087373	121
549	3300006871	Ga0075434_100665919	Ga0075434_1006659192	121
550	3300006880	Ga0075429_100192544	Ga0075429_1001925443	121
551	3300006880	Ga0075429_101822993	Ga0075429_1018229931	121
552	3300006881	Ga0068865_101706610	Ga0068865_1017066101	121
553	3300006931	Ga0097620_100016585	Ga0097620_1000165858	121
554	3300006931	Ga0097620_100019496	Ga0097620_10001949612	121
555	3300006946	Ga0079104_1018047	Ga0079104_10180471	121
556	3300009011	Ga0105251_10005500	Ga0105251_100055003	121
557	3300009036	Ga0105244_10177104	Ga0105244_101771041	121
558	3300009093	Ga0105240_10003598	Ga0105240_1000359817	121
559	3300009093	Ga0105240_10040538	Ga0105240_100405382	121
560	3300009093	Ga0105240_11011613	Ga0105240_110116131	121
561	3300009093	Ga0105240_11122616	Ga0105240_111226162	121
562	3300009094	Ga0111539_10043351	Ga0111539_100433516	121
563	3300009094	Ga0111539_11094840	Ga0111539_110948401	121
564	3300009098	Ga0105245_10039067	Ga0105245_100390673	121
565	3300009098	Ga0105245_10160271	Ga0105245_101602714	121
566	3300009098	Ga0105245_10362181	Ga0105245_103621812	121
567	3300009098	Ga0105245_10399772	Ga0105245_103997722	121
568	3300009098	Ga0105245_10421791	Ga0105245_104217912	121
569	3300009101	Ga0105247_10018586	Ga0105247_100185865	121
570	3300009101	Ga0105247_10960422	Ga0105247_109604221	121
571	3300009147	Ga0114129_10009318	Ga0114129_100093186	121
572	3300009147	Ga0114129_10265936	Ga0114129_102659361	121
573	3300009147	Ga0114129_10493121	Ga0114129_104931211	121
574	3300009148	Ga0105243_10055168	Ga0105243_100551683	121
575	3300009148	Ga0105243_10123954	Ga0105243_101239543	121
576	3300009174	Ga0105241_10051261	Ga0105241_100512612	121
577	3300009174	Ga0105241_10562190	Ga0105241_105621902	121
578	3300009176	Ga0105242_10018435	Ga0105242_100184354	121
579	3300009176	Ga0105242_10018779	Ga0105242_100187792	121
580	3300009176	Ga0105242_10024603	Ga0105242_100246038	121
581	3300009176	Ga0105242_10345377	Ga0105242_103453772	121
582	3300009176	Ga0105242_11072140	Ga0105242_110721402	121
583	3300009177	Ga0105248_10002483	Ga0105248_1000248333	121
584	3300009177	Ga0105248_10002724	Ga0105248_100027246	121
585	3300009177	Ga0105248_10016657	Ga0105248_100166577	121
586	3300009177	Ga0105248_10050902	Ga0105248_100509025	121
587	3300009177	Ga0105248_10218249	Ga0105248_102182492	121
588	3300009177	Ga0105248_10357129	Ga0105248_103571293	121
589	3300009177	Ga0105248_11024762	Ga0105248_110247622	121
590	3300009545	Ga0105237_10432249	Ga0105237_104322492	121
591	3300009553	Ga0105249_10104560	Ga0105249_101045604	121
592	3300009553	Ga0105249_10649520	Ga0105249_106495202	121
593	3300010375	Ga0105239_10312245	Ga0105239_103122453	121
594	3300012500	Ga0157314_1036159	Ga0157314_10361592	121
595	3300012503	Ga0157313_1009643	Ga0157313_10096431	121
596	3300012508	Ga0157315_1003387	Ga0157315_10033872	121
597	3300013100	Ga0157373_10370070	Ga0157373_103700702	121
598	3300013100	Ga0157373_10456861	Ga0157373_104568612	121
599	3300013104	Ga0157370_10150104	Ga0157370_101501042	121
600	3300013104	Ga0157370_10246371	Ga0157370_102463711	121
601	3300013105	Ga0157369_10366724	Ga0157369_103667242	121
602	3300013249	Ga0171463_1012	Ga0171463_1012140	121
603	3300013296	Ga0157374_10002352	Ga0157374_100023529	121
604	3300013296	Ga0157374_10034498	Ga0157374_100344982	121
605	3300013296	Ga0157374_10561448	Ga0157374_105614482	121
606	3300013296	Ga0157374_10637020	Ga0157374_106370202	121
607	3300013297	Ga0157378_10048143	Ga0157378_100481432	121
608	3300013297	Ga0157378_10214363	Ga0157378_102143631	121
609	3300013297	Ga0157378_10236082	Ga0157378_102360824	121
610	3300013297	Ga0157378_10626403	Ga0157378_106264033	121
611	3300013306	Ga0163162_10030019	Ga0163162_100300198	121
612	3300013306	Ga0163162_10053101	Ga0163162_100531016	121
613	3300013306	Ga0163162_10472959	Ga0163162_104729592	121
614	3300013306	Ga0163162_11450683	Ga0163162_114506832	121
615	3300013307	Ga0157372_10096933	Ga0157372_100969334	121
616	3300013307	Ga0157372_10468783	Ga0157372_104687832	121
617	3300013307	Ga0157372_10546173	Ga0157372_105461731	121
618	3300013307	Ga0157372_11684444	Ga0157372_116844441	121
619	3300013308	Ga0157375_10000470	Ga0157375_1000047045	121
620	3300013308	Ga0157375_10132215	Ga0157375_101322155	121
621	3300013308	Ga0157375_10561691	Ga0157375_105616912	121
622	3300013308	Ga0157375_11105173	Ga0157375_111051732	121
623	3300013308	Ga0157375_11179750	Ga0157375_111797501	121
624	3300013308	Ga0157375_13378574	Ga0157375_133785741	121
625	3300014325	Ga0163163_10003566	Ga0163163_100035665	121
626	3300014325	Ga0163163_10093148	Ga0163163_100931484	121
627	3300014325	Ga0163163_10093549	Ga0163163_100935494	121
628	3300014325	Ga0163163_10157204	Ga0163163_101572045	121
629	3300014326	Ga0157380_10024216	Ga0157380_100242162	121
630	3300014326	Ga0157380_10040367	Ga0157380_100403672	121
631	3300014326	Ga0157380_10210218	Ga0157380_102102182	121
632	3300014326	Ga0157380_11453609	Ga0157380_114536092	121
633	3300014497	Ga0182008_10467165	Ga0182008_104671651	121
634	3300014745	Ga0157377_11032077	Ga0157377_110320772	121
635	3300014968	Ga0157379_10003561	Ga0157379_1000356124	121
636	3300014968	Ga0157379_10005327	Ga0157379_1000532711	121
637	3300014968	Ga0157379_10037039	Ga0157379_100370396	121
638	3300014968	Ga0157379_10163966	Ga0157379_101639662	121
639	3300014969	Ga0157376_10035738	Ga0157376_100357382	121
640	3300014969	Ga0157376_10157258	Ga0157376_101572584	121
641	3300014969	Ga0157376_10404896	Ga0157376_104048962	121
642	3300014969	Ga0157376_11149917	Ga0157376_111499172	121
643	3300015261	Ga0182006_1066188	Ga0182006_10661882	121
644	3300015262	Ga0182007_10001460	Ga0182007_1000146016	121
645	3300015262	Ga0182007_10008889	Ga0182007_100088892	121
646	3300015262	Ga0182007_10019040	Ga0182007_100190403	121
647	3300015265	Ga0182005_1033151	Ga0182005_10331511	121
648	3300015690	Ga0183363_1205	Ga0183363_12056	121
649	3300017792	Ga0163161_10015923	Ga0163161_100159238	121
650	3300017792	Ga0163161_10033003	Ga0163161_100330036	121
651	3300017792	Ga0163161_10052328	Ga0163161_100523282	121
652	3300025208	Ga0209436_100256	Ga0209436_10025613	121
653	3300025208	Ga0209436_101114	Ga0209436_1011149	121
654	3300025245	Ga0207425_1006259	Ga0207425_10062596	121
655	3300025245	Ga0207425_1048343	Ga0207425_10483431	121
656	3300025258	Ga0209129_1000425	Ga0209129_100042510	121
657	3300025263	Ga0209565_1000015	Ga0209565_1000015233	121
658	3300025263	Ga0209565_1000820	Ga0209565_10008206	121
659	3300025271	Ga0207666_1021168	Ga0207666_10211681	121
660	3300025271	Ga0207666_1084167	Ga0207666_10841671	121
661	3300025273	Ga0209673_1000017	Ga0209673_1000017124	121
662	3300025273	Ga0209673_1000454	Ga0209673_10004545	121
663	3300025284	Ga0209130_1000054	Ga0209130_100005452	121
664	3300025284	Ga0209130_1000924	Ga0209130_10009244	121
665	3300025284	Ga0209130_1004551	Ga0209130_10045515	121
666	3300025291	Ga0209675_1000012	Ga0209675_1000012249	121
667	3300025292	Ga0209676_1000111	Ga0209676_1000111155	121
668	3300025292	Ga0209676_1024688	Ga0209676_10246884	121
669	3300025292	Ga0209676_1025951	Ga0209676_10259512	121
670	3300025294	Ga0209025_1000392	Ga0209025_100039244	121
671	3300025294	Ga0209025_1007626	Ga0209025_10076269	121
672	3300025294	Ga0209025_1025331	Ga0209025_10253312	121
673	3300025295	Ga0209564_1000016	Ga0209564_1000016362	121
674	3300025295	Ga0209564_1000070	Ga0209564_1000070165	121
675	3300025295	Ga0209564_1005711	Ga0209564_10057114	121
676	3300025297	Ga0209758_1032976	Ga0209758_10329764	121
677	3300025298	Ga0209050_1000111	Ga0209050_100011136	121
678	3300025298	Ga0209050_1039682	Ga0209050_10396822	121
679	3300025299	Ga0209256_1000047	Ga0209256_1000047177	121
680	3300025299	Ga0209256_1000076	Ga0209256_1000076194	121
681	3300025302	Ga0207426_1000127	Ga0207426_100012752	121
682	3300025302	Ga0207426_1000194	Ga0207426_1000194100	121
683	3300025303	Ga0209051_1000340	Ga0209051_100034034	121
684	3300025303	Ga0209051_1008130	Ga0209051_10081306	121
685	3300025303	Ga0209051_1064154	Ga0209051_10641541	121
686	3300025304	Ga0209257_1000690	Ga0209257_100069036	121
687	3300025304	Ga0209257_1007256	Ga0209257_10072561	121
688	3300025304	Ga0209257_1026679	Ga0209257_10266792	121
689	3300025304	Ga0209257_1072311	Ga0209257_10723111	121
690	3300025315	Ga0207697_10012101	Ga0207697_100121012	121
691	3300025315	Ga0207697_10042956	Ga0207697_100429562	121
692	3300025315	Ga0207697_10121626	Ga0207697_101216262	121
693	3300025315	Ga0207697_10234324	Ga0207697_102343242	121
694	3300025735	Ga0207713_1003655	Ga0207713_10036558	121
695	3300025893	Ga0207682_10056093	Ga0207682_100560931	121
696	3300025893	Ga0207682_10074598	Ga0207682_100745981	121
697	3300025893	Ga0207682_10131590	Ga0207682_101315901	121
698	3300025898	Ga0207692_10188343	Ga0207692_101883431	121
699	3300025899	Ga0207642_10122414	Ga0207642_101224143	121
700	3300025899	Ga0207642_10406577	Ga0207642_104065772	121
701	3300025899	Ga0207642_10905212	Ga0207642_109052121	121
702	3300025903	Ga0207680_10004859	Ga0207680_100048593	121
703	3300025903	Ga0207680_10108473	Ga0207680_101084731	121
704	3300025903	Ga0207680_10209199	Ga0207680_102091993	121
705	3300025903	Ga0207680_10474166	Ga0207680_104741662	121
706	3300025903	Ga0207680_10545578	Ga0207680_105455782	121
707	3300025903	Ga0207680_11032866	Ga0207680_110328661	121
708	3300025904	Ga0207647_10109940	Ga0207647_101099402	121
709	3300025906	Ga0207699_10307252	Ga0207699_103072522	121
710	3300025907	Ga0207645_10047247	Ga0207645_100472474	121
711	3300025907	Ga0207645_10089012	Ga0207645_100890123	121
712	3300025907	Ga0207645_10454959	Ga0207645_104549592	121
713	3300025908	Ga0207643_10006817	Ga0207643_100068178	121
714	3300025908	Ga0207643_10335175	Ga0207643_103351752	121
715	3300025910	Ga0207684_10004303	Ga0207684_100043036	121
716	3300025910	Ga0207684_10012597	Ga0207684_1001259710	121
717	3300025910	Ga0207684_10014747	Ga0207684_100147475	121
718	3300025911	Ga0207654_10017882	Ga0207654_100178824	121
719	3300025911	Ga0207654_10459234	Ga0207654_104592341	121
720	3300025912	Ga0207707_11217054	Ga0207707_112170542	121
721	3300025913	Ga0207695_10069765	Ga0207695_100697658	121
722	3300025913	Ga0207695_10352048	Ga0207695_103520482	121
723	3300025914	Ga0207671_10348357	Ga0207671_103483572	121
724	3300025916	Ga0207663_11612362	Ga0207663_116123621	121
725	3300025917	Ga0207660_10662561	Ga0207660_106625611	121
726	3300025918	Ga0207662_10125169	Ga0207662_101251693	121
727	3300025918	Ga0207662_10169590	Ga0207662_101695902	121
728	3300025919	Ga0207657_10304376	Ga0207657_103043761	121
729	3300025919	Ga0207657_10520046	Ga0207657_105200461	121
730	3300025922	Ga0207646_11148622	Ga0207646_111486221	121
731	3300025923	Ga0207681_10039017	Ga0207681_100390175	121
732	3300025923	Ga0207681_10042489	Ga0207681_100424893	121
733	3300025923	Ga0207681_10070420	Ga0207681_100704203	121
734	3300025923	Ga0207681_10207712	Ga0207681_102077122	121
735	3300025924	Ga0207694_10353111	Ga0207694_103531113	121
736	3300025925	Ga0207650_10126868	Ga0207650_101268682	121
737	3300025925	Ga0207650_10336977	Ga0207650_103369773	121
738	3300025926	Ga0207659_10013750	Ga0207659_100137508	121
739	3300025926	Ga0207659_10014752	Ga0207659_100147525	121
740	3300025926	Ga0207659_10466000	Ga0207659_104660001	121
741	3300025926	Ga0207659_10572640	Ga0207659_105726401	121
742	3300025926	Ga0207659_10579420	Ga0207659_105794201	121
743	3300025926	Ga0207659_11491875	Ga0207659_114918751	121
744	3300025927	Ga0207687_10034895	Ga0207687_100348953	121
745	3300025927	Ga0207687_10133832	Ga0207687_101338322	121
746	3300025927	Ga0207687_10592864	Ga0207687_105928642	121
747	3300025927	Ga0207687_10620657	Ga0207687_106206572	121
748	3300025927	Ga0207687_11113556	Ga0207687_111135561	121
749	3300025928	Ga0207700_11081220	Ga0207700_110812201	121
750	3300025929	Ga0207664_10128348	Ga0207664_101283482	121
751	3300025931	Ga0207644_10002580	Ga0207644_100025802	121
752	3300025931	Ga0207644_10002881	Ga0207644_1000288118	121
753	3300025931	Ga0207644_10087869	Ga0207644_100878695	121
754	3300025931	Ga0207644_10335412	Ga0207644_103354123	121
755	3300025931	Ga0207644_10849460	Ga0207644_108494602	121
756	3300025932	Ga0207690_10064367	Ga0207690_100643672	121
757	3300025933	Ga0207706_10036657	Ga0207706_100366579	121
758	3300025933	Ga0207706_10140490	Ga0207706_101404902	121
759	3300025933	Ga0207706_10615554	Ga0207706_106155542	121
760	3300025933	Ga0207706_10759785	Ga0207706_107597852	121
761	3300025934	Ga0207686_10003571	Ga0207686_100035714	121
762	3300025934	Ga0207686_10005536	Ga0207686_100055365	121
763	3300025934	Ga0207686_10013775	Ga0207686_100137753	121
764	3300025934	Ga0207686_10178090	Ga0207686_101780902	121
765	3300025934	Ga0207686_10655882	Ga0207686_106558822	121
766	3300025935	Ga0207709_10147066	Ga0207709_101470662	121
767	3300025936	Ga0207670_10097029	Ga0207670_100970294	121
768	3300025936	Ga0207670_10788493	Ga0207670_107884931	121
769	3300025937	Ga0207669_10097530	Ga0207669_100975303	121
770	3300025937	Ga0207669_10262537	Ga0207669_102625372	121
771	3300025937	Ga0207669_10684752	Ga0207669_106847521	121
772	3300025937	Ga0207669_11148457	Ga0207669_111484571	121
773	3300025937	Ga0207669_11728679	Ga0207669_117286791	121
774	3300025938	Ga0207704_10236014	Ga0207704_102360141	121
775	3300025938	Ga0207704_10290578	Ga0207704_102905781	121
776	3300025938	Ga0207704_10447067	Ga0207704_104470671	121
777	3300025938	Ga0207704_11295693	Ga0207704_112956931	121
778	3300025938	Ga0207704_11894544	Ga0207704_118945442	121
779	3300025939	Ga0207665_10003589	Ga0207665_100035893	121
780	3300025940	Ga0207691_10011536	Ga0207691_100115362	121
781	3300025940	Ga0207691_10052579	Ga0207691_100525795	121
782	3300025940	Ga0207691_10058408	Ga0207691_100584083	121
783	3300025940	Ga0207691_10079350	Ga0207691_100793502	121
784	3300025940	Ga0207691_10304343	Ga0207691_103043431	121
785	3300025941	Ga0207711_10000392	Ga0207711_1000039241	121
786	3300025941	Ga0207711_10000865	Ga0207711_1000086537	121
787	3300025941	Ga0207711_10012503	Ga0207711_100125032	121
788	3300025941	Ga0207711_10111886	Ga0207711_101118865	121
789	3300025941	Ga0207711_10159734	Ga0207711_101597342	121
790	3300025942	Ga0207689_10005992	Ga0207689_1000599214	121
791	3300025942	Ga0207689_10022940	Ga0207689_100229404	121
792	3300025942	Ga0207689_10168434	Ga0207689_101684342	121
793	3300025942	Ga0207689_11392140	Ga0207689_113921401	121
794	3300025944	Ga0207661_10638306	Ga0207661_106383061	121
795	3300025945	Ga0207679_10125191	Ga0207679_101251914	121
796	3300025945	Ga0207679_10288677	Ga0207679_102886772	121
797	3300025949	Ga0207667_10003980	Ga0207667_1000398016	121
798	3300025949	Ga0207667_10303782	Ga0207667_103037822	121
799	3300025949	Ga0207667_10871241	Ga0207667_108712412	121
800	3300025960	Ga0207651_10001236	Ga0207651_100012366	121
801	3300025960	Ga0207651_10062288	Ga0207651_100622882	121
802	3300025960	Ga0207651_10106694	Ga0207651_101066943	121
803	3300025961	Ga0207712_10024611	Ga0207712_100246115	121
804	3300025961	Ga0207712_10213509	Ga0207712_102135092	121
805	3300025961	Ga0207712_10560689	Ga0207712_105606892	121
806	3300025972	Ga0207668_10098924	Ga0207668_100989242	121
807	3300025972	Ga0207668_10798245	Ga0207668_107982451	121
808	3300025981	Ga0207640_10079058	Ga0207640_100790582	121
809	3300025981	Ga0207640_10344955	Ga0207640_103449551	121
810	3300025981	Ga0207640_10350923	Ga0207640_103509232	121
811	3300025981	Ga0207640_10898260	Ga0207640_108982602	121
812	3300025986	Ga0207658_10023584	Ga0207658_100235844	121
813	3300025986	Ga0207658_10104585	Ga0207658_101045854	121
814	3300025986	Ga0207658_10215836	Ga0207658_102158362	121
815	3300025986	Ga0207658_10243795	Ga0207658_102437952	121
816	3300025986	Ga0207658_10706196	Ga0207658_107061961	121
817	3300025986	Ga0207658_10757638	Ga0207658_107576382	121
818	3300026023	Ga0207677_10003011	Ga0207677_1000301113	121
819	3300026023	Ga0207677_10019843	Ga0207677_100198436	121
820	3300026023	Ga0207677_10558212	Ga0207677_105582122	121
821	3300026023	Ga0207677_10951106	Ga0207677_109511062	121
822	3300026023	Ga0207677_11588206	Ga0207677_115882061	121
823	3300026035	Ga0207703_10000361	Ga0207703_1000036116	121
824	3300026035	Ga0207703_10340078	Ga0207703_103400782	121
825	3300026035	Ga0207703_10488385	Ga0207703_104883852	121
826	3300026041	Ga0207639_10355959	Ga0207639_103559592	121
827	3300026067	Ga0207678_10231700	Ga0207678_102317001	121
828	3300026067	Ga0207678_10323151	Ga0207678_103231512	121
829	3300026088	Ga0207641_10056497	Ga0207641_100564974	121
830	3300026088	Ga0207641_10057396	Ga0207641_100573964	121
831	3300026088	Ga0207641_10077359	Ga0207641_100773592	121
832	3300026088	Ga0207641_10137202	Ga0207641_101372022	121
833	3300026088	Ga0207641_11005786	Ga0207641_110057861	121
834	3300026088	Ga0207641_11459217	Ga0207641_114592172	121
835	3300026089	Ga0207648_10013369	Ga0207648_100133697	121
836	3300026089	Ga0207648_10076009	Ga0207648_100760093	121
837	3300026089	Ga0207648_10078401	Ga0207648_100784014	121
838	3300026089	Ga0207648_10243377	Ga0207648_102433772	121
839	3300026089	Ga0207648_11357997	Ga0207648_113579972	121
840	3300026095	Ga0207676_10007187	Ga0207676_100071876	121
841	3300026095	Ga0207676_10012292	Ga0207676_1001229210	121
842	3300026095	Ga0207676_10017084	Ga0207676_100170843	121
843	3300026095	Ga0207676_10054936	Ga0207676_100549365	121
844	3300026095	Ga0207676_10192124	Ga0207676_101921243	121
845	3300026095	Ga0207676_10951013	Ga0207676_109510132	121
846	3300026118	Ga0207675_100008669	Ga0207675_1000086693	121
847	3300026118	Ga0207675_100025064	Ga0207675_1000250645	121
848	3300026118	Ga0207675_100131361	Ga0207675_1001313612	121
849	3300026118	Ga0207675_100716319	Ga0207675_1007163192	121
850	3300026121	Ga0207683_10000942	Ga0207683_100009425	121
851	3300026121	Ga0207683_10000995	Ga0207683_1000099524	121
852	3300026121	Ga0207683_10001084	Ga0207683_1000108439	121
853	3300026121	Ga0207683_10010839	Ga0207683_100108393	121
854	3300026121	Ga0207683_10013606	Ga0207683_1001360610	121
855	3300026121	Ga0207683_10015493	Ga0207683_100154931	121
856	3300026142	Ga0207698_10132904	Ga0207698_101329042	121
857	3300026142	Ga0207698_10650519	Ga0207698_106505191	121
858	3300026142	Ga0207698_12354929	Ga0207698_123549291	121
859	3300027111	Ga0209281_1000329	Ga0209281_10003292	121
860	3300027111	Ga0209281_1016011	Ga0209281_10160112	121
861	3300027111	Ga0209281_1017300	Ga0209281_10173002	121
862	3300027378	Ga0209981_1019922	Ga0209981_10199221	121
863	3300027395	Ga0209996_1044419	Ga0209996_10444191	121
864	3300027424	Ga0209984_1000717	Ga0209984_10007174	121
865	3300027462	Ga0210000_1031135	Ga0210000_10311352	121
866	3300027471	Ga0209995_1047014	Ga0209995_10470142	121
867	3300027543	Ga0209999_1085856	Ga0209999_10858562	121
868	3300027552	Ga0209982_1001736	Ga0209982_10017363	121
869	3300027614	Ga0209970_1034396	Ga0209970_10343962	121
870	3300027614	Ga0209970_1035471	Ga0209970_10354712	121
871	3300027617	Ga0210002_1000683	Ga0210002_10006836	121
872	3300027665	Ga0209983_1007279	Ga0209983_10072794	121
873	3300027682	Ga0209971_1005261	Ga0209971_10052612	121
874	3300027907	Ga0207428_10016385	Ga0207428_100163852	121
875	3300028379	Ga0268266_10009485	Ga0268266_1000948514	121
876	3300028379	Ga0268266_10050272	Ga0268266_100502725	121
877	3300028380	Ga0268265_10178621	Ga0268265_101786212	121
878	3300028381	Ga0268264_10133625	Ga0268264_101336251	121
879	3300028381	Ga0268264_10318684	Ga0268264_103186843	121
880	3300028381	Ga0268264_10633412	Ga0268264_106334122	121
881	3300028381	Ga0268264_10726848	Ga0268264_107268482	121
882	3300028794	Ga0307515_10001657	Ga0307515_1000165727	121
883	3300028794	Ga0307515_10009209	Ga0307515_1000920915	121
884	3300028794	Ga0307515_10027465	Ga0307515_100274653	121
885	3300028794	Ga0307515_10241537	Ga0307515_102415371	121
886	3300030763	Ga0265763_1004159	Ga0265763_10041591	121
887	3300031090	Ga0265760_10183532	Ga0265760_101835321	121
888	3300031456	Ga0307513_10444546	Ga0307513_104445462	121
889	3300031507	Ga0307509_10261182	Ga0307509_102611822	121
890	3300031548	Ga0307408_100003341	Ga0307408_10000334120	121
891	3300031548	Ga0307408_100133020	Ga0307408_1001330202	121
892	3300031548	Ga0307408_101612003	Ga0307408_1016120031	121
893	3300031616	Ga0307508_10199553	Ga0307508_101995531	121
894	3300031731	Ga0307405_10051505	Ga0307405_100515052	121
895	3300031731	Ga0307405_11234845	Ga0307405_112348451	121
896	3300031824	Ga0307413_10086572	Ga0307413_100865722	121
897	3300031852	Ga0307410_10007868	Ga0307410_100078683	121
898	3300031852	Ga0307410_10908575	Ga0307410_109085751	121
899	3300031889	Ga0326468_10016974	Ga0326468_100169741	121
900	3300031901	Ga0307406_10067737	Ga0307406_100677372	121
901	3300031903	Ga0307407_10023971	Ga0307407_100239716	121
902	3300031911	Ga0307412_11584883	Ga0307412_115848831	121
903	3300031995	Ga0307409_100001463	Ga0307409_10000146319	121
904	3300031995	Ga0307409_100019105	Ga0307409_1000191051	121
905	3300031995	Ga0307409_100313152	Ga0307409_1003131521	121
906	3300031995	Ga0307409_101236199	Ga0307409_1012361991	121
907	3300032002	Ga0307416_100071131	Ga0307416_1000711312	121
908	3300032002	Ga0307416_102645513	Ga0307416_1026455131	121
909	3300032002	Ga0307416_103740964	Ga0307416_1037409641	121
910	3300032005	Ga0307411_10033248	Ga0307411_100332484	121
911	3300032126	Ga0307415_100013697	Ga0307415_1000136977	121
912	3300034819	Ga0373958_0164773	Ga0373958_0164773_135_509	121
913	3300034957	Ga0373938_0231170	Ga0373938_0231170_62_436	121
914	3300035088	Ga0373940_0280693	Ga0373940_0280693_171_545	121
915	3300035113	Ga0373936_0028091	Ga0373936_0028091_1739_2113	121
916	3300035115	Ga0373941_0353953	Ga0373941_0353953_137_514	121
917	3300035120	Ga0373957_0164782	Ga0373957_0164782_173_547	121
918	3300035170	Ga0373943_0255061	Ga0373943_0255061_396_770	121
919	3300035242	Ga0373962_0256188	Ga0373962_0256188_143_517	121
920	3300035691	Ga0373931_1202372	Ga0373931_1202372_69_443	121
921	3300035695	Ga0373927_0012998	Ga0373927_0012998_5050_5424	121
922	3300035724	Ga0373933_0471555	Ga0373933_0471555_36_410	121
923	3300035725	Ga0373947_0348830	Ga0373947_0348830_405_779	121
924	3300037068	Ga0373925_0101281	Ga0373925_0101281_864_1238	121
925	3300037068	Ga0373925_0834449	Ga0373925_0834449_104_478	121
926	3300037418	Ga0395900_0616324	Ga0395900_0616324_639_1013	121
927	3300037466	Ga0395898_0008391	Ga0395898_0008391_2461_2835	121
928	3300037466	Ga0395898_0009575	Ga0395898_0009575_9737_10111	121
929	3300037466	Ga0395898_0083726	Ga0395898_0083726_245_619	121
930	3300037471	Ga0395905_0016084	Ga0395905_0016084_1893_2267	121
931	3300038443	Ga0395901_0006902	Ga0395901_0006902_683_1057	121
932	3300038443	Ga0395901_0056683	Ga0395901_0056683_121_495	121
933	3300041404	Ga0439436_0035245	Ga0439436_0035245_450_824	121
934	3300041406	Ga0439439_0133926	Ga0439439_0133926_275_649	121
935	3300041413	Ga0439465_0044058	Ga0439465_0044058_1013_1387	121
936	3300041413	Ga0439465_0413215	Ga0439465_0413215_66_440	121
937	3300041453	Ga0451797_1565710	Ga0451797_1565710_154_528	121
938	3300041460	Ga0451802_1345392	Ga0451802_1345392_114_488	121
939	3300041486	Ga0451807_0432443	Ga0451807_0432443_354_728	121
940	3300041512	Ga0451853_1544785	Ga0451853_1544785_74_448	121
941	3300042006	Ga0439432_043815	Ga0439432_043815_491_865	121
942	3300042007	Ga0439449_0026545	Ga0439449_0026545_1461_1835	121
943	3300042007	Ga0439449_0092792	Ga0439449_0092792_289_666	121
944	3300042012	Ga0439455_0001294	Ga0439455_0001294_1459_1833	121
945	3300042014	Ga0439457_051594	Ga0439457_051594_309_683	121
946	3300042146	Ga0450907_071311	Ga0450907_071311_37_411	121
947	3300042876	Ga0451577_0089001	Ga0451577_0089001_137_505	121
948	3300044658	Ga0466972_0000084	Ga0466972_0000084_56382_56756	121
949	3300044693	Ga0466961_0065027	Ga0466961_0065027_1598_1963	121
950	3300044842	Ga0466957_0002234	Ga0466957_0002234_8293_8658	121
951	3300046460	Ga0495638_0225529	Ga0495638_0225529_288_662	121
952	3300046461	Ga0495641_0328102	Ga0495641_0328102_71_445	121
953	3300046462	Ga0495651_0004151	Ga0495651_0004151_3895_4269	121
954	3300046463	Ga0495653_0149748	Ga0495653_0149748_412_786	121
955	3300046507	Ga0495606_0534668	Ga0495606_0534668_89_463	121
956	3300046511	Ga0495608_0031265	Ga0495608_0031265_2855_3229	121
957	3300046513	Ga0495616_0443102	Ga0495616_0443102_97_471	121
958	3300046515	Ga0495620_0043594	Ga0495620_0043594_1448_1822	121
959	3300046515	Ga0495620_0083271	Ga0495620_0083271_816_1190	121
960	3300046516	Ga0495628_0359951	Ga0495628_0359951_539_913	121
961	3300046517	Ga0495630_0099159	Ga0495630_0099159_1032_1406	121
962	3300046526	Ga0495666_0239782	Ga0495666_0239782_282_656	121
963	3300046528	Ga0495642_0027738	Ga0495642_0027738_1540_1914	121
964	3300046528	Ga0495642_0082612	Ga0495642_0082612_122_496	121
965	3300046529	Ga0495652_0009284	Ga0495652_0009284_7670_8044	121
966	3300046539	Ga0495621_0001969	Ga0495621_0001969_823_1197	121
967	3300046539	Ga0495621_0072254	Ga0495621_0072254_95_469	121
968	3300046539	Ga0495621_0094598	Ga0495621_0094598_297_671	121
969	3300046539	Ga0495621_0133617	Ga0495621_0133617_496_870	121
970	3300046539	Ga0495621_0434303	Ga0495621_0434303_146_532	121
971	3300046539	Ga0495621_0486794	Ga0495621_0486794_122_496	121
972	3300046543	Ga0495645_0002184	Ga0495645_0002184_715_1089	121
973	3300046543	Ga0495645_0238411	Ga0495645_0238411_383_757	121
974	3300046557	Ga0495622_0193273	Ga0495622_0193273_80_454	121
975	3300046558	Ga0495633_0073668	Ga0495633_0073668_305_679	121
976	3300046615	Ga0495656_0287708	Ga0495656_0287708_51_425	121
977	3300046664	Ga0495659_0055643	Ga0495659_0055643_225_599	121
978	3300046675	Ga0495657_0251529	Ga0495657_0251529_676_1050	121
979	3300046675	Ga0495657_0663542	Ga0495657_0663542_114_488	121
980	3300046680	Ga0495646_0003195	Ga0495646_0003195_7631_8005	121
981	3300046683	Ga0495658_0975702	Ga0495658_0975702_52_426	121
982	3300046690	Ga0495624_0070386	Ga0495624_0070386_1194_1568	121
983	3300046690	Ga0495624_0083293	Ga0495624_0083293_430_804	121
984	3300046810	Ga0495660_0028666	Ga0495660_0028666_568_942	121
985	3300047317	Ga0495604_0975635	Ga0495604_0975635_102_476	121
986	3300047318	Ga0495636_0031848	Ga0495636_0031848_613_987	121
987	3300047321	Ga0495676_0012456	Ga0495676_0012456_4275_4649	121
988	3300047323	Ga0495683_0043814	Ga0495683_0043814_524_898	121
989	3300047673	Ga0495593_0053118	Ga0495593_0053118_1046_1420	121
990	3300048903	Ga0496100_0605872	Ga0496100_0605872_395_769	121
991	3300048904	Ga0496101_0034634	Ga0496101_0034634_2452_2826	121
992	3300048905	Ga0496102_0316002	Ga0496102_0316002_1016_1390	121
993	3300048906	Ga0496103_0060319	Ga0496103_0060319_101_475	121
994	3300048907	Ga0496104_0047505	Ga0496104_0047505_3291_3665	121
995	3300048907	Ga0496104_0400546	Ga0496104_0400546_12_386	121
996	3300048907	Ga0496104_1101062	Ga0496104_1101062_153_527	121
997	3300048909	Ga0496106_0524292	Ga0496106_0524292_30_404	121
998	3300048909	Ga0496106_1023536	Ga0496106_1023536_50_424	121
999	3300048909	Ga0496106_1503652	Ga0496106_1503652_73_441	121
1000	3300048910	Ga0496107_0190648	Ga0496107_0190648_952_1326	121
1001	3300048910	Ga0496107_0746973	Ga0496107_0746973_290_664	121
1002	3300048911	Ga0496108_0180613	Ga0496108_0180613_1002_1376	121
1003	3300048911	Ga0496108_0510394	Ga0496108_0510394_341_715	121
1004	3300048911	Ga0496108_1077072	Ga0496108_1077072_299_673	121
1005	3300048911	Ga0496108_1590048	Ga0496108_1590048_98_472	121
1006	3300048912	Ga0496109_0437049	Ga0496109_0437049_95_469	121
1007	3300048912	Ga0496109_1828767	Ga0496109_1828767_76_450	121
1008	3300048913	Ga0496110_0705071	Ga0496110_0705071_217_591	121
1009	3300048913	Ga0496110_1588857	Ga0496110_1588857_22_396	121
1010	3300048915	Ga0496112_0434833	Ga0496112_0434833_359_733	121
1011	3300048917	Ga0496114_0031536	Ga0496114_0031536_3669_4043	121
1012	3300048917	Ga0496114_1133801	Ga0496114_1133801_13_387	121
1013	3300048918	Ga0496115_0009430	Ga0496115_0009430_2049_2423	121
1014	3300048918	Ga0496115_0032721	Ga0496115_0032721_1313_1687	121
1015	3300048918	Ga0496115_0245056	Ga0496115_0245056_173_547	121
1016	3300048919	Ga0496116_0274777	Ga0496116_0274777_160_534	121
1017	3300048920	Ga0496117_0030685	Ga0496117_0030685_3240_3614	121
1018	3300048921	Ga0496118_0005239	Ga0496118_0005239_11086_11460	121
1019	3300049576	Ga0501040_0644018	Ga0501040_0644018_302_676	121
1020	3300049578	Ga0501042_1102363	Ga0501042_1102363_141_515	121
1021	3300049580	Ga0501046_1016346	Ga0501046_1016346_118_492	121
1022	3300049583	Ga0501067_0429325	Ga0501067_0429325_93_467	121
1023	3300049585	Ga0501069_0113287	Ga0501069_0113287_792_1160	121
1024	3300049587	Ga0501071_1363433	Ga0501071_1363433_42_440	121
1025	3300049588	Ga0501072_0405502	Ga0501072_0405502_29_403	121
1026	3300049592	Ga0501076_0061533	Ga0501076_0061533_1193_1567	121
1027	3300049592	Ga0501076_1612326	Ga0501076_1612326_133_507	121
1028	3300049741	Ga0501079_0497855	Ga0501079_0497855_325_699	121
1029	3300049824	Ga0501045_0428560	Ga0501045_0428560_323_697	121
1030	3300050489	nmdc:mga03683_515123_c1	nmdc:mga03683_515123_c1_182_556	121
1031	3300050493	nmdc:mga0k408_104216_c1	nmdc:mga0k408_104216_c1_1019_1393	121
1032	3300050493	nmdc:mga0k408_41704_c1	nmdc:mga0k408_41704_c1_1252_1626	121
1033	3300050493	nmdc:mga0k408_77360_c1	nmdc:mga0k408_77360_c1_21_398	121
1034	3300050496	nmdc:mga07m45_100079_c1	nmdc:mga07m45_100079_c1_804_1181	121
1035	3300050496	nmdc:mga07m45_246819_c1	nmdc:mga07m45_246819_c1_316_690	121
1036	3300050496	nmdc:mga07m45_884970_c1	nmdc:mga07m45_884970_c1_81_455	121
1037	3300050507	nmdc:mga05p37_431342_c1	nmdc:mga05p37_431342_c1_372_746	121
1038	3300050507	nmdc:mga05p37_97096_c1	nmdc:mga05p37_97096_c1_2228_2602	121
1039	3300050508	nmdc:mga09592_1468229_c1	nmdc:mga09592_1468229_c1_133_510	121
1040	3300050511	nmdc:mga08y16_249226_c1	nmdc:mga08y16_249226_c1_10_384	121
1041	3300050511	nmdc:mga08y16_36491_c1	nmdc:mga08y16_36491_c1_519_893	121
1042	3300050512	nmdc:mga0n895_395221_c1	nmdc:mga0n895_395221_c1_986_1360	121
1043	3300050512	nmdc:mga0n895_664491_c1	nmdc:mga0n895_664491_c1_499_867	121
1044	3300050513	nmdc:mga0rr50_1417753_c1	nmdc:mga0rr50_1417753_c1_113_490	121
1045	3300050513	nmdc:mga0rr50_1489610_c1	nmdc:mga0rr50_1489610_c1_147_521	121
1046	3300050513	nmdc:mga0rr50_334838_c1	nmdc:mga0rr50_334838_c1_484_852	121
1047	3300050514	nmdc:mga08x19_144919_c1	nmdc:mga08x19_144919_c1_345_719	121
1048	3300050514	nmdc:mga08x19_167623_c1	nmdc:mga08x19_167623_c1_323_697	121
1049	3300050515	nmdc:mga0a205_18502_c1	nmdc:mga0a205_18502_c1_2316_2690	121
1050	3300053083	Ga0495655_0131907	Ga0495655_0131907_327_701	121
1051	3300053092	Ga0500583_0000830	Ga0500583_0000830_6557_6931	121
1052	3300053094	Ga0500566_0165937	Ga0500566_0165937_456_830	121
1053	3300053096	Ga0500641_0029713	Ga0500641_0029713_1664_2038	121
1054	3300053130	Ga0500642_0333374	Ga0500642_0333374_106_480	121
1055	3300053142	Ga0500577_0147011	Ga0500577_0147011_566_940	121
1056	3300053151	Ga0500604_0009122	Ga0500604_0009122_568_987	121
1057	3300053153	Ga0500616_0237552	Ga0500616_0237552_341_715	121
1058	3300053156	Ga0500622_0003735	Ga0500622_0003735_832_1206	121
1059	3300060353	Ga0501082_1989982	Ga0501082_1989982_110_484	121
1060	3300061719	Ga0466962_0127586	Ga0466962_0127586_98_463	121
1061	3300061734	Ga0530510_0493192	Ga0530510_0493192_503_877	121
1062	3300001991	JGI24743J22301_10010877	JGI24743J22301_100108772	122
1063	3300002070	JGI24750J21931_1024712	JGI24750J21931_10247122	122
1064	3300002076	JGI24749J21850_1003526	JGI24749J21850_10035263	122
1065	3300002155	JGI24033J26618_1025896	JGI24033J26618_10258961	122
1066	3300002239	JGI24034J26672_10115352	JGI24034J26672_101153521	122
1067	3300002459	JGI24751J29686_10029346	JGI24751J29686_100293462	122
1068	3300002705	JGI25156J39149_1001320	JGI25156J39149_10013202	122
1069	3300002737	JGI25162J39368_1000709	JGI25162J39368_100070926	122
1070	3300002738	JGI25154J39366_1008173	JGI25154J39366_10081732	122
1071	3300002741	JGI25157J39369_1000682	JGI25157J39369_100068217	122
1072	3300002741	JGI25157J39369_1000987	JGI25157J39369_10009874	122
1073	3300002772	JGI25164J39214_1000149	JGI25164J39214_100014927	122
1074	3300003214	JGI25165J46597_1000088	JGI25165J46597_1000088166	122
1075	3300003215	JGI25153J46596_10000074	JGI25153J46596_1000007463	122
1076	3300003323	rootH1_10268562	rootH1_102685624	122
1077	3300003752	Ga0055539_1001744	Ga0055539_10017443	122
1078	3300003759	Ga0055525_1000132	Ga0055525_100013272	122
1079	3300003760	Ga0055527_1000056	Ga0055527_100005669	122
1080	3300003760	Ga0055527_1000073	Ga0055527_100007345	122
1081	3300003760	Ga0055527_1002693	Ga0055527_10026933	122
1082	3300003761	Ga0055535_1000080	Ga0055535_100008065	122
1083	3300003761	Ga0055535_1001006	Ga0055535_100100615	122
1084	3300003761	Ga0055535_1001047	Ga0055535_100104710	122
1085	3300003762	Ga0055542_1000130	Ga0055542_100013026	122
1086	3300003762	Ga0055542_1000155	Ga0055542_10001559	122
1087	3300003762	Ga0055542_1000165	Ga0055542_100016545	122
1088	3300003763	Ga0055529_1000182	Ga0055529_10001829	122
1089	3300003763	Ga0055529_1000194	Ga0055529_100019445	122
1090	3300003763	Ga0055529_1001217	Ga0055529_10012172	122
1091	3300003763	Ga0055529_1001571	Ga0055529_10015717	122
1092	3300005289	Ga0065704_10167588	Ga0065704_101675882	122
1093	3300005290	Ga0065712_10122246	Ga0065712_101222462	122
1094	3300005293	Ga0065715_10153311	Ga0065715_101533111	122
1095	3300005295	Ga0065707_10125710	Ga0065707_101257101	122
1096	3300005295	Ga0065707_10576670	Ga0065707_105766702	122
1097	3300005327	Ga0070658_10253542	Ga0070658_102535422	122
1098	3300005327	Ga0070658_10407202	Ga0070658_104072022	122
1099	3300005328	Ga0070676_10173774	Ga0070676_101737743	122
1100	3300005329	Ga0070683_100007568	Ga0070683_10000756816	122
1101	3300005329	Ga0070683_100154332	Ga0070683_1001543323	122
1102	3300005330	Ga0070690_100128150	Ga0070690_1001281503	122
1103	3300005331	Ga0070670_100019356	Ga0070670_1000193568	122
1104	3300005331	Ga0070670_100049079	Ga0070670_1000490793	122
1105	3300005331	Ga0070670_100052905	Ga0070670_1000529053	122
1106	3300005333	Ga0070677_10004579	Ga0070677_100045793	122
1107	3300005333	Ga0070677_10018102	Ga0070677_100181022	122
1108	3300005333	Ga0070677_10040230	Ga0070677_100402302	122
1109	3300005334	Ga0068869_100019057	Ga0068869_1000190575	122
1110	3300005336	Ga0070680_100294389	Ga0070680_1002943893	122
1111	3300005336	Ga0070680_101376523	Ga0070680_1013765231	122
1112	3300005337	Ga0070682_100022804	Ga0070682_1000228045	122
1113	3300005337	Ga0070682_100830984	Ga0070682_1008309842	122
1114	3300005339	Ga0070660_100019117	Ga0070660_1000191173	122
1115	3300005339	Ga0070660_100047825	Ga0070660_1000478253	122
1116	3300005339	Ga0070660_100111707	Ga0070660_1001117073	122
1117	3300005340	Ga0070689_100015605	Ga0070689_1000156053	122
1118	3300005340	Ga0070689_100118176	Ga0070689_1001181762	122
1119	3300005340	Ga0070689_100167182	Ga0070689_1001671824	122
1120	3300005340	Ga0070689_100349045	Ga0070689_1003490452	122
1121	3300005340	Ga0070689_101366899	Ga0070689_1013668991	122
1122	3300005341	Ga0070691_10005697	Ga0070691_100056977	122
1123	3300005344	Ga0070661_100003044	Ga0070661_10000304421	122
1124	3300005344	Ga0070661_100691354	Ga0070661_1006913541	122
1125	3300005344	Ga0070661_101064759	Ga0070661_1010647591	122
1126	3300005345	Ga0070692_10107587	Ga0070692_101075871	122
1127	3300005345	Ga0070692_10475712	Ga0070692_104757121	122
1128	3300005347	Ga0070668_100798208	Ga0070668_1007982081	122
1129	3300005353	Ga0070669_100049822	Ga0070669_1000498224	122
1130	3300005353	Ga0070669_100628739	Ga0070669_1006287391	122
1131	3300005354	Ga0070675_100005561	Ga0070675_1000055613	122
1132	3300005354	Ga0070675_100011847	Ga0070675_1000118474	122
1133	3300005354	Ga0070675_100097014	Ga0070675_1000970142	122
1134	3300005355	Ga0070671_100003070	Ga0070671_10000307017	122
1135	3300005355	Ga0070671_100079314	Ga0070671_1000793143	122
1136	3300005355	Ga0070671_100105263	Ga0070671_1001052632	122
1137	3300005355	Ga0070671_101323168	Ga0070671_1013231681	122
1138	3300005364	Ga0070673_100013837	Ga0070673_1000138378	122
1139	3300005364	Ga0070673_100157909	Ga0070673_1001579092	122
1140	3300005365	Ga0070688_100008726	Ga0070688_1000087264	122
1141	3300005366	Ga0070659_100001896	Ga0070659_10000189614	122
1142	3300005366	Ga0070659_100002053	Ga0070659_10000205312	122
1143	3300005366	Ga0070659_100112097	Ga0070659_1001120973	122
1144	3300005366	Ga0070659_100341696	Ga0070659_1003416961	122
1145	3300005367	Ga0070667_100118897	Ga0070667_1001188972	122
1146	3300005367	Ga0070667_100555070	Ga0070667_1005550702	122
1147	3300005367	Ga0070667_101095340	Ga0070667_1010953401	122
1148	3300005434	Ga0070709_10442725	Ga0070709_104427251	122
1149	3300005435	Ga0070714_100017695	Ga0070714_1000176958	122
1150	3300005435	Ga0070714_100158971	Ga0070714_1001589712	122
1151	3300005435	Ga0070714_100686337	Ga0070714_1006863372	122
1152	3300005436	Ga0070713_100068890	Ga0070713_1000688902	122
1153	3300005436	Ga0070713_100101565	Ga0070713_1001015655	122
1154	3300005441	Ga0070700_100007013	Ga0070700_1000070133	122
1155	3300005441	Ga0070700_100010857	Ga0070700_1000108571	122
1156	3300005444	Ga0070694_100830784	Ga0070694_1008307842	122
1157	3300005455	Ga0070663_100447335	Ga0070663_1004473352	122
1158	3300005457	Ga0070662_100138720	Ga0070662_1001387201	122
1159	3300005457	Ga0070662_100318620	Ga0070662_1003186202	122
1160	3300005457	Ga0070662_101407303	Ga0070662_1014073031	122
1161	3300005458	Ga0070681_10010356	Ga0070681_1001035612	122
1162	3300005458	Ga0070681_10272024	Ga0070681_102720242	122
1163	3300005459	Ga0068867_100012784	Ga0068867_1000127845	122
1164	3300005459	Ga0068867_102213849	Ga0068867_1022138491	122
1165	3300005466	Ga0070685_10006717	Ga0070685_100067177	122
1166	3300005518	Ga0070699_100637099	Ga0070699_1006370992	122
1167	3300005530	Ga0070679_100064847	Ga0070679_1000648475	122
1168	3300005530	Ga0070679_100193774	Ga0070679_1001937744	122
1169	3300005535	Ga0070684_100008101	Ga0070684_1000081019	122
1170	3300005535	Ga0070684_101968049	Ga0070684_1019680491	122
1171	3300005539	Ga0068853_100020673	Ga0068853_1000206739	122
1172	3300005539	Ga0068853_100054356	Ga0068853_1000543566	122
1173	3300005539	Ga0068853_102463840	Ga0068853_1024638402	122
1174	3300005543	Ga0070672_100569796	Ga0070672_1005697962	122
1175	3300005544	Ga0070686_100023620	Ga0070686_1000236206	122
1176	3300005546	Ga0070696_100824073	Ga0070696_1008240731	122
1177	3300005546	Ga0070696_101017165	Ga0070696_1010171651	122
1178	3300005547	Ga0070693_100008092	Ga0070693_1000080926	122
1179	3300005547	Ga0070693_100034187	Ga0070693_1000341872	122
1180	3300005547	Ga0070693_100286783	Ga0070693_1002867832	122
1181	3300005548	Ga0070665_100053676	Ga0070665_1000536764	122
1182	3300005548	Ga0070665_100085420	Ga0070665_1000854205	122
1183	3300005563	Ga0068855_100007796	Ga0068855_10000779613	122
1184	3300005564	Ga0070664_100079343	Ga0070664_1000793433	122
1185	3300005564	Ga0070664_100134092	Ga0070664_1001340924	122
1186	3300005564	Ga0070664_100157942	Ga0070664_1001579422	122
1187	3300005564	Ga0070664_100217018	Ga0070664_1002170183	122
1188	3300005564	Ga0070664_100916689	Ga0070664_1009166892	122
1189	3300005577	Ga0068857_100055991	Ga0068857_1000559915	122
1190	3300005577	Ga0068857_100119480	Ga0068857_1001194804	122
1191	3300005577	Ga0068857_101045437	Ga0068857_1010454371	122
1192	3300005578	Ga0068854_100031623	Ga0068854_1000316236	122
1193	3300005578	Ga0068854_100219572	Ga0068854_1002195721	122
1194	3300005578	Ga0068854_101377336	Ga0068854_1013773361	122
1195	3300005614	Ga0068856_100013142	Ga0068856_10001314212	122
1196	3300005614	Ga0068856_100049361	Ga0068856_1000493613	122
1197	3300005614	Ga0068856_100522102	Ga0068856_1005221022	122
1198	3300005616	Ga0068852_100002689	Ga0068852_10000268921	122
1199	3300005616	Ga0068852_101253611	Ga0068852_1012536111	122
1200	3300005616	Ga0068852_101457152	Ga0068852_1014571522	122
1201	3300005617	Ga0068859_100179662	Ga0068859_1001796625	122
1202	3300005617	Ga0068859_100235221	Ga0068859_1002352212	122
1203	3300005617	Ga0068859_100727561	Ga0068859_1007275612	122
1204	3300005617	Ga0068859_100729663	Ga0068859_1007296633	122
1205	3300005618	Ga0068864_100918945	Ga0068864_1009189452	122
1206	3300005718	Ga0068866_10002879	Ga0068866_100028796	122
1207	3300005718	Ga0068866_10205682	Ga0068866_102056821	122
1208	3300005834	Ga0068851_10015759	Ga0068851_100157595	122
1209	3300005834	Ga0068851_10037917	Ga0068851_100379174	122
1210	3300005834	Ga0068851_11082813	Ga0068851_110828131	122
1211	3300005840	Ga0068870_10005697	Ga0068870_100056974	122
1212	3300005840	Ga0068870_10123164	Ga0068870_101231642	122
1213	3300005841	Ga0068863_100674163	Ga0068863_1006741631	122
1214	3300005842	Ga0068858_100230839	Ga0068858_1002308393	122
1215	3300005844	Ga0068862_100013472	Ga0068862_10001347211	122
1216	3300005844	Ga0068862_102247167	Ga0068862_1022471671	122
1217	3300005983	Ga0081540_1003476	Ga0081540_100347610	122
1218	3300006175	Ga0070712_100360914	Ga0070712_1003609142	122
1219	3300006177	Ga0075362_10372835	Ga0075362_103728352	122
1220	3300006177	Ga0075362_10561508	Ga0075362_105615081	122
1221	3300006195	Ga0075366_10043852	Ga0075366_100438523	122
1222	3300006195	Ga0075366_10177863	Ga0075366_101778631	122
1223	3300006353	Ga0075370_10003187	Ga0075370_1000318710	122
1224	3300006358	Ga0068871_100031166	Ga0068871_1000311665	122
1225	3300006358	Ga0068871_101686408	Ga0068871_1016864081	122
1226	3300006871	Ga0075434_100287196	Ga0075434_1002871962	122
1227	3300006871	Ga0075434_100878373	Ga0075434_1008783732	122
1228	3300006881	Ga0068865_100389662	Ga0068865_1003896623	122
1229	3300006931	Ga0097620_100179653	Ga0097620_1001796535	122
1230	3300006931	Ga0097620_100235227	Ga0097620_1002352272	122
1231	3300006931	Ga0097620_100727598	Ga0097620_1007275982	122
1232	3300006931	Ga0097620_100729746	Ga0097620_1007297463	122
1233	3300009093	Ga0105240_10029664	Ga0105240_100296649	122
1234	3300009093	Ga0105240_10037050	Ga0105240_1003705010	122
1235	3300009093	Ga0105240_10308610	Ga0105240_103086102	122
1236	3300009093	Ga0105240_10447370	Ga0105240_104473703	122
1237	3300009094	Ga0111539_10080888	Ga0111539_100808884	122
1238	3300009094	Ga0111539_10131318	Ga0111539_101313182	122
1239	3300009098	Ga0105245_10039618	Ga0105245_100396183	122
1240	3300009098	Ga0105245_10842644	Ga0105245_108426441	122
1241	3300009098	Ga0105245_10911775	Ga0105245_109117751	122
1242	3300009098	Ga0105245_11502654	Ga0105245_115026541	122
1243	3300009148	Ga0105243_10110314	Ga0105243_101103141	122
1244	3300009174	Ga0105241_10066269	Ga0105241_100662692	122
1245	3300009176	Ga0105242_10041581	Ga0105242_100415811	122
1246	3300009176	Ga0105242_10043335	Ga0105242_100433351	122
1247	3300009176	Ga0105242_12962464	Ga0105242_129624641	122
1248	3300009177	Ga0105248_10086812	Ga0105248_100868124	122
1249	3300009177	Ga0105248_10403251	Ga0105248_104032514	122
1250	3300009177	Ga0105248_12839823	Ga0105248_128398231	122
1251	3300009177	Ga0105248_12904197	Ga0105248_129041971	122
1252	3300009545	Ga0105237_10002537	Ga0105237_100025377	122
1253	3300009545	Ga0105237_10073808	Ga0105237_100738082	122
1254	3300009545	Ga0105237_10101048	Ga0105237_101010483	122
1255	3300009545	Ga0105237_11577090	Ga0105237_115770901	122
1256	3300009551	Ga0105238_10002915	Ga0105238_1000291514	122
1257	3300009553	Ga0105249_10139137	Ga0105249_101391374	122
1258	3300010375	Ga0105239_11475381	Ga0105239_114753812	122
1259	3300011119	Ga0105246_10031580	Ga0105246_100315802	122
1260	3300011119	Ga0105246_10083834	Ga0105246_100838342	122
1261	3300013100	Ga0157373_10004318	Ga0157373_1000431816	122
1262	3300013100	Ga0157373_10443329	Ga0157373_104433291	122
1263	3300013102	Ga0157371_10010943	Ga0157371_100109438	122
1264	3300013102	Ga0157371_10077292	Ga0157371_100772925	122
1265	3300013104	Ga0157370_10012695	Ga0157370_1001269511	122
1266	3300013105	Ga0157369_10029525	Ga0157369_100295257	122
1267	3300013105	Ga0157369_10100322	Ga0157369_101003222	122
1268	3300013105	Ga0157369_10835370	Ga0157369_108353702	122
1269	3300013296	Ga0157374_10275292	Ga0157374_102752922	122
1270	3300013296	Ga0157374_12834191	Ga0157374_128341911	122
1271	3300013306	Ga0163162_10337068	Ga0163162_103370685	122
1272	3300013307	Ga0157372_10004355	Ga0157372_1000435523	122
1273	3300013307	Ga0157372_10084055	Ga0157372_100840554	122
1274	3300013307	Ga0157372_12013148	Ga0157372_120131482	122
1275	3300013308	Ga0157375_10213723	Ga0157375_102137233	122
1276	3300013308	Ga0157375_11334233	Ga0157375_113342331	122
1277	3300013308	Ga0157375_12683144	Ga0157375_126831441	122
1278	3300014325	Ga0163163_10026804	Ga0163163_100268043	122
1279	3300014325	Ga0163163_10782393	Ga0163163_107823932	122
1280	3300014326	Ga0157380_10823976	Ga0157380_108239762	122
1281	3300014497	Ga0182008_10159415	Ga0182008_101594151	122
1282	3300014745	Ga0157377_10036979	Ga0157377_100369791	122
1283	3300014968	Ga0157379_10415898	Ga0157379_104158982	122
1284	3300014969	Ga0157376_11291273	Ga0157376_112912732	122
1285	3300014969	Ga0157376_12102345	Ga0157376_121023451	122
1286	3300015262	Ga0182007_10009622	Ga0182007_100096228	122
1287	3300017792	Ga0163161_10099077	Ga0163161_100990773	122
1288	3300020070	Ga0206356_10688538	Ga0206356_106885382	122
1289	3300020082	Ga0206353_11675778	Ga0206353_116757781	122
1290	3300021361	Ga0213872_10118197	Ga0213872_101181973	122
1291	3300021384	Ga0213876_10503762	Ga0213876_105037621	122
1292	3300025226	Ga0209674_100175	Ga0209674_10017526	122
1293	3300025226	Ga0209674_100457	Ga0209674_1004571	122
1294	3300025228	Ga0209672_100018	Ga0209672_10001841	122
1295	3300025228	Ga0209672_100048	Ga0209672_100048228	122
1296	3300025228	Ga0209672_100682	Ga0209672_1006829	122
1297	3300025230	Ga0209563_100065	Ga0209563_100065232	122
1298	3300025231	Ga0207427_100021	Ga0207427_10002127	122
1299	3300025233	Ga0209437_100087	Ga0209437_10008727	122
1300	3300025242	Ga0209258_100024	Ga0209258_100024147	122
1301	3300025242	Ga0209258_100086	Ga0209258_100086228	122
1302	3300025242	Ga0209258_100275	Ga0209258_10027575	122
1303	3300025242	Ga0209258_129863	Ga0209258_1298631	122
1304	3300025246	Ga0209646_1000858	Ga0209646_100085814	122
1305	3300025246	Ga0209646_1005801	Ga0209646_10058012	122
1306	3300025250	Ga0209026_1000284	Ga0209026_10002842	122
1307	3300025250	Ga0209026_1000370	Ga0209026_100037020	122
1308	3300025250	Ga0209026_1004022	Ga0209026_10040228	122
1309	3300025250	Ga0209026_1005932	Ga0209026_10059322	122
1310	3300025253	Ga0209677_101623	Ga0209677_1016236	122
1311	3300025254	Ga0209148_1000009	Ga0209148_1000009475	122
1312	3300025254	Ga0209148_1000095	Ga0209148_1000095228	122
1313	3300025254	Ga0209148_1000245	Ga0209148_10002459	122
1314	3300025256	Ga0209759_1000616	Ga0209759_100061626	122
1315	3300025256	Ga0209759_1001142	Ga0209759_10011422	122
1316	3300025256	Ga0209759_1001994	Ga0209759_10019948	122
1317	3300025261	Ga0209233_1000023	Ga0209233_1000023595	122
1318	3300025272	Ga0209455_1000029	Ga0209455_1000029147	122
1319	3300025272	Ga0209455_1000087	Ga0209455_1000087228	122
1320	3300025272	Ga0209455_1000189	Ga0209455_100018940	122
1321	3300025272	Ga0209455_1000202	Ga0209455_10002029	122
1322	3300025290	Ga0207673_1000661	Ga0207673_10006613	122
1323	3300025292	Ga0209676_1055168	Ga0209676_10551682	122
1324	3300025297	Ga0209758_1000136	Ga0209758_100013662	122
1325	3300025315	Ga0207697_10000008	Ga0207697_1000000865	122
1326	3300025321	Ga0207656_10008670	Ga0207656_100086707	122
1327	3300025321	Ga0207656_10141711	Ga0207656_101417111	122
1328	3300025893	Ga0207682_10001587	Ga0207682_100015879	122
1329	3300025893	Ga0207682_10003188	Ga0207682_1000318811	122
1330	3300025899	Ga0207642_10258699	Ga0207642_102586992	122
1331	3300025901	Ga0207688_10906857	Ga0207688_109068571	122
1332	3300025903	Ga0207680_10246303	Ga0207680_102463031	122
1333	3300025903	Ga0207680_10909022	Ga0207680_109090222	122
1334	3300025904	Ga0207647_10055498	Ga0207647_100554983	122
1335	3300025906	Ga0207699_11064733	Ga0207699_110647331	122
1336	3300025907	Ga0207645_10008084	Ga0207645_100080848	122
1337	3300025907	Ga0207645_10281425	Ga0207645_102814252	122
1338	3300025908	Ga0207643_10017754	Ga0207643_100177543	122
1339	3300025908	Ga0207643_10112450	Ga0207643_101124501	122
1340	3300025909	Ga0207705_10145082	Ga0207705_101450821	122
1341	3300025909	Ga0207705_10179167	Ga0207705_101791673	122
1342	3300025909	Ga0207705_10229447	Ga0207705_102294473	122
1343	3300025909	Ga0207705_10317923	Ga0207705_103179232	122
1344	3300025911	Ga0207654_10207925	Ga0207654_102079251	122
1345	3300025912	Ga0207707_10007928	Ga0207707_100079281	122
1346	3300025913	Ga0207695_10000114	Ga0207695_10000114130	122
1347	3300025913	Ga0207695_10010992	Ga0207695_100109927	122
1348	3300025913	Ga0207695_10030358	Ga0207695_100303586	122
1349	3300025913	Ga0207695_10944886	Ga0207695_109448861	122
1350	3300025914	Ga0207671_10000697	Ga0207671_1000069718	122
1351	3300025914	Ga0207671_10268403	Ga0207671_102684032	122
1352	3300025917	Ga0207660_10010901	Ga0207660_100109012	122
1353	3300025917	Ga0207660_10948960	Ga0207660_109489602	122
1354	3300025918	Ga0207662_10144391	Ga0207662_101443912	122
1355	3300025919	Ga0207657_10011681	Ga0207657_1001168112	122
1356	3300025919	Ga0207657_10041708	Ga0207657_100417082	122
1357	3300025919	Ga0207657_10882966	Ga0207657_108829662	122
1358	3300025920	Ga0207649_10041926	Ga0207649_100419264	122
1359	3300025920	Ga0207649_10295831	Ga0207649_102958311	122
1360	3300025920	Ga0207649_10538415	Ga0207649_105384152	122
1361	3300025921	Ga0207652_10048221	Ga0207652_100482214	122
1362	3300025921	Ga0207652_10177532	Ga0207652_101775322	122
1363	3300025921	Ga0207652_10337161	Ga0207652_103371612	122
1364	3300025923	Ga0207681_10133205	Ga0207681_101332051	122
1365	3300025923	Ga0207681_10876125	Ga0207681_108761251	122
1366	3300025924	Ga0207694_10106155	Ga0207694_101061552	122
1367	3300025925	Ga0207650_10002149	Ga0207650_100021492	122
1368	3300025925	Ga0207650_10023179	Ga0207650_100231791	122
1369	3300025925	Ga0207650_10059199	Ga0207650_100591993	122
1370	3300025925	Ga0207650_10323059	Ga0207650_103230593	122
1371	3300025926	Ga0207659_10047150	Ga0207659_100471502	122
1372	3300025926	Ga0207659_10125826	Ga0207659_101258264	122
1373	3300025926	Ga0207659_10182090	Ga0207659_101820901	122
1374	3300025926	Ga0207659_11337310	Ga0207659_113373101	122
1375	3300025927	Ga0207687_10960179	Ga0207687_109601792	122
1376	3300025928	Ga0207700_10049234	Ga0207700_100492345	122
1377	3300025929	Ga0207664_10152105	Ga0207664_101521052	122
1378	3300025929	Ga0207664_10247799	Ga0207664_102477992	122
1379	3300025931	Ga0207644_10000751	Ga0207644_1000075113	122
1380	3300025931	Ga0207644_10076610	Ga0207644_100766102	122
1381	3300025931	Ga0207644_10094052	Ga0207644_100940524	122
1382	3300025931	Ga0207644_10104076	Ga0207644_101040764	122
1383	3300025931	Ga0207644_10138682	Ga0207644_101386822	122
1384	3300025932	Ga0207690_10001623	Ga0207690_100016236	122
1385	3300025932	Ga0207690_10266299	Ga0207690_102662991	122
1386	3300025932	Ga0207690_10312875	Ga0207690_103128752	122
1387	3300025933	Ga0207706_10014113	Ga0207706_100141132	122
1388	3300025933	Ga0207706_10979339	Ga0207706_109793392	122
1389	3300025933	Ga0207706_11597439	Ga0207706_115974391	122
1390	3300025935	Ga0207709_10341155	Ga0207709_103411552	122
1391	3300025936	Ga0207670_10080096	Ga0207670_100800965	122
1392	3300025936	Ga0207670_10094302	Ga0207670_100943023	122
1393	3300025936	Ga0207670_10228582	Ga0207670_102285822	122
1394	3300025936	Ga0207670_10343680	Ga0207670_103436801	122
1395	3300025937	Ga0207669_10053182	Ga0207669_100531822	122
1396	3300025938	Ga0207704_11030068	Ga0207704_110300682	122
1397	3300025940	Ga0207691_10027564	Ga0207691_100275642	122
1398	3300025941	Ga0207711_10103161	Ga0207711_101031612	122
1399	3300025941	Ga0207711_10279668	Ga0207711_102796684	122
1400	3300025942	Ga0207689_10080250	Ga0207689_100802503	122
1401	3300025944	Ga0207661_10001271	Ga0207661_1000127118	122
1402	3300025944	Ga0207661_10045498	Ga0207661_100454988	122
1403	3300025944	Ga0207661_10414122	Ga0207661_104141222	122
1404	3300025945	Ga0207679_10044679	Ga0207679_100446792	122
1405	3300025945	Ga0207679_10052949	Ga0207679_100529493	122
1406	3300025945	Ga0207679_10095502	Ga0207679_100955024	122
1407	3300025945	Ga0207679_10097874	Ga0207679_100978745	122
1408	3300025949	Ga0207667_10187146	Ga0207667_101871462	122
1409	3300025949	Ga0207667_10517264	Ga0207667_105172642	122
1410	3300025960	Ga0207651_10030369	Ga0207651_100303694	122
1411	3300025961	Ga0207712_10038813	Ga0207712_100388133	122
1412	3300025961	Ga0207712_10181596	Ga0207712_101815963	122
1413	3300025972	Ga0207668_10280294	Ga0207668_102802942	122
1414	3300025981	Ga0207640_10023844	Ga0207640_100238446	122
1415	3300025981	Ga0207640_11252919	Ga0207640_112529191	122
1416	3300025986	Ga0207658_10090039	Ga0207658_100900392	122
1417	3300025986	Ga0207658_10623224	Ga0207658_106232241	122
1418	3300025986	Ga0207658_11230678	Ga0207658_112306781	122
1419	3300026023	Ga0207677_10760045	Ga0207677_107600452	122
1420	3300026035	Ga0207703_10282380	Ga0207703_102823803	122
1421	3300026041	Ga0207639_10059898	Ga0207639_100598983	122
1422	3300026041	Ga0207639_10156405	Ga0207639_101564052	122
1423	3300026041	Ga0207639_10217395	Ga0207639_102173954	122
1424	3300026041	Ga0207639_10412335	Ga0207639_104123352	122
1425	3300026041	Ga0207639_10439067	Ga0207639_104390673	122
1426	3300026067	Ga0207678_10004505	Ga0207678_100045052	122
1427	3300026067	Ga0207678_10620861	Ga0207678_106208612	122
1428	3300026067	Ga0207678_11520963	Ga0207678_115209631	122
1429	3300026075	Ga0207708_10002339	Ga0207708_100023392	122
1430	3300026075	Ga0207708_10013642	Ga0207708_100136427	122
1431	3300026078	Ga0207702_10002486	Ga0207702_100024864	122
1432	3300026078	Ga0207702_10025249	Ga0207702_100252498	122
1433	3300026078	Ga0207702_10642504	Ga0207702_106425041	122
1434	3300026089	Ga0207648_10001508	Ga0207648_1000150817	122
1435	3300026089	Ga0207648_10224672	Ga0207648_102246722	122
1436	3300026089	Ga0207648_11588431	Ga0207648_115884311	122
1437	3300026095	Ga0207676_10167164	Ga0207676_101671641	122
1438	3300026116	Ga0207674_10003021	Ga0207674_1000302117	122
1439	3300026116	Ga0207674_10017139	Ga0207674_1001713912	122
1440	3300026116	Ga0207674_10871835	Ga0207674_108718352	122
1441	3300026142	Ga0207698_10182992	Ga0207698_101829922	122
1442	3300026142	Ga0207698_10661171	Ga0207698_106611712	122
1443	3300027717	Ga0209998_10068289	Ga0209998_100682891	122
1444	3300027907	Ga0207428_10292624	Ga0207428_102926241	122
1445	3300028379	Ga0268266_12119934	Ga0268266_121199341	122
1446	3300028380	Ga0268265_10230256	Ga0268265_102302562	122
1447	3300028794	Ga0307515_10016418	Ga0307515_1001641811	122
1448	3300031456	Ga0307513_10001052	Ga0307513_1000105224	122
1449	3300031456	Ga0307513_10093110	Ga0307513_100931105	122
1450	3300031456	Ga0307513_10620333	Ga0307513_106203331	122
1451	3300031456	Ga0307513_10849529	Ga0307513_108495291	122
1452	3300031507	Ga0307509_10060780	Ga0307509_100607803	122
1453	3300031507	Ga0307509_10062017	Ga0307509_100620174	122
1454	3300031548	Ga0307408_100466147	Ga0307408_1004661471	122
1455	3300031616	Ga0307508_10110603	Ga0307508_101106032	122
1456	3300031730	Ga0307516_10267870	Ga0307516_102678701	122
1457	3300031731	Ga0307405_10779623	Ga0307405_107796232	122
1458	3300031824	Ga0307413_10131696	Ga0307413_101316961	122
1459	3300031901	Ga0307406_10518419	Ga0307406_105184192	122
1460	3300031995	Ga0307409_100813537	Ga0307409_1008135372	122
1461	3300032002	Ga0307416_100574054	Ga0307416_1005740542	122
1462	3300035084	Ga0373928_0069604	Ga0373928_0069604_378_749	122
1463	3300035111	Ga0373923_0489564	Ga0373923_0489564_58_429	122
1464	3300035115	Ga0373941_0022478	Ga0373941_0022478_165_542	122
1465	3300035116	Ga0373945_0214898	Ga0373945_0214898_226_597	122
1466	3300035116	Ga0373945_0512927	Ga0373945_0512927_115_492	122
1467	3300035121	Ga0373960_0152246	Ga0373960_0152246_336_713	122
1468	3300035172	Ga0373955_0173877	Ga0373955_0173877_711_1088	122
1469	3300035241	Ga0373961_0000083	Ga0373961_0000083_19727_20104	122
1470	3300035692	Ga0373935_0416404	Ga0373935_0416404_145_522	122
1471	3300035695	Ga0373927_0109897	Ga0373927_0109897_129_500	122
1472	3300035725	Ga0373947_0153016	Ga0373947_0153016_623_994	122
1473	3300036401	Ga0373937_0044574	Ga0373937_0044574_975_1352	122
1474	3300036401	Ga0373937_0468639	Ga0373937_0468639_420_797	122
1475	3300036401	Ga0373937_0516546	Ga0373937_0516546_336_713	122
1476	3300037312	Ga0395899_0000119	Ga0395899_0000119_29269_29637	122
1477	3300037312	Ga0395899_0059442	Ga0395899_0059442_216_614	122
1478	3300037312	Ga0395899_0106334	Ga0395899_0106334_980_1348	122
1479	3300037418	Ga0395900_0000333	Ga0395900_0000333_60101_60469	122
1480	3300037418	Ga0395900_0024547	Ga0395900_0024547_1309_1677	122
1481	3300037418	Ga0395900_0080600	Ga0395900_0080600_2430_2828	122
1482	3300037418	Ga0395900_1532702	Ga0395900_1532702_145_513	122
1483	3300037466	Ga0395898_0000211	Ga0395898_0000211_136058_136426	122
1484	3300037466	Ga0395898_0044349	Ga0395898_0044349_69_467	122
1485	3300037471	Ga0395905_0424854	Ga0395905_0424854_651_1028	122
1486	3300038443	Ga0395901_1144514	Ga0395901_1144514_37_405	122
1487	3300039437	Ga0436365_0816611	Ga0436365_0816611_2535_2903	122
1488	3300039447	Ga0436361_0024497	Ga0436361_0024497_1857_2228	122
1489	3300041406	Ga0439439_0223918	Ga0439439_0223918_43_420	122
1490	3300041463	Ga0451804_0918015	Ga0451804_0918015_154_531	122
1491	3300041512	Ga0451853_0439069	Ga0451853_0439069_152_520	122
1492	3300041512	Ga0451853_0517740	Ga0451853_0517740_233_610	122
1493	3300042004	Ga0439445_0061281	Ga0439445_0061281_383_763	122
1494	3300042134	Ga0450898_026825	Ga0450898_026825_536_907	122
1495	3300042436	Ga0439435_0280212	Ga0439435_0280212_18_395	122
1496	3300044735	Ga0466968_0573646	Ga0466968_0573646_40_408	122
1497	3300045051	Ga0451576_0466476	Ga0451576_0466476_239_613	122
1498	3300046454	Ga0495592_0076221	Ga0495592_0076221_391_768	122
1499	3300046462	Ga0495651_0109847	Ga0495651_0109847_1329_1706	122
1500	3300046492	Ga0495585_0003091	Ga0495585_0003091_4222_4644	122
1501	3300046516	Ga0495628_0026278	Ga0495628_0026278_807_1184	122
1502	3300046529	Ga0495652_0021508	Ga0495652_0021508_4201_4578	122
1503	3300046533	Ga0495640_0247357	Ga0495640_0247357_32_409	122
1504	3300046536	Ga0495587_0030836	Ga0495587_0030836_118_495	122
1505	3300046537	Ga0495598_0092111	Ga0495598_0092111_36_413	122
1506	3300046539	Ga0495621_0175938	Ga0495621_0175938_266_643	122
1507	3300046543	Ga0495645_0010794	Ga0495645_0010794_6022_6399	122
1508	3300046663	Ga0495635_0360445	Ga0495635_0360445_110_481	122
1509	3300046678	Ga0495599_0000841	Ga0495599_0000841_2997_3374	122
1510	3300046680	Ga0495646_0021937	Ga0495646_0021937_881_1258	122
1511	3300046683	Ga0495658_0143558	Ga0495658_0143558_613_984	122
1512	3300047319	Ga0495674_0125298	Ga0495674_0125298_1468_1845	122
1513	3300047321	Ga0495676_0803897	Ga0495676_0803897_161_538	122
1514	3300047444	Ga0495675_0100920	Ga0495675_0100920_1097_1474	122
1515	3300047471	Ga0495684_0424572	Ga0495684_0424572_527_904	122
1516	3300048088	Ga0495602_0107327	Ga0495602_0107327_346_723	122
1517	3300048903	Ga0496100_0198943	Ga0496100_0198943_1055_1432	122
1518	3300048903	Ga0496100_0541969	Ga0496100_0541969_133_510	122
1519	3300048904	Ga0496101_0052525	Ga0496101_0052525_974_1351	122
1520	3300048904	Ga0496101_0123328	Ga0496101_0123328_591_959	122
1521	3300048907	Ga0496104_0067843	Ga0496104_0067843_2186_2563	122
1522	3300048909	Ga0496106_0069339	Ga0496106_0069339_409_786	122
1523	3300048909	Ga0496106_0102681	Ga0496106_0102681_1664_2041	122
1524	3300048910	Ga0496107_0040774	Ga0496107_0040774_717_1094	122
1525	3300048910	Ga0496107_0222957	Ga0496107_0222957_197_574	122
1526	3300048910	Ga0496107_0394454	Ga0496107_0394454_651_1019	122
1527	3300048911	Ga0496108_0070998	Ga0496108_0070998_1300_1677	122
1528	3300048912	Ga0496109_0190835	Ga0496109_0190835_1159_1536	122
1529	3300048913	Ga0496110_0086416	Ga0496110_0086416_1160_1537	122
1530	3300048915	Ga0496112_1253482	Ga0496112_1253482_263_640	122
1531	3300048917	Ga0496114_0186186	Ga0496114_0186186_888_1265	122
1532	3300048918	Ga0496115_0086056	Ga0496115_0086056_1179_1556	122
1533	3300048920	Ga0496117_0004101	Ga0496117_0004101_2455_2823	122
1534	3300048920	Ga0496117_0148039	Ga0496117_0148039_873_1241	122
1535	3300048921	Ga0496118_0004682	Ga0496118_0004682_12486_12854	122
1536	3300048921	Ga0496118_0177558	Ga0496118_0177558_895_1263	122
1537	3300048924	Ga0496121_0054315	Ga0496121_0054315_1224_1592	122
1538	3300049570	Ga0501033_0219162	Ga0501033_0219162_833_1201	122
1539	3300049570	Ga0501033_0295277	Ga0501033_0295277_59_427	122
1540	3300049571	Ga0501034_0378774	Ga0501034_0378774_928_1296	122
1541	3300049572	Ga0501036_0971028	Ga0501036_0971028_23_397	122
1542	3300049573	Ga0501037_0182861	Ga0501037_0182861_126_494	122
1543	3300049574	Ga0501038_0500856	Ga0501038_0500856_11_379	122
1544	3300049581	Ga0501047_0020169	Ga0501047_0020169_1113_1481	122
1545	3300049581	Ga0501047_0821557	Ga0501047_0821557_22_390	122
1546	3300049584	Ga0501068_0193073	Ga0501068_0193073_478_846	122
1547	3300049585	Ga0501069_0001198	Ga0501069_0001198_6692_7060	122
1548	3300049586	Ga0501070_0007428	Ga0501070_0007428_8264_8632	122
1549	3300049586	Ga0501070_0052083	Ga0501070_0052083_1597_1965	122
1550	3300049586	Ga0501070_0167601	Ga0501070_0167601_964_1341	122
1551	3300049586	Ga0501070_0333945	Ga0501070_0333945_379_750	122
1552	3300049586	Ga0501070_0593318	Ga0501070_0593318_183_551	122
1553	3300049588	Ga0501072_0089516	Ga0501072_0089516_1564_1932	122
1554	3300049588	Ga0501072_0664788	Ga0501072_0664788_348_719	122
1555	3300049589	Ga0501073_0005888	Ga0501073_0005888_7477_7845	122
1556	3300049590	Ga0501074_0001066	Ga0501074_0001066_7840_8208	122
1557	3300049592	Ga0501076_0261072	Ga0501076_0261072_309_677	122
1558	3300049593	Ga0501077_0004844	Ga0501077_0004844_526_894	122
1559	3300049741	Ga0501079_0007531	Ga0501079_0007531_5372_5740	122
1560	3300049742	Ga0501080_0003596	Ga0501080_0003596_7932_8300	122
1561	3300049742	Ga0501080_0314435	Ga0501080_0314435_918_1286	122
1562	3300049742	Ga0501080_1354385	Ga0501080_1354385_213_584	122
1563	3300049744	Ga0501083_0002695	Ga0501083_0002695_1495_1863	122
1564	3300049744	Ga0501083_0337630	Ga0501083_0337630_26_397	122
1565	3300049822	Ga0501035_0147762	Ga0501035_0147762_910_1281	122
1566	3300049822	Ga0501035_0437196	Ga0501035_0437196_335_703	122
1567	3300049823	Ga0501044_0174498	Ga0501044_0174498_1480_1848	122
1568	3300049823	Ga0501044_0221010	Ga0501044_0221010_1334_1705	122
1569	3300049823	Ga0501044_1465516	Ga0501044_1465516_126_494	122
1570	3300050489	nmdc:mga03683_281237_c1	nmdc:mga03683_281237_c1_54_431	122
1571	3300050493	nmdc:mga0k408_250867_c1	nmdc:mga0k408_250867_c1_461_847	122
1572	3300050493	nmdc:mga0k408_345832_c1	nmdc:mga0k408_345832_c1_28_402	122
1573	3300050496	nmdc:mga07m45_1462_c1	nmdc:mga07m45_1462_c1_5862_6239	122
1574	3300050511	nmdc:mga08y16_236341_c1	nmdc:mga08y16_236341_c1_1421_1795	122
1575	3300050511	nmdc:mga08y16_61937_c1	nmdc:mga08y16_61937_c1_2389_2766	122
1576	3300050512	nmdc:mga0n895_309129_c1	nmdc:mga0n895_309129_c1_279_656	122
1577	3300053077	Ga0495601_0335499	Ga0495601_0335499_167_544	122
1578	3300053084	Ga0495595_0545931	Ga0495595_0545931_32_409	122
1579	3300053086	Ga0500578_0520587	Ga0500578_0520587_89_457	122
1580	3300053088	Ga0500644_0006415	Ga0500644_0006415_2019_2396	122
1581	3300053090	Ga0500646_0037604	Ga0500646_0037604_192_569	122
1582	3300053093	Ga0500651_0022908	Ga0500651_0022908_2412_2780	122
1583	3300053103	Ga0500555_005319	Ga0500555_005319_2366_2734	122
1584	3300053104	Ga0500556_0404890	Ga0500556_0404890_68_436	122
1585	3300053117	Ga0500593_000739	Ga0500593_000739_5141_5518	122
1586	3300053119	Ga0500595_022290	Ga0500595_022290_469_837	122
1587	3300053123	Ga0500614_019705	Ga0500614_019705_165_533	122
1588	3300053131	Ga0500652_157972	Ga0500652_157972_266_634	122
1589	3300053134	Ga0500658_0260176	Ga0500658_0260176_211_582	122
1590	3300053146	Ga0500588_0037272	Ga0500588_0037272_660_1028	122
1591	3300054114	Ga0501084_0018430	Ga0501084_0018430_4490_4858	122
1592	3300060353	Ga0501082_0039532	Ga0501082_0039532_1610_1978	122
1593	3300001915	JGI24741J21665_1003721	JGI24741J21665_10037218	123
1594	3300005331	Ga0070670_100019822	Ga0070670_1000198221	123
1595	3300005354	Ga0070675_100142344	Ga0070675_1001423443	123
1596	3300005563	Ga0068855_100103709	Ga0068855_1001037093	123
1597	3300005614	Ga0068856_100471292	Ga0068856_1004712922	123
1598	3300005618	Ga0068864_100002422	Ga0068864_1000024222	123
1599	3300005841	Ga0068863_100012363	Ga0068863_10001236314	123
1600	3300009011	Ga0105251_10052161	Ga0105251_100521612	123
1601	3300009093	Ga0105240_10453738	Ga0105240_104537382	123
1602	3300009098	Ga0105245_10164167	Ga0105245_101641676	123
1603	3300013105	Ga0157369_11199124	Ga0157369_111991242	123
1604	3300013296	Ga0157374_10106479	Ga0157374_101064794	123
1605	3300014325	Ga0163163_10018583	Ga0163163_100185836	123
1606	3300014326	Ga0157380_10344491	Ga0157380_103444913	123
1607	3300025901	Ga0207688_10099552	Ga0207688_100995522	123
1608	3300025925	Ga0207650_10002444	Ga0207650_1000244419	123
1609	3300025926	Ga0207659_10274396	Ga0207659_102743963	123
1610	3300025944	Ga0207661_10615566	Ga0207661_106155662	123
1611	3300025949	Ga0207667_10068634	Ga0207667_100686342	123
1612	3300025986	Ga0207658_11661014	Ga0207658_116610141	123
1613	3300026075	Ga0207708_10099328	Ga0207708_100993283	123
1614	3300026078	Ga0207702_10783335	Ga0207702_107833352	123
1615	3300026088	Ga0207641_10184641	Ga0207641_101846412	123
1616	3300026095	Ga0207676_10375714	Ga0207676_103757142	123
1617	3300026118	Ga0207675_100512120	Ga0207675_1005121202	123
1618	3300031456	Ga0307513_10199250	Ga0307513_101992502	123
1619	3300037312	Ga0395899_0027537	Ga0395899_0027537_410_802	123
1620	3300037418	Ga0395900_0227732	Ga0395900_0227732_1430_1801	123
1621	3300037418	Ga0395900_0436817	Ga0395900_0436817_81_473	123
1622	3300038443	Ga0395901_0117049	Ga0395901_0117049_1186_1578	123
1623	3300039438	Ga0436360_0485462	Ga0436360_0485462_339_731	123
1624	3300048915	Ga0496112_0183530	Ga0496112_0183530_991_1389	123

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

17

134

0.95 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4z04-assembly1.cif.gz_A-2	crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione	0.9461	1	121
4z04-assembly1.cif.gz_A-2	crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione	0.924	1	121
4qb5-assembly2.cif.gz_B	crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118	0.8712	1	117
4qb5-assembly1.cif.gz_C	crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118	0.863	1	120
4qb5-assembly1.cif.gz_A	crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118	0.8535	1	120

ID	Description	Score	Start	End	Superfamily
4z04A00	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.9461	1	121	3.10.180.10
4z04A00	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.924	1	121	3.10.180.10
4qb5A00	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.8469	1	120	3.10.180.10
4qb5A00	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.8402	1	120	3.10.180.10
3itwA02	Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1;	0.8273	58	119	3.30.720.110

ID	Description	Score	Start	End	GO Terms
AF-A0A118DN11-F1-model_v4	Lyase	1.001	1	121	GO:0016829
AF-A0A530HA84-F1-model_v4	VOC family protein	0.9994	58	121
AF-A0A0E1X199-F1-model_v4	Glyoxalase/bleomycin resistance protein/dioxygenase	0.9991	60	121	GO:0051213
AF-A0A352S8D7-F1-model_v4	Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein	0.9991	59	120	GO:0051213
AF-A0A2Z7A8Q7-F1-model_v4	Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase	0.9951	1	121	GO:0016020 GO:0016846 GO:0046872 GO:0051213

Feature Viewer

pLDDT	pTM	Quality
93.97	0.88	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F495092

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

17

134

0.95

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map