F495116
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1628 | 453 | 3256 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300025936|Ga0207670_10274512|Ga0207670_102745122 |
| Length | 172 |
| Sequence | MAKKVSAMVKLQIPAGKATPAPPVGTALGPQGVNIMEFCKAFNAKTSAKDQEGLIIPVVITIFSDRSFTFITKTPPVPVLIKRAVSIAKGSAEPNKNRVGKLTLKQVEEIAKIKMPDLNSFDLEGVMNQVKGTARSMGVDALLVEKPADVTEAVRAGFDSGRPTLLELPISA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 6 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 9 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 90 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 100 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 101 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 102 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 105 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 107 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 123 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 144 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 145 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 147 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 214 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 218 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 219 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 226 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 227 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 228 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 229 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 230 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 231 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 232 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 234 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 235 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 236 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 237 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 238 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 239 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 240 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 246 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 247 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 248 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 249 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 250 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 253 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 255 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 257 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 258 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 259 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 260 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 261 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 262 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 263 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 264 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 265 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 266 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 267 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 268 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 270 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 271 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 272 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 273 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 274 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 275 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 278 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 279 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 280 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 281 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 282 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 283 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 284 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 285 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 286 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 287 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 288 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 289 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 290 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 291 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 292 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 293 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 294 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 295 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 296 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 297 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 298 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 299 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 300 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 301 | 3300041508 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT | Metatranscriptome | Unclassified |
| 302 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 303 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 304 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 305 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 306 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 307 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 308 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 309 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 310 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 311 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 312 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 313 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 314 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 315 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 316 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 317 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 364 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 365 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 366 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 367 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 369 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 370 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 371 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 372 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 398 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 399 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 400 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 401 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 402 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 409 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 410 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 411 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 422 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 423 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 424 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 425 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 426 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 427 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 428 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 429 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 430 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 431 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 432 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 433 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 434 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 435 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 436 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 452 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.84 |
| Metatranscriptomes | 5.16 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.47 |
| Nodule | 0 |
| Rhizoplane | 1.47 |
| Rhizosphere | 94.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207670_10274512 | 3300025936 | Bacteria | 1312 |
| 2 | SwRhRL2b_contig_3648165 | 2162886007 | Bacteria | 1043 |
| 3 | JGI24741J21665_1033893 | 3300001915 | Bacteria | 760 |
| 4 | JGI24737J22298_10075653 | 3300001990 | Bacteria | 1004 |
| 5 | Ga0058859_11478218 | 3300004798 | Bacteria | 761 |
| 6 | Ga0058859_11638471 | 3300004798 | Bacteria | 1015 |
| 7 | Ga0058863_11581443 | 3300004799 | Bacteria | 1004 |
| 8 | Ga0058863_11773336 | 3300004799 | Bacteria | 1148 |
| 9 | Ga0058861_10045775 | 3300004800 | Bacteria | 2017 |
| 10 | Ga0058861_10173322 | 3300004800 | Bacteria | 666 |
| 11 | Ga0058860_10210260 | 3300004801 | Bacteria | 3080 |
| 12 | Ga0058860_11763004 | 3300004801 | Bacteria | 3239 |
| 13 | Ga0058862_10217184 | 3300004803 | Bacteria | 1688 |
| 14 | Ga0058862_12307729 | 3300004803 | Bacteria | 609 |
| 15 | Ga0065704_10095262 | 3300005289 | Bacteria | 2497 |
| 16 | Ga0065715_10103339 | 3300005293 | Bacteria | 3040 |
| 17 | Ga0065707_10932254 | 3300005295 | Bacteria | 557 |
| 18 | Ga0070658_10016310 | 3300005327 | Bacteria | 5944 |
| 19 | Ga0070658_10031526 | 3300005327 | Bacteria | 4257 |
| 20 | Ga0070658_10067399 | 3300005327 | Bacteria | 2924 |
| 21 | Ga0070658_10074906 | 3300005327 | Bacteria | 2776 |
| 22 | Ga0070658_10163021 | 3300005327 | Bacteria | 1871 |
| 23 | Ga0070658_11088690 | 3300005327 | Bacteria | 695 |
| 24 | Ga0070676_10000002 | 3300005328 | Bacteria | 357662 |
| 25 | Ga0070676_10016036 | 3300005328 | Bacteria | 4138 |
| 26 | Ga0070676_10176212 | 3300005328 | Bacteria | 1387 |
| 27 | Ga0070676_10255796 | 3300005328 | Bacteria | 1171 |
| 28 | Ga0070683_100002981 | 3300005329 | Bacteria | 13577 |
| 29 | Ga0070683_100029815 | 3300005329 | Bacteria | 4944 |
| 30 | Ga0070683_100088449 | 3300005329 | Bacteria | 2906 |
| 31 | Ga0070683_100111881 | 3300005329 | Bacteria | 2576 |
| 32 | Ga0070683_100152539 | 3300005329 | Bacteria | 2191 |
| 33 | Ga0070683_100560145 | 3300005329 | Bacteria | 1093 |
| 34 | Ga0070683_100718798 | 3300005329 | Bacteria | 957 |
| 35 | Ga0070690_100029366 | 3300005330 | Bacteria | 3410 |
| 36 | Ga0070690_101425284 | 3300005330 | Bacteria | 558 |
| 37 | Ga0070670_100016026 | 3300005331 | Bacteria | 6432 |
| 38 | Ga0070670_100493721 | 3300005331 | Bacteria | 1088 |
| 39 | Ga0068869_100013457 | 3300005334 | Bacteria | 5443 |
| 40 | Ga0068869_100054244 | 3300005334 | Bacteria | 2917 |
| 41 | Ga0068869_100226642 | 3300005334 | Bacteria | 1483 |
| 42 | Ga0068869_100296407 | 3300005334 | Bacteria | 1304 |
| 43 | Ga0068869_100981623 | 3300005334 | Bacteria | 734 |
| 44 | Ga0070666_10038785 | 3300005335 | Bacteria | 3171 |
| 45 | Ga0070666_10206581 | 3300005335 | Bacteria | 1382 |
| 46 | Ga0070666_10237723 | 3300005335 | Bacteria | 1288 |
| 47 | Ga0070666_10445556 | 3300005335 | Bacteria | 934 |
| 48 | Ga0070666_10822541 | 3300005335 | Bacteria | 685 |
| 49 | Ga0070680_100055226 | 3300005336 | Bacteria | 3245 |
| 50 | Ga0070680_100065121 | 3300005336 | Bacteria | 2987 |
| 51 | Ga0070680_100097517 | 3300005336 | Bacteria | 2437 |
| 52 | Ga0070680_100197639 | 3300005336 | Bacteria | 1695 |
| 53 | Ga0070680_100289189 | 3300005336 | Bacteria | 1389 |
| 54 | Ga0070680_100611279 | 3300005336 | Bacteria | 936 |
| 55 | Ga0070682_100060709 | 3300005337 | Bacteria | 2391 |
| 56 | Ga0070682_100299058 | 3300005337 | Bacteria | 1180 |
| 57 | Ga0068868_100170735 | 3300005338 | Unclassified | 1800 |
| 58 | Ga0068868_100205574 | 3300005338 | Bacteria | 1643 |
| 59 | Ga0068868_100312728 | 3300005338 | Bacteria | 1337 |
| 60 | Ga0068868_100372630 | 3300005338 | Bacteria | 1227 |
| 61 | Ga0068868_100569883 | 3300005338 | Bacteria | 1000 |
| 62 | Ga0068868_100963262 | 3300005338 | Bacteria | 779 |
| 63 | Ga0068868_101151115 | 3300005338 | Bacteria | 715 |
| 64 | Ga0068868_101252207 | 3300005338 | Bacteria | 688 |
| 65 | Ga0068868_101614268 | 3300005338 | Bacteria | 609 |
| 66 | Ga0070660_100005332 | 3300005339 | Bacteria | 8896 |
| 67 | Ga0070660_100081218 | 3300005339 | Bacteria | 2545 |
| 68 | Ga0070660_100182693 | 3300005339 | Bacteria | 1697 |
| 69 | Ga0070660_100290089 | 3300005339 | Bacteria | 1340 |
| 70 | Ga0070660_100828546 | 3300005339 | Bacteria | 779 |
| 71 | Ga0070660_101481411 | 3300005339 | Bacteria | 577 |
| 72 | Ga0070689_100179833 | 3300005340 | Bacteria | 1717 |
| 73 | Ga0070689_100289442 | 3300005340 | Bacteria | 1361 |
| 74 | Ga0070689_100307037 | 3300005340 | Bacteria | 1322 |
| 75 | Ga0070689_101187320 | 3300005340 | Bacteria | 684 |
| 76 | Ga0070689_101277498 | 3300005340 | Bacteria | 660 |
| 77 | Ga0070691_10001162 | 3300005341 | Bacteria | 10979 |
| 78 | Ga0070691_10743465 | 3300005341 | Bacteria | 592 |
| 79 | Ga0070687_100626167 | 3300005343 | Bacteria | 742 |
| 80 | Ga0070661_100154852 | 3300005344 | Bacteria | 1734 |
| 81 | Ga0070661_100166885 | 3300005344 | Bacteria | 1670 |
| 82 | Ga0070661_100594716 | 3300005344 | Bacteria | 894 |
| 83 | Ga0070661_101115174 | 3300005344 | Bacteria | 658 |
| 84 | Ga0070692_10002909 | 3300005345 | Bacteria | 6792 |
| 85 | Ga0070692_10190709 | 3300005345 | Bacteria | 1194 |
| 86 | Ga0070669_100917855 | 3300005353 | Bacteria | 748 |
| 87 | Ga0070675_100330358 | 3300005354 | Bacteria | 1348 |
| 88 | Ga0070675_101391407 | 3300005354 | Bacteria | 647 |
| 89 | Ga0070671_100150795 | 3300005355 | Bacteria | 1963 |
| 90 | Ga0070671_100224240 | 3300005355 | Bacteria | 1595 |
| 91 | Ga0070671_100316383 | 3300005355 | Bacteria | 1330 |
| 92 | Ga0070671_101876450 | 3300005355 | Bacteria | 533 |
| 93 | Ga0070674_100195020 | 3300005356 | Bacteria | 1560 |
| 94 | Ga0070674_100198590 | 3300005356 | Unclassified | 1547 |
| 95 | Ga0070673_100017147 | 3300005364 | Bacteria | 5141 |
| 96 | Ga0070673_100047614 | 3300005364 | Bacteria | 3337 |
| 97 | Ga0070673_100352989 | 3300005364 | Bacteria | 1305 |
| 98 | Ga0070673_100958561 | 3300005364 | Bacteria | 795 |
| 99 | Ga0070673_101088356 | 3300005364 | Unclassified | 746 |
| 100 | Ga0070688_100113294 | 3300005365 | Bacteria | 1807 |
| 101 | Ga0070688_100326462 | 3300005365 | Bacteria | 1117 |
| 102 | Ga0070688_100898197 | 3300005365 | Bacteria | 698 |
| 103 | Ga0070659_100171910 | 3300005366 | Bacteria | 1775 |
| 104 | Ga0070659_100622854 | 3300005366 | Bacteria | 929 |
| 105 | Ga0070659_100667005 | 3300005366 | Bacteria | 897 |
| 106 | Ga0070659_101179388 | 3300005366 | Bacteria | 677 |
| 107 | Ga0070667_100000132 | 3300005367 | Bacteria | 94794 |
| 108 | Ga0070667_100069113 | 3300005367 | Bacteria | 3006 |
| 109 | Ga0070667_100272503 | 3300005367 | Bacteria | 1518 |
| 110 | Ga0070667_100344053 | 3300005367 | Bacteria | 1349 |
| 111 | Ga0070667_100490960 | 3300005367 | Bacteria | 1125 |
| 112 | Ga0070667_100628989 | 3300005367 | Bacteria | 990 |
| 113 | Ga0070667_101011134 | 3300005367 | Bacteria | 776 |
| 114 | Ga0070703_10013380 | 3300005406 | Bacteria | 2329 |
| 115 | Ga0070703_10058463 | 3300005406 | Bacteria | 1255 |
| 116 | Ga0070703_10066326 | 3300005406 | Bacteria | 1194 |
| 117 | Ga0070703_10316328 | 3300005406 | Bacteria | 656 |
| 118 | Ga0070709_10477097 | 3300005434 | Bacteria | 944 |
| 119 | Ga0070709_10504015 | 3300005434 | Bacteria | 920 |
| 120 | Ga0070709_10784059 | 3300005434 | Bacteria | 747 |
| 121 | Ga0070714_100022737 | 3300005435 | Bacteria | 5144 |
| 122 | Ga0070714_100048608 | 3300005435 | Bacteria | 3608 |
| 123 | Ga0070714_100811131 | 3300005435 | Bacteria | 907 |
| 124 | Ga0070714_101210173 | 3300005435 | Bacteria | 737 |
| 125 | Ga0070713_100018979 | 3300005436 | Bacteria | 5237 |
| 126 | Ga0070713_100038050 | 3300005436 | Bacteria | 3895 |
| 127 | Ga0070713_100051702 | 3300005436 | Bacteria | 3399 |
| 128 | Ga0070713_100543976 | 3300005436 | Bacteria | 1099 |
| 129 | Ga0070713_100876364 | 3300005436 | Bacteria | 863 |
| 130 | Ga0070713_102174219 | 3300005436 | Bacteria | 538 |
| 131 | Ga0070710_11162542 | 3300005437 | Bacteria | 569 |
| 132 | Ga0070701_10002390 | 3300005438 | Bacteria | 7217 |
| 133 | Ga0070701_10057462 | 3300005438 | Bacteria | 2039 |
| 134 | Ga0070711_100093697 | 3300005439 | Bacteria | 2169 |
| 135 | Ga0070711_100151767 | 3300005439 | Bacteria | 1748 |
| 136 | Ga0070711_100253776 | 3300005439 | Bacteria | 1381 |
| 137 | Ga0070711_100462963 | 3300005439 | Bacteria | 1040 |
| 138 | Ga0070711_100876785 | 3300005439 | Bacteria | 765 |
| 139 | Ga0070711_101019603 | 3300005439 | Bacteria | 711 |
| 140 | Ga0070711_101024855 | 3300005439 | Bacteria | 709 |
| 141 | Ga0070711_101097070 | 3300005439 | Bacteria | 686 |
| 142 | Ga0070711_101099405 | 3300005439 | Bacteria | 685 |
| 143 | Ga0070705_100120288 | 3300005440 | Bacteria | 1694 |
| 144 | Ga0070705_100120816 | 3300005440 | Bacteria | 1691 |
| 145 | Ga0070705_100238858 | 3300005440 | Bacteria | 1269 |
| 146 | Ga0070705_100686332 | 3300005440 | Bacteria | 803 |
| 147 | Ga0070700_100009609 | 3300005441 | Bacteria | 5315 |
| 148 | Ga0070700_100087382 | 3300005441 | Bacteria | 2026 |
| 149 | Ga0070694_100033358 | 3300005444 | Bacteria | 3387 |
| 150 | Ga0070694_100150838 | 3300005444 | Bacteria | 1697 |
| 151 | Ga0070694_100155350 | 3300005444 | Bacteria | 1674 |
| 152 | Ga0070694_100278260 | 3300005444 | Bacteria | 1275 |
| 153 | Ga0070694_101240026 | 3300005444 | Bacteria | 626 |
| 154 | Ga0070708_100074547 | 3300005445 | Bacteria | 3061 |
| 155 | Ga0070708_100129831 | 3300005445 | Bacteria | 2331 |
| 156 | Ga0070708_100784730 | 3300005445 | Bacteria | 896 |
| 157 | Ga0070708_101006534 | 3300005445 | Bacteria | 781 |
| 158 | Ga0070708_101126167 | 3300005445 | Bacteria | 735 |
| 159 | Ga0070708_101805362 | 3300005445 | Bacteria | 567 |
| 160 | Ga0070663_100145118 | 3300005455 | Bacteria | 1815 |
| 161 | Ga0070678_100242814 | 3300005456 | Bacteria | 1507 |
| 162 | Ga0070678_100818074 | 3300005456 | Bacteria | 847 |
| 163 | Ga0070678_101031663 | 3300005456 | Bacteria | 757 |
| 164 | Ga0070662_100160240 | 3300005457 | Bacteria | 1759 |
| 165 | Ga0070662_100403790 | 3300005457 | Bacteria | 1128 |
| 166 | Ga0070662_100499792 | 3300005457 | Bacteria | 1014 |
| 167 | Ga0070662_100716786 | 3300005457 | Bacteria | 847 |
| 168 | Ga0070681_10015833 | 3300005458 | Bacteria | 7517 |
| 169 | Ga0070681_10030019 | 3300005458 | Bacteria | 5455 |
| 170 | Ga0070681_10048985 | 3300005458 | Bacteria | 4220 |
| 171 | Ga0070681_10089529 | 3300005458 | Bacteria | 3029 |
| 172 | Ga0070681_10180638 | 3300005458 | Bacteria | 2032 |
| 173 | Ga0070681_10213766 | 3300005458 | Bacteria | 1844 |
| 174 | Ga0068867_100127890 | 3300005459 | Bacteria | 1971 |
| 175 | Ga0068867_100150919 | 3300005459 | Bacteria | 1825 |
| 176 | Ga0068867_100177486 | 3300005459 | Bacteria | 1691 |
| 177 | Ga0068867_100309143 | 3300005459 | Bacteria | 1306 |
| 178 | Ga0068867_100326184 | 3300005459 | Bacteria | 1273 |
| 179 | Ga0068867_100463174 | 3300005459 | Bacteria | 1083 |
| 180 | Ga0068867_100993111 | 3300005459 | Bacteria | 761 |
| 181 | Ga0068867_101606186 | 3300005459 | Bacteria | 608 |
| 182 | Ga0068867_101639692 | 3300005459 | Bacteria | 602 |
| 183 | Ga0068867_101900621 | 3300005459 | Bacteria | 561 |
| 184 | Ga0070685_10011503 | 3300005466 | Bacteria | 4632 |
| 185 | Ga0070685_10040968 | 3300005466 | Bacteria | 2637 |
| 186 | Ga0070706_100066634 | 3300005467 | Bacteria | 3330 |
| 187 | Ga0070706_100329158 | 3300005467 | Bacteria | 1425 |
| 188 | Ga0070706_100493363 | 3300005467 | Bacteria | 1139 |
| 189 | Ga0070706_100947528 | 3300005467 | Bacteria | 794 |
| 190 | Ga0070707_100221932 | 3300005468 | Bacteria | 1840 |
| 191 | Ga0070707_100680983 | 3300005468 | Bacteria | 991 |
| 192 | Ga0070698_100261630 | 3300005471 | Bacteria | 1662 |
| 193 | Ga0070698_100278933 | 3300005471 | Bacteria | 1603 |
| 194 | Ga0070698_100510295 | 3300005471 | Bacteria | 1140 |
| 195 | Ga0070698_100681089 | 3300005471 | Bacteria | 970 |
| 196 | Ga0070698_100854161 | 3300005471 | Bacteria | 855 |
| 197 | Ga0070699_100028934 | 3300005518 | Bacteria | 4777 |
| 198 | Ga0070699_100061001 | 3300005518 | Bacteria | 3268 |
| 199 | Ga0070699_100076627 | 3300005518 | Bacteria | 2911 |
| 200 | Ga0070699_100182515 | 3300005518 | Bacteria | 1862 |
| 201 | Ga0070699_100588284 | 3300005518 | Bacteria | 1014 |
| 202 | Ga0070679_100011561 | 3300005530 | Bacteria | 8412 |
| 203 | Ga0070679_100089372 | 3300005530 | Bacteria | 3067 |
| 204 | Ga0070679_100292090 | 3300005530 | Bacteria | 1581 |
| 205 | Ga0070679_100704166 | 3300005530 | Bacteria | 953 |
| 206 | Ga0070679_101293611 | 3300005530 | Bacteria | 675 |
| 207 | Ga0070684_100061031 | 3300005535 | Bacteria | 3299 |
| 208 | Ga0070684_100153008 | 3300005535 | Bacteria | 2090 |
| 209 | Ga0070684_100210188 | 3300005535 | Bacteria | 1773 |
| 210 | Ga0070684_100232151 | 3300005535 | Bacteria | 1685 |
| 211 | Ga0070684_100421634 | 3300005535 | Bacteria | 1232 |
| 212 | Ga0070684_100577216 | 3300005535 | Bacteria | 1044 |
| 213 | Ga0070684_100896869 | 3300005535 | Bacteria | 830 |
| 214 | Ga0070684_100984030 | 3300005535 | Bacteria | 791 |
| 215 | Ga0070697_100072171 | 3300005536 | Bacteria | 2832 |
| 216 | Ga0070697_100420954 | 3300005536 | Bacteria | 1161 |
| 217 | Ga0070697_100879252 | 3300005536 | Bacteria | 794 |
| 218 | Ga0070697_101288979 | 3300005536 | Bacteria | 652 |
| 219 | Ga0070697_101642471 | 3300005536 | Bacteria | 575 |
| 220 | Ga0068853_100114452 | 3300005539 | Bacteria | 2399 |
| 221 | Ga0068853_100166379 | 3300005539 | Bacteria | 1993 |
| 222 | Ga0068853_100200496 | 3300005539 | Bacteria | 1816 |
| 223 | Ga0068853_100235159 | 3300005539 | Bacteria | 1677 |
| 224 | Ga0068853_100270100 | 3300005539 | Bacteria | 1566 |
| 225 | Ga0068853_100499688 | 3300005539 | Bacteria | 1148 |
| 226 | Ga0068853_100687497 | 3300005539 | Unclassified | 975 |
| 227 | Ga0068853_100935963 | 3300005539 | Bacteria | 833 |
| 228 | Ga0070672_100007564 | 3300005543 | Bacteria | 7383 |
| 229 | Ga0070672_100358507 | 3300005543 | Bacteria | 1244 |
| 230 | Ga0070672_101805901 | 3300005543 | Bacteria | 550 |
| 231 | Ga0070686_100072179 | 3300005544 | Bacteria | 2263 |
| 232 | Ga0070686_100117212 | 3300005544 | Unclassified | 1823 |
| 233 | Ga0070686_100401214 | 3300005544 | Bacteria | 1043 |
| 234 | Ga0070686_100798114 | 3300005544 | Bacteria | 761 |
| 235 | Ga0070695_100034336 | 3300005545 | Bacteria | 3179 |
| 236 | Ga0070695_100035895 | 3300005545 | Bacteria | 3116 |
| 237 | Ga0070695_100092851 | 3300005545 | Bacteria | 2018 |
| 238 | Ga0070695_100116111 | 3300005545 | Bacteria | 1824 |
| 239 | Ga0070695_100154106 | 3300005545 | Bacteria | 1606 |
| 240 | Ga0070695_100623424 | 3300005545 | Bacteria | 849 |
| 241 | Ga0070695_100860415 | 3300005545 | Bacteria | 730 |
| 242 | Ga0070696_100007562 | 3300005546 | Bacteria | 7265 |
| 243 | Ga0070696_100060883 | 3300005546 | Bacteria | 2640 |
| 244 | Ga0070696_100130611 | 3300005546 | Bacteria | 1827 |
| 245 | Ga0070696_100140894 | 3300005546 | Bacteria | 1762 |
| 246 | Ga0070696_100183437 | 3300005546 | Bacteria | 1553 |
| 247 | Ga0070696_100192349 | 3300005546 | Bacteria | 1519 |
| 248 | Ga0070696_100215586 | 3300005546 | Bacteria | 1438 |
| 249 | Ga0070696_101026562 | 3300005546 | Bacteria | 690 |
| 250 | Ga0070693_100064853 | 3300005547 | Bacteria | 2133 |
| 251 | Ga0070693_100109376 | 3300005547 | Bacteria | 1697 |
| 252 | Ga0070693_100308782 | 3300005547 | Bacteria | 1069 |
| 253 | Ga0070665_100000956 | 3300005548 | Bacteria | 36803 |
| 254 | Ga0070665_100048212 | 3300005548 | Bacteria | 4277 |
| 255 | Ga0070665_100307536 | 3300005548 | Bacteria | 1588 |
| 256 | Ga0070665_100568406 | 3300005548 | Bacteria | 1146 |
| 257 | Ga0070665_100683593 | 3300005548 | Unclassified | 1039 |
| 258 | Ga0070665_100702219 | 3300005548 | Bacteria | 1024 |
| 259 | Ga0070704_100016254 | 3300005549 | Bacteria | 4699 |
| 260 | Ga0070704_100163554 | 3300005549 | Bacteria | 1762 |
| 261 | Ga0070704_100181372 | 3300005549 | Bacteria | 1684 |
| 262 | Ga0070704_100347104 | 3300005549 | Bacteria | 1252 |
| 263 | Ga0070704_100380742 | 3300005549 | Bacteria | 1199 |
| 264 | Ga0070704_100429662 | 3300005549 | Bacteria | 1133 |
| 265 | Ga0070704_100442098 | 3300005549 | Bacteria | 1118 |
| 266 | Ga0070704_101380064 | 3300005549 | Bacteria | 646 |
| 267 | Ga0068855_100027078 | 3300005563 | Bacteria | 6859 |
| 268 | Ga0068855_100050405 | 3300005563 | Bacteria | 4906 |
| 269 | Ga0068855_100145813 | 3300005563 | Bacteria | 2695 |
| 270 | Ga0068855_100325622 | 3300005563 | Bacteria | 1697 |
| 271 | Ga0068855_100455335 | 3300005563 | Bacteria | 1396 |
| 272 | Ga0068855_100526141 | 3300005563 | Bacteria | 1282 |
| 273 | Ga0068855_101008224 | 3300005563 | Bacteria | 874 |
| 274 | Ga0070664_100335375 | 3300005564 | Bacteria | 1373 |
| 275 | Ga0070664_100917022 | 3300005564 | Bacteria | 822 |
| 276 | Ga0070664_101606590 | 3300005564 | Bacteria | 616 |
| 277 | Ga0070664_101820334 | 3300005564 | Bacteria | 577 |
| 278 | Ga0068857_100012106 | 3300005577 | Bacteria | 7501 |
| 279 | Ga0068857_100057320 | 3300005577 | Bacteria | 3457 |
| 280 | Ga0068857_100059824 | 3300005577 | Bacteria | 3385 |
| 281 | Ga0068857_100102495 | 3300005577 | Bacteria | 2569 |
| 282 | Ga0068857_100243648 | 3300005577 | Bacteria | 1646 |
| 283 | Ga0068857_100263859 | 3300005577 | Bacteria | 1581 |
| 284 | Ga0068854_100139520 | 3300005578 | Bacteria | 1859 |
| 285 | Ga0068854_100179166 | 3300005578 | Bacteria | 1654 |
| 286 | Ga0068854_100575038 | 3300005578 | Bacteria | 959 |
| 287 | Ga0068854_100729067 | 3300005578 | Bacteria | 858 |
| 288 | Ga0068856_100067689 | 3300005614 | Bacteria | 3529 |
| 289 | Ga0068856_100103633 | 3300005614 | Bacteria | 2839 |
| 290 | Ga0068856_100161060 | 3300005614 | Bacteria | 2254 |
| 291 | Ga0068856_100275982 | 3300005614 | Bacteria | 1697 |
| 292 | Ga0068856_100568697 | 3300005614 | Bacteria | 1155 |
| 293 | Ga0070702_101861160 | 3300005615 | Bacteria | 504 |
| 294 | Ga0068852_100016325 | 3300005616 | Bacteria | 5786 |
| 295 | Ga0068852_100053398 | 3300005616 | Bacteria | 3478 |
| 296 | Ga0068852_100140852 | 3300005616 | Bacteria | 2232 |
| 297 | Ga0068859_100125671 | 3300005617 | Bacteria | 2633 |
| 298 | Ga0068859_100213847 | 3300005617 | Bacteria | 2015 |
| 299 | Ga0068859_100301917 | 3300005617 | Bacteria | 1694 |
| 300 | Ga0068859_100351175 | 3300005617 | Bacteria | 1570 |
| 301 | Ga0068859_100493007 | 3300005617 | Bacteria | 1320 |
| 302 | Ga0068859_100551046 | 3300005617 | Bacteria | 1247 |
| 303 | Ga0068859_100587214 | 3300005617 | Bacteria | 1207 |
| 304 | Ga0068859_100759850 | 3300005617 | Unclassified | 1058 |
| 305 | Ga0068859_100763293 | 3300005617 | Bacteria | 1056 |
| 306 | Ga0068859_101175867 | 3300005617 | Bacteria | 844 |
| 307 | Ga0068859_101679303 | 3300005617 | Bacteria | 701 |
| 308 | Ga0068859_101793134 | 3300005617 | Bacteria | 678 |
| 309 | Ga0068864_100038611 | 3300005618 | Bacteria | 4079 |
| 310 | Ga0068864_100090071 | 3300005618 | Bacteria | 2704 |
| 311 | Ga0068864_100137228 | 3300005618 | Bacteria | 2203 |
| 312 | Ga0068864_100209746 | 3300005618 | Bacteria | 1793 |
| 313 | Ga0068864_100240032 | 3300005618 | Bacteria | 1679 |
| 314 | Ga0068864_100906887 | 3300005618 | Bacteria | 870 |
| 315 | Ga0068866_10253131 | 3300005718 | Bacteria | 1079 |
| 316 | Ga0068866_10317409 | 3300005718 | Bacteria | 979 |
| 317 | Ga0068866_10318738 | 3300005718 | Bacteria | 977 |
| 318 | Ga0068861_100082107 | 3300005719 | Bacteria | 2525 |
| 319 | Ga0068861_101325800 | 3300005719 | Bacteria | 701 |
| 320 | Ga0068861_102198987 | 3300005719 | Bacteria | 553 |
| 321 | Ga0068861_102441214 | 3300005719 | Bacteria | 526 |
| 322 | Ga0068851_10732196 | 3300005834 | Bacteria | 611 |
| 323 | Ga0068870_10000560 | 3300005840 | Bacteria | 14068 |
| 324 | Ga0068870_10865311 | 3300005840 | Bacteria | 636 |
| 325 | Ga0068863_100093573 | 3300005841 | Bacteria | 2852 |
| 326 | Ga0068863_100126817 | 3300005841 | Bacteria | 2435 |
| 327 | Ga0068863_100177935 | 3300005841 | Bacteria | 2042 |
| 328 | Ga0068863_100223089 | 3300005841 | Bacteria | 1816 |
| 329 | Ga0068863_100758322 | 3300005841 | Bacteria | 966 |
| 330 | Ga0068863_100913460 | 3300005841 | Bacteria | 878 |
| 331 | Ga0068863_101781746 | 3300005841 | Bacteria | 625 |
| 332 | Ga0068858_100045647 | 3300005842 | Bacteria | 4061 |
| 333 | Ga0068858_100069232 | 3300005842 | Bacteria | 3271 |
| 334 | Ga0068858_100145469 | 3300005842 | Bacteria | 2226 |
| 335 | Ga0068858_100180802 | 3300005842 | Bacteria | 1991 |
| 336 | Ga0068858_100215287 | 3300005842 | Bacteria | 1819 |
| 337 | Ga0068858_100236799 | 3300005842 | Bacteria | 1731 |
| 338 | Ga0068858_100254153 | 3300005842 | Bacteria | 1670 |
| 339 | Ga0068858_100314260 | 3300005842 | Bacteria | 1496 |
| 340 | Ga0068858_100355453 | 3300005842 | Bacteria | 1404 |
| 341 | Ga0068858_100495302 | 3300005842 | Bacteria | 1180 |
| 342 | Ga0068858_100558114 | 3300005842 | Bacteria | 1109 |
| 343 | Ga0068858_100590851 | 3300005842 | Bacteria | 1076 |
| 344 | Ga0068860_100001432 | 3300005843 | Bacteria | 25835 |
| 345 | Ga0068860_100025519 | 3300005843 | Bacteria | 5701 |
| 346 | Ga0068860_100037244 | 3300005843 | Bacteria | 4656 |
| 347 | Ga0068860_100052656 | 3300005843 | Bacteria | 3871 |
| 348 | Ga0068860_100158941 | 3300005843 | Bacteria | 2178 |
| 349 | Ga0068860_100274079 | 3300005843 | Bacteria | 1647 |
| 350 | Ga0068860_100371164 | 3300005843 | Bacteria | 1411 |
| 351 | Ga0068860_100574900 | 3300005843 | Bacteria | 1131 |
| 352 | Ga0068860_101343304 | 3300005843 | Bacteria | 736 |
| 353 | Ga0068862_100030715 | 3300005844 | Bacteria | 4529 |
| 354 | Ga0068862_100196706 | 3300005844 | Bacteria | 1816 |
| 355 | Ga0068862_100285027 | 3300005844 | Bacteria | 1515 |
| 356 | Ga0068862_100394778 | 3300005844 | Bacteria | 1293 |
| 357 | Ga0068862_102590031 | 3300005844 | Bacteria | 519 |
| 358 | Ga0081455_10005833 | 3300005937 | Bacteria | 13401 |
| 359 | Ga0081539_10001872 | 3300005985 | Bacteria | 33010 |
| 360 | Ga0070717_10049261 | 3300006028 | Bacteria | 3458 |
| 361 | Ga0070717_10056186 | 3300006028 | Bacteria | 3251 |
| 362 | Ga0070717_10234697 | 3300006028 | Bacteria | 1616 |
| 363 | Ga0070717_10275547 | 3300006028 | Bacteria | 1491 |
| 364 | Ga0070717_11021466 | 3300006028 | Bacteria | 753 |
| 365 | Ga0075364_10491385 | 3300006051 | Bacteria | 839 |
| 366 | Ga0070715_10521029 | 3300006163 | Bacteria | 684 |
| 367 | Ga0070715_10697994 | 3300006163 | Bacteria | 606 |
| 368 | Ga0070715_10975008 | 3300006163 | Bacteria | 526 |
| 369 | Ga0070716_100304097 | 3300006173 | Bacteria | 1111 |
| 370 | Ga0070712_100042578 | 3300006175 | Bacteria | 3123 |
| 371 | Ga0075367_10358711 | 3300006178 | Bacteria | 920 |
| 372 | Ga0097621_100024374 | 3300006237 | Bacteria | 4724 |
| 373 | Ga0097621_100050693 | 3300006237 | Bacteria | 3376 |
| 374 | Ga0097621_100107171 | 3300006237 | Bacteria | 2358 |
| 375 | Ga0097621_100130824 | 3300006237 | Bacteria | 2136 |
| 376 | Ga0097621_100131589 | 3300006237 | Bacteria | 2130 |
| 377 | Ga0097621_100154467 | 3300006237 | Bacteria | 1969 |
| 378 | Ga0097621_100172262 | 3300006237 | Bacteria | 1866 |
| 379 | Ga0097621_100197378 | 3300006237 | Bacteria | 1745 |
| 380 | Ga0097621_100283779 | 3300006237 | Bacteria | 1458 |
| 381 | Ga0097621_100446323 | 3300006237 | Bacteria | 1165 |
| 382 | Ga0097621_100551091 | 3300006237 | Bacteria | 1049 |
| 383 | Ga0097621_100569171 | 3300006237 | Bacteria | 1033 |
| 384 | Ga0097621_100705071 | 3300006237 | Bacteria | 929 |
| 385 | Ga0097621_100768582 | 3300006237 | Bacteria | 891 |
| 386 | Ga0097621_101559027 | 3300006237 | Bacteria | 627 |
| 387 | Ga0097621_101673966 | 3300006237 | Bacteria | 605 |
| 388 | Ga0097621_102319595 | 3300006237 | Bacteria | 513 |
| 389 | Ga0075370_10585878 | 3300006353 | Bacteria | 675 |
| 390 | Ga0068871_100023285 | 3300006358 | Bacteria | 4788 |
| 391 | Ga0068871_100034497 | 3300006358 | Bacteria | 4015 |
| 392 | Ga0068871_100065515 | 3300006358 | Bacteria | 2975 |
| 393 | Ga0068871_100115475 | 3300006358 | Bacteria | 2263 |
| 394 | Ga0068871_100169351 | 3300006358 | Bacteria | 1871 |
| 395 | Ga0068871_100212469 | 3300006358 | Bacteria | 1673 |
| 396 | Ga0068871_100252988 | 3300006358 | Bacteria | 1535 |
| 397 | Ga0068871_100288695 | 3300006358 | Bacteria | 1437 |
| 398 | Ga0068871_100309636 | 3300006358 | Bacteria | 1388 |
| 399 | Ga0068871_100318174 | 3300006358 | Bacteria | 1369 |
| 400 | Ga0068871_100363237 | 3300006358 | Bacteria | 1283 |
| 401 | Ga0068871_100786088 | 3300006358 | Bacteria | 877 |
| 402 | Ga0068871_101671516 | 3300006358 | Bacteria | 603 |
| 403 | Ga0068871_101949028 | 3300006358 | Bacteria | 559 |
| 404 | Ga0075428_100013647 | 3300006844 | Bacteria | 9045 |
| 405 | Ga0075428_100339381 | 3300006844 | Bacteria | 1613 |
| 406 | Ga0075428_100970747 | 3300006844 | Bacteria | 900 |
| 407 | Ga0075428_101266367 | 3300006844 | Bacteria | 776 |
| 408 | Ga0075430_100043860 | 3300006846 | Bacteria | 3782 |
| 409 | Ga0075430_100056313 | 3300006846 | Bacteria | 3306 |
| 410 | Ga0075431_100001342 | 3300006847 | Bacteria | 22507 |
| 411 | Ga0075431_100071481 | 3300006847 | Bacteria | 3580 |
| 412 | Ga0075431_100283521 | 3300006847 | Bacteria | 1677 |
| 413 | Ga0075433_10024737 | 3300006852 | Bacteria | 5071 |
| 414 | Ga0075433_10062480 | 3300006852 | Bacteria | 3261 |
| 415 | Ga0075433_10358116 | 3300006852 | Bacteria | 1289 |
| 416 | Ga0075433_10529950 | 3300006852 | Bacteria | 1036 |
| 417 | Ga0075433_10706073 | 3300006852 | Bacteria | 883 |
| 418 | Ga0075434_100374162 | 3300006871 | Bacteria | 1445 |
| 419 | Ga0075429_100243279 | 3300006880 | Bacteria | 1576 |
| 420 | Ga0075429_100268861 | 3300006880 | Bacteria | 1493 |
| 421 | Ga0068865_100475504 | 3300006881 | Bacteria | 1037 |
| 422 | Ga0068865_100475982 | 3300006881 | Unclassified | 1037 |
| 423 | Ga0068865_101422307 | 3300006881 | Bacteria | 620 |
| 424 | Ga0075436_100176998 | 3300006914 | Bacteria | 1507 |
| 425 | Ga0075436_100431729 | 3300006914 | Bacteria | 957 |
| 426 | Ga0075436_100965092 | 3300006914 | Bacteria | 639 |
| 427 | Ga0097620_100125671 | 3300006931 | Bacteria | 2633 |
| 428 | Ga0097620_100213846 | 3300006931 | Bacteria | 2015 |
| 429 | Ga0097620_100301950 | 3300006931 | Bacteria | 1694 |
| 430 | Ga0097620_100351171 | 3300006931 | Bacteria | 1570 |
| 431 | Ga0097620_100551056 | 3300006931 | Bacteria | 1247 |
| 432 | Ga0097620_100587214 | 3300006931 | Bacteria | 1207 |
| 433 | Ga0097620_100759894 | 3300006931 | Unclassified | 1058 |
| 434 | Ga0097620_100763245 | 3300006931 | Bacteria | 1056 |
| 435 | Ga0097620_101175896 | 3300006931 | Bacteria | 844 |
| 436 | Ga0097620_101679307 | 3300006931 | Bacteria | 701 |
| 437 | Ga0097620_101793153 | 3300006931 | Bacteria | 678 |
| 438 | Ga0075435_100246536 | 3300007076 | Bacteria | 1520 |
| 439 | Ga0075435_102069623 | 3300007076 | Bacteria | 500 |
| 440 | Ga0099794_10019102 | 3300007265 | Bacteria | 3082 |
| 441 | Ga0099794_10116345 | 3300007265 | Bacteria | 1342 |
| 442 | Ga0099794_10241234 | 3300007265 | Bacteria | 931 |
| 443 | Ga0099794_10362524 | 3300007265 | Bacteria | 755 |
| 444 | Ga0105240_10000877 | 3300009093 | Bacteria | 54159 |
| 445 | Ga0105240_10001306 | 3300009093 | Bacteria | 42965 |
| 446 | Ga0105240_10005628 | 3300009093 | Bacteria | 18597 |
| 447 | Ga0105240_10011526 | 3300009093 | Bacteria | 12304 |
| 448 | Ga0105240_10012424 | 3300009093 | Bacteria | 11757 |
| 449 | Ga0105240_10051605 | 3300009093 | Bacteria | 5173 |
| 450 | Ga0105240_10089720 | 3300009093 | Bacteria | 3759 |
| 451 | Ga0105240_10210891 | 3300009093 | Bacteria | 2270 |
| 452 | Ga0105240_10237058 | 3300009093 | Bacteria | 2117 |
| 453 | Ga0105240_10261841 | 3300009093 | Bacteria | 1995 |
| 454 | Ga0105240_10264391 | 3300009093 | Bacteria | 1983 |
| 455 | Ga0105240_10303761 | 3300009093 | Bacteria | 1825 |
| 456 | Ga0105240_10470576 | 3300009093 | Bacteria | 1403 |
| 457 | Ga0105240_10858755 | 3300009093 | Bacteria | 979 |
| 458 | Ga0105240_10896683 | 3300009093 | Bacteria | 954 |
| 459 | Ga0105240_10928192 | 3300009093 | Bacteria | 935 |
| 460 | Ga0111539_10023315 | 3300009094 | Bacteria | 7604 |
| 461 | Ga0111539_10179787 | 3300009094 | Bacteria | 2471 |
| 462 | Ga0111539_10490847 | 3300009094 | Bacteria | 1430 |
| 463 | Ga0111539_11535031 | 3300009094 | Bacteria | 772 |
| 464 | Ga0105245_10017754 | 3300009098 | Bacteria | 6210 |
| 465 | Ga0105245_10039480 | 3300009098 | Bacteria | 4201 |
| 466 | Ga0105245_10104493 | 3300009098 | Bacteria | 2626 |
| 467 | Ga0105245_10129420 | 3300009098 | Bacteria | 2366 |
| 468 | Ga0105245_10148838 | 3300009098 | Bacteria | 2212 |
| 469 | Ga0105245_10149293 | 3300009098 | Bacteria | 2209 |
| 470 | Ga0105245_10256599 | 3300009098 | Bacteria | 1700 |
| 471 | Ga0105245_10312503 | 3300009098 | Bacteria | 1546 |
| 472 | Ga0105245_10346196 | 3300009098 | Bacteria | 1471 |
| 473 | Ga0105245_10379204 | 3300009098 | Bacteria | 1408 |
| 474 | Ga0105245_10409019 | 3300009098 | Bacteria | 1358 |
| 475 | Ga0105245_11701976 | 3300009098 | Bacteria | 683 |
| 476 | Ga0105245_11921349 | 3300009098 | Bacteria | 645 |
| 477 | Ga0105247_10048453 | 3300009101 | Bacteria | 2609 |
| 478 | Ga0105247_10054705 | 3300009101 | Bacteria | 2463 |
| 479 | Ga0105247_10401618 | 3300009101 | Bacteria | 977 |
| 480 | Ga0105247_10437679 | 3300009101 | Bacteria | 940 |
| 481 | Ga0105247_10939367 | 3300009101 | Bacteria | 671 |
| 482 | Ga0105247_11276221 | 3300009101 | Bacteria | 588 |
| 483 | Ga0114129_10038278 | 3300009147 | Bacteria | 6767 |
| 484 | Ga0114129_10231657 | 3300009147 | Bacteria | 2487 |
| 485 | Ga0114129_10284318 | 3300009147 | Bacteria | 2209 |
| 486 | Ga0114129_10586595 | 3300009147 | Bacteria | 1446 |
| 487 | Ga0114129_10730698 | 3300009147 | Bacteria | 1269 |
| 488 | Ga0114129_10787421 | 3300009147 | Bacteria | 1214 |
| 489 | Ga0105243_10077324 | 3300009148 | Bacteria | 2706 |
| 490 | Ga0105243_10213567 | 3300009148 | Bacteria | 1700 |
| 491 | Ga0105243_10592635 | 3300009148 | Bacteria | 1066 |
| 492 | Ga0105243_10828722 | 3300009148 | Bacteria | 914 |
| 493 | Ga0105243_11411429 | 3300009148 | Bacteria | 717 |
| 494 | Ga0105243_11508488 | 3300009148 | Bacteria | 696 |
| 495 | Ga0105243_11607711 | 3300009148 | Bacteria | 677 |
| 496 | Ga0105243_12367652 | 3300009148 | Bacteria | 569 |
| 497 | Ga0105243_12635984 | 3300009148 | Bacteria | 543 |
| 498 | Ga0105241_10149324 | 3300009174 | Bacteria | 1910 |
| 499 | Ga0105241_10215640 | 3300009174 | Bacteria | 1610 |
| 500 | Ga0105241_10406938 | 3300009174 | Bacteria | 1195 |
| 501 | Ga0105241_11175611 | 3300009174 | Bacteria | 725 |
| 502 | Ga0105241_11315796 | 3300009174 | Bacteria | 689 |
| 503 | Ga0105241_11539105 | 3300009174 | Bacteria | 641 |
| 504 | Ga0105242_10007188 | 3300009176 | Bacteria | 8588 |
| 505 | Ga0105242_10017892 | 3300009176 | Bacteria | 5533 |
| 506 | Ga0105242_10029508 | 3300009176 | Unclassified | 4376 |
| 507 | Ga0105242_10045247 | 3300009176 | Bacteria | 3566 |
| 508 | Ga0105242_10087110 | 3300009176 | Bacteria | 2622 |
| 509 | Ga0105242_10101803 | 3300009176 | Bacteria | 2435 |
| 510 | Ga0105242_10159358 | 3300009176 | Bacteria | 1974 |
| 511 | Ga0105242_11232430 | 3300009176 | Bacteria | 769 |
| 512 | Ga0105242_11256972 | 3300009176 | Bacteria | 762 |
| 513 | Ga0105242_12119993 | 3300009176 | Bacteria | 606 |
| 514 | Ga0105248_10048956 | 3300009177 | Bacteria | 4741 |
| 515 | Ga0105248_10091261 | 3300009177 | Bacteria | 3431 |
| 516 | Ga0105248_10128484 | 3300009177 | Bacteria | 2859 |
| 517 | Ga0105248_10147346 | 3300009177 | Bacteria | 2656 |
| 518 | Ga0105248_10189293 | 3300009177 | Bacteria | 2319 |
| 519 | Ga0105248_10191864 | 3300009177 | Bacteria | 2302 |
| 520 | Ga0105248_10252960 | 3300009177 | Bacteria | 1983 |
| 521 | Ga0105248_10400149 | 3300009177 | Bacteria | 1546 |
| 522 | Ga0105248_10454223 | 3300009177 | Bacteria | 1444 |
| 523 | Ga0105248_10758693 | 3300009177 | Bacteria | 1095 |
| 524 | Ga0105248_11044875 | 3300009177 | Bacteria | 923 |
| 525 | Ga0105248_11113116 | 3300009177 | Bacteria | 893 |
| 526 | Ga0105248_12535227 | 3300009177 | Bacteria | 584 |
| 527 | Ga0105237_10008200 | 3300009545 | Bacteria | 11346 |
| 528 | Ga0105237_10051788 | 3300009545 | Bacteria | 4123 |
| 529 | Ga0105237_10053225 | 3300009545 | Bacteria | 4061 |
| 530 | Ga0105237_10152505 | 3300009545 | Bacteria | 2307 |
| 531 | Ga0105237_10202396 | 3300009545 | Bacteria | 1986 |
| 532 | Ga0105237_10209685 | 3300009545 | Bacteria | 1948 |
| 533 | Ga0105237_10349760 | 3300009545 | Bacteria | 1482 |
| 534 | Ga0105237_10580274 | 3300009545 | Bacteria | 1128 |
| 535 | Ga0105237_10665163 | 3300009545 | Bacteria | 1048 |
| 536 | Ga0105237_10759439 | 3300009545 | Bacteria | 976 |
| 537 | Ga0105237_10930111 | 3300009545 | Bacteria | 876 |
| 538 | Ga0105237_11269133 | 3300009545 | Bacteria | 743 |
| 539 | Ga0105238_10025778 | 3300009551 | Bacteria | 5995 |
| 540 | Ga0105238_10042029 | 3300009551 | Bacteria | 4629 |
| 541 | Ga0105238_10043331 | 3300009551 | Bacteria | 4553 |
| 542 | Ga0105238_10079438 | 3300009551 | Bacteria | 3271 |
| 543 | Ga0105238_10103931 | 3300009551 | Bacteria | 2822 |
| 544 | Ga0105238_10121891 | 3300009551 | Bacteria | 2587 |
| 545 | Ga0105238_10145691 | 3300009551 | Bacteria | 2345 |
| 546 | Ga0105238_10181937 | 3300009551 | Bacteria | 2079 |
| 547 | Ga0105238_10193134 | 3300009551 | Bacteria | 2012 |
| 548 | Ga0105238_11624994 | 3300009551 | Bacteria | 676 |
| 549 | Ga0105238_11666046 | 3300009551 | Bacteria | 668 |
| 550 | Ga0105238_12122480 | 3300009551 | Bacteria | 596 |
| 551 | Ga0105249_10002635 | 3300009553 | Bacteria | 15525 |
| 552 | Ga0105249_10024654 | 3300009553 | Bacteria | 5407 |
| 553 | Ga0105249_10077940 | 3300009553 | Bacteria | 3074 |
| 554 | Ga0105249_10139643 | 3300009553 | Bacteria | 2322 |
| 555 | Ga0105249_11574552 | 3300009553 | Bacteria | 730 |
| 556 | Ga0105239_10001360 | 3300010375 | Bacteria | 32860 |
| 557 | Ga0105239_10096569 | 3300010375 | Bacteria | 3265 |
| 558 | Ga0105239_10100314 | 3300010375 | Bacteria | 3202 |
| 559 | Ga0105239_10122659 | 3300010375 | Bacteria | 2887 |
| 560 | Ga0105239_10372259 | 3300010375 | Bacteria | 1614 |
| 561 | Ga0105239_10607484 | 3300010375 | Bacteria | 1248 |
| 562 | Ga0105239_10718863 | 3300010375 | Bacteria | 1142 |
| 563 | Ga0105239_11293308 | 3300010375 | Bacteria | 841 |
| 564 | Ga0105239_11528422 | 3300010375 | Bacteria | 771 |
| 565 | Ga0105246_10077977 | 3300011119 | Bacteria | 2352 |
| 566 | Ga0105246_10099260 | 3300011119 | Bacteria | 2116 |
| 567 | Ga0105246_10114492 | 3300011119 | Bacteria | 1987 |
| 568 | Ga0105246_10194956 | 3300011119 | Bacteria | 1571 |
| 569 | Ga0105246_10282632 | 3300011119 | Bacteria | 1332 |
| 570 | Ga0105246_10561124 | 3300011119 | Bacteria | 980 |
| 571 | Ga0105246_10920208 | 3300011119 | Bacteria | 786 |
| 572 | Ga0105246_11066126 | 3300011119 | Bacteria | 736 |
| 573 | Ga0105246_11362579 | 3300011119 | Bacteria | 660 |
| 574 | Ga0105246_11602649 | 3300011119 | Bacteria | 615 |
| 575 | Ga0157319_1045228 | 3300012497 | Bacteria | 529 |
| 576 | Ga0157373_10005841 | 3300013100 | Bacteria | 9211 |
| 577 | Ga0157373_10348386 | 3300013100 | Bacteria | 1056 |
| 578 | Ga0157373_10512080 | 3300013100 | Bacteria | 868 |
| 579 | Ga0157373_10693042 | 3300013100 | Bacteria | 746 |
| 580 | Ga0157373_11014028 | 3300013100 | Bacteria | 620 |
| 581 | Ga0157371_10707574 | 3300013102 | Bacteria | 754 |
| 582 | Ga0157371_10768908 | 3300013102 | Bacteria | 724 |
| 583 | Ga0157371_11104805 | 3300013102 | Bacteria | 608 |
| 584 | Ga0157370_10009380 | 3300013104 | Bacteria | 10467 |
| 585 | Ga0157370_10016088 | 3300013104 | Bacteria | 7582 |
| 586 | Ga0157370_10060235 | 3300013104 | Bacteria | 3605 |
| 587 | Ga0157370_10087501 | 3300013104 | Bacteria | 2926 |
| 588 | Ga0157370_10111743 | 3300013104 | Bacteria | 2554 |
| 589 | Ga0157370_10115052 | 3300013104 | Bacteria | 2513 |
| 590 | Ga0157370_10220654 | 3300013104 | Bacteria | 1756 |
| 591 | Ga0157370_10709121 | 3300013104 | Bacteria | 918 |
| 592 | Ga0157370_10870264 | 3300013104 | Bacteria | 818 |
| 593 | Ga0157369_10089419 | 3300013105 | Bacteria | 3288 |
| 594 | Ga0157369_10144717 | 3300013105 | Bacteria | 2513 |
| 595 | Ga0157369_10290053 | 3300013105 | Bacteria | 1703 |
| 596 | Ga0157369_11928311 | 3300013105 | Bacteria | 600 |
| 597 | Ga0157374_10280734 | 3300013296 | Bacteria | 1644 |
| 598 | Ga0157374_10319069 | 3300013296 | Bacteria | 1539 |
| 599 | Ga0157374_10330236 | 3300013296 | Bacteria | 1512 |
| 600 | Ga0157374_10446725 | 3300013296 | Bacteria | 1294 |
| 601 | Ga0157374_10491386 | 3300013296 | Bacteria | 1231 |
| 602 | Ga0157374_10936791 | 3300013296 | Bacteria | 884 |
| 603 | Ga0157374_10977597 | 3300013296 | Bacteria | 865 |
| 604 | Ga0157374_11462225 | 3300013296 | Bacteria | 706 |
| 605 | Ga0157374_11919559 | 3300013296 | Bacteria | 618 |
| 606 | Ga0157374_12096100 | 3300013296 | Bacteria | 592 |
| 607 | Ga0157378_10009845 | 3300013297 | Bacteria | 8336 |
| 608 | Ga0157378_10024793 | 3300013297 | Bacteria | 5282 |
| 609 | Ga0157378_10173155 | 3300013297 | Bacteria | 2026 |
| 610 | Ga0157378_10363194 | 3300013297 | Bacteria | 1417 |
| 611 | Ga0157378_10445060 | 3300013297 | Bacteria | 1285 |
| 612 | Ga0157378_10450373 | 3300013297 | Bacteria | 1277 |
| 613 | Ga0157378_10662029 | 3300013297 | Bacteria | 1061 |
| 614 | Ga0157378_10888711 | 3300013297 | Bacteria | 921 |
| 615 | Ga0157378_11520754 | 3300013297 | Unclassified | 714 |
| 616 | Ga0157378_11595813 | 3300013297 | Bacteria | 698 |
| 617 | Ga0157378_12033050 | 3300013297 | Bacteria | 625 |
| 618 | Ga0157378_12695637 | 3300013297 | Bacteria | 549 |
| 619 | Ga0163162_10199046 | 3300013306 | Bacteria | 2132 |
| 620 | Ga0163162_10225142 | 3300013306 | Bacteria | 2005 |
| 621 | Ga0163162_10255877 | 3300013306 | Bacteria | 1883 |
| 622 | Ga0163162_10578563 | 3300013306 | Bacteria | 1250 |
| 623 | Ga0163162_11115184 | 3300013306 | Bacteria | 894 |
| 624 | Ga0163162_11629940 | 3300013306 | Bacteria | 736 |
| 625 | Ga0163162_12061465 | 3300013306 | Bacteria | 654 |
| 626 | Ga0163162_12680609 | 3300013306 | Bacteria | 574 |
| 627 | Ga0157372_10122792 | 3300013307 | Bacteria | 2985 |
| 628 | Ga0157372_10225448 | 3300013307 | Bacteria | 2173 |
| 629 | Ga0157372_10242922 | 3300013307 | Bacteria | 2089 |
| 630 | Ga0157372_10276972 | 3300013307 | Bacteria | 1950 |
| 631 | Ga0157372_10366455 | 3300013307 | Bacteria | 1679 |
| 632 | Ga0157372_10999408 | 3300013307 | Bacteria | 969 |
| 633 | Ga0157372_11151609 | 3300013307 | Bacteria | 897 |
| 634 | Ga0157372_11362368 | 3300013307 | Bacteria | 818 |
| 635 | Ga0157372_12609069 | 3300013307 | Bacteria | 580 |
| 636 | Ga0157372_13394294 | 3300013307 | Bacteria | 507 |
| 637 | Ga0157375_10018698 | 3300013308 | Bacteria | 6289 |
| 638 | Ga0157375_10032840 | 3300013308 | Bacteria | 4926 |
| 639 | Ga0157375_10116410 | 3300013308 | Bacteria | 2777 |
| 640 | Ga0157375_10126067 | 3300013308 | Bacteria | 2675 |
| 641 | Ga0157375_10425489 | 3300013308 | Bacteria | 1494 |
| 642 | Ga0157375_10472512 | 3300013308 | Bacteria | 1419 |
| 643 | Ga0157375_10501536 | 3300013308 | Bacteria | 1378 |
| 644 | Ga0157375_11706751 | 3300013308 | Bacteria | 746 |
| 645 | Ga0157375_11750934 | 3300013308 | Bacteria | 736 |
| 646 | Ga0157375_12682966 | 3300013308 | Bacteria | 596 |
| 647 | Ga0163163_10021758 | 3300014325 | Bacteria | 6058 |
| 648 | Ga0163163_10055051 | 3300014325 | Bacteria | 3931 |
| 649 | Ga0163163_10073100 | 3300014325 | Bacteria | 3419 |
| 650 | Ga0163163_10115863 | 3300014325 | Bacteria | 2711 |
| 651 | Ga0163163_10219037 | 3300014325 | Bacteria | 1952 |
| 652 | Ga0163163_10265123 | 3300014325 | Bacteria | 1769 |
| 653 | Ga0163163_10406008 | 3300014325 | Bacteria | 1421 |
| 654 | Ga0163163_10711542 | 3300014325 | Bacteria | 1068 |
| 655 | Ga0163163_10796119 | 3300014325 | Bacteria | 1009 |
| 656 | Ga0163163_10916822 | 3300014325 | Bacteria | 939 |
| 657 | Ga0163163_10978368 | 3300014325 | Bacteria | 909 |
| 658 | Ga0163163_11064320 | 3300014325 | Bacteria | 872 |
| 659 | Ga0157380_10267691 | 3300014326 | Bacteria | 1556 |
| 660 | Ga0157380_12284723 | 3300014326 | Bacteria | 605 |
| 661 | Ga0157377_10282327 | 3300014745 | Bacteria | 1089 |
| 662 | Ga0157377_10400044 | 3300014745 | Bacteria | 935 |
| 663 | Ga0157377_11103247 | 3300014745 | Bacteria | 608 |
| 664 | Ga0157379_10006057 | 3300014968 | Bacteria | 10415 |
| 665 | Ga0157379_10144596 | 3300014968 | Bacteria | 2144 |
| 666 | Ga0157379_10483045 | 3300014968 | Bacteria | 1147 |
| 667 | Ga0157379_10663700 | 3300014968 | Bacteria | 977 |
| 668 | Ga0157379_10829439 | 3300014968 | Bacteria | 874 |
| 669 | Ga0157379_11022947 | 3300014968 | Unclassified | 788 |
| 670 | Ga0157379_11373458 | 3300014968 | Bacteria | 684 |
| 671 | Ga0157379_11615559 | 3300014968 | Bacteria | 633 |
| 672 | Ga0157379_11774386 | 3300014968 | Bacteria | 606 |
| 673 | Ga0157376_10000261 | 3300014969 | Bacteria | 35920 |
| 674 | Ga0157376_10012722 | 3300014969 | Bacteria | 6257 |
| 675 | Ga0157376_10193186 | 3300014969 | Bacteria | 1868 |
| 676 | Ga0157376_10193905 | 3300014969 | Bacteria | 1865 |
| 677 | Ga0157376_10912527 | 3300014969 | Bacteria | 897 |
| 678 | Ga0157376_11827967 | 3300014969 | Bacteria | 644 |
| 679 | Ga0157376_11899754 | 3300014969 | Bacteria | 632 |
| 680 | Ga0157376_11958019 | 3300014969 | Bacteria | 623 |
| 681 | Ga0157376_12202120 | 3300014969 | Bacteria | 590 |
| 682 | Ga0157376_12698772 | 3300014969 | Bacteria | 537 |
| 683 | Ga0182007_10079041 | 3300015262 | Bacteria | 1079 |
| 684 | Ga0182007_10218614 | 3300015262 | Bacteria | 672 |
| 685 | Ga0163161_10881247 | 3300017792 | Bacteria | 757 |
| 686 | Ga0206356_11182845 | 3300020070 | Bacteria | 1797 |
| 687 | Ga0206356_11564136 | 3300020070 | Bacteria | 648 |
| 688 | Ga0206351_10681821 | 3300020077 | Bacteria | 726 |
| 689 | Ga0206352_10028984 | 3300020078 | Bacteria | 583 |
| 690 | Ga0206352_10470863 | 3300020078 | Bacteria | 2207 |
| 691 | Ga0206352_10752238 | 3300020078 | Bacteria | 713 |
| 692 | Ga0206352_11270903 | 3300020078 | Bacteria | 790 |
| 693 | Ga0206353_11732501 | 3300020082 | Bacteria | 1305 |
| 694 | Ga0213876_10041973 | 3300021384 | Bacteria | 2417 |
| 695 | Ga0213875_10022806 | 3300021388 | Bacteria | 2994 |
| 696 | Ga0224712_10000548 | 3300022467 | Bacteria | 7616 |
| 697 | Ga0224572_1066287 | 3300024225 | Bacteria | 668 |
| 698 | Ga0207656_10470961 | 3300025321 | Bacteria | 636 |
| 699 | Ga0207653_10010608 | 3300025885 | Bacteria | 2876 |
| 700 | Ga0207653_10019306 | 3300025885 | Bacteria | 2149 |
| 701 | Ga0207653_10233351 | 3300025885 | Bacteria | 701 |
| 702 | Ga0207692_10074593 | 3300025898 | Bacteria | 1798 |
| 703 | Ga0207692_10452153 | 3300025898 | Bacteria | 809 |
| 704 | Ga0207692_10462867 | 3300025898 | Bacteria | 800 |
| 705 | Ga0207642_10470226 | 3300025899 | Bacteria | 765 |
| 706 | Ga0207710_10050839 | 3300025900 | Bacteria | 1860 |
| 707 | Ga0207710_10056828 | 3300025900 | Bacteria | 1766 |
| 708 | Ga0207710_10307720 | 3300025900 | Bacteria | 801 |
| 709 | Ga0207710_10487930 | 3300025900 | Bacteria | 638 |
| 710 | Ga0207688_10106342 | 3300025901 | Bacteria | 1625 |
| 711 | Ga0207680_10193211 | 3300025903 | Bacteria | 1383 |
| 712 | Ga0207680_10194678 | 3300025903 | Bacteria | 1378 |
| 713 | Ga0207680_10201701 | 3300025903 | Bacteria | 1356 |
| 714 | Ga0207680_10507495 | 3300025903 | Bacteria | 859 |
| 715 | Ga0207680_10799496 | 3300025903 | Bacteria | 676 |
| 716 | Ga0207647_10043016 | 3300025904 | Bacteria | 2829 |
| 717 | Ga0207647_10384978 | 3300025904 | Bacteria | 791 |
| 718 | Ga0207685_10145305 | 3300025905 | Bacteria | 1068 |
| 719 | Ga0207685_10519982 | 3300025905 | Bacteria | 629 |
| 720 | Ga0207685_10532667 | 3300025905 | Bacteria | 622 |
| 721 | Ga0207699_10299935 | 3300025906 | Bacteria | 1122 |
| 722 | Ga0207699_10396201 | 3300025906 | Bacteria | 982 |
| 723 | Ga0207699_10853605 | 3300025906 | Bacteria | 671 |
| 724 | Ga0207645_10000001 | 3300025907 | Bacteria | 442754 |
| 725 | Ga0207645_10127376 | 3300025907 | Bacteria | 1655 |
| 726 | Ga0207645_10741378 | 3300025907 | Bacteria | 668 |
| 727 | Ga0207643_10001234 | 3300025908 | Bacteria | 15095 |
| 728 | Ga0207705_10027514 | 3300025909 | Bacteria | 4055 |
| 729 | Ga0207705_10058265 | 3300025909 | Bacteria | 2787 |
| 730 | Ga0207705_10381660 | 3300025909 | Bacteria | 1088 |
| 731 | Ga0207684_10017024 | 3300025910 | Bacteria | 6244 |
| 732 | Ga0207684_10088612 | 3300025910 | Bacteria | 2637 |
| 733 | Ga0207684_10135015 | 3300025910 | Bacteria | 2118 |
| 734 | Ga0207654_10002666 | 3300025911 | Bacteria | 9063 |
| 735 | Ga0207654_10039405 | 3300025911 | Bacteria | 2657 |
| 736 | Ga0207707_10039884 | 3300025912 | Bacteria | 4103 |
| 737 | Ga0207707_10051420 | 3300025912 | Bacteria | 3588 |
| 738 | Ga0207707_10052960 | 3300025912 | Bacteria | 3532 |
| 739 | Ga0207707_10065301 | 3300025912 | Bacteria | 3170 |
| 740 | Ga0207707_10142451 | 3300025912 | Bacteria | 2096 |
| 741 | Ga0207707_10202549 | 3300025912 | Bacteria | 1730 |
| 742 | Ga0207695_10001948 | 3300025913 | Bacteria | 32047 |
| 743 | Ga0207695_10008732 | 3300025913 | Bacteria | 12637 |
| 744 | Ga0207695_10009692 | 3300025913 | Bacteria | 11858 |
| 745 | Ga0207695_10024901 | 3300025913 | Bacteria | 6717 |
| 746 | Ga0207695_10033693 | 3300025913 | Bacteria | 5580 |
| 747 | Ga0207695_10104263 | 3300025913 | Bacteria | 2826 |
| 748 | Ga0207695_10121084 | 3300025913 | Bacteria | 2585 |
| 749 | Ga0207695_10140626 | 3300025913 | Bacteria | 2363 |
| 750 | Ga0207695_10148295 | 3300025913 | Bacteria | 2287 |
| 751 | Ga0207695_10164082 | 3300025913 | Bacteria | 2151 |
| 752 | Ga0207695_10482163 | 3300025913 | Bacteria | 1122 |
| 753 | Ga0207695_10901946 | 3300025913 | Bacteria | 764 |
| 754 | Ga0207695_10927662 | 3300025913 | Bacteria | 750 |
| 755 | Ga0207695_10959222 | 3300025913 | Bacteria | 735 |
| 756 | Ga0207671_10008521 | 3300025914 | Bacteria | 8682 |
| 757 | Ga0207671_10010454 | 3300025914 | Bacteria | 7655 |
| 758 | Ga0207671_10068243 | 3300025914 | Bacteria | 2649 |
| 759 | Ga0207671_10085702 | 3300025914 | Bacteria | 2367 |
| 760 | Ga0207671_10118089 | 3300025914 | Bacteria | 2025 |
| 761 | Ga0207671_10163633 | 3300025914 | Bacteria | 1724 |
| 762 | Ga0207671_10263012 | 3300025914 | Bacteria | 1358 |
| 763 | Ga0207671_10296510 | 3300025914 | Bacteria | 1277 |
| 764 | Ga0207671_10377164 | 3300025914 | Bacteria | 1126 |
| 765 | Ga0207671_10496509 | 3300025914 | Bacteria | 973 |
| 766 | Ga0207671_10841365 | 3300025914 | Bacteria | 727 |
| 767 | Ga0207693_10088443 | 3300025915 | Bacteria | 2428 |
| 768 | Ga0207663_10034350 | 3300025916 | Bacteria | 3031 |
| 769 | Ga0207663_10195008 | 3300025916 | Bacteria | 1457 |
| 770 | Ga0207663_10229309 | 3300025916 | Bacteria | 1356 |
| 771 | Ga0207663_10276502 | 3300025916 | Bacteria | 1246 |
| 772 | Ga0207663_10510796 | 3300025916 | Bacteria | 935 |
| 773 | Ga0207663_10570019 | 3300025916 | Bacteria | 887 |
| 774 | Ga0207663_10603209 | 3300025916 | Bacteria | 863 |
| 775 | Ga0207663_11119858 | 3300025916 | Bacteria | 633 |
| 776 | Ga0207663_11128813 | 3300025916 | Bacteria | 630 |
| 777 | Ga0207660_10007721 | 3300025917 | Bacteria | 6962 |
| 778 | Ga0207660_10042286 | 3300025917 | Bacteria | 3198 |
| 779 | Ga0207660_10096570 | 3300025917 | Bacteria | 2200 |
| 780 | Ga0207660_10192938 | 3300025917 | Bacteria | 1587 |
| 781 | Ga0207662_10297311 | 3300025918 | Bacteria | 1072 |
| 782 | Ga0207662_10629033 | 3300025918 | Bacteria | 748 |
| 783 | Ga0207657_10002040 | 3300025919 | Bacteria | 21838 |
| 784 | Ga0207657_10190582 | 3300025919 | Bacteria | 1654 |
| 785 | Ga0207657_10337253 | 3300025919 | Bacteria | 1190 |
| 786 | Ga0207657_10425210 | 3300025919 | Bacteria | 1044 |
| 787 | Ga0207657_10951241 | 3300025919 | Bacteria | 660 |
| 788 | Ga0207649_10137200 | 3300025920 | Bacteria | 1669 |
| 789 | Ga0207649_10161490 | 3300025920 | Bacteria | 1553 |
| 790 | Ga0207649_10361367 | 3300025920 | Bacteria | 1077 |
| 791 | Ga0207652_10002950 | 3300025921 | Bacteria | 14218 |
| 792 | Ga0207652_10101022 | 3300025921 | Bacteria | 2547 |
| 793 | Ga0207652_10157853 | 3300025921 | Bacteria | 2032 |
| 794 | Ga0207646_10012863 | 3300025922 | Bacteria | 8022 |
| 795 | Ga0207646_10133227 | 3300025922 | Bacteria | 2237 |
| 796 | Ga0207646_10432754 | 3300025922 | Bacteria | 1187 |
| 797 | Ga0207646_11047304 | 3300025922 | Bacteria | 720 |
| 798 | Ga0207681_10246401 | 3300025923 | Bacteria | 1393 |
| 799 | Ga0207681_10858191 | 3300025923 | Bacteria | 759 |
| 800 | Ga0207694_10030295 | 3300025924 | Bacteria | 4132 |
| 801 | Ga0207694_10033344 | 3300025924 | Bacteria | 3944 |
| 802 | Ga0207694_10038575 | 3300025924 | Bacteria | 3673 |
| 803 | Ga0207694_10074283 | 3300025924 | Bacteria | 2661 |
| 804 | Ga0207694_10154946 | 3300025924 | Bacteria | 1847 |
| 805 | Ga0207694_10194561 | 3300025924 | Bacteria | 1648 |
| 806 | Ga0207694_11716799 | 3300025924 | Bacteria | 528 |
| 807 | Ga0207650_10208613 | 3300025925 | Bacteria | 1568 |
| 808 | Ga0207650_10425348 | 3300025925 | Bacteria | 1102 |
| 809 | Ga0207650_10931971 | 3300025925 | Bacteria | 738 |
| 810 | Ga0207659_10083343 | 3300025926 | Bacteria | 2370 |
| 811 | Ga0207687_10017019 | 3300025927 | Bacteria | 4780 |
| 812 | Ga0207687_10019124 | 3300025927 | Bacteria | 4535 |
| 813 | Ga0207687_10032379 | 3300025927 | Bacteria | 3540 |
| 814 | Ga0207687_10071255 | 3300025927 | Bacteria | 2483 |
| 815 | Ga0207687_10096250 | 3300025927 | Bacteria | 2169 |
| 816 | Ga0207687_10129959 | 3300025927 | Bacteria | 1896 |
| 817 | Ga0207687_10177359 | 3300025927 | Bacteria | 1648 |
| 818 | Ga0207687_10190510 | 3300025927 | Bacteria | 1596 |
| 819 | Ga0207687_10205512 | 3300025927 | Bacteria | 1542 |
| 820 | Ga0207687_11643371 | 3300025927 | Bacteria | 551 |
| 821 | Ga0207700_10029176 | 3300025928 | Bacteria | 3890 |
| 822 | Ga0207700_10164168 | 3300025928 | Bacteria | 1847 |
| 823 | Ga0207700_10446296 | 3300025928 | Bacteria | 1140 |
| 824 | Ga0207700_10515366 | 3300025928 | Bacteria | 1059 |
| 825 | Ga0207700_10555465 | 3300025928 | Bacteria | 1019 |
| 826 | Ga0207700_10693373 | 3300025928 | Bacteria | 909 |
| 827 | Ga0207664_10004267 | 3300025929 | Bacteria | 9673 |
| 828 | Ga0207664_10274240 | 3300025929 | Bacteria | 1478 |
| 829 | Ga0207664_10428131 | 3300025929 | Bacteria | 1179 |
| 830 | Ga0207664_11302818 | 3300025929 | Bacteria | 646 |
| 831 | Ga0207644_10066014 | 3300025931 | Bacteria | 2633 |
| 832 | Ga0207644_10174854 | 3300025931 | Bacteria | 1679 |
| 833 | Ga0207644_10553114 | 3300025931 | Bacteria | 953 |
| 834 | Ga0207644_10585547 | 3300025931 | Bacteria | 925 |
| 835 | Ga0207644_11131740 | 3300025931 | Bacteria | 658 |
| 836 | Ga0207690_10183495 | 3300025932 | Bacteria | 1577 |
| 837 | Ga0207690_10326729 | 3300025932 | Bacteria | 1207 |
| 838 | Ga0207706_10070832 | 3300025933 | Bacteria | 3067 |
| 839 | Ga0207686_10003970 | 3300025934 | Bacteria | 7941 |
| 840 | Ga0207686_10005039 | 3300025934 | Bacteria | 7106 |
| 841 | Ga0207686_10005404 | 3300025934 | Bacteria | 6851 |
| 842 | Ga0207686_10019111 | 3300025934 | Unclassified | 3891 |
| 843 | Ga0207686_10076510 | 3300025934 | Bacteria | 2170 |
| 844 | Ga0207686_10137346 | 3300025934 | Bacteria | 1685 |
| 845 | Ga0207686_10240774 | 3300025934 | Bacteria | 1317 |
| 846 | Ga0207709_10115699 | 3300025935 | Bacteria | 1802 |
| 847 | Ga0207709_10161771 | 3300025935 | Bacteria | 1562 |
| 848 | Ga0207709_10218441 | 3300025935 | Bacteria | 1373 |
| 849 | Ga0207709_10374506 | 3300025935 | Bacteria | 1081 |
| 850 | Ga0207709_10557787 | 3300025935 | Bacteria | 902 |
| 851 | Ga0207709_10623133 | 3300025935 | Bacteria | 856 |
| 852 | Ga0207709_10728149 | 3300025935 | Bacteria | 796 |
| 853 | Ga0207670_10151143 | 3300025936 | Bacteria | 1723 |
| 854 | Ga0207670_10152015 | 3300025936 | Bacteria | 1719 |
| 855 | Ga0207670_10342167 | 3300025936 | Bacteria | 1182 |
| 856 | Ga0207670_10348310 | 3300025936 | Bacteria | 1172 |
| 857 | Ga0207670_10594838 | 3300025936 | Bacteria | 908 |
| 858 | Ga0207669_10168175 | 3300025937 | Unclassified | 1557 |
| 859 | Ga0207704_10040646 | 3300025938 | Bacteria | 2720 |
| 860 | Ga0207704_10506339 | 3300025938 | Bacteria | 974 |
| 861 | Ga0207704_10673673 | 3300025938 | Bacteria | 854 |
| 862 | Ga0207704_11366181 | 3300025938 | Bacteria | 607 |
| 863 | Ga0207665_10096123 | 3300025939 | Bacteria | 2060 |
| 864 | Ga0207665_10500424 | 3300025939 | Bacteria | 939 |
| 865 | Ga0207691_10011682 | 3300025940 | Bacteria | 8433 |
| 866 | Ga0207691_10287124 | 3300025940 | Bacteria | 1415 |
| 867 | Ga0207691_10331216 | 3300025940 | Bacteria | 1304 |
| 868 | Ga0207691_10581586 | 3300025940 | Bacteria | 948 |
| 869 | Ga0207691_11114821 | 3300025940 | Bacteria | 656 |
| 870 | Ga0207711_10002186 | 3300025941 | Bacteria | 17573 |
| 871 | Ga0207711_10122624 | 3300025941 | Bacteria | 2322 |
| 872 | Ga0207711_10253474 | 3300025941 | Bacteria | 1616 |
| 873 | Ga0207711_10291298 | 3300025941 | Bacteria | 1505 |
| 874 | Ga0207711_10314266 | 3300025941 | Bacteria | 1447 |
| 875 | Ga0207711_10360513 | 3300025941 | Bacteria | 1347 |
| 876 | Ga0207711_10394295 | 3300025941 | Bacteria | 1285 |
| 877 | Ga0207711_10401010 | 3300025941 | Bacteria | 1274 |
| 878 | Ga0207711_10426824 | 3300025941 | Bacteria | 1233 |
| 879 | Ga0207711_10493303 | 3300025941 | Bacteria | 1141 |
| 880 | Ga0207711_11398284 | 3300025941 | Bacteria | 642 |
| 881 | Ga0207689_10076821 | 3300025942 | Bacteria | 2745 |
| 882 | Ga0207689_10129346 | 3300025942 | Bacteria | 2078 |
| 883 | Ga0207689_10186020 | 3300025942 | Bacteria | 1713 |
| 884 | Ga0207689_10438903 | 3300025942 | Bacteria | 1090 |
| 885 | Ga0207689_10462938 | 3300025942 | Bacteria | 1060 |
| 886 | Ga0207661_10007311 | 3300025944 | Bacteria | 7855 |
| 887 | Ga0207661_10008612 | 3300025944 | Bacteria | 7289 |
| 888 | Ga0207661_10029011 | 3300025944 | Bacteria | 4245 |
| 889 | Ga0207661_10070357 | 3300025944 | Bacteria | 2856 |
| 890 | Ga0207661_10143604 | 3300025944 | Bacteria | 2056 |
| 891 | Ga0207661_10214715 | 3300025944 | Bacteria | 1697 |
| 892 | Ga0207661_10428017 | 3300025944 | Bacteria | 1203 |
| 893 | Ga0207661_10594606 | 3300025944 | Bacteria | 1015 |
| 894 | Ga0207661_11598627 | 3300025944 | Bacteria | 596 |
| 895 | Ga0207661_11721433 | 3300025944 | Bacteria | 572 |
| 896 | Ga0207679_10147074 | 3300025945 | Bacteria | 1913 |
| 897 | Ga0207679_10170041 | 3300025945 | Bacteria | 1793 |
| 898 | Ga0207679_10301142 | 3300025945 | Bacteria | 1382 |
| 899 | Ga0207679_10483672 | 3300025945 | Bacteria | 1102 |
| 900 | Ga0207679_11309751 | 3300025945 | Bacteria | 665 |
| 901 | Ga0207667_10015532 | 3300025949 | Bacteria | 8643 |
| 902 | Ga0207667_10020712 | 3300025949 | Bacteria | 7307 |
| 903 | Ga0207667_10021290 | 3300025949 | Bacteria | 7186 |
| 904 | Ga0207667_10070161 | 3300025949 | Bacteria | 3647 |
| 905 | Ga0207667_10071295 | 3300025949 | Bacteria | 3613 |
| 906 | Ga0207667_10244652 | 3300025949 | Bacteria | 1835 |
| 907 | Ga0207667_11811993 | 3300025949 | Bacteria | 574 |
| 908 | Ga0207651_10012611 | 3300025960 | Bacteria | 4793 |
| 909 | Ga0207651_10197727 | 3300025960 | Bacteria | 1608 |
| 910 | Ga0207651_10971665 | 3300025960 | Unclassified | 758 |
| 911 | Ga0207651_10977347 | 3300025960 | Bacteria | 756 |
| 912 | Ga0207651_11598486 | 3300025960 | Bacteria | 587 |
| 913 | Ga0207712_10003146 | 3300025961 | Bacteria | 10526 |
| 914 | Ga0207712_10004825 | 3300025961 | Bacteria | 8520 |
| 915 | Ga0207712_10092233 | 3300025961 | Bacteria | 2233 |
| 916 | Ga0207712_10286248 | 3300025961 | Bacteria | 1347 |
| 917 | Ga0207712_10539391 | 3300025961 | Bacteria | 1002 |
| 918 | Ga0207712_10552613 | 3300025961 | Bacteria | 990 |
| 919 | Ga0207712_10774951 | 3300025961 | Bacteria | 842 |
| 920 | Ga0207640_10161981 | 3300025981 | Bacteria | 1656 |
| 921 | Ga0207640_10183861 | 3300025981 | Bacteria | 1569 |
| 922 | Ga0207640_10568825 | 3300025981 | Bacteria | 955 |
| 923 | Ga0207640_10843076 | 3300025981 | Bacteria | 797 |
| 924 | Ga0207658_10000049 | 3300025986 | Bacteria | 129769 |
| 925 | Ga0207658_10101054 | 3300025986 | Bacteria | 2259 |
| 926 | Ga0207658_10134934 | 3300025986 | Bacteria | 1988 |
| 927 | Ga0207658_10462178 | 3300025986 | Bacteria | 1125 |
| 928 | Ga0207658_10863586 | 3300025986 | Bacteria | 823 |
| 929 | Ga0207658_10870731 | 3300025986 | Bacteria | 819 |
| 930 | Ga0207658_11428116 | 3300025986 | Bacteria | 633 |
| 931 | Ga0207677_10203666 | 3300026023 | Bacteria | 1575 |
| 932 | Ga0207677_10224814 | 3300026023 | Bacteria | 1508 |
| 933 | Ga0207677_10246308 | 3300026023 | Unclassified | 1449 |
| 934 | Ga0207677_10306818 | 3300026023 | Bacteria | 1313 |
| 935 | Ga0207677_10812374 | 3300026023 | Bacteria | 838 |
| 936 | Ga0207703_10069669 | 3300026035 | Bacteria | 2901 |
| 937 | Ga0207703_10120083 | 3300026035 | Bacteria | 2255 |
| 938 | Ga0207703_10172273 | 3300026035 | Bacteria | 1905 |
| 939 | Ga0207703_10194964 | 3300026035 | Bacteria | 1797 |
| 940 | Ga0207703_10317015 | 3300026035 | Bacteria | 1427 |
| 941 | Ga0207703_10339060 | 3300026035 | Bacteria | 1381 |
| 942 | Ga0207703_10727470 | 3300026035 | Unclassified | 945 |
| 943 | Ga0207703_11335727 | 3300026035 | Bacteria | 690 |
| 944 | Ga0207703_11683800 | 3300026035 | Bacteria | 610 |
| 945 | Ga0207639_10045508 | 3300026041 | Bacteria | 3306 |
| 946 | Ga0207639_10209326 | 3300026041 | Bacteria | 1677 |
| 947 | Ga0207639_10242622 | 3300026041 | Bacteria | 1567 |
| 948 | Ga0207639_10341680 | 3300026041 | Bacteria | 1335 |
| 949 | Ga0207639_10390135 | 3300026041 | Bacteria | 1252 |
| 950 | Ga0207639_10553773 | 3300026041 | Bacteria | 1056 |
| 951 | Ga0207639_10749435 | 3300026041 | Bacteria | 908 |
| 952 | Ga0207639_10926269 | 3300026041 | Unclassified | 815 |
| 953 | Ga0207639_10937646 | 3300026041 | Bacteria | 810 |
| 954 | Ga0207639_11696704 | 3300026041 | Bacteria | 592 |
| 955 | Ga0207678_11218354 | 3300026067 | Bacteria | 666 |
| 956 | Ga0207708_10060638 | 3300026075 | Bacteria | 2887 |
| 957 | Ga0207708_10127103 | 3300026075 | Bacteria | 1990 |
| 958 | Ga0207708_11650427 | 3300026075 | Bacteria | 563 |
| 959 | Ga0207702_10049903 | 3300026078 | Bacteria | 3532 |
| 960 | Ga0207702_10120702 | 3300026078 | Bacteria | 2346 |
| 961 | Ga0207702_10206316 | 3300026078 | Bacteria | 1825 |
| 962 | Ga0207702_10238935 | 3300026078 | Bacteria | 1701 |
| 963 | Ga0207702_10256020 | 3300026078 | Bacteria | 1646 |
| 964 | Ga0207702_10440394 | 3300026078 | Bacteria | 1263 |
| 965 | Ga0207702_10605810 | 3300026078 | Bacteria | 1075 |
| 966 | Ga0207641_10082414 | 3300026088 | Bacteria | 2795 |
| 967 | Ga0207641_10097869 | 3300026088 | Bacteria | 2579 |
| 968 | Ga0207641_10203132 | 3300026088 | Bacteria | 1828 |
| 969 | Ga0207641_10340938 | 3300026088 | Bacteria | 1426 |
| 970 | Ga0207641_11168754 | 3300026088 | Bacteria | 769 |
| 971 | Ga0207648_10073228 | 3300026089 | Bacteria | 2986 |
| 972 | Ga0207648_10181282 | 3300026089 | Bacteria | 1864 |
| 973 | Ga0207648_10197096 | 3300026089 | Bacteria | 1786 |
| 974 | Ga0207648_10228338 | 3300026089 | Bacteria | 1655 |
| 975 | Ga0207648_10409100 | 3300026089 | Bacteria | 1230 |
| 976 | Ga0207648_10453931 | 3300026089 | Bacteria | 1167 |
| 977 | Ga0207676_10006640 | 3300026095 | Bacteria | 8178 |
| 978 | Ga0207676_10078610 | 3300026095 | Bacteria | 2672 |
| 979 | Ga0207676_10146864 | 3300026095 | Bacteria | 2026 |
| 980 | Ga0207676_10211529 | 3300026095 | Bacteria | 1721 |
| 981 | Ga0207676_10642670 | 3300026095 | Bacteria | 1023 |
| 982 | Ga0207676_12189824 | 3300026095 | Bacteria | 551 |
| 983 | Ga0207674_10016607 | 3300026116 | Bacteria | 8049 |
| 984 | Ga0207674_10052247 | 3300026116 | Bacteria | 4168 |
| 985 | Ga0207674_10068105 | 3300026116 | Bacteria | 3582 |
| 986 | Ga0207674_10085677 | 3300026116 | Bacteria | 3145 |
| 987 | Ga0207674_10092133 | 3300026116 | Bacteria | 3021 |
| 988 | Ga0207674_10267945 | 3300026116 | Bacteria | 1655 |
| 989 | Ga0207674_10500098 | 3300026116 | Bacteria | 1174 |
| 990 | Ga0207674_10666325 | 3300026116 | Bacteria | 1005 |
| 991 | Ga0207674_11275789 | 3300026116 | Bacteria | 704 |
| 992 | Ga0207675_100069431 | 3300026118 | Bacteria | 3293 |
| 993 | Ga0207675_100075709 | 3300026118 | Bacteria | 3151 |
| 994 | Ga0207675_100275734 | 3300026118 | Bacteria | 1633 |
| 995 | Ga0207675_101389841 | 3300026118 | Bacteria | 723 |
| 996 | Ga0207675_101681455 | 3300026118 | Bacteria | 655 |
| 997 | Ga0207683_10151323 | 3300026121 | Bacteria | 2094 |
| 998 | Ga0207683_10152334 | 3300026121 | Bacteria | 2087 |
| 999 | Ga0207683_10279816 | 3300026121 | Bacteria | 1525 |
| 1000 | Ga0207683_10798177 | 3300026121 | Bacteria | 876 |
| 1001 | Ga0207698_10009875 | 3300026142 | Bacteria | 6103 |
| 1002 | Ga0207698_10016901 | 3300026142 | Bacteria | 4933 |
| 1003 | Ga0207698_10346841 | 3300026142 | Bacteria | 1401 |
| 1004 | Ga0207698_10549016 | 3300026142 | Bacteria | 1132 |
| 1005 | Ga0207698_11810344 | 3300026142 | Bacteria | 626 |
| 1006 | Ga0209983_1129971 | 3300027665 | Bacteria | 576 |
| 1007 | Ga0209588_1036300 | 3300027671 | Bacteria | 1586 |
| 1008 | Ga0207428_10031589 | 3300027907 | Bacteria | 4365 |
| 1009 | Ga0268266_10002958 | 3300028379 | Bacteria | 17520 |
| 1010 | Ga0268266_10021412 | 3300028379 | Bacteria | 5507 |
| 1011 | Ga0268266_10166783 | 3300028379 | Bacteria | 1996 |
| 1012 | Ga0268266_10424516 | 3300028379 | Bacteria | 1260 |
| 1013 | Ga0268265_10020775 | 3300028380 | Bacteria | 4589 |
| 1014 | Ga0268265_10271219 | 3300028380 | Bacteria | 1513 |
| 1015 | Ga0268265_10358419 | 3300028380 | Bacteria | 1334 |
| 1016 | Ga0268265_10490284 | 3300028380 | Bacteria | 1156 |
| 1017 | Ga0268265_10582846 | 3300028380 | Bacteria | 1066 |
| 1018 | Ga0268265_11075304 | 3300028380 | Bacteria | 798 |
| 1019 | Ga0268264_10001547 | 3300028381 | Bacteria | 21355 |
| 1020 | Ga0268264_10016109 | 3300028381 | Bacteria | 6125 |
| 1021 | Ga0268264_10207754 | 3300028381 | Bacteria | 1795 |
| 1022 | Ga0268264_10313321 | 3300028381 | Bacteria | 1481 |
| 1023 | Ga0268264_10369093 | 3300028381 | Bacteria | 1371 |
| 1024 | Ga0268264_10447531 | 3300028381 | Bacteria | 1251 |
| 1025 | Ga0268264_10669879 | 3300028381 | Bacteria | 1028 |
| 1026 | Ga0268264_12482945 | 3300028381 | Unclassified | 524 |
| 1027 | Ga0268264_12500210 | 3300028381 | Bacteria | 522 |
| 1028 | Ga0265334_10094599 | 3300028573 | Bacteria | 1087 |
| 1029 | Ga0265318_10011693 | 3300028577 | Bacteria | 3766 |
| 1030 | Ga0265338_10054342 | 3300028800 | Bacteria | 3573 |
| 1031 | Ga0265338_10206263 | 3300028800 | Bacteria | 1479 |
| 1032 | Ga0265338_10302524 | 3300028800 | Bacteria | 1162 |
| 1033 | Ga0265338_10692706 | 3300028800 | Bacteria | 704 |
| 1034 | Ga0265338_10889284 | 3300028800 | Bacteria | 607 |
| 1035 | Ga0265762_1106763 | 3300030760 | Bacteria | 627 |
| 1036 | Ga0265775_103369 | 3300030762 | Bacteria | 862 |
| 1037 | Ga0265760_10073850 | 3300031090 | Bacteria | 1049 |
| 1038 | Ga0265760_10172429 | 3300031090 | Bacteria | 719 |
| 1039 | Ga0265760_10228481 | 3300031090 | Bacteria | 637 |
| 1040 | Ga0265330_10250292 | 3300031235 | Bacteria | 747 |
| 1041 | Ga0265330_10251180 | 3300031235 | Bacteria | 745 |
| 1042 | Ga0265332_10310353 | 3300031238 | Bacteria | 651 |
| 1043 | Ga0265325_10027317 | 3300031241 | Bacteria | 3085 |
| 1044 | Ga0265325_10109103 | 3300031241 | Bacteria | 1347 |
| 1045 | Ga0265340_10040215 | 3300031247 | Bacteria | 2304 |
| 1046 | Ga0265331_10070798 | 3300031250 | Bacteria | 1632 |
| 1047 | Ga0265331_10089844 | 3300031250 | Bacteria | 1421 |
| 1048 | Ga0265331_10338182 | 3300031250 | Bacteria | 674 |
| 1049 | Ga0265331_10343667 | 3300031250 | Bacteria | 668 |
| 1050 | Ga0265331_10445723 | 3300031250 | Bacteria | 581 |
| 1051 | Ga0265327_10063515 | 3300031251 | Bacteria | 1875 |
| 1052 | Ga0265316_10001314 | 3300031344 | Bacteria | 26729 |
| 1053 | Ga0265316_10007548 | 3300031344 | Bacteria | 10232 |
| 1054 | Ga0265316_10033449 | 3300031344 | Bacteria | 4187 |
| 1055 | Ga0265316_10067016 | 3300031344 | Bacteria | 2776 |
| 1056 | Ga0265316_10101319 | 3300031344 | Bacteria | 2188 |
| 1057 | Ga0265316_10270427 | 3300031344 | Bacteria | 1244 |
| 1058 | Ga0265316_10293198 | 3300031344 | Bacteria | 1186 |
| 1059 | Ga0265316_10526766 | 3300031344 | Bacteria | 842 |
| 1060 | Ga0265316_10773848 | 3300031344 | Bacteria | 674 |
| 1061 | Ga0265316_10868165 | 3300031344 | Bacteria | 631 |
| 1062 | Ga0265316_11073145 | 3300031344 | Bacteria | 559 |
| 1063 | Ga0265316_11128060 | 3300031344 | Bacteria | 543 |
| 1064 | Ga0265313_10012996 | 3300031595 | Bacteria | 5034 |
| 1065 | Ga0316575_10060722 | 3300031665 | Unclassified | 1510 |
| 1066 | Ga0265314_10055511 | 3300031711 | Bacteria | 2733 |
| 1067 | Ga0265314_10066132 | 3300031711 | Bacteria | 2439 |
| 1068 | Ga0265314_10151872 | 3300031711 | Bacteria | 1419 |
| 1069 | Ga0265314_10255370 | 3300031711 | Bacteria | 1004 |
| 1070 | Ga0265342_10084206 | 3300031712 | Bacteria | 1832 |
| 1071 | Ga0316576_10060959 | 3300031727 | Bacteria | 2765 |
| 1072 | Ga0316576_10225395 | 3300031727 | Unclassified | 1410 |
| 1073 | Ga0316576_10275615 | 3300031727 | Bacteria | 1260 |
| 1074 | Ga0316576_10287570 | 3300031727 | Bacteria | 1230 |
| 1075 | Ga0316576_10438416 | 3300031727 | Bacteria | 966 |
| 1076 | Ga0316576_10485278 | 3300031727 | Unclassified | 910 |
| 1077 | Ga0316577_10024609 | 3300031733 | Bacteria | 3347 |
| 1078 | Ga0316577_10058177 | 3300031733 | Bacteria | 2158 |
| 1079 | Ga0316577_10193366 | 3300031733 | Bacteria | 1150 |
| 1080 | Ga0307413_10133435 | 3300031824 | Bacteria | 1703 |
| 1081 | Ga0307410_10000336 | 3300031852 | Bacteria | 18223 |
| 1082 | Ga0307411_10002603 | 3300032005 | Bacteria | 8060 |
| 1083 | Ga0316583_10049103 | 3300032133 | Bacteria | 1485 |
| 1084 | Ga0316593_10000031 | 3300032168 | Bacteria | 14752 |
| 1085 | Ga0316593_10000158 | 3300032168 | Bacteria | 9794 |
| 1086 | Ga0316593_10000278 | 3300032168 | Bacteria | 8597 |
| 1087 | Ga0316593_10000848 | 3300032168 | Bacteria | 6188 |
| 1088 | Ga0316593_10001195 | 3300032168 | Bacteria | 5565 |
| 1089 | Ga0316593_10002697 | 3300032168 | Bacteria | 4270 |
| 1090 | Ga0316593_10010835 | 3300032168 | Bacteria | 2630 |
| 1091 | Ga0316593_10011946 | 3300032168 | Bacteria | 2538 |
| 1092 | Ga0316593_10018705 | 3300032168 | Bacteria | 2133 |
| 1093 | Ga0316593_10041649 | 3300032168 | Bacteria | 1529 |
| 1094 | Ga0316593_10043616 | 3300032168 | Bacteria | 1499 |
| 1095 | Ga0316593_10055552 | 3300032168 | Bacteria | 1346 |
| 1096 | Ga0316593_10151760 | 3300032168 | Bacteria | 843 |
| 1097 | Ga0316593_10298255 | 3300032168 | Bacteria | 610 |
| 1098 | Ga0316592_1000536 | 3300033524 | Bacteria | 5367 |
| 1099 | Ga0316592_1002993 | 3300033524 | Unclassified | 2987 |
| 1100 | Ga0316592_1010913 | 3300033524 | Bacteria | 1838 |
| 1101 | Ga0316592_1033351 | 3300033524 | Unclassified | 1125 |
| 1102 | Ga0316592_1069834 | 3300033524 | Bacteria | 794 |
| 1103 | Ga0316592_1141118 | 3300033524 | Bacteria | 565 |
| 1104 | Ga0316588_1015198 | 3300033528 | Unclassified | 1693 |
| 1105 | Ga0316588_1080796 | 3300033528 | Bacteria | 805 |
| 1106 | Ga0316588_1089361 | 3300033528 | Bacteria | 767 |
| 1107 | Ga0316587_1010208 | 3300033529 | Bacteria | 1500 |
| 1108 | Ga0316596_1000058 | 3300033541 | Bacteria | 12401 |
| 1109 | Ga0316596_1000988 | 3300033541 | Bacteria | 5465 |
| 1110 | Ga0316596_1001007 | 3300033541 | Bacteria | 5422 |
| 1111 | Ga0316596_1001016 | 3300033541 | Bacteria | 5403 |
| 1112 | Ga0316596_1001482 | 3300033541 | Bacteria | 4755 |
| 1113 | Ga0316596_1009369 | 3300033541 | Bacteria | 2349 |
| 1114 | Ga0316596_1014849 | 3300033541 | Bacteria | 1936 |
| 1115 | Ga0316596_1019395 | 3300033541 | Bacteria | 1725 |
| 1116 | Ga0316596_1023719 | 3300033541 | Bacteria | 1573 |
| 1117 | Ga0316596_1040060 | 3300033541 | Unclassified | 1230 |
| 1118 | Ga0316596_1042813 | 3300033541 | Bacteria | 1192 |
| 1119 | Ga0316596_1043728 | 3300033541 | Bacteria | 1179 |
| 1120 | Ga0316596_1056788 | 3300033541 | Bacteria | 1041 |
| 1121 | Ga0316596_1063628 | 3300033541 | Unclassified | 985 |
| 1122 | Ga0316596_1162060 | 3300033541 | Unclassified | 616 |
| 1123 | Ga0316596_1178262 | 3300033541 | Bacteria | 588 |
| 1124 | Ga0373930_0011058 | 3300034816 | Bacteria | 1624 |
| 1125 | Ga0373959_0021787 | 3300034820 | Bacteria | 1233 |
| 1126 | Ga0373926_0006956 | 3300035083 | Bacteria | 3761 |
| 1127 | Ga0373926_0348587 | 3300035083 | Bacteria | 581 |
| 1128 | Ga0373928_0013532 | 3300035084 | Bacteria | 1639 |
| 1129 | Ga0373928_0150792 | 3300035084 | Bacteria | 643 |
| 1130 | Ga0373929_0077800 | 3300035085 | Bacteria | 804 |
| 1131 | Ga0373934_0021690 | 3300035086 | Bacteria | 2475 |
| 1132 | Ga0373934_0045842 | 3300035086 | Bacteria | 1729 |
| 1133 | Ga0373940_0202122 | 3300035088 | Bacteria | 653 |
| 1134 | Ga0373944_0143572 | 3300035089 | Bacteria | 837 |
| 1135 | Ga0373951_0005949 | 3300035091 | Bacteria | 2813 |
| 1136 | Ga0373923_0380102 | 3300035111 | Bacteria | 677 |
| 1137 | Ga0373932_0113268 | 3300035112 | Bacteria | 896 |
| 1138 | Ga0373936_0100591 | 3300035113 | Bacteria | 1220 |
| 1139 | Ga0373936_0472085 | 3300035113 | Bacteria | 582 |
| 1140 | Ga0373939_0428529 | 3300035114 | Bacteria | 553 |
| 1141 | Ga0373941_0407221 | 3300035115 | Bacteria | 564 |
| 1142 | Ga0373945_0153546 | 3300035116 | Bacteria | 934 |
| 1143 | Ga0373953_0186434 | 3300035117 | Bacteria | 896 |
| 1144 | Ga0373953_0249603 | 3300035117 | Bacteria | 771 |
| 1145 | Ga0373954_0064249 | 3300035118 | Bacteria | 1735 |
| 1146 | Ga0373954_0137445 | 3300035118 | Bacteria | 1191 |
| 1147 | Ga0373954_0339067 | 3300035118 | Bacteria | 742 |
| 1148 | Ga0373956_0123334 | 3300035119 | Bacteria | 1211 |
| 1149 | Ga0373957_0094581 | 3300035120 | Bacteria | 1191 |
| 1150 | Ga0373957_0468153 | 3300035120 | Bacteria | 547 |
| 1151 | Ga0373960_0003527 | 3300035121 | Bacteria | 3546 |
| 1152 | Ga0373943_0006464 | 3300035170 | Bacteria | 5264 |
| 1153 | Ga0373943_0366742 | 3300035170 | Bacteria | 827 |
| 1154 | Ga0373943_0572436 | 3300035170 | Bacteria | 664 |
| 1155 | Ga0373946_0071032 | 3300035171 | Bacteria | 1504 |
| 1156 | Ga0373946_0233713 | 3300035171 | Bacteria | 892 |
| 1157 | Ga0373946_0318424 | 3300035171 | Bacteria | 772 |
| 1158 | Ga0373946_0418822 | 3300035171 | Unclassified | 678 |
| 1159 | Ga0373955_0023160 | 3300035172 | Bacteria | 3160 |
| 1160 | Ga0373955_0120824 | 3300035172 | Bacteria | 1523 |
| 1161 | Ga0373955_0263653 | 3300035172 | Bacteria | 1035 |
| 1162 | Ga0373942_0070132 | 3300035207 | Bacteria | 1022 |
| 1163 | Ga0316574_0027877 | 3300035398 | Bacteria | 3403 |
| 1164 | Ga0316574_0047264 | 3300035398 | Bacteria | 2671 |
| 1165 | Ga0316574_0374240 | 3300035398 | Unclassified | 899 |
| 1166 | Ga0316574_0417157 | 3300035398 | Bacteria | 844 |
| 1167 | Ga0316574_0659110 | 3300035398 | Bacteria | 644 |
| 1168 | Ga0316574_0751348 | 3300035398 | Bacteria | 596 |
| 1169 | Ga0373931_0860368 | 3300035691 | Bacteria | 607 |
| 1170 | Ga0373935_0029628 | 3300035692 | Bacteria | 3388 |
| 1171 | Ga0373935_0064571 | 3300035692 | Bacteria | 2348 |
| 1172 | Ga0373935_0362104 | 3300035692 | Bacteria | 1036 |
| 1173 | Ga0373927_0001719 | 3300035695 | Bacteria | 16366 |
| 1174 | Ga0373927_0033099 | 3300035695 | Bacteria | 3365 |
| 1175 | Ga0373927_0778051 | 3300035695 | Bacteria | 632 |
| 1176 | Ga0373933_0197266 | 3300035724 | Bacteria | 1287 |
| 1177 | Ga0373933_0766130 | 3300035724 | Bacteria | 635 |
| 1178 | Ga0373933_1185337 | 3300035724 | Bacteria | 503 |
| 1179 | Ga0373947_0003896 | 3300035725 | Bacteria | 8774 |
| 1180 | Ga0373947_0016431 | 3300035725 | Bacteria | 4253 |
| 1181 | Ga0373947_0161506 | 3300035725 | Bacteria | 1449 |
| 1182 | Ga0373947_0527159 | 3300035725 | Bacteria | 803 |
| 1183 | Ga0373947_0695562 | 3300035725 | Bacteria | 694 |
| 1184 | Ga0373937_0028911 | 3300036401 | Bacteria | 5019 |
| 1185 | Ga0373937_0198764 | 3300036401 | Bacteria | 1884 |
| 1186 | Ga0373937_0328502 | 3300036401 | Bacteria | 1447 |
| 1187 | Ga0373937_0426859 | 3300036401 | Bacteria | 1258 |
| 1188 | Ga0373937_0625822 | 3300036401 | Bacteria | 1021 |
| 1189 | Ga0373937_1069058 | 3300036401 | Bacteria | 756 |
| 1190 | Ga0265778_011924 | 3300036457 | Bacteria | 1006 |
| 1191 | Ga0316582_0042688 | 3300036647 | Unclassified | 2842 |
| 1192 | Ga0316582_0087611 | 3300036647 | Bacteria | 2044 |
| 1193 | Ga0316582_0117881 | 3300036647 | Bacteria | 1774 |
| 1194 | Ga0316582_0419163 | 3300036647 | Bacteria | 922 |
| 1195 | Ga0316582_0526217 | 3300036647 | Unclassified | 815 |
| 1196 | Ga0316582_0663414 | 3300036647 | Bacteria | 717 |
| 1197 | Ga0316582_0791537 | 3300036647 | Bacteria | 650 |
| 1198 | Ga0316582_1117031 | 3300036647 | Bacteria | 537 |
| 1199 | Ga0316584_0124461 | 3300036712 | Bacteria | 1926 |
| 1200 | Ga0316584_0312843 | 3300036712 | Unclassified | 1135 |
| 1201 | Ga0316584_0364668 | 3300036712 | Bacteria | 1035 |
| 1202 | Ga0316584_0868728 | 3300036712 | Bacteria | 609 |
| 1203 | Ga0373925_0009542 | 3300037068 | Bacteria | 7067 |
| 1204 | Ga0373925_0016284 | 3300037068 | Bacteria | 5382 |
| 1205 | Ga0373925_0031340 | 3300037068 | Bacteria | 3906 |
| 1206 | Ga0373925_0105223 | 3300037068 | Bacteria | 2174 |
| 1207 | Ga0373925_0167391 | 3300037068 | Bacteria | 1734 |
| 1208 | Ga0373925_0187798 | 3300037068 | Bacteria | 1639 |
| 1209 | Ga0373925_0197899 | 3300037068 | Bacteria | 1597 |
| 1210 | Ga0373925_0436539 | 3300037068 | Bacteria | 1071 |
| 1211 | Ga0373925_0703435 | 3300037068 | Bacteria | 833 |
| 1212 | Ga0373925_0849683 | 3300037068 | Bacteria | 752 |
| 1213 | Ga0373925_0920895 | 3300037068 | Bacteria | 720 |
| 1214 | Ga0395900_1929699 | 3300037418 | Bacteria | 501 |
| 1215 | Ga0316581_0042275 | 3300037588 | Bacteria | 1391 |
| 1216 | Ga0436364_0656271 | 3300037853 | Bacteria | 878 |
| 1217 | Ga0436364_1088472 | 3300037853 | Bacteria | 1916 |
| 1218 | Ga0436364_1149820 | 3300037853 | Bacteria | 1959 |
| 1219 | Ga0400484_03429 | 3300038725 | Bacteria | 9202 |
| 1220 | Ga0400484_18778 | 3300038725 | Bacteria | 13718 |
| 1221 | Ga0400490_18584 | 3300038726 | Bacteria | 1761 |
| 1222 | Ga0400490_18978 | 3300038726 | Bacteria | 41932 |
| 1223 | Ga0400490_28208 | 3300038726 | Bacteria | 2092 |
| 1224 | Ga0400491_17104 | 3300038727 | Bacteria | 2177 |
| 1225 | Ga0400485_05635 | 3300038735 | Bacteria | 4210 |
| 1226 | Ga0400485_13399 | 3300038735 | Bacteria | 1576 |
| 1227 | Ga0400485_14867 | 3300038735 | Bacteria | 7745 |
| 1228 | Ga0400488_07617 | 3300038741 | Bacteria | 1900 |
| 1229 | Ga0400488_38202 | 3300038741 | Bacteria | 3358 |
| 1230 | Ga0400488_59906 | 3300038741 | Bacteria | 7640 |
| 1231 | Ga0400488_60637 | 3300038741 | Bacteria | 3082 |
| 1232 | Ga0400486_19544 | 3300038742 | Bacteria | 14376 |
| 1233 | Ga0400486_22210 | 3300038742 | Bacteria | 14238 |
| 1234 | Ga0400486_30281 | 3300038742 | Bacteria | 14022 |
| 1235 | Ga0400483_070291 | 3300039062 | Bacteria | 1587 |
| 1236 | Ga0400483_083434 | 3300039062 | Bacteria | 1501 |
| 1237 | Ga0400483_084767 | 3300039062 | Bacteria | 6332 |
| 1238 | Ga0400483_120099 | 3300039062 | Bacteria | 48943 |
| 1239 | Ga0400483_154386 | 3300039062 | Bacteria | 1051 |
| 1240 | Ga0400483_216594 | 3300039062 | Bacteria | 3541 |
| 1241 | Ga0400483_257333 | 3300039062 | Bacteria | 11342 |
| 1242 | Ga0400483_261234 | 3300039062 | Bacteria | 14568 |
| 1243 | Ga0400489_53490 | 3300039093 | Bacteria | 12707 |
| 1244 | Ga0400489_55784 | 3300039093 | Bacteria | 1480 |
| 1245 | Ga0400489_74110 | 3300039093 | Bacteria | 1903 |
| 1246 | Ga0400489_74550 | 3300039093 | Bacteria | 6193 |
| 1247 | Ga0400487_41192 | 3300039110 | Bacteria | 13896 |
| 1248 | Ga0436365_0931713 | 3300039437 | Bacteria | 1342 |
| 1249 | Ga0436360_0560131 | 3300039438 | Bacteria | 797 |
| 1250 | Ga0436360_1059506 | 3300039438 | Bacteria | 723 |
| 1251 | Ga0436361_0600685 | 3300039447 | Bacteria | 763 |
| 1252 | Ga0436363_0310931 | 3300039450 | Bacteria | 818 |
| 1253 | Ga0436363_1010169 | 3300039450 | Bacteria | 2247 |
| 1254 | Ga0436363_1537811 | 3300039450 | Bacteria | 715 |
| 1255 | Ga0436362_0350632 | 3300039453 | Bacteria | 1868 |
| 1256 | Ga0436362_0757945 | 3300039453 | Bacteria | 519 |
| 1257 | Ga0436362_1011805 | 3300039453 | Bacteria | 538 |
| 1258 | Ga0436362_1230516 | 3300039453 | Bacteria | 733 |
| 1259 | Ga0451795_1024431 | 3300041456 | Bacteria | 1394 |
| 1260 | Ga0451795_1037796 | 3300041456 | Bacteria | 871 |
| 1261 | Ga0451807_2678434 | 3300041486 | Bacteria | 1017 |
| 1262 | Ga0451835_0294879 | 3300041492 | Unclassified | 718 |
| 1263 | Ga0451837_1262203 | 3300041494 | Bacteria | 671 |
| 1264 | Ga0451852_14943 | 3300041508 | Bacteria | 842 |
| 1265 | Ga0451852_32296 | 3300041508 | Bacteria | 835 |
| 1266 | Ga0451855_1247256 | 3300041511 | Bacteria | 601 |
| 1267 | Ga0439441_023690 | 3300042001 | Bacteria | 1148 |
| 1268 | Ga0439441_092726 | 3300042001 | Bacteria | 669 |
| 1269 | Ga0439448_0049076 | 3300042005 | Bacteria | 1379 |
| 1270 | Ga0450914_000417 | 3300042118 | Bacteria | 1955 |
| 1271 | Ga0439444_0139755 | 3300042437 | Bacteria | 578 |
| 1272 | Ga0450893_0064797 | 3300042532 | Bacteria | 703 |
| 1273 | Ga0451577_0003967 | 3300042876 | Bacteria | 15959 |
| 1274 | Ga0451577_0020405 | 3300042876 | Bacteria | 6082 |
| 1275 | Ga0451577_0028183 | 3300042876 | Bacteria | 5081 |
| 1276 | Ga0451577_0028471 | 3300042876 | Bacteria | 5053 |
| 1277 | Ga0451577_0099005 | 3300042876 | Bacteria | 2604 |
| 1278 | Ga0451577_0125417 | 3300042876 | Bacteria | 2301 |
| 1279 | Ga0451577_0173135 | 3300042876 | Bacteria | 1945 |
| 1280 | Ga0451577_0210923 | 3300042876 | Bacteria | 1754 |
| 1281 | Ga0451577_0258096 | 3300042876 | Bacteria | 1578 |
| 1282 | Ga0451577_0933670 | 3300042876 | Bacteria | 781 |
| 1283 | Ga0453683_0000002 | 3300044673 | Bacteria | 1244396 |
| 1284 | Ga0453683_0000075 | 3300044673 | Bacteria | 150395 |
| 1285 | Ga0453683_0002122 | 3300044673 | Bacteria | 15802 |
| 1286 | Ga0453683_0002232 | 3300044673 | Bacteria | 15321 |
| 1287 | Ga0453683_0004112 | 3300044673 | Bacteria | 10455 |
| 1288 | Ga0453683_0004693 | 3300044673 | Bacteria | 9642 |
| 1289 | Ga0453683_0006996 | 3300044673 | Bacteria | 7690 |
| 1290 | Ga0453683_0040252 | 3300044673 | Bacteria | 2935 |
| 1291 | Ga0453683_0138466 | 3300044673 | Bacteria | 1535 |
| 1292 | Ga0453683_0202278 | 3300044673 | Bacteria | 1261 |
| 1293 | Ga0453683_0207795 | 3300044673 | Bacteria | 1243 |
| 1294 | Ga0453683_0228629 | 3300044673 | Bacteria | 1184 |
| 1295 | Ga0453683_0239083 | 3300044673 | Bacteria | 1156 |
| 1296 | Ga0453683_0429302 | 3300044673 | Bacteria | 853 |
| 1297 | Ga0453683_0443324 | 3300044673 | Bacteria | 839 |
| 1298 | Ga0453684_0001225 | 3300044712 | Bacteria | 78748 |
| 1299 | Ga0453684_0005920 | 3300044712 | Bacteria | 23717 |
| 1300 | Ga0453684_0010338 | 3300044712 | Bacteria | 15977 |
| 1301 | Ga0453684_0011463 | 3300044712 | Bacteria | 14855 |
| 1302 | Ga0453684_0012653 | 3300044712 | Bacteria | 13869 |
| 1303 | Ga0453684_0013713 | 3300044712 | Bacteria | 13122 |
| 1304 | Ga0453684_0014912 | 3300044712 | Bacteria | 12358 |
| 1305 | Ga0453684_0025712 | 3300044712 | Bacteria | 8536 |
| 1306 | Ga0453684_0028706 | 3300044712 | Bacteria | 7924 |
| 1307 | Ga0453684_0029890 | 3300044712 | Bacteria | 7717 |
| 1308 | Ga0453684_0035204 | 3300044712 | Bacteria | 6926 |
| 1309 | Ga0453684_0035213 | 3300044712 | Bacteria | 6925 |
| 1310 | Ga0453684_0148240 | 3300044712 | Bacteria | 2792 |
| 1311 | Ga0453684_0221982 | 3300044712 | Bacteria | 2188 |
| 1312 | Ga0453684_0271517 | 3300044712 | Bacteria | 1938 |
| 1313 | Ga0453684_0296692 | 3300044712 | Bacteria | 1838 |
| 1314 | Ga0453684_0392328 | 3300044712 | Bacteria | 1556 |
| 1315 | Ga0453684_0427169 | 3300044712 | Bacteria | 1479 |
| 1316 | Ga0453684_0762724 | 3300044712 | Bacteria | 1046 |
| 1317 | Ga0453684_0769817 | 3300044712 | Bacteria | 1040 |
| 1318 | Ga0453684_2168520 | 3300044712 | Bacteria | 556 |
| 1319 | Ga0466971_0342723 | 3300044719 | Bacteria | 722 |
| 1320 | Ga0466957_0505455 | 3300044842 | Bacteria | 838 |
| 1321 | Ga0466959_0475082 | 3300045049 | Bacteria | 846 |
| 1322 | Ga0451576_0001727 | 3300045051 | Bacteria | 35974 |
| 1323 | Ga0451576_0004781 | 3300045051 | Bacteria | 17359 |
| 1324 | Ga0451576_0005241 | 3300045051 | Bacteria | 16364 |
| 1325 | Ga0451576_0022705 | 3300045051 | Bacteria | 6797 |
| 1326 | Ga0451576_0032803 | 3300045051 | Bacteria | 5523 |
| 1327 | Ga0451576_0036131 | 3300045051 | Bacteria | 5239 |
| 1328 | Ga0451576_0138590 | 3300045051 | Bacteria | 2538 |
| 1329 | Ga0451576_0222858 | 3300045051 | Bacteria | 1969 |
| 1330 | Ga0451576_0255239 | 3300045051 | Bacteria | 1832 |
| 1331 | Ga0451576_0256198 | 3300045051 | Bacteria | 1829 |
| 1332 | Ga0451576_0273269 | 3300045051 | Bacteria | 1767 |
| 1333 | Ga0451576_0309752 | 3300045051 | Bacteria | 1652 |
| 1334 | Ga0451576_0333268 | 3300045051 | Bacteria | 1588 |
| 1335 | Ga0451576_0370125 | 3300045051 | Bacteria | 1501 |
| 1336 | Ga0451576_0396796 | 3300045051 | Bacteria | 1446 |
| 1337 | Ga0451576_0599502 | 3300045051 | Bacteria | 1158 |
| 1338 | Ga0451576_0641954 | 3300045051 | Unclassified | 1115 |
| 1339 | Ga0451576_0678999 | 3300045051 | Bacteria | 1082 |
| 1340 | Ga0451576_0901347 | 3300045051 | Bacteria | 928 |
| 1341 | Ga0451576_1147915 | 3300045051 | Bacteria | 812 |
| 1342 | Ga0451576_1263593 | 3300045051 | Unclassified | 770 |
| 1343 | Ga0451576_1321500 | 3300045051 | Bacteria | 751 |
| 1344 | Ga0451576_1409929 | 3300045051 | Bacteria | 725 |
| 1345 | Ga0451576_1747275 | 3300045051 | Bacteria | 644 |
| 1346 | Ga0451576_2141729 | 3300045051 | Bacteria | 575 |
| 1347 | Ga0466958_0042921 | 3300045836 | Bacteria | 2723 |
| 1348 | Ga0466967_0178061 | 3300045976 | Bacteria | 2004 |
| 1349 | Ga0466967_0606929 | 3300045976 | Bacteria | 1080 |
| 1350 | Ga0466967_1425483 | 3300045976 | Bacteria | 690 |
| 1351 | Ga0495592_0023757 | 3300046454 | Bacteria | 4663 |
| 1352 | Ga0495592_0187843 | 3300046454 | Bacteria | 1402 |
| 1353 | Ga0495603_0217457 | 3300046455 | Bacteria | 1103 |
| 1354 | Ga0495651_0027888 | 3300046462 | Bacteria | 4401 |
| 1355 | Ga0495651_0048591 | 3300046462 | Bacteria | 3277 |
| 1356 | Ga0495653_0475312 | 3300046463 | Bacteria | 782 |
| 1357 | Ga0495580_0012363 | 3300046472 | Bacteria | 6549 |
| 1358 | Ga0495580_0023177 | 3300046472 | Bacteria | 4562 |
| 1359 | Ga0495580_0023989 | 3300046472 | Bacteria | 4471 |
| 1360 | Ga0495580_0029617 | 3300046472 | Bacteria | 3972 |
| 1361 | Ga0495580_0030495 | 3300046472 | Bacteria | 3904 |
| 1362 | Ga0495580_0088205 | 3300046472 | Bacteria | 2160 |
| 1363 | Ga0495580_0127171 | 3300046472 | Bacteria | 1769 |
| 1364 | Ga0495580_0178602 | 3300046472 | Bacteria | 1466 |
| 1365 | Ga0495580_0293569 | 3300046472 | Bacteria | 1108 |
| 1366 | Ga0495580_0317224 | 3300046472 | Bacteria | 1059 |
| 1367 | Ga0495580_0388283 | 3300046472 | Bacteria | 942 |
| 1368 | Ga0495580_0929845 | 3300046472 | Bacteria | 557 |
| 1369 | Ga0495582_0022430 | 3300046473 | Bacteria | 3455 |
| 1370 | Ga0495582_0918982 | 3300046473 | Bacteria | 506 |
| 1371 | Ga0495605_0085624 | 3300046474 | Bacteria | 1467 |
| 1372 | Ga0495639_0230055 | 3300046475 | Bacteria | 913 |
| 1373 | Ga0495662_0043206 | 3300046476 | Bacteria | 2175 |
| 1374 | Ga0495662_0151718 | 3300046476 | Bacteria | 1141 |
| 1375 | Ga0495662_0289647 | 3300046476 | Bacteria | 806 |
| 1376 | Ga0495664_0024694 | 3300046477 | Bacteria | 3494 |
| 1377 | Ga0495664_0453920 | 3300046477 | Bacteria | 767 |
| 1378 | Ga0495584_0110433 | 3300046491 | Bacteria | 1391 |
| 1379 | Ga0495594_0308925 | 3300046499 | Bacteria | 901 |
| 1380 | Ga0495608_0077894 | 3300046511 | Bacteria | 2158 |
| 1381 | Ga0495608_0284462 | 3300046511 | Bacteria | 1026 |
| 1382 | Ga0495618_0169570 | 3300046514 | Bacteria | 1389 |
| 1383 | Ga0495628_0010572 | 3300046516 | Bacteria | 7832 |
| 1384 | Ga0495628_0583777 | 3300046516 | Bacteria | 800 |
| 1385 | Ga0495628_0688411 | 3300046516 | Bacteria | 723 |
| 1386 | Ga0495628_0934713 | 3300046516 | Bacteria | 600 |
| 1387 | Ga0495630_0094544 | 3300046517 | Bacteria | 2259 |
| 1388 | Ga0495630_0610875 | 3300046517 | Bacteria | 836 |
| 1389 | Ga0495666_0264501 | 3300046526 | Bacteria | 782 |
| 1390 | Ga0495642_0183506 | 3300046528 | Bacteria | 911 |
| 1391 | Ga0495652_0096288 | 3300046529 | Bacteria | 2411 |
| 1392 | Ga0495652_0139956 | 3300046529 | Bacteria | 1904 |
| 1393 | Ga0495652_0284319 | 3300046529 | Bacteria | 1210 |
| 1394 | Ga0495652_0394223 | 3300046529 | Bacteria | 982 |
| 1395 | Ga0495652_0529066 | 3300046529 | Bacteria | 813 |
| 1396 | Ga0495652_0532377 | 3300046529 | Bacteria | 810 |
| 1397 | Ga0495654_0152044 | 3300046530 | Bacteria | 1023 |
| 1398 | Ga0495665_0009280 | 3300046531 | Bacteria | 5330 |
| 1399 | Ga0495665_0085461 | 3300046531 | Bacteria | 1658 |
| 1400 | Ga0495665_0107457 | 3300046531 | Bacteria | 1464 |
| 1401 | Ga0495665_0316982 | 3300046531 | Bacteria | 797 |
| 1402 | Ga0495640_0121071 | 3300046533 | Bacteria | 1701 |
| 1403 | Ga0495640_0363549 | 3300046533 | Bacteria | 892 |
| 1404 | Ga0495640_0963270 | 3300046533 | Bacteria | 504 |
| 1405 | Ga0495587_0000336 | 3300046536 | Bacteria | 33530 |
| 1406 | Ga0495587_0034621 | 3300046536 | Bacteria | 3045 |
| 1407 | Ga0495587_0614109 | 3300046536 | Bacteria | 598 |
| 1408 | Ga0495645_0007171 | 3300046543 | Bacteria | 7757 |
| 1409 | Ga0495645_0149505 | 3300046543 | Bacteria | 1624 |
| 1410 | Ga0495645_0188652 | 3300046543 | Bacteria | 1407 |
| 1411 | Ga0495645_0351093 | 3300046543 | Bacteria | 950 |
| 1412 | Ga0495667_0025931 | 3300046559 | Bacteria | 3948 |
| 1413 | Ga0495667_0213520 | 3300046559 | Bacteria | 1233 |
| 1414 | Ga0495667_0649029 | 3300046559 | Bacteria | 656 |
| 1415 | Ga0495634_0068987 | 3300046642 | Bacteria | 2334 |
| 1416 | Ga0495634_0407941 | 3300046642 | Bacteria | 806 |
| 1417 | Ga0495635_0026942 | 3300046663 | Bacteria | 3998 |
| 1418 | Ga0495635_0624136 | 3300046663 | Bacteria | 703 |
| 1419 | Ga0495599_0019509 | 3300046678 | Bacteria | 4226 |
| 1420 | Ga0495599_0033693 | 3300046678 | Bacteria | 3219 |
| 1421 | Ga0495599_0180759 | 3300046678 | Bacteria | 1300 |
| 1422 | Ga0495599_0371939 | 3300046678 | Bacteria | 854 |
| 1423 | Ga0495623_0027406 | 3300046679 | Bacteria | 3666 |
| 1424 | Ga0495623_0086938 | 3300046679 | Bacteria | 1926 |
| 1425 | Ga0495623_0111431 | 3300046679 | Bacteria | 1658 |
| 1426 | Ga0495623_0244224 | 3300046679 | Bacteria | 1013 |
| 1427 | Ga0495646_0080108 | 3300046680 | Bacteria | 1905 |
| 1428 | Ga0495658_0016731 | 3300046683 | Bacteria | 3777 |
| 1429 | Ga0495658_0413110 | 3300046683 | Bacteria | 861 |
| 1430 | Ga0495658_0908389 | 3300046683 | Bacteria | 563 |
| 1431 | Ga0495669_0138369 | 3300046684 | Bacteria | 1149 |
| 1432 | Ga0495613_0585565 | 3300046689 | Bacteria | 743 |
| 1433 | Ga0495624_0337596 | 3300046690 | Bacteria | 907 |
| 1434 | Ga0495649_0461488 | 3300046694 | Bacteria | 634 |
| 1435 | Ga0495600_0013166 | 3300046809 | Bacteria | 5190 |
| 1436 | Ga0495581_0376593 | 3300047315 | Bacteria | 828 |
| 1437 | Ga0495604_0088514 | 3300047317 | Bacteria | 2303 |
| 1438 | Ga0495604_0412952 | 3300047317 | Bacteria | 887 |
| 1439 | Ga0495604_0495478 | 3300047317 | Bacteria | 793 |
| 1440 | Ga0495636_0120637 | 3300047318 | Bacteria | 1160 |
| 1441 | Ga0495674_0008368 | 3300047319 | Bacteria | 9858 |
| 1442 | Ga0495674_0021292 | 3300047319 | Bacteria | 5998 |
| 1443 | Ga0495674_0277501 | 3300047319 | Bacteria | 1374 |
| 1444 | Ga0495674_0593101 | 3300047319 | Bacteria | 878 |
| 1445 | Ga0495674_0753754 | 3300047319 | Bacteria | 760 |
| 1446 | Ga0495674_1027410 | 3300047319 | Bacteria | 630 |
| 1447 | Ga0495680_0009543 | 3300047322 | Bacteria | 8719 |
| 1448 | Ga0495680_0172767 | 3300047322 | Bacteria | 1564 |
| 1449 | Ga0495680_0273497 | 3300047322 | Bacteria | 1192 |
| 1450 | Ga0495675_0270691 | 3300047444 | Bacteria | 1015 |
| 1451 | Ga0495675_0722514 | 3300047444 | Bacteria | 556 |
| 1452 | Ga0495684_0059377 | 3300047471 | Bacteria | 2913 |
| 1453 | Ga0495684_0061272 | 3300047471 | Bacteria | 2862 |
| 1454 | Ga0495684_0193971 | 3300047471 | Bacteria | 1500 |
| 1455 | Ga0495684_0648584 | 3300047471 | Bacteria | 706 |
| 1456 | Ga0495593_0408973 | 3300047673 | Bacteria | 679 |
| 1457 | Ga0495602_0002172 | 3300048088 | Bacteria | 19797 |
| 1458 | Ga0495602_0086900 | 3300048088 | Bacteria | 2609 |
| 1459 | Ga0495602_0376090 | 3300048088 | Bacteria | 1019 |
| 1460 | Ga0495602_0614631 | 3300048088 | Bacteria | 746 |
| 1461 | Ga0495602_0661740 | 3300048088 | Bacteria | 712 |
| 1462 | Ga0495602_1008010 | 3300048088 | Bacteria | 549 |
| 1463 | Ga0496101_1610231 | 3300048904 | Bacteria | 504 |
| 1464 | Ga0496102_0191714 | 3300048905 | Bacteria | 1926 |
| 1465 | Ga0496104_0445908 | 3300048907 | Bacteria | 1206 |
| 1466 | Ga0496104_0626248 | 3300048907 | Bacteria | 985 |
| 1467 | Ga0496104_0668185 | 3300048907 | Bacteria | 947 |
| 1468 | Ga0496104_0971048 | 3300048907 | Bacteria | 754 |
| 1469 | Ga0496104_1349134 | 3300048907 | Bacteria | 616 |
| 1470 | Ga0496106_0301046 | 3300048909 | Bacteria | 1286 |
| 1471 | Ga0496106_0557531 | 3300048909 | Bacteria | 919 |
| 1472 | Ga0496107_0126937 | 3300048910 | Bacteria | 1882 |
| 1473 | Ga0496107_0651161 | 3300048910 | Bacteria | 777 |
| 1474 | Ga0496109_0594315 | 3300048912 | Bacteria | 1043 |
| 1475 | Ga0496110_0103426 | 3300048913 | Bacteria | 2555 |
| 1476 | Ga0496112_0501711 | 3300048915 | Bacteria | 1149 |
| 1477 | Ga0496112_0884512 | 3300048915 | Bacteria | 816 |
| 1478 | Ga0496114_0021928 | 3300048917 | Bacteria | 5200 |
| 1479 | Ga0496115_0134495 | 3300048918 | Bacteria | 2039 |
| 1480 | Ga0496115_0152875 | 3300048918 | Bacteria | 1906 |
| 1481 | Ga0496115_0501758 | 3300048918 | Bacteria | 975 |
| 1482 | Ga0496115_0741324 | 3300048918 | Bacteria | 769 |
| 1483 | Ga0496115_0773764 | 3300048918 | Bacteria | 749 |
| 1484 | Ga0501031_0024798 | 3300049568 | Bacteria | 3910 |
| 1485 | Ga0501032_0032955 | 3300049569 | Bacteria | 3550 |
| 1486 | Ga0501033_0057175 | 3300049570 | Bacteria | 2883 |
| 1487 | Ga0501034_0164665 | 3300049571 | Bacteria | 2186 |
| 1488 | Ga0501036_0000271 | 3300049572 | Bacteria | 35394 |
| 1489 | Ga0501036_0212525 | 3300049572 | Bacteria | 1625 |
| 1490 | Ga0501037_0113122 | 3300049573 | Bacteria | 1954 |
| 1491 | Ga0501038_0041377 | 3300049574 | Bacteria | 4018 |
| 1492 | Ga0501039_0001023 | 3300049575 | Bacteria | 20395 |
| 1493 | Ga0501039_0163818 | 3300049575 | Bacteria | 1748 |
| 1494 | Ga0501039_1014729 | 3300049575 | Bacteria | 644 |
| 1495 | Ga0501040_0081789 | 3300049576 | Bacteria | 2238 |
| 1496 | Ga0501040_0208399 | 3300049576 | Bacteria | 1389 |
| 1497 | Ga0501041_0096339 | 3300049577 | Bacteria | 1829 |
| 1498 | Ga0501042_1096008 | 3300049578 | Bacteria | 580 |
| 1499 | Ga0501043_0045931 | 3300049579 | Bacteria | 3434 |
| 1500 | Ga0501043_0108308 | 3300049579 | Bacteria | 2182 |
| 1501 | Ga0501046_0001715 | 3300049580 | Bacteria | 20916 |
| 1502 | Ga0501046_0220371 | 3300049580 | Bacteria | 1405 |
| 1503 | Ga0501046_0523886 | 3300049580 | Bacteria | 847 |
| 1504 | Ga0501047_0078052 | 3300049581 | Bacteria | 3185 |
| 1505 | Ga0501047_0165397 | 3300049581 | Bacteria | 2082 |
| 1506 | Ga0501048_0002444 | 3300049582 | Bacteria | 14178 |
| 1507 | Ga0501067_0008591 | 3300049583 | Bacteria | 5661 |
| 1508 | Ga0501068_0011651 | 3300049584 | Bacteria | 4968 |
| 1509 | Ga0501069_0033574 | 3300049585 | Bacteria | 2826 |
| 1510 | Ga0501070_0459034 | 3300049586 | Bacteria | 1026 |
| 1511 | Ga0501072_0029641 | 3300049588 | Bacteria | 4275 |
| 1512 | Ga0501072_0508033 | 3300049588 | Bacteria | 953 |
| 1513 | Ga0501073_0022059 | 3300049589 | Bacteria | 4588 |
| 1514 | Ga0501074_0071146 | 3300049590 | Bacteria | 2500 |
| 1515 | Ga0501074_0098746 | 3300049590 | Bacteria | 2090 |
| 1516 | Ga0501075_0042844 | 3300049591 | Bacteria | 3394 |
| 1517 | Ga0501075_0753470 | 3300049591 | Bacteria | 741 |
| 1518 | Ga0501075_0894116 | 3300049591 | Bacteria | 675 |
| 1519 | Ga0501076_0001624 | 3300049592 | Bacteria | 15181 |
| 1520 | Ga0501076_0151568 | 3300049592 | Bacteria | 1886 |
| 1521 | Ga0501076_0338085 | 3300049592 | Bacteria | 1235 |
| 1522 | Ga0501077_0004653 | 3300049593 | Bacteria | 8336 |
| 1523 | Ga0501077_0025080 | 3300049593 | Bacteria | 3787 |
| 1524 | Ga0501077_0058407 | 3300049593 | Bacteria | 2449 |
| 1525 | Ga0501235_047766 | 3300049669 | Bacteria | 987 |
| 1526 | Ga0501250_032609 | 3300049680 | Bacteria | 730 |
| 1527 | Ga0501257_024296 | 3300049686 | Bacteria | 1439 |
| 1528 | Ga0501259_072921 | 3300049688 | Bacteria | 740 |
| 1529 | Ga0501225_0052312 | 3300049705 | Bacteria | 1139 |
| 1530 | Ga0501079_0014191 | 3300049741 | Bacteria | 6074 |
| 1531 | Ga0501079_0017703 | 3300049741 | Bacteria | 5443 |
| 1532 | Ga0501079_1355206 | 3300049741 | Bacteria | 560 |
| 1533 | Ga0501080_0052114 | 3300049742 | Bacteria | 3808 |
| 1534 | Ga0501080_0214540 | 3300049742 | Bacteria | 1763 |
| 1535 | Ga0501080_0921413 | 3300049742 | Bacteria | 761 |
| 1536 | Ga0501081_0000475 | 3300049743 | Bacteria | 22308 |
| 1537 | Ga0501081_0231180 | 3300049743 | Bacteria | 1347 |
| 1538 | Ga0501081_0347406 | 3300049743 | Bacteria | 1093 |
| 1539 | Ga0501083_0054848 | 3300049744 | Bacteria | 2673 |
| 1540 | Ga0501035_0119002 | 3300049822 | Bacteria | 2310 |
| 1541 | Ga0501035_0696454 | 3300049822 | Bacteria | 820 |
| 1542 | Ga0501044_0116744 | 3300049823 | Bacteria | 2673 |
| 1543 | nmdc:mga03n38_17374_c1 | 3300050490 | Bacteria | 2816 |
| 1544 | nmdc:mga03n38_35075_c1 | 3300050490 | Bacteria | 2146 |
| 1545 | nmdc:mga06z11_312743_c1 | 3300050494 | Bacteria | 936 |
| 1546 | nmdc:mga06z11_735806_c1 | 3300050494 | Bacteria | 601 |
| 1547 | nmdc:mga07m45_145970_c1 | 3300050496 | Bacteria | 1371 |
| 1548 | nmdc:mga07m45_539019_c1 | 3300050496 | Bacteria | 675 |
| 1549 | nmdc:mga05p37_125039_c1 | 3300050507 | Bacteria | 3158 |
| 1550 | nmdc:mga05p37_129768_c1 | 3300050507 | Bacteria | 3093 |
| 1551 | nmdc:mga05p37_338782_c2 | 3300050507 | Bacteria | 1261 |
| 1552 | nmdc:mga05p37_39379_c1 | 3300050507 | Bacteria | 5803 |
| 1553 | nmdc:mga05p37_414217_c1 | 3300050507 | Bacteria | 1570 |
| 1554 | nmdc:mga05p37_472763_c1 | 3300050507 | Bacteria | 1446 |
| 1555 | nmdc:mga09592_262536_c1 | 3300050508 | Bacteria | 1498 |
| 1556 | nmdc:mga09592_389439_c1 | 3300050508 | Bacteria | 1205 |
| 1557 | nmdc:mga09592_434945_c1 | 3300050508 | Bacteria | 1132 |
| 1558 | nmdc:mga09592_552004_c1 | 3300050508 | Bacteria | 989 |
| 1559 | nmdc:mga09592_60333_c1 | 3300050508 | Bacteria | 3206 |
| 1560 | nmdc:mga0qj67_29683_c1 | 3300050509 | Bacteria | 4248 |
| 1561 | nmdc:mga0qj67_31569_c1 | 3300050509 | Bacteria | 4127 |
| 1562 | nmdc:mga06r32_240_c1 | 3300050510 | Bacteria | 44888 |
| 1563 | nmdc:mga06r32_464452_c1 | 3300050510 | Bacteria | 1245 |
| 1564 | nmdc:mga06r32_73091_c1 | 3300050510 | Bacteria | 3321 |
| 1565 | nmdc:mga08y16_50222_c1 | 3300050511 | Bacteria | 4365 |
| 1566 | nmdc:mga0n895_20157_c1 | 3300050512 | Bacteria | 6212 |
| 1567 | nmdc:mga0n895_310352_c1 | 3300050512 | Bacteria | 1599 |
| 1568 | nmdc:mga0n895_837255_c1 | 3300050512 | Bacteria | 908 |
| 1569 | nmdc:mga0rr50_132028_c1 | 3300050513 | Bacteria | 2001 |
| 1570 | nmdc:mga0rr50_1353826_c1 | 3300050513 | Bacteria | 603 |
| 1571 | nmdc:mga0rr50_139429_c1 | 3300050513 | Bacteria | 1949 |
| 1572 | nmdc:mga0rr50_215168_c1 | 3300050513 | Bacteria | 1585 |
| 1573 | nmdc:mga0rr50_448736_c1 | 3300050513 | Bacteria | 1093 |
| 1574 | nmdc:mga0rr50_654789_c1 | 3300050513 | Bacteria | 896 |
| 1575 | nmdc:mga0rr50_849630_c1 | 3300050513 | Bacteria | 778 |
| 1576 | nmdc:mga08x19_1791_c1 | 3300050514 | Bacteria | 13199 |
| 1577 | nmdc:mga08x19_231932_c1 | 3300050514 | Bacteria | 1271 |
| 1578 | nmdc:mga0a205_250257_c1 | 3300050515 | Bacteria | 1652 |
| 1579 | nmdc:mga0a205_306760_c1 | 3300050515 | Bacteria | 1460 |
| 1580 | nmdc:mga0a205_628980_c1 | 3300050515 | Bacteria | 925 |
| 1581 | nmdc:mga0a205_665473_c1 | 3300050515 | Bacteria | 892 |
| 1582 | nmdc:mga0a205_739243_c1 | 3300050515 | Bacteria | 833 |
| 1583 | nmdc:mga0a205_8916_c1 | 3300050515 | Bacteria | 9141 |
| 1584 | nmdc:mga0a205_911109_c1 | 3300050515 | Bacteria | 726 |
| 1585 | nmdc:mga0a205_961216_c1 | 3300050515 | Bacteria | 701 |
| 1586 | Ga0495619_0442875 | 3300053085 | Bacteria | 896 |
| 1587 | Ga0500644_0000002 | 3300053088 | Bacteria | 374631 |
| 1588 | Ga0500647_0000012 | 3300053091 | Bacteria | 38564 |
| 1589 | Ga0500583_0496959 | 3300053092 | Bacteria | 573 |
| 1590 | Ga0500651_0002297 | 3300053093 | Bacteria | 10033 |
| 1591 | Ga0500641_0001325 | 3300053096 | Bacteria | 8791 |
| 1592 | Ga0500648_000006 | 3300053097 | Bacteria | 75079 |
| 1593 | Ga0500650_0000070 | 3300053098 | Bacteria | 30965 |
| 1594 | Ga0500642_0003400 | 3300053130 | Bacteria | 4809 |
| 1595 | Ga0500568_0003342 | 3300053139 | Bacteria | 9004 |
| 1596 | Ga0500577_0000003 | 3300053142 | Bacteria | 180444 |
| 1597 | Ga0500588_0024291 | 3300053146 | Bacteria | 1671 |
| 1598 | Ga0500604_0026223 | 3300053151 | Bacteria | 1680 |
| 1599 | Ga0500637_0009880 | 3300053178 | Bacteria | 4881 |
| 1600 | Ga0500649_070870 | 3300053722 | Bacteria | 1438 |
| 1601 | Ga0500645_210790 | 3300053730 | Bacteria | 522 |
| 1602 | Ga0501084_0022618 | 3300054114 | Bacteria | 5246 |
| 1603 | Ga0501084_0088994 | 3300054114 | Bacteria | 2591 |
| 1604 | Ga0501084_0437588 | 3300054114 | Bacteria | 1105 |
| 1605 | Ga0587084_043643 | 3300059477 | Bacteria | 771 |
| 1606 | Ga0587070_083707 | 3300059491 | Bacteria | 705 |
| 1607 | Ga0587073_0060500 | 3300059492 | Bacteria | 887 |
| 1608 | Ga0587083_0038110 | 3300059505 | Bacteria | 992 |
| 1609 | Ga0587085_097648 | 3300059506 | Bacteria | 616 |
| 1610 | Ga0587088_098636 | 3300059508 | Bacteria | 650 |
| 1611 | Ga0587091_059570 | 3300059511 | Bacteria | 807 |
| 1612 | Ga0587092_017348 | 3300059512 | Bacteria | 1075 |
| 1613 | Ga0587092_060759 | 3300059512 | Bacteria | 706 |
| 1614 | Ga0587106_017865 | 3300059605 | Bacteria | 1019 |
| 1615 | Ga0587101_126038 | 3300059623 | Bacteria | 534 |
| 1616 | Ga0587109_078498 | 3300059624 | Bacteria | 726 |
| 1617 | Ga0587109_096569 | 3300059624 | Bacteria | 674 |
| 1618 | Ga0587062_010776 | 3300059639 | Bacteria | 1141 |
| 1619 | Ga0587072_061068 | 3300059643 | Bacteria | 776 |
| 1620 | Ga0587114_021420 | 3300059655 | Bacteria | 915 |
| 1621 | Ga0587111_0123911 | 3300060346 | Bacteria | 669 |
| 1622 | Ga0501082_0000140 | 3300060353 | Bacteria | 59882 |
| 1623 | Ga0501082_0035433 | 3300060353 | Bacteria | 4301 |
| 1624 | Ga0501082_0142200 | 3300060353 | Bacteria | 2082 |
| 1625 | Ga0501082_0253504 | 3300060353 | Bacteria | 1531 |
| 1626 | Ga0530510_0003506 | 3300061734 | Bacteria | 10782 |
| 1627 | Ga0530510_0071270 | 3300061734 | Bacteria | 2522 |
| 1628 | Ga0530510_0219539 | 3300061734 | Bacteria | 1413 |
| 1629 | Ga0207670_10274512 | |||
| 1630 | SwRhRL2b_contig_3648165 | |||
| 1631 | JGI24741J21665_1033893 | |||
| 1632 | JGI24737J22298_10075653 | |||
| 1633 | Ga0058859_11478218 | |||
| 1634 | Ga0058859_11638471 | |||
| 1635 | Ga0058863_11581443 | |||
| 1636 | Ga0058863_11773336 | |||
| 1637 | Ga0058861_10045775 | |||
| 1638 | Ga0058861_10173322 | |||
| 1639 | Ga0058860_10210260 | |||
| 1640 | Ga0058860_11763004 | |||
| 1641 | Ga0058862_10217184 | |||
| 1642 | Ga0058862_12307729 | |||
| 1643 | Ga0065704_10095262 | |||
| 1644 | Ga0065715_10103339 | |||
| 1645 | Ga0065707_10932254 | |||
| 1646 | Ga0070658_10016310 | |||
| 1647 | Ga0070658_10031526 | |||
| 1648 | Ga0070658_10067399 | |||
| 1649 | Ga0070658_10074906 | |||
| 1650 | Ga0070658_10163021 | |||
| 1651 | Ga0070658_11088690 | |||
| 1652 | Ga0070676_10000002 | |||
| 1653 | Ga0070676_10016036 | |||
| 1654 | Ga0070676_10176212 | |||
| 1655 | Ga0070676_10255796 | |||
| 1656 | Ga0070683_100002981 | |||
| 1657 | Ga0070683_100029815 | |||
| 1658 | Ga0070683_100088449 | |||
| 1659 | Ga0070683_100111881 | |||
| 1660 | Ga0070683_100152539 | |||
| 1661 | Ga0070683_100560145 | |||
| 1662 | Ga0070683_100718798 | |||
| 1663 | Ga0070690_100029366 | |||
| 1664 | Ga0070690_101425284 | |||
| 1665 | Ga0070670_100016026 | |||
| 1666 | Ga0070670_100493721 | |||
| 1667 | Ga0068869_100013457 | |||
| 1668 | Ga0068869_100054244 | |||
| 1669 | Ga0068869_100226642 | |||
| 1670 | Ga0068869_100296407 | |||
| 1671 | Ga0068869_100981623 | |||
| 1672 | Ga0070666_10038785 | |||
| 1673 | Ga0070666_10206581 | |||
| 1674 | Ga0070666_10237723 | |||
| 1675 | Ga0070666_10445556 | |||
| 1676 | Ga0070666_10822541 | |||
| 1677 | Ga0070680_100055226 | |||
| 1678 | Ga0070680_100065121 | |||
| 1679 | Ga0070680_100097517 | |||
| 1680 | Ga0070680_100197639 | |||
| 1681 | Ga0070680_100289189 | |||
| 1682 | Ga0070680_100611279 | |||
| 1683 | Ga0070682_100060709 | |||
| 1684 | Ga0070682_100299058 | |||
| 1685 | Ga0068868_100170735 | |||
| 1686 | Ga0068868_100205574 | |||
| 1687 | Ga0068868_100312728 | |||
| 1688 | Ga0068868_100372630 | |||
| 1689 | Ga0068868_100569883 | |||
| 1690 | Ga0068868_100963262 | |||
| 1691 | Ga0068868_101151115 | |||
| 1692 | Ga0068868_101252207 | |||
| 1693 | Ga0068868_101614268 | |||
| 1694 | Ga0070660_100005332 | |||
| 1695 | Ga0070660_100081218 | |||
| 1696 | Ga0070660_100182693 | |||
| 1697 | Ga0070660_100290089 | |||
| 1698 | Ga0070660_100828546 | |||
| 1699 | Ga0070660_101481411 | |||
| 1700 | Ga0070689_100179833 | |||
| 1701 | Ga0070689_100289442 | |||
| 1702 | Ga0070689_100307037 | |||
| 1703 | Ga0070689_101187320 | |||
| 1704 | Ga0070689_101277498 | |||
| 1705 | Ga0070691_10001162 | |||
| 1706 | Ga0070691_10743465 | |||
| 1707 | Ga0070687_100626167 | |||
| 1708 | Ga0070661_100154852 | |||
| 1709 | Ga0070661_100166885 | |||
| 1710 | Ga0070661_100594716 | |||
| 1711 | Ga0070661_101115174 | |||
| 1712 | Ga0070692_10002909 | |||
| 1713 | Ga0070692_10190709 | |||
| 1714 | Ga0070669_100917855 | |||
| 1715 | Ga0070675_100330358 | |||
| 1716 | Ga0070675_101391407 | |||
| 1717 | Ga0070671_100150795 | |||
| 1718 | Ga0070671_100224240 | |||
| 1719 | Ga0070671_100316383 | |||
| 1720 | Ga0070671_101876450 | |||
| 1721 | Ga0070674_100195020 | |||
| 1722 | Ga0070674_100198590 | |||
| 1723 | Ga0070673_100017147 | |||
| 1724 | Ga0070673_100047614 | |||
| 1725 | Ga0070673_100352989 | |||
| 1726 | Ga0070673_100958561 | |||
| 1727 | Ga0070673_101088356 | |||
| 1728 | Ga0070688_100113294 | |||
| 1729 | Ga0070688_100326462 | |||
| 1730 | Ga0070688_100898197 | |||
| 1731 | Ga0070659_100171910 | |||
| 1732 | Ga0070659_100622854 | |||
| 1733 | Ga0070659_100667005 | |||
| 1734 | Ga0070659_101179388 | |||
| 1735 | Ga0070667_100000132 | |||
| 1736 | Ga0070667_100069113 | |||
| 1737 | Ga0070667_100272503 | |||
| 1738 | Ga0070667_100344053 | |||
| 1739 | Ga0070667_100490960 | |||
| 1740 | Ga0070667_100628989 | |||
| 1741 | Ga0070667_101011134 | |||
| 1742 | Ga0070703_10013380 | |||
| 1743 | Ga0070703_10058463 | |||
| 1744 | Ga0070703_10066326 | |||
| 1745 | Ga0070703_10316328 | |||
| 1746 | Ga0070709_10477097 | |||
| 1747 | Ga0070709_10504015 | |||
| 1748 | Ga0070709_10784059 | |||
| 1749 | Ga0070714_100022737 | |||
| 1750 | Ga0070714_100048608 | |||
| 1751 | Ga0070714_100811131 | |||
| 1752 | Ga0070714_101210173 | |||
| 1753 | Ga0070713_100018979 | |||
| 1754 | Ga0070713_100038050 | |||
| 1755 | Ga0070713_100051702 | |||
| 1756 | Ga0070713_100543976 | |||
| 1757 | Ga0070713_100876364 | |||
| 1758 | Ga0070713_102174219 | |||
| 1759 | Ga0070710_11162542 | |||
| 1760 | Ga0070701_10002390 | |||
| 1761 | Ga0070701_10057462 | |||
| 1762 | Ga0070711_100093697 | |||
| 1763 | Ga0070711_100151767 | |||
| 1764 | Ga0070711_100253776 | |||
| 1765 | Ga0070711_100462963 | |||
| 1766 | Ga0070711_100876785 | |||
| 1767 | Ga0070711_101019603 | |||
| 1768 | Ga0070711_101024855 | |||
| 1769 | Ga0070711_101097070 | |||
| 1770 | Ga0070711_101099405 | |||
| 1771 | Ga0070705_100120288 | |||
| 1772 | Ga0070705_100120816 | |||
| 1773 | Ga0070705_100238858 | |||
| 1774 | Ga0070705_100686332 | |||
| 1775 | Ga0070700_100009609 | |||
| 1776 | Ga0070700_100087382 | |||
| 1777 | Ga0070694_100033358 | |||
| 1778 | Ga0070694_100150838 | |||
| 1779 | Ga0070694_100155350 | |||
| 1780 | Ga0070694_100278260 | |||
| 1781 | Ga0070694_101240026 | |||
| 1782 | Ga0070708_100074547 | |||
| 1783 | Ga0070708_100129831 | |||
| 1784 | Ga0070708_100784730 | |||
| 1785 | Ga0070708_101006534 | |||
| 1786 | Ga0070708_101126167 | |||
| 1787 | Ga0070708_101805362 | |||
| 1788 | Ga0070663_100145118 | |||
| 1789 | Ga0070678_100242814 | |||
| 1790 | Ga0070678_100818074 | |||
| 1791 | Ga0070678_101031663 | |||
| 1792 | Ga0070662_100160240 | |||
| 1793 | Ga0070662_100403790 | |||
| 1794 | Ga0070662_100499792 | |||
| 1795 | Ga0070662_100716786 | |||
| 1796 | Ga0070681_10015833 | |||
| 1797 | Ga0070681_10030019 | |||
| 1798 | Ga0070681_10048985 | |||
| 1799 | Ga0070681_10089529 | |||
| 1800 | Ga0070681_10180638 | |||
| 1801 | Ga0070681_10213766 | |||
| 1802 | Ga0068867_100127890 | |||
| 1803 | Ga0068867_100150919 | |||
| 1804 | Ga0068867_100177486 | |||
| 1805 | Ga0068867_100309143 | |||
| 1806 | Ga0068867_100326184 | |||
| 1807 | Ga0068867_100463174 | |||
| 1808 | Ga0068867_100993111 | |||
| 1809 | Ga0068867_101606186 | |||
| 1810 | Ga0068867_101639692 | |||
| 1811 | Ga0068867_101900621 | |||
| 1812 | Ga0070685_10011503 | |||
| 1813 | Ga0070685_10040968 | |||
| 1814 | Ga0070706_100066634 | |||
| 1815 | Ga0070706_100329158 | |||
| 1816 | Ga0070706_100493363 | |||
| 1817 | Ga0070706_100947528 | |||
| 1818 | Ga0070707_100221932 | |||
| 1819 | Ga0070707_100680983 | |||
| 1820 | Ga0070698_100261630 | |||
| 1821 | Ga0070698_100278933 | |||
| 1822 | Ga0070698_100510295 | |||
| 1823 | Ga0070698_100681089 | |||
| 1824 | Ga0070698_100854161 | |||
| 1825 | Ga0070699_100028934 | |||
| 1826 | Ga0070699_100061001 | |||
| 1827 | Ga0070699_100076627 | |||
| 1828 | Ga0070699_100182515 | |||
| 1829 | Ga0070699_100588284 | |||
| 1830 | Ga0070679_100011561 | |||
| 1831 | Ga0070679_100089372 | |||
| 1832 | Ga0070679_100292090 | |||
| 1833 | Ga0070679_100704166 | |||
| 1834 | Ga0070679_101293611 | |||
| 1835 | Ga0070684_100061031 | |||
| 1836 | Ga0070684_100153008 | |||
| 1837 | Ga0070684_100210188 | |||
| 1838 | Ga0070684_100232151 | |||
| 1839 | Ga0070684_100421634 | |||
| 1840 | Ga0070684_100577216 | |||
| 1841 | Ga0070684_100896869 | |||
| 1842 | Ga0070684_100984030 | |||
| 1843 | Ga0070697_100072171 | |||
| 1844 | Ga0070697_100420954 | |||
| 1845 | Ga0070697_100879252 | |||
| 1846 | Ga0070697_101288979 | |||
| 1847 | Ga0070697_101642471 | |||
| 1848 | Ga0068853_100114452 | |||
| 1849 | Ga0068853_100166379 | |||
| 1850 | Ga0068853_100200496 | |||
| 1851 | Ga0068853_100235159 | |||
| 1852 | Ga0068853_100270100 | |||
| 1853 | Ga0068853_100499688 | |||
| 1854 | Ga0068853_100687497 | |||
| 1855 | Ga0068853_100935963 | |||
| 1856 | Ga0070672_100007564 | |||
| 1857 | Ga0070672_100358507 | |||
| 1858 | Ga0070672_101805901 | |||
| 1859 | Ga0070686_100072179 | |||
| 1860 | Ga0070686_100117212 | |||
| 1861 | Ga0070686_100401214 | |||
| 1862 | Ga0070686_100798114 | |||
| 1863 | Ga0070695_100034336 | |||
| 1864 | Ga0070695_100035895 | |||
| 1865 | Ga0070695_100092851 | |||
| 1866 | Ga0070695_100116111 | |||
| 1867 | Ga0070695_100154106 | |||
| 1868 | Ga0070695_100623424 | |||
| 1869 | Ga0070695_100860415 | |||
| 1870 | Ga0070696_100007562 | |||
| 1871 | Ga0070696_100060883 | |||
| 1872 | Ga0070696_100130611 | |||
| 1873 | Ga0070696_100140894 | |||
| 1874 | Ga0070696_100183437 | |||
| 1875 | Ga0070696_100192349 | |||
| 1876 | Ga0070696_100215586 | |||
| 1877 | Ga0070696_101026562 | |||
| 1878 | Ga0070693_100064853 | |||
| 1879 | Ga0070693_100109376 | |||
| 1880 | Ga0070693_100308782 | |||
| 1881 | Ga0070665_100000956 | |||
| 1882 | Ga0070665_100048212 | |||
| 1883 | Ga0070665_100307536 | |||
| 1884 | Ga0070665_100568406 | |||
| 1885 | Ga0070665_100683593 | |||
| 1886 | Ga0070665_100702219 | |||
| 1887 | Ga0070704_100016254 | |||
| 1888 | Ga0070704_100163554 | |||
| 1889 | Ga0070704_100181372 | |||
| 1890 | Ga0070704_100347104 | |||
| 1891 | Ga0070704_100380742 | |||
| 1892 | Ga0070704_100429662 | |||
| 1893 | Ga0070704_100442098 | |||
| 1894 | Ga0070704_101380064 | |||
| 1895 | Ga0068855_100027078 | |||
| 1896 | Ga0068855_100050405 | |||
| 1897 | Ga0068855_100145813 | |||
| 1898 | Ga0068855_100325622 | |||
| 1899 | Ga0068855_100455335 | |||
| 1900 | Ga0068855_100526141 | |||
| 1901 | Ga0068855_101008224 | |||
| 1902 | Ga0070664_100335375 | |||
| 1903 | Ga0070664_100917022 | |||
| 1904 | Ga0070664_101606590 | |||
| 1905 | Ga0070664_101820334 | |||
| 1906 | Ga0068857_100012106 | |||
| 1907 | Ga0068857_100057320 | |||
| 1908 | Ga0068857_100059824 | |||
| 1909 | Ga0068857_100102495 | |||
| 1910 | Ga0068857_100243648 | |||
| 1911 | Ga0068857_100263859 | |||
| 1912 | Ga0068854_100139520 | |||
| 1913 | Ga0068854_100179166 | |||
| 1914 | Ga0068854_100575038 | |||
| 1915 | Ga0068854_100729067 | |||
| 1916 | Ga0068856_100067689 | |||
| 1917 | Ga0068856_100103633 | |||
| 1918 | Ga0068856_100161060 | |||
| 1919 | Ga0068856_100275982 | |||
| 1920 | Ga0068856_100568697 | |||
| 1921 | Ga0070702_101861160 | |||
| 1922 | Ga0068852_100016325 | |||
| 1923 | Ga0068852_100053398 | |||
| 1924 | Ga0068852_100140852 | |||
| 1925 | Ga0068859_100125671 | |||
| 1926 | Ga0068859_100213847 | |||
| 1927 | Ga0068859_100301917 | |||
| 1928 | Ga0068859_100351175 | |||
| 1929 | Ga0068859_100493007 | |||
| 1930 | Ga0068859_100551046 | |||
| 1931 | Ga0068859_100587214 | |||
| 1932 | Ga0068859_100759850 | |||
| 1933 | Ga0068859_100763293 | |||
| 1934 | Ga0068859_101175867 | |||
| 1935 | Ga0068859_101679303 | |||
| 1936 | Ga0068859_101793134 | |||
| 1937 | Ga0068864_100038611 | |||
| 1938 | Ga0068864_100090071 | |||
| 1939 | Ga0068864_100137228 | |||
| 1940 | Ga0068864_100209746 | |||
| 1941 | Ga0068864_100240032 | |||
| 1942 | Ga0068864_100906887 | |||
| 1943 | Ga0068866_10253131 | |||
| 1944 | Ga0068866_10317409 | |||
| 1945 | Ga0068866_10318738 | |||
| 1946 | Ga0068861_100082107 | |||
| 1947 | Ga0068861_101325800 | |||
| 1948 | Ga0068861_102198987 | |||
| 1949 | Ga0068861_102441214 | |||
| 1950 | Ga0068851_10732196 | |||
| 1951 | Ga0068870_10000560 | |||
| 1952 | Ga0068870_10865311 | |||
| 1953 | Ga0068863_100093573 | |||
| 1954 | Ga0068863_100126817 | |||
| 1955 | Ga0068863_100177935 | |||
| 1956 | Ga0068863_100223089 | |||
| 1957 | Ga0068863_100758322 | |||
| 1958 | Ga0068863_100913460 | |||
| 1959 | Ga0068863_101781746 | |||
| 1960 | Ga0068858_100045647 | |||
| 1961 | Ga0068858_100069232 | |||
| 1962 | Ga0068858_100145469 | |||
| 1963 | Ga0068858_100180802 | |||
| 1964 | Ga0068858_100215287 | |||
| 1965 | Ga0068858_100236799 | |||
| 1966 | Ga0068858_100254153 | |||
| 1967 | Ga0068858_100314260 | |||
| 1968 | Ga0068858_100355453 | |||
| 1969 | Ga0068858_100495302 | |||
| 1970 | Ga0068858_100558114 | |||
| 1971 | Ga0068858_100590851 | |||
| 1972 | Ga0068860_100001432 | |||
| 1973 | Ga0068860_100025519 | |||
| 1974 | Ga0068860_100037244 | |||
| 1975 | Ga0068860_100052656 | |||
| 1976 | Ga0068860_100158941 | |||
| 1977 | Ga0068860_100274079 | |||
| 1978 | Ga0068860_100371164 | |||
| 1979 | Ga0068860_100574900 | |||
| 1980 | Ga0068860_101343304 | |||
| 1981 | Ga0068862_100030715 | |||
| 1982 | Ga0068862_100196706 | |||
| 1983 | Ga0068862_100285027 | |||
| 1984 | Ga0068862_100394778 | |||
| 1985 | Ga0068862_102590031 | |||
| 1986 | Ga0081455_10005833 | |||
| 1987 | Ga0081539_10001872 | |||
| 1988 | Ga0070717_10049261 | |||
| 1989 | Ga0070717_10056186 | |||
| 1990 | Ga0070717_10234697 | |||
| 1991 | Ga0070717_10275547 | |||
| 1992 | Ga0070717_11021466 | |||
| 1993 | Ga0075364_10491385 | |||
| 1994 | Ga0070715_10521029 | |||
| 1995 | Ga0070715_10697994 | |||
| 1996 | Ga0070715_10975008 | |||
| 1997 | Ga0070716_100304097 | |||
| 1998 | Ga0070712_100042578 | |||
| 1999 | Ga0075367_10358711 | |||
| 2000 | Ga0097621_100024374 | |||
| 2001 | Ga0097621_100050693 | |||
| 2002 | Ga0097621_100107171 | |||
| 2003 | Ga0097621_100130824 | |||
| 2004 | Ga0097621_100131589 | |||
| 2005 | Ga0097621_100154467 | |||
| 2006 | Ga0097621_100172262 | |||
| 2007 | Ga0097621_100197378 | |||
| 2008 | Ga0097621_100283779 | |||
| 2009 | Ga0097621_100446323 | |||
| 2010 | Ga0097621_100551091 | |||
| 2011 | Ga0097621_100569171 | |||
| 2012 | Ga0097621_100705071 | |||
| 2013 | Ga0097621_100768582 | |||
| 2014 | Ga0097621_101559027 | |||
| 2015 | Ga0097621_101673966 | |||
| 2016 | Ga0097621_102319595 | |||
| 2017 | Ga0075370_10585878 | |||
| 2018 | Ga0068871_100023285 | |||
| 2019 | Ga0068871_100034497 | |||
| 2020 | Ga0068871_100065515 | |||
| 2021 | Ga0068871_100115475 | |||
| 2022 | Ga0068871_100169351 | |||
| 2023 | Ga0068871_100212469 | |||
| 2024 | Ga0068871_100252988 | |||
| 2025 | Ga0068871_100288695 | |||
| 2026 | Ga0068871_100309636 | |||
| 2027 | Ga0068871_100318174 | |||
| 2028 | Ga0068871_100363237 | |||
| 2029 | Ga0068871_100786088 | |||
| 2030 | Ga0068871_101671516 | |||
| 2031 | Ga0068871_101949028 | |||
| 2032 | Ga0075428_100013647 | |||
| 2033 | Ga0075428_100339381 | |||
| 2034 | Ga0075428_100970747 | |||
| 2035 | Ga0075428_101266367 | |||
| 2036 | Ga0075430_100043860 | |||
| 2037 | Ga0075430_100056313 | |||
| 2038 | Ga0075431_100001342 | |||
| 2039 | Ga0075431_100071481 | |||
| 2040 | Ga0075431_100283521 | |||
| 2041 | Ga0075433_10024737 | |||
| 2042 | Ga0075433_10062480 | |||
| 2043 | Ga0075433_10358116 | |||
| 2044 | Ga0075433_10529950 | |||
| 2045 | Ga0075433_10706073 | |||
| 2046 | Ga0075434_100374162 | |||
| 2047 | Ga0075429_100243279 | |||
| 2048 | Ga0075429_100268861 | |||
| 2049 | Ga0068865_100475504 | |||
| 2050 | Ga0068865_100475982 | |||
| 2051 | Ga0068865_101422307 | |||
| 2052 | Ga0075436_100176998 | |||
| 2053 | Ga0075436_100431729 | |||
| 2054 | Ga0075436_100965092 | |||
| 2055 | Ga0097620_100125671 | |||
| 2056 | Ga0097620_100213846 | |||
| 2057 | Ga0097620_100301950 | |||
| 2058 | Ga0097620_100351171 | |||
| 2059 | Ga0097620_100551056 | |||
| 2060 | Ga0097620_100587214 | |||
| 2061 | Ga0097620_100759894 | |||
| 2062 | Ga0097620_100763245 | |||
| 2063 | Ga0097620_101175896 | |||
| 2064 | Ga0097620_101679307 | |||
| 2065 | Ga0097620_101793153 | |||
| 2066 | Ga0075435_100246536 | |||
| 2067 | Ga0075435_102069623 | |||
| 2068 | Ga0099794_10019102 | |||
| 2069 | Ga0099794_10116345 | |||
| 2070 | Ga0099794_10241234 | |||
| 2071 | Ga0099794_10362524 | |||
| 2072 | Ga0105240_10000877 | |||
| 2073 | Ga0105240_10001306 | |||
| 2074 | Ga0105240_10005628 | |||
| 2075 | Ga0105240_10011526 | |||
| 2076 | Ga0105240_10012424 | |||
| 2077 | Ga0105240_10051605 | |||
| 2078 | Ga0105240_10089720 | |||
| 2079 | Ga0105240_10210891 | |||
| 2080 | Ga0105240_10237058 | |||
| 2081 | Ga0105240_10261841 | |||
| 2082 | Ga0105240_10264391 | |||
| 2083 | Ga0105240_10303761 | |||
| 2084 | Ga0105240_10470576 | |||
| 2085 | Ga0105240_10858755 | |||
| 2086 | Ga0105240_10896683 | |||
| 2087 | Ga0105240_10928192 | |||
| 2088 | Ga0111539_10023315 | |||
| 2089 | Ga0111539_10179787 | |||
| 2090 | Ga0111539_10490847 | |||
| 2091 | Ga0111539_11535031 | |||
| 2092 | Ga0105245_10017754 | |||
| 2093 | Ga0105245_10039480 | |||
| 2094 | Ga0105245_10104493 | |||
| 2095 | Ga0105245_10129420 | |||
| 2096 | Ga0105245_10148838 | |||
| 2097 | Ga0105245_10149293 | |||
| 2098 | Ga0105245_10256599 | |||
| 2099 | Ga0105245_10312503 | |||
| 2100 | Ga0105245_10346196 | |||
| 2101 | Ga0105245_10379204 | |||
| 2102 | Ga0105245_10409019 | |||
| 2103 | Ga0105245_11701976 | |||
| 2104 | Ga0105245_11921349 | |||
| 2105 | Ga0105247_10048453 | |||
| 2106 | Ga0105247_10054705 | |||
| 2107 | Ga0105247_10401618 | |||
| 2108 | Ga0105247_10437679 | |||
| 2109 | Ga0105247_10939367 | |||
| 2110 | Ga0105247_11276221 | |||
| 2111 | Ga0114129_10038278 | |||
| 2112 | Ga0114129_10231657 | |||
| 2113 | Ga0114129_10284318 | |||
| 2114 | Ga0114129_10586595 | |||
| 2115 | Ga0114129_10730698 | |||
| 2116 | Ga0114129_10787421 | |||
| 2117 | Ga0105243_10077324 | |||
| 2118 | Ga0105243_10213567 | |||
| 2119 | Ga0105243_10592635 | |||
| 2120 | Ga0105243_10828722 | |||
| 2121 | Ga0105243_11411429 | |||
| 2122 | Ga0105243_11508488 | |||
| 2123 | Ga0105243_11607711 | |||
| 2124 | Ga0105243_12367652 | |||
| 2125 | Ga0105243_12635984 | |||
| 2126 | Ga0105241_10149324 | |||
| 2127 | Ga0105241_10215640 | |||
| 2128 | Ga0105241_10406938 | |||
| 2129 | Ga0105241_11175611 | |||
| 2130 | Ga0105241_11315796 | |||
| 2131 | Ga0105241_11539105 | |||
| 2132 | Ga0105242_10007188 | |||
| 2133 | Ga0105242_10017892 | |||
| 2134 | Ga0105242_10029508 | |||
| 2135 | Ga0105242_10045247 | |||
| 2136 | Ga0105242_10087110 | |||
| 2137 | Ga0105242_10101803 | |||
| 2138 | Ga0105242_10159358 | |||
| 2139 | Ga0105242_11232430 | |||
| 2140 | Ga0105242_11256972 | |||
| 2141 | Ga0105242_12119993 | |||
| 2142 | Ga0105248_10048956 | |||
| 2143 | Ga0105248_10091261 | |||
| 2144 | Ga0105248_10128484 | |||
| 2145 | Ga0105248_10147346 | |||
| 2146 | Ga0105248_10189293 | |||
| 2147 | Ga0105248_10191864 | |||
| 2148 | Ga0105248_10252960 | |||
| 2149 | Ga0105248_10400149 | |||
| 2150 | Ga0105248_10454223 | |||
| 2151 | Ga0105248_10758693 | |||
| 2152 | Ga0105248_11044875 | |||
| 2153 | Ga0105248_11113116 | |||
| 2154 | Ga0105248_12535227 | |||
| 2155 | Ga0105237_10008200 | |||
| 2156 | Ga0105237_10051788 | |||
| 2157 | Ga0105237_10053225 | |||
| 2158 | Ga0105237_10152505 | |||
| 2159 | Ga0105237_10202396 | |||
| 2160 | Ga0105237_10209685 | |||
| 2161 | Ga0105237_10349760 | |||
| 2162 | Ga0105237_10580274 | |||
| 2163 | Ga0105237_10665163 | |||
| 2164 | Ga0105237_10759439 | |||
| 2165 | Ga0105237_10930111 | |||
| 2166 | Ga0105237_11269133 | |||
| 2167 | Ga0105238_10025778 | |||
| 2168 | Ga0105238_10042029 | |||
| 2169 | Ga0105238_10043331 | |||
| 2170 | Ga0105238_10079438 | |||
| 2171 | Ga0105238_10103931 | |||
| 2172 | Ga0105238_10121891 | |||
| 2173 | Ga0105238_10145691 | |||
| 2174 | Ga0105238_10181937 | |||
| 2175 | Ga0105238_10193134 | |||
| 2176 | Ga0105238_11624994 | |||
| 2177 | Ga0105238_11666046 | |||
| 2178 | Ga0105238_12122480 | |||
| 2179 | Ga0105249_10002635 | |||
| 2180 | Ga0105249_10024654 | |||
| 2181 | Ga0105249_10077940 | |||
| 2182 | Ga0105249_10139643 | |||
| 2183 | Ga0105249_11574552 | |||
| 2184 | Ga0105239_10001360 | |||
| 2185 | Ga0105239_10096569 | |||
| 2186 | Ga0105239_10100314 | |||
| 2187 | Ga0105239_10122659 | |||
| 2188 | Ga0105239_10372259 | |||
| 2189 | Ga0105239_10607484 | |||
| 2190 | Ga0105239_10718863 | |||
| 2191 | Ga0105239_11293308 | |||
| 2192 | Ga0105239_11528422 | |||
| 2193 | Ga0105246_10077977 | |||
| 2194 | Ga0105246_10099260 | |||
| 2195 | Ga0105246_10114492 | |||
| 2196 | Ga0105246_10194956 | |||
| 2197 | Ga0105246_10282632 | |||
| 2198 | Ga0105246_10561124 | |||
| 2199 | Ga0105246_10920208 | |||
| 2200 | Ga0105246_11066126 | |||
| 2201 | Ga0105246_11362579 | |||
| 2202 | Ga0105246_11602649 | |||
| 2203 | Ga0157319_1045228 | |||
| 2204 | Ga0157373_10005841 | |||
| 2205 | Ga0157373_10348386 | |||
| 2206 | Ga0157373_10512080 | |||
| 2207 | Ga0157373_10693042 | |||
| 2208 | Ga0157373_11014028 | |||
| 2209 | Ga0157371_10707574 | |||
| 2210 | Ga0157371_10768908 | |||
| 2211 | Ga0157371_11104805 | |||
| 2212 | Ga0157370_10009380 | |||
| 2213 | Ga0157370_10016088 | |||
| 2214 | Ga0157370_10060235 | |||
| 2215 | Ga0157370_10087501 | |||
| 2216 | Ga0157370_10111743 | |||
| 2217 | Ga0157370_10115052 | |||
| 2218 | Ga0157370_10220654 | |||
| 2219 | Ga0157370_10709121 | |||
| 2220 | Ga0157370_10870264 | |||
| 2221 | Ga0157369_10089419 | |||
| 2222 | Ga0157369_10144717 | |||
| 2223 | Ga0157369_10290053 | |||
| 2224 | Ga0157369_11928311 | |||
| 2225 | Ga0157374_10280734 | |||
| 2226 | Ga0157374_10319069 | |||
| 2227 | Ga0157374_10330236 | |||
| 2228 | Ga0157374_10446725 | |||
| 2229 | Ga0157374_10491386 | |||
| 2230 | Ga0157374_10936791 | |||
| 2231 | Ga0157374_10977597 | |||
| 2232 | Ga0157374_11462225 | |||
| 2233 | Ga0157374_11919559 | |||
| 2234 | Ga0157374_12096100 | |||
| 2235 | Ga0157378_10009845 | |||
| 2236 | Ga0157378_10024793 | |||
| 2237 | Ga0157378_10173155 | |||
| 2238 | Ga0157378_10363194 | |||
| 2239 | Ga0157378_10445060 | |||
| 2240 | Ga0157378_10450373 | |||
| 2241 | Ga0157378_10662029 | |||
| 2242 | Ga0157378_10888711 | |||
| 2243 | Ga0157378_11520754 | |||
| 2244 | Ga0157378_11595813 | |||
| 2245 | Ga0157378_12033050 | |||
| 2246 | Ga0157378_12695637 | |||
| 2247 | Ga0163162_10199046 | |||
| 2248 | Ga0163162_10225142 | |||
| 2249 | Ga0163162_10255877 | |||
| 2250 | Ga0163162_10578563 | |||
| 2251 | Ga0163162_11115184 | |||
| 2252 | Ga0163162_11629940 | |||
| 2253 | Ga0163162_12061465 | |||
| 2254 | Ga0163162_12680609 | |||
| 2255 | Ga0157372_10122792 | |||
| 2256 | Ga0157372_10225448 | |||
| 2257 | Ga0157372_10242922 | |||
| 2258 | Ga0157372_10276972 | |||
| 2259 | Ga0157372_10366455 | |||
| 2260 | Ga0157372_10999408 | |||
| 2261 | Ga0157372_11151609 | |||
| 2262 | Ga0157372_11362368 | |||
| 2263 | Ga0157372_12609069 | |||
| 2264 | Ga0157372_13394294 | |||
| 2265 | Ga0157375_10018698 | |||
| 2266 | Ga0157375_10032840 | |||
| 2267 | Ga0157375_10116410 | |||
| 2268 | Ga0157375_10126067 | |||
| 2269 | Ga0157375_10425489 | |||
| 2270 | Ga0157375_10472512 | |||
| 2271 | Ga0157375_10501536 | |||
| 2272 | Ga0157375_11706751 | |||
| 2273 | Ga0157375_11750934 | |||
| 2274 | Ga0157375_12682966 | |||
| 2275 | Ga0163163_10021758 | |||
| 2276 | Ga0163163_10055051 | |||
| 2277 | Ga0163163_10073100 | |||
| 2278 | Ga0163163_10115863 | |||
| 2279 | Ga0163163_10219037 | |||
| 2280 | Ga0163163_10265123 | |||
| 2281 | Ga0163163_10406008 | |||
| 2282 | Ga0163163_10711542 | |||
| 2283 | Ga0163163_10796119 | |||
| 2284 | Ga0163163_10916822 | |||
| 2285 | Ga0163163_10978368 | |||
| 2286 | Ga0163163_11064320 | |||
| 2287 | Ga0157380_10267691 | |||
| 2288 | Ga0157380_12284723 | |||
| 2289 | Ga0157377_10282327 | |||
| 2290 | Ga0157377_10400044 | |||
| 2291 | Ga0157377_11103247 | |||
| 2292 | Ga0157379_10006057 | |||
| 2293 | Ga0157379_10144596 | |||
| 2294 | Ga0157379_10483045 | |||
| 2295 | Ga0157379_10663700 | |||
| 2296 | Ga0157379_10829439 | |||
| 2297 | Ga0157379_11022947 | |||
| 2298 | Ga0157379_11373458 | |||
| 2299 | Ga0157379_11615559 | |||
| 2300 | Ga0157379_11774386 | |||
| 2301 | Ga0157376_10000261 | |||
| 2302 | Ga0157376_10012722 | |||
| 2303 | Ga0157376_10193186 | |||
| 2304 | Ga0157376_10193905 | |||
| 2305 | Ga0157376_10912527 | |||
| 2306 | Ga0157376_11827967 | |||
| 2307 | Ga0157376_11899754 | |||
| 2308 | Ga0157376_11958019 | |||
| 2309 | Ga0157376_12202120 | |||
| 2310 | Ga0157376_12698772 | |||
| 2311 | Ga0182007_10079041 | |||
| 2312 | Ga0182007_10218614 | |||
| 2313 | Ga0163161_10881247 | |||
| 2314 | Ga0206356_11182845 | |||
| 2315 | Ga0206356_11564136 | |||
| 2316 | Ga0206351_10681821 | |||
| 2317 | Ga0206352_10028984 | |||
| 2318 | Ga0206352_10470863 | |||
| 2319 | Ga0206352_10752238 | |||
| 2320 | Ga0206352_11270903 | |||
| 2321 | Ga0206353_11732501 | |||
| 2322 | Ga0213876_10041973 | |||
| 2323 | Ga0213875_10022806 | |||
| 2324 | Ga0224712_10000548 | |||
| 2325 | Ga0224572_1066287 | |||
| 2326 | Ga0207656_10470961 | |||
| 2327 | Ga0207653_10010608 | |||
| 2328 | Ga0207653_10019306 | |||
| 2329 | Ga0207653_10233351 | |||
| 2330 | Ga0207692_10074593 | |||
| 2331 | Ga0207692_10452153 | |||
| 2332 | Ga0207692_10462867 | |||
| 2333 | Ga0207642_10470226 | |||
| 2334 | Ga0207710_10050839 | |||
| 2335 | Ga0207710_10056828 | |||
| 2336 | Ga0207710_10307720 | |||
| 2337 | Ga0207710_10487930 | |||
| 2338 | Ga0207688_10106342 | |||
| 2339 | Ga0207680_10193211 | |||
| 2340 | Ga0207680_10194678 | |||
| 2341 | Ga0207680_10201701 | |||
| 2342 | Ga0207680_10507495 | |||
| 2343 | Ga0207680_10799496 | |||
| 2344 | Ga0207647_10043016 | |||
| 2345 | Ga0207647_10384978 | |||
| 2346 | Ga0207685_10145305 | |||
| 2347 | Ga0207685_10519982 | |||
| 2348 | Ga0207685_10532667 | |||
| 2349 | Ga0207699_10299935 | |||
| 2350 | Ga0207699_10396201 | |||
| 2351 | Ga0207699_10853605 | |||
| 2352 | Ga0207645_10000001 | |||
| 2353 | Ga0207645_10127376 | |||
| 2354 | Ga0207645_10741378 | |||
| 2355 | Ga0207643_10001234 | |||
| 2356 | Ga0207705_10027514 | |||
| 2357 | Ga0207705_10058265 | |||
| 2358 | Ga0207705_10381660 | |||
| 2359 | Ga0207684_10017024 | |||
| 2360 | Ga0207684_10088612 | |||
| 2361 | Ga0207684_10135015 | |||
| 2362 | Ga0207654_10002666 | |||
| 2363 | Ga0207654_10039405 | |||
| 2364 | Ga0207707_10039884 | |||
| 2365 | Ga0207707_10051420 | |||
| 2366 | Ga0207707_10052960 | |||
| 2367 | Ga0207707_10065301 | |||
| 2368 | Ga0207707_10142451 | |||
| 2369 | Ga0207707_10202549 | |||
| 2370 | Ga0207695_10001948 | |||
| 2371 | Ga0207695_10008732 | |||
| 2372 | Ga0207695_10009692 | |||
| 2373 | Ga0207695_10024901 | |||
| 2374 | Ga0207695_10033693 | |||
| 2375 | Ga0207695_10104263 | |||
| 2376 | Ga0207695_10121084 | |||
| 2377 | Ga0207695_10140626 | |||
| 2378 | Ga0207695_10148295 | |||
| 2379 | Ga0207695_10164082 | |||
| 2380 | Ga0207695_10482163 | |||
| 2381 | Ga0207695_10901946 | |||
| 2382 | Ga0207695_10927662 | |||
| 2383 | Ga0207695_10959222 | |||
| 2384 | Ga0207671_10008521 | |||
| 2385 | Ga0207671_10010454 | |||
| 2386 | Ga0207671_10068243 | |||
| 2387 | Ga0207671_10085702 | |||
| 2388 | Ga0207671_10118089 | |||
| 2389 | Ga0207671_10163633 | |||
| 2390 | Ga0207671_10263012 | |||
| 2391 | Ga0207671_10296510 | |||
| 2392 | Ga0207671_10377164 | |||
| 2393 | Ga0207671_10496509 | |||
| 2394 | Ga0207671_10841365 | |||
| 2395 | Ga0207693_10088443 | |||
| 2396 | Ga0207663_10034350 | |||
| 2397 | Ga0207663_10195008 | |||
| 2398 | Ga0207663_10229309 | |||
| 2399 | Ga0207663_10276502 | |||
| 2400 | Ga0207663_10510796 | |||
| 2401 | Ga0207663_10570019 | |||
| 2402 | Ga0207663_10603209 | |||
| 2403 | Ga0207663_11119858 | |||
| 2404 | Ga0207663_11128813 | |||
| 2405 | Ga0207660_10007721 | |||
| 2406 | Ga0207660_10042286 | |||
| 2407 | Ga0207660_10096570 | |||
| 2408 | Ga0207660_10192938 | |||
| 2409 | Ga0207662_10297311 | |||
| 2410 | Ga0207662_10629033 | |||
| 2411 | Ga0207657_10002040 | |||
| 2412 | Ga0207657_10190582 | |||
| 2413 | Ga0207657_10337253 | |||
| 2414 | Ga0207657_10425210 | |||
| 2415 | Ga0207657_10951241 | |||
| 2416 | Ga0207649_10137200 | |||
| 2417 | Ga0207649_10161490 | |||
| 2418 | Ga0207649_10361367 | |||
| 2419 | Ga0207652_10002950 | |||
| 2420 | Ga0207652_10101022 | |||
| 2421 | Ga0207652_10157853 | |||
| 2422 | Ga0207646_10012863 | |||
| 2423 | Ga0207646_10133227 | |||
| 2424 | Ga0207646_10432754 | |||
| 2425 | Ga0207646_11047304 | |||
| 2426 | Ga0207681_10246401 | |||
| 2427 | Ga0207681_10858191 | |||
| 2428 | Ga0207694_10030295 | |||
| 2429 | Ga0207694_10033344 | |||
| 2430 | Ga0207694_10038575 | |||
| 2431 | Ga0207694_10074283 | |||
| 2432 | Ga0207694_10154946 | |||
| 2433 | Ga0207694_10194561 | |||
| 2434 | Ga0207694_11716799 | |||
| 2435 | Ga0207650_10208613 | |||
| 2436 | Ga0207650_10425348 | |||
| 2437 | Ga0207650_10931971 | |||
| 2438 | Ga0207659_10083343 | |||
| 2439 | Ga0207687_10017019 | |||
| 2440 | Ga0207687_10019124 | |||
| 2441 | Ga0207687_10032379 | |||
| 2442 | Ga0207687_10071255 | |||
| 2443 | Ga0207687_10096250 | |||
| 2444 | Ga0207687_10129959 | |||
| 2445 | Ga0207687_10177359 | |||
| 2446 | Ga0207687_10190510 | |||
| 2447 | Ga0207687_10205512 | |||
| 2448 | Ga0207687_11643371 | |||
| 2449 | Ga0207700_10029176 | |||
| 2450 | Ga0207700_10164168 | |||
| 2451 | Ga0207700_10446296 | |||
| 2452 | Ga0207700_10515366 | |||
| 2453 | Ga0207700_10555465 | |||
| 2454 | Ga0207700_10693373 | |||
| 2455 | Ga0207664_10004267 | |||
| 2456 | Ga0207664_10274240 | |||
| 2457 | Ga0207664_10428131 | |||
| 2458 | Ga0207664_11302818 | |||
| 2459 | Ga0207644_10066014 | |||
| 2460 | Ga0207644_10174854 | |||
| 2461 | Ga0207644_10553114 | |||
| 2462 | Ga0207644_10585547 | |||
| 2463 | Ga0207644_11131740 | |||
| 2464 | Ga0207690_10183495 | |||
| 2465 | Ga0207690_10326729 | |||
| 2466 | Ga0207706_10070832 | |||
| 2467 | Ga0207686_10003970 | |||
| 2468 | Ga0207686_10005039 | |||
| 2469 | Ga0207686_10005404 | |||
| 2470 | Ga0207686_10019111 | |||
| 2471 | Ga0207686_10076510 | |||
| 2472 | Ga0207686_10137346 | |||
| 2473 | Ga0207686_10240774 | |||
| 2474 | Ga0207709_10115699 | |||
| 2475 | Ga0207709_10161771 | |||
| 2476 | Ga0207709_10218441 | |||
| 2477 | Ga0207709_10374506 | |||
| 2478 | Ga0207709_10557787 | |||
| 2479 | Ga0207709_10623133 | |||
| 2480 | Ga0207709_10728149 | |||
| 2481 | Ga0207670_10151143 | |||
| 2482 | Ga0207670_10152015 | |||
| 2483 | Ga0207670_10342167 | |||
| 2484 | Ga0207670_10348310 | |||
| 2485 | Ga0207670_10594838 | |||
| 2486 | Ga0207669_10168175 | |||
| 2487 | Ga0207704_10040646 | |||
| 2488 | Ga0207704_10506339 | |||
| 2489 | Ga0207704_10673673 | |||
| 2490 | Ga0207704_11366181 | |||
| 2491 | Ga0207665_10096123 | |||
| 2492 | Ga0207665_10500424 | |||
| 2493 | Ga0207691_10011682 | |||
| 2494 | Ga0207691_10287124 | |||
| 2495 | Ga0207691_10331216 | |||
| 2496 | Ga0207691_10581586 | |||
| 2497 | Ga0207691_11114821 | |||
| 2498 | Ga0207711_10002186 | |||
| 2499 | Ga0207711_10122624 | |||
| 2500 | Ga0207711_10253474 | |||
| 2501 | Ga0207711_10291298 | |||
| 2502 | Ga0207711_10314266 | |||
| 2503 | Ga0207711_10360513 | |||
| 2504 | Ga0207711_10394295 | |||
| 2505 | Ga0207711_10401010 | |||
| 2506 | Ga0207711_10426824 | |||
| 2507 | Ga0207711_10493303 | |||
| 2508 | Ga0207711_11398284 | |||
| 2509 | Ga0207689_10076821 | |||
| 2510 | Ga0207689_10129346 | |||
| 2511 | Ga0207689_10186020 | |||
| 2512 | Ga0207689_10438903 | |||
| 2513 | Ga0207689_10462938 | |||
| 2514 | Ga0207661_10007311 | |||
| 2515 | Ga0207661_10008612 | |||
| 2516 | Ga0207661_10029011 | |||
| 2517 | Ga0207661_10070357 | |||
| 2518 | Ga0207661_10143604 | |||
| 2519 | Ga0207661_10214715 | |||
| 2520 | Ga0207661_10428017 | |||
| 2521 | Ga0207661_10594606 | |||
| 2522 | Ga0207661_11598627 | |||
| 2523 | Ga0207661_11721433 | |||
| 2524 | Ga0207679_10147074 | |||
| 2525 | Ga0207679_10170041 | |||
| 2526 | Ga0207679_10301142 | |||
| 2527 | Ga0207679_10483672 | |||
| 2528 | Ga0207679_11309751 | |||
| 2529 | Ga0207667_10015532 | |||
| 2530 | Ga0207667_10020712 | |||
| 2531 | Ga0207667_10021290 | |||
| 2532 | Ga0207667_10070161 | |||
| 2533 | Ga0207667_10071295 | |||
| 2534 | Ga0207667_10244652 | |||
| 2535 | Ga0207667_11811993 | |||
| 2536 | Ga0207651_10012611 | |||
| 2537 | Ga0207651_10197727 | |||
| 2538 | Ga0207651_10971665 | |||
| 2539 | Ga0207651_10977347 | |||
| 2540 | Ga0207651_11598486 | |||
| 2541 | Ga0207712_10003146 | |||
| 2542 | Ga0207712_10004825 | |||
| 2543 | Ga0207712_10092233 | |||
| 2544 | Ga0207712_10286248 | |||
| 2545 | Ga0207712_10539391 | |||
| 2546 | Ga0207712_10552613 | |||
| 2547 | Ga0207712_10774951 | |||
| 2548 | Ga0207640_10161981 | |||
| 2549 | Ga0207640_10183861 | |||
| 2550 | Ga0207640_10568825 | |||
| 2551 | Ga0207640_10843076 | |||
| 2552 | Ga0207658_10000049 | |||
| 2553 | Ga0207658_10101054 | |||
| 2554 | Ga0207658_10134934 | |||
| 2555 | Ga0207658_10462178 | |||
| 2556 | Ga0207658_10863586 | |||
| 2557 | Ga0207658_10870731 | |||
| 2558 | Ga0207658_11428116 | |||
| 2559 | Ga0207677_10203666 | |||
| 2560 | Ga0207677_10224814 | |||
| 2561 | Ga0207677_10246308 | |||
| 2562 | Ga0207677_10306818 | |||
| 2563 | Ga0207677_10812374 | |||
| 2564 | Ga0207703_10069669 | |||
| 2565 | Ga0207703_10120083 | |||
| 2566 | Ga0207703_10172273 | |||
| 2567 | Ga0207703_10194964 | |||
| 2568 | Ga0207703_10317015 | |||
| 2569 | Ga0207703_10339060 | |||
| 2570 | Ga0207703_10727470 | |||
| 2571 | Ga0207703_11335727 | |||
| 2572 | Ga0207703_11683800 | |||
| 2573 | Ga0207639_10045508 | |||
| 2574 | Ga0207639_10209326 | |||
| 2575 | Ga0207639_10242622 | |||
| 2576 | Ga0207639_10341680 | |||
| 2577 | Ga0207639_10390135 | |||
| 2578 | Ga0207639_10553773 | |||
| 2579 | Ga0207639_10749435 | |||
| 2580 | Ga0207639_10926269 | |||
| 2581 | Ga0207639_10937646 | |||
| 2582 | Ga0207639_11696704 | |||
| 2583 | Ga0207678_11218354 | |||
| 2584 | Ga0207708_10060638 | |||
| 2585 | Ga0207708_10127103 | |||
| 2586 | Ga0207708_11650427 | |||
| 2587 | Ga0207702_10049903 | |||
| 2588 | Ga0207702_10120702 | |||
| 2589 | Ga0207702_10206316 | |||
| 2590 | Ga0207702_10238935 | |||
| 2591 | Ga0207702_10256020 | |||
| 2592 | Ga0207702_10440394 | |||
| 2593 | Ga0207702_10605810 | |||
| 2594 | Ga0207641_10082414 | |||
| 2595 | Ga0207641_10097869 | |||
| 2596 | Ga0207641_10203132 | |||
| 2597 | Ga0207641_10340938 | |||
| 2598 | Ga0207641_11168754 | |||
| 2599 | Ga0207648_10073228 | |||
| 2600 | Ga0207648_10181282 | |||
| 2601 | Ga0207648_10197096 | |||
| 2602 | Ga0207648_10228338 | |||
| 2603 | Ga0207648_10409100 | |||
| 2604 | Ga0207648_10453931 | |||
| 2605 | Ga0207676_10006640 | |||
| 2606 | Ga0207676_10078610 | |||
| 2607 | Ga0207676_10146864 | |||
| 2608 | Ga0207676_10211529 | |||
| 2609 | Ga0207676_10642670 | |||
| 2610 | Ga0207676_12189824 | |||
| 2611 | Ga0207674_10016607 | |||
| 2612 | Ga0207674_10052247 | |||
| 2613 | Ga0207674_10068105 | |||
| 2614 | Ga0207674_10085677 | |||
| 2615 | Ga0207674_10092133 | |||
| 2616 | Ga0207674_10267945 | |||
| 2617 | Ga0207674_10500098 | |||
| 2618 | Ga0207674_10666325 | |||
| 2619 | Ga0207674_11275789 | |||
| 2620 | Ga0207675_100069431 | |||
| 2621 | Ga0207675_100075709 | |||
| 2622 | Ga0207675_100275734 | |||
| 2623 | Ga0207675_101389841 | |||
| 2624 | Ga0207675_101681455 | |||
| 2625 | Ga0207683_10151323 | |||
| 2626 | Ga0207683_10152334 | |||
| 2627 | Ga0207683_10279816 | |||
| 2628 | Ga0207683_10798177 | |||
| 2629 | Ga0207698_10009875 | |||
| 2630 | Ga0207698_10016901 | |||
| 2631 | Ga0207698_10346841 | |||
| 2632 | Ga0207698_10549016 | |||
| 2633 | Ga0207698_11810344 | |||
| 2634 | Ga0209983_1129971 | |||
| 2635 | Ga0209588_1036300 | |||
| 2636 | Ga0207428_10031589 | |||
| 2637 | Ga0268266_10002958 | |||
| 2638 | Ga0268266_10021412 | |||
| 2639 | Ga0268266_10166783 | |||
| 2640 | Ga0268266_10424516 | |||
| 2641 | Ga0268265_10020775 | |||
| 2642 | Ga0268265_10271219 | |||
| 2643 | Ga0268265_10358419 | |||
| 2644 | Ga0268265_10490284 | |||
| 2645 | Ga0268265_10582846 | |||
| 2646 | Ga0268265_11075304 | |||
| 2647 | Ga0268264_10001547 | |||
| 2648 | Ga0268264_10016109 | |||
| 2649 | Ga0268264_10207754 | |||
| 2650 | Ga0268264_10313321 | |||
| 2651 | Ga0268264_10369093 | |||
| 2652 | Ga0268264_10447531 | |||
| 2653 | Ga0268264_10669879 | |||
| 2654 | Ga0268264_12482945 | |||
| 2655 | Ga0268264_12500210 | |||
| 2656 | Ga0265334_10094599 | |||
| 2657 | Ga0265318_10011693 | |||
| 2658 | Ga0265338_10054342 | |||
| 2659 | Ga0265338_10206263 | |||
| 2660 | Ga0265338_10302524 | |||
| 2661 | Ga0265338_10692706 | |||
| 2662 | Ga0265338_10889284 | |||
| 2663 | Ga0265762_1106763 | |||
| 2664 | Ga0265775_103369 | |||
| 2665 | Ga0265760_10073850 | |||
| 2666 | Ga0265760_10172429 | |||
| 2667 | Ga0265760_10228481 | |||
| 2668 | Ga0265330_10250292 | |||
| 2669 | Ga0265330_10251180 | |||
| 2670 | Ga0265332_10310353 | |||
| 2671 | Ga0265325_10027317 | |||
| 2672 | Ga0265325_10109103 | |||
| 2673 | Ga0265340_10040215 | |||
| 2674 | Ga0265331_10070798 | |||
| 2675 | Ga0265331_10089844 | |||
| 2676 | Ga0265331_10338182 | |||
| 2677 | Ga0265331_10343667 | |||
| 2678 | Ga0265331_10445723 | |||
| 2679 | Ga0265327_10063515 | |||
| 2680 | Ga0265316_10001314 | |||
| 2681 | Ga0265316_10007548 | |||
| 2682 | Ga0265316_10033449 | |||
| 2683 | Ga0265316_10067016 | |||
| 2684 | Ga0265316_10101319 | |||
| 2685 | Ga0265316_10270427 | |||
| 2686 | Ga0265316_10293198 | |||
| 2687 | Ga0265316_10526766 | |||
| 2688 | Ga0265316_10773848 | |||
| 2689 | Ga0265316_10868165 | |||
| 2690 | Ga0265316_11073145 | |||
| 2691 | Ga0265316_11128060 | |||
| 2692 | Ga0265313_10012996 | |||
| 2693 | Ga0316575_10060722 | |||
| 2694 | Ga0265314_10055511 | |||
| 2695 | Ga0265314_10066132 | |||
| 2696 | Ga0265314_10151872 | |||
| 2697 | Ga0265314_10255370 | |||
| 2698 | Ga0265342_10084206 | |||
| 2699 | Ga0316576_10060959 | |||
| 2700 | Ga0316576_10225395 | |||
| 2701 | Ga0316576_10275615 | |||
| 2702 | Ga0316576_10287570 | |||
| 2703 | Ga0316576_10438416 | |||
| 2704 | Ga0316576_10485278 | |||
| 2705 | Ga0316577_10024609 | |||
| 2706 | Ga0316577_10058177 | |||
| 2707 | Ga0316577_10193366 | |||
| 2708 | Ga0307413_10133435 | |||
| 2709 | Ga0307410_10000336 | |||
| 2710 | Ga0307411_10002603 | |||
| 2711 | Ga0316583_10049103 | |||
| 2712 | Ga0316593_10000031 | |||
| 2713 | Ga0316593_10000158 | |||
| 2714 | Ga0316593_10000278 | |||
| 2715 | Ga0316593_10000848 | |||
| 2716 | Ga0316593_10001195 | |||
| 2717 | Ga0316593_10002697 | |||
| 2718 | Ga0316593_10010835 | |||
| 2719 | Ga0316593_10011946 | |||
| 2720 | Ga0316593_10018705 | |||
| 2721 | Ga0316593_10041649 | |||
| 2722 | Ga0316593_10043616 | |||
| 2723 | Ga0316593_10055552 | |||
| 2724 | Ga0316593_10151760 | |||
| 2725 | Ga0316593_10298255 | |||
| 2726 | Ga0316592_1000536 | |||
| 2727 | Ga0316592_1002993 | |||
| 2728 | Ga0316592_1010913 | |||
| 2729 | Ga0316592_1033351 | |||
| 2730 | Ga0316592_1069834 | |||
| 2731 | Ga0316592_1141118 | |||
| 2732 | Ga0316588_1015198 | |||
| 2733 | Ga0316588_1080796 | |||
| 2734 | Ga0316588_1089361 | |||
| 2735 | Ga0316587_1010208 | |||
| 2736 | Ga0316596_1000058 | |||
| 2737 | Ga0316596_1000988 | |||
| 2738 | Ga0316596_1001007 | |||
| 2739 | Ga0316596_1001016 | |||
| 2740 | Ga0316596_1001482 | |||
| 2741 | Ga0316596_1009369 | |||
| 2742 | Ga0316596_1014849 | |||
| 2743 | Ga0316596_1019395 | |||
| 2744 | Ga0316596_1023719 | |||
| 2745 | Ga0316596_1040060 | |||
| 2746 | Ga0316596_1042813 | |||
| 2747 | Ga0316596_1043728 | |||
| 2748 | Ga0316596_1056788 | |||
| 2749 | Ga0316596_1063628 | |||
| 2750 | Ga0316596_1162060 | |||
| 2751 | Ga0316596_1178262 | |||
| 2752 | Ga0373930_0011058 | |||
| 2753 | Ga0373959_0021787 | |||
| 2754 | Ga0373926_0006956 | |||
| 2755 | Ga0373926_0348587 | |||
| 2756 | Ga0373928_0013532 | |||
| 2757 | Ga0373928_0150792 | |||
| 2758 | Ga0373929_0077800 | |||
| 2759 | Ga0373934_0021690 | |||
| 2760 | Ga0373934_0045842 | |||
| 2761 | Ga0373940_0202122 | |||
| 2762 | Ga0373944_0143572 | |||
| 2763 | Ga0373951_0005949 | |||
| 2764 | Ga0373923_0380102 | |||
| 2765 | Ga0373932_0113268 | |||
| 2766 | Ga0373936_0100591 | |||
| 2767 | Ga0373936_0472085 | |||
| 2768 | Ga0373939_0428529 | |||
| 2769 | Ga0373941_0407221 | |||
| 2770 | Ga0373945_0153546 | |||
| 2771 | Ga0373953_0186434 | |||
| 2772 | Ga0373953_0249603 | |||
| 2773 | Ga0373954_0064249 | |||
| 2774 | Ga0373954_0137445 | |||
| 2775 | Ga0373954_0339067 | |||
| 2776 | Ga0373956_0123334 | |||
| 2777 | Ga0373957_0094581 | |||
| 2778 | Ga0373957_0468153 | |||
| 2779 | Ga0373960_0003527 | |||
| 2780 | Ga0373943_0006464 | |||
| 2781 | Ga0373943_0366742 | |||
| 2782 | Ga0373943_0572436 | |||
| 2783 | Ga0373946_0071032 | |||
| 2784 | Ga0373946_0233713 | |||
| 2785 | Ga0373946_0318424 | |||
| 2786 | Ga0373946_0418822 | |||
| 2787 | Ga0373955_0023160 | |||
| 2788 | Ga0373955_0120824 | |||
| 2789 | Ga0373955_0263653 | |||
| 2790 | Ga0373942_0070132 | |||
| 2791 | Ga0316574_0027877 | |||
| 2792 | Ga0316574_0047264 | |||
| 2793 | Ga0316574_0374240 | |||
| 2794 | Ga0316574_0417157 | |||
| 2795 | Ga0316574_0659110 | |||
| 2796 | Ga0316574_0751348 | |||
| 2797 | Ga0373931_0860368 | |||
| 2798 | Ga0373935_0029628 | |||
| 2799 | Ga0373935_0064571 | |||
| 2800 | Ga0373935_0362104 | |||
| 2801 | Ga0373927_0001719 | |||
| 2802 | Ga0373927_0033099 | |||
| 2803 | Ga0373927_0778051 | |||
| 2804 | Ga0373933_0197266 | |||
| 2805 | Ga0373933_0766130 | |||
| 2806 | Ga0373933_1185337 | |||
| 2807 | Ga0373947_0003896 | |||
| 2808 | Ga0373947_0016431 | |||
| 2809 | Ga0373947_0161506 | |||
| 2810 | Ga0373947_0527159 | |||
| 2811 | Ga0373947_0695562 | |||
| 2812 | Ga0373937_0028911 | |||
| 2813 | Ga0373937_0198764 | |||
| 2814 | Ga0373937_0328502 | |||
| 2815 | Ga0373937_0426859 | |||
| 2816 | Ga0373937_0625822 | |||
| 2817 | Ga0373937_1069058 | |||
| 2818 | Ga0265778_011924 | |||
| 2819 | Ga0316582_0042688 | |||
| 2820 | Ga0316582_0087611 | |||
| 2821 | Ga0316582_0117881 | |||
| 2822 | Ga0316582_0419163 | |||
| 2823 | Ga0316582_0526217 | |||
| 2824 | Ga0316582_0663414 | |||
| 2825 | Ga0316582_0791537 | |||
| 2826 | Ga0316582_1117031 | |||
| 2827 | Ga0316584_0124461 | |||
| 2828 | Ga0316584_0312843 | |||
| 2829 | Ga0316584_0364668 | |||
| 2830 | Ga0316584_0868728 | |||
| 2831 | Ga0373925_0009542 | |||
| 2832 | Ga0373925_0016284 | |||
| 2833 | Ga0373925_0031340 | |||
| 2834 | Ga0373925_0105223 | |||
| 2835 | Ga0373925_0167391 | |||
| 2836 | Ga0373925_0187798 | |||
| 2837 | Ga0373925_0197899 | |||
| 2838 | Ga0373925_0436539 | |||
| 2839 | Ga0373925_0703435 | |||
| 2840 | Ga0373925_0849683 | |||
| 2841 | Ga0373925_0920895 | |||
| 2842 | Ga0395900_1929699 | |||
| 2843 | Ga0316581_0042275 | |||
| 2844 | Ga0436364_0656271 | |||
| 2845 | Ga0436364_1088472 | |||
| 2846 | Ga0436364_1149820 | |||
| 2847 | Ga0400484_03429 | |||
| 2848 | Ga0400484_18778 | |||
| 2849 | Ga0400490_18584 | |||
| 2850 | Ga0400490_18978 | |||
| 2851 | Ga0400490_28208 | |||
| 2852 | Ga0400491_17104 | |||
| 2853 | Ga0400485_05635 | |||
| 2854 | Ga0400485_13399 | |||
| 2855 | Ga0400485_14867 | |||
| 2856 | Ga0400488_07617 | |||
| 2857 | Ga0400488_38202 | |||
| 2858 | Ga0400488_59906 | |||
| 2859 | Ga0400488_60637 | |||
| 2860 | Ga0400486_19544 | |||
| 2861 | Ga0400486_22210 | |||
| 2862 | Ga0400486_30281 | |||
| 2863 | Ga0400483_070291 | |||
| 2864 | Ga0400483_083434 | |||
| 2865 | Ga0400483_084767 | |||
| 2866 | Ga0400483_120099 | |||
| 2867 | Ga0400483_154386 | |||
| 2868 | Ga0400483_216594 | |||
| 2869 | Ga0400483_257333 | |||
| 2870 | Ga0400483_261234 | |||
| 2871 | Ga0400489_53490 | |||
| 2872 | Ga0400489_55784 | |||
| 2873 | Ga0400489_74110 | |||
| 2874 | Ga0400489_74550 | |||
| 2875 | Ga0400487_41192 | |||
| 2876 | Ga0436365_0931713 | |||
| 2877 | Ga0436360_0560131 | |||
| 2878 | Ga0436360_1059506 | |||
| 2879 | Ga0436361_0600685 | |||
| 2880 | Ga0436363_0310931 | |||
| 2881 | Ga0436363_1010169 | |||
| 2882 | Ga0436363_1537811 | |||
| 2883 | Ga0436362_0350632 | |||
| 2884 | Ga0436362_0757945 | |||
| 2885 | Ga0436362_1011805 | |||
| 2886 | Ga0436362_1230516 | |||
| 2887 | Ga0451795_1024431 | |||
| 2888 | Ga0451795_1037796 | |||
| 2889 | Ga0451807_2678434 | |||
| 2890 | Ga0451835_0294879 | |||
| 2891 | Ga0451837_1262203 | |||
| 2892 | Ga0451852_14943 | |||
| 2893 | Ga0451852_32296 | |||
| 2894 | Ga0451855_1247256 | |||
| 2895 | Ga0439441_023690 | |||
| 2896 | Ga0439441_092726 | |||
| 2897 | Ga0439448_0049076 | |||
| 2898 | Ga0450914_000417 | |||
| 2899 | Ga0439444_0139755 | |||
| 2900 | Ga0450893_0064797 | |||
| 2901 | Ga0451577_0003967 | |||
| 2902 | Ga0451577_0020405 | |||
| 2903 | Ga0451577_0028183 | |||
| 2904 | Ga0451577_0028471 | |||
| 2905 | Ga0451577_0099005 | |||
| 2906 | Ga0451577_0125417 | |||
| 2907 | Ga0451577_0173135 | |||
| 2908 | Ga0451577_0210923 | |||
| 2909 | Ga0451577_0258096 | |||
| 2910 | Ga0451577_0933670 | |||
| 2911 | Ga0453683_0000002 | |||
| 2912 | Ga0453683_0000075 | |||
| 2913 | Ga0453683_0002122 | |||
| 2914 | Ga0453683_0002232 | |||
| 2915 | Ga0453683_0004112 | |||
| 2916 | Ga0453683_0004693 | |||
| 2917 | Ga0453683_0006996 | |||
| 2918 | Ga0453683_0040252 | |||
| 2919 | Ga0453683_0138466 | |||
| 2920 | Ga0453683_0202278 | |||
| 2921 | Ga0453683_0207795 | |||
| 2922 | Ga0453683_0228629 | |||
| 2923 | Ga0453683_0239083 | |||
| 2924 | Ga0453683_0429302 | |||
| 2925 | Ga0453683_0443324 | |||
| 2926 | Ga0453684_0001225 | |||
| 2927 | Ga0453684_0005920 | |||
| 2928 | Ga0453684_0010338 | |||
| 2929 | Ga0453684_0011463 | |||
| 2930 | Ga0453684_0012653 | |||
| 2931 | Ga0453684_0013713 | |||
| 2932 | Ga0453684_0014912 | |||
| 2933 | Ga0453684_0025712 | |||
| 2934 | Ga0453684_0028706 | |||
| 2935 | Ga0453684_0029890 | |||
| 2936 | Ga0453684_0035204 | |||
| 2937 | Ga0453684_0035213 | |||
| 2938 | Ga0453684_0148240 | |||
| 2939 | Ga0453684_0221982 | |||
| 2940 | Ga0453684_0271517 | |||
| 2941 | Ga0453684_0296692 | |||
| 2942 | Ga0453684_0392328 | |||
| 2943 | Ga0453684_0427169 | |||
| 2944 | Ga0453684_0762724 | |||
| 2945 | Ga0453684_0769817 | |||
| 2946 | Ga0453684_2168520 | |||
| 2947 | Ga0466971_0342723 | |||
| 2948 | Ga0466957_0505455 | |||
| 2949 | Ga0466959_0475082 | |||
| 2950 | Ga0451576_0001727 | |||
| 2951 | Ga0451576_0004781 | |||
| 2952 | Ga0451576_0005241 | |||
| 2953 | Ga0451576_0022705 | |||
| 2954 | Ga0451576_0032803 | |||
| 2955 | Ga0451576_0036131 | |||
| 2956 | Ga0451576_0138590 | |||
| 2957 | Ga0451576_0222858 | |||
| 2958 | Ga0451576_0255239 | |||
| 2959 | Ga0451576_0256198 | |||
| 2960 | Ga0451576_0273269 | |||
| 2961 | Ga0451576_0309752 | |||
| 2962 | Ga0451576_0333268 | |||
| 2963 | Ga0451576_0370125 | |||
| 2964 | Ga0451576_0396796 | |||
| 2965 | Ga0451576_0599502 | |||
| 2966 | Ga0451576_0641954 | |||
| 2967 | Ga0451576_0678999 | |||
| 2968 | Ga0451576_0901347 | |||
| 2969 | Ga0451576_1147915 | |||
| 2970 | Ga0451576_1263593 | |||
| 2971 | Ga0451576_1321500 | |||
| 2972 | Ga0451576_1409929 | |||
| 2973 | Ga0451576_1747275 | |||
| 2974 | Ga0451576_2141729 | |||
| 2975 | Ga0466958_0042921 | |||
| 2976 | Ga0466967_0178061 | |||
| 2977 | Ga0466967_0606929 | |||
| 2978 | Ga0466967_1425483 | |||
| 2979 | Ga0495592_0023757 | |||
| 2980 | Ga0495592_0187843 | |||
| 2981 | Ga0495603_0217457 | |||
| 2982 | Ga0495651_0027888 | |||
| 2983 | Ga0495651_0048591 | |||
| 2984 | Ga0495653_0475312 | |||
| 2985 | Ga0495580_0012363 | |||
| 2986 | Ga0495580_0023177 | |||
| 2987 | Ga0495580_0023989 | |||
| 2988 | Ga0495580_0029617 | |||
| 2989 | Ga0495580_0030495 | |||
| 2990 | Ga0495580_0088205 | |||
| 2991 | Ga0495580_0127171 | |||
| 2992 | Ga0495580_0178602 | |||
| 2993 | Ga0495580_0293569 | |||
| 2994 | Ga0495580_0317224 | |||
| 2995 | Ga0495580_0388283 | |||
| 2996 | Ga0495580_0929845 | |||
| 2997 | Ga0495582_0022430 | |||
| 2998 | Ga0495582_0918982 | |||
| 2999 | Ga0495605_0085624 | |||
| 3000 | Ga0495639_0230055 | |||
| 3001 | Ga0495662_0043206 | |||
| 3002 | Ga0495662_0151718 | |||
| 3003 | Ga0495662_0289647 | |||
| 3004 | Ga0495664_0024694 | |||
| 3005 | Ga0495664_0453920 | |||
| 3006 | Ga0495584_0110433 | |||
| 3007 | Ga0495594_0308925 | |||
| 3008 | Ga0495608_0077894 | |||
| 3009 | Ga0495608_0284462 | |||
| 3010 | Ga0495618_0169570 | |||
| 3011 | Ga0495628_0010572 | |||
| 3012 | Ga0495628_0583777 | |||
| 3013 | Ga0495628_0688411 | |||
| 3014 | Ga0495628_0934713 | |||
| 3015 | Ga0495630_0094544 | |||
| 3016 | Ga0495630_0610875 | |||
| 3017 | Ga0495666_0264501 | |||
| 3018 | Ga0495642_0183506 | |||
| 3019 | Ga0495652_0096288 | |||
| 3020 | Ga0495652_0139956 | |||
| 3021 | Ga0495652_0284319 | |||
| 3022 | Ga0495652_0394223 | |||
| 3023 | Ga0495652_0529066 | |||
| 3024 | Ga0495652_0532377 | |||
| 3025 | Ga0495654_0152044 | |||
| 3026 | Ga0495665_0009280 | |||
| 3027 | Ga0495665_0085461 | |||
| 3028 | Ga0495665_0107457 | |||
| 3029 | Ga0495665_0316982 | |||
| 3030 | Ga0495640_0121071 | |||
| 3031 | Ga0495640_0363549 | |||
| 3032 | Ga0495640_0963270 | |||
| 3033 | Ga0495587_0000336 | |||
| 3034 | Ga0495587_0034621 | |||
| 3035 | Ga0495587_0614109 | |||
| 3036 | Ga0495645_0007171 | |||
| 3037 | Ga0495645_0149505 | |||
| 3038 | Ga0495645_0188652 | |||
| 3039 | Ga0495645_0351093 | |||
| 3040 | Ga0495667_0025931 | |||
| 3041 | Ga0495667_0213520 | |||
| 3042 | Ga0495667_0649029 | |||
| 3043 | Ga0495634_0068987 | |||
| 3044 | Ga0495634_0407941 | |||
| 3045 | Ga0495635_0026942 | |||
| 3046 | Ga0495635_0624136 | |||
| 3047 | Ga0495599_0019509 | |||
| 3048 | Ga0495599_0033693 | |||
| 3049 | Ga0495599_0180759 | |||
| 3050 | Ga0495599_0371939 | |||
| 3051 | Ga0495623_0027406 | |||
| 3052 | Ga0495623_0086938 | |||
| 3053 | Ga0495623_0111431 | |||
| 3054 | Ga0495623_0244224 | |||
| 3055 | Ga0495646_0080108 | |||
| 3056 | Ga0495658_0016731 | |||
| 3057 | Ga0495658_0413110 | |||
| 3058 | Ga0495658_0908389 | |||
| 3059 | Ga0495669_0138369 | |||
| 3060 | Ga0495613_0585565 | |||
| 3061 | Ga0495624_0337596 | |||
| 3062 | Ga0495649_0461488 | |||
| 3063 | Ga0495600_0013166 | |||
| 3064 | Ga0495581_0376593 | |||
| 3065 | Ga0495604_0088514 | |||
| 3066 | Ga0495604_0412952 | |||
| 3067 | Ga0495604_0495478 | |||
| 3068 | Ga0495636_0120637 | |||
| 3069 | Ga0495674_0008368 | |||
| 3070 | Ga0495674_0021292 | |||
| 3071 | Ga0495674_0277501 | |||
| 3072 | Ga0495674_0593101 | |||
| 3073 | Ga0495674_0753754 | |||
| 3074 | Ga0495674_1027410 | |||
| 3075 | Ga0495680_0009543 | |||
| 3076 | Ga0495680_0172767 | |||
| 3077 | Ga0495680_0273497 | |||
| 3078 | Ga0495675_0270691 | |||
| 3079 | Ga0495675_0722514 | |||
| 3080 | Ga0495684_0059377 | |||
| 3081 | Ga0495684_0061272 | |||
| 3082 | Ga0495684_0193971 | |||
| 3083 | Ga0495684_0648584 | |||
| 3084 | Ga0495593_0408973 | |||
| 3085 | Ga0495602_0002172 | |||
| 3086 | Ga0495602_0086900 | |||
| 3087 | Ga0495602_0376090 | |||
| 3088 | Ga0495602_0614631 | |||
| 3089 | Ga0495602_0661740 | |||
| 3090 | Ga0495602_1008010 | |||
| 3091 | Ga0496101_1610231 | |||
| 3092 | Ga0496102_0191714 | |||
| 3093 | Ga0496104_0445908 | |||
| 3094 | Ga0496104_0626248 | |||
| 3095 | Ga0496104_0668185 | |||
| 3096 | Ga0496104_0971048 | |||
| 3097 | Ga0496104_1349134 | |||
| 3098 | Ga0496106_0301046 | |||
| 3099 | Ga0496106_0557531 | |||
| 3100 | Ga0496107_0126937 | |||
| 3101 | Ga0496107_0651161 | |||
| 3102 | Ga0496109_0594315 | |||
| 3103 | Ga0496110_0103426 | |||
| 3104 | Ga0496112_0501711 | |||
| 3105 | Ga0496112_0884512 | |||
| 3106 | Ga0496114_0021928 | |||
| 3107 | Ga0496115_0134495 | |||
| 3108 | Ga0496115_0152875 | |||
| 3109 | Ga0496115_0501758 | |||
| 3110 | Ga0496115_0741324 | |||
| 3111 | Ga0496115_0773764 | |||
| 3112 | Ga0501031_0024798 | |||
| 3113 | Ga0501032_0032955 | |||
| 3114 | Ga0501033_0057175 | |||
| 3115 | Ga0501034_0164665 | |||
| 3116 | Ga0501036_0000271 | |||
| 3117 | Ga0501036_0212525 | |||
| 3118 | Ga0501037_0113122 | |||
| 3119 | Ga0501038_0041377 | |||
| 3120 | Ga0501039_0001023 | |||
| 3121 | Ga0501039_0163818 | |||
| 3122 | Ga0501039_1014729 | |||
| 3123 | Ga0501040_0081789 | |||
| 3124 | Ga0501040_0208399 | |||
| 3125 | Ga0501041_0096339 | |||
| 3126 | Ga0501042_1096008 | |||
| 3127 | Ga0501043_0045931 | |||
| 3128 | Ga0501043_0108308 | |||
| 3129 | Ga0501046_0001715 | |||
| 3130 | Ga0501046_0220371 | |||
| 3131 | Ga0501046_0523886 | |||
| 3132 | Ga0501047_0078052 | |||
| 3133 | Ga0501047_0165397 | |||
| 3134 | Ga0501048_0002444 | |||
| 3135 | Ga0501067_0008591 | |||
| 3136 | Ga0501068_0011651 | |||
| 3137 | Ga0501069_0033574 | |||
| 3138 | Ga0501070_0459034 | |||
| 3139 | Ga0501072_0029641 | |||
| 3140 | Ga0501072_0508033 | |||
| 3141 | Ga0501073_0022059 | |||
| 3142 | Ga0501074_0071146 | |||
| 3143 | Ga0501074_0098746 | |||
| 3144 | Ga0501075_0042844 | |||
| 3145 | Ga0501075_0753470 | |||
| 3146 | Ga0501075_0894116 | |||
| 3147 | Ga0501076_0001624 | |||
| 3148 | Ga0501076_0151568 | |||
| 3149 | Ga0501076_0338085 | |||
| 3150 | Ga0501077_0004653 | |||
| 3151 | Ga0501077_0025080 | |||
| 3152 | Ga0501077_0058407 | |||
| 3153 | Ga0501235_047766 | |||
| 3154 | Ga0501250_032609 | |||
| 3155 | Ga0501257_024296 | |||
| 3156 | Ga0501259_072921 | |||
| 3157 | Ga0501225_0052312 | |||
| 3158 | Ga0501079_0014191 | |||
| 3159 | Ga0501079_0017703 | |||
| 3160 | Ga0501079_1355206 | |||
| 3161 | Ga0501080_0052114 | |||
| 3162 | Ga0501080_0214540 | |||
| 3163 | Ga0501080_0921413 | |||
| 3164 | Ga0501081_0000475 | |||
| 3165 | Ga0501081_0231180 | |||
| 3166 | Ga0501081_0347406 | |||
| 3167 | Ga0501083_0054848 | |||
| 3168 | Ga0501035_0119002 | |||
| 3169 | Ga0501035_0696454 | |||
| 3170 | Ga0501044_0116744 | |||
| 3171 | nmdc:mga03n38_17374_c1 | |||
| 3172 | nmdc:mga03n38_35075_c1 | |||
| 3173 | nmdc:mga06z11_312743_c1 | |||
| 3174 | nmdc:mga06z11_735806_c1 | |||
| 3175 | nmdc:mga07m45_145970_c1 | |||
| 3176 | nmdc:mga07m45_539019_c1 | |||
| 3177 | nmdc:mga05p37_125039_c1 | |||
| 3178 | nmdc:mga05p37_129768_c1 | |||
| 3179 | nmdc:mga05p37_338782_c2 | |||
| 3180 | nmdc:mga05p37_39379_c1 | |||
| 3181 | nmdc:mga05p37_414217_c1 | |||
| 3182 | nmdc:mga05p37_472763_c1 | |||
| 3183 | nmdc:mga09592_262536_c1 | |||
| 3184 | nmdc:mga09592_389439_c1 | |||
| 3185 | nmdc:mga09592_434945_c1 | |||
| 3186 | nmdc:mga09592_552004_c1 | |||
| 3187 | nmdc:mga09592_60333_c1 | |||
| 3188 | nmdc:mga0qj67_29683_c1 | |||
| 3189 | nmdc:mga0qj67_31569_c1 | |||
| 3190 | nmdc:mga06r32_240_c1 | |||
| 3191 | nmdc:mga06r32_464452_c1 | |||
| 3192 | nmdc:mga06r32_73091_c1 | |||
| 3193 | nmdc:mga08y16_50222_c1 | |||
| 3194 | nmdc:mga0n895_20157_c1 | |||
| 3195 | nmdc:mga0n895_310352_c1 | |||
| 3196 | nmdc:mga0n895_837255_c1 | |||
| 3197 | nmdc:mga0rr50_132028_c1 | |||
| 3198 | nmdc:mga0rr50_1353826_c1 | |||
| 3199 | nmdc:mga0rr50_139429_c1 | |||
| 3200 | nmdc:mga0rr50_215168_c1 | |||
| 3201 | nmdc:mga0rr50_448736_c1 | |||
| 3202 | nmdc:mga0rr50_654789_c1 | |||
| 3203 | nmdc:mga0rr50_849630_c1 | |||
| 3204 | nmdc:mga08x19_1791_c1 | |||
| 3205 | nmdc:mga08x19_231932_c1 | |||
| 3206 | nmdc:mga0a205_250257_c1 | |||
| 3207 | nmdc:mga0a205_306760_c1 | |||
| 3208 | nmdc:mga0a205_628980_c1 | |||
| 3209 | nmdc:mga0a205_665473_c1 | |||
| 3210 | nmdc:mga0a205_739243_c1 | |||
| 3211 | nmdc:mga0a205_8916_c1 | |||
| 3212 | nmdc:mga0a205_911109_c1 | |||
| 3213 | nmdc:mga0a205_961216_c1 | |||
| 3214 | Ga0495619_0442875 | |||
| 3215 | Ga0500644_0000002 | |||
| 3216 | Ga0500647_0000012 | |||
| 3217 | Ga0500583_0496959 | |||
| 3218 | Ga0500651_0002297 | |||
| 3219 | Ga0500641_0001325 | |||
| 3220 | Ga0500648_000006 | |||
| 3221 | Ga0500650_0000070 | |||
| 3222 | Ga0500642_0003400 | |||
| 3223 | Ga0500568_0003342 | |||
| 3224 | Ga0500577_0000003 | |||
| 3225 | Ga0500588_0024291 | |||
| 3226 | Ga0500604_0026223 | |||
| 3227 | Ga0500637_0009880 | |||
| 3228 | Ga0500649_070870 | |||
| 3229 | Ga0500645_210790 | |||
| 3230 | Ga0501084_0022618 | |||
| 3231 | Ga0501084_0088994 | |||
| 3232 | Ga0501084_0437588 | |||
| 3233 | Ga0587084_043643 | |||
| 3234 | Ga0587070_083707 | |||
| 3235 | Ga0587073_0060500 | |||
| 3236 | Ga0587083_0038110 | |||
| 3237 | Ga0587085_097648 | |||
| 3238 | Ga0587088_098636 | |||
| 3239 | Ga0587091_059570 | |||
| 3240 | Ga0587092_017348 | |||
| 3241 | Ga0587092_060759 | |||
| 3242 | Ga0587106_017865 | |||
| 3243 | Ga0587101_126038 | |||
| 3244 | Ga0587109_078498 | |||
| 3245 | Ga0587109_096569 | |||
| 3246 | Ga0587062_010776 | |||
| 3247 | Ga0587072_061068 | |||
| 3248 | Ga0587114_021420 | |||
| 3249 | Ga0587111_0123911 | |||
| 3250 | Ga0501082_0000140 | |||
| 3251 | Ga0501082_0035433 | |||
| 3252 | Ga0501082_0142200 | |||
| 3253 | Ga0501082_0253504 | |||
| 3254 | Ga0530510_0003506 | |||
| 3255 | Ga0530510_0071270 | |||
| 3256 | Ga0530510_0219539 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1hc8-assembly2.cif.gz_B | crystal structure of a conserved ribosomal protein-rna complex | 0.9961 | 71 | 140 |
| 1mms-assembly2.cif.gz_B | crystal structure of the ribosomal protein l11-rna complex | 0.9917 | 71 | 140 |
| 1y39-assembly2.cif.gz_B | co-evolution of protein and rna structures within a highly conserved ribosomal domain | 0.9884 | 70 | 140 |
| 1hc8-assembly2.cif.gz_B | crystal structure of a conserved ribosomal protein-rna complex | 0.9821 | 71 | 140 |
| 1mms-assembly2.cif.gz_B | crystal structure of the ribosomal protein l11-rna complex | 0.9779 | 71 | 140 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1J9L7_135_215_1.10.10.250 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain | 0.9956 | 72 | 139 | 1.10.10.250 |
| af_P54030_78_161_1.10.10.250 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain | 0.9956 | 80 | 139 | 1.10.10.250 |
| af_A0A0R4J4M9_4_71_3.30.1550.10 | Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain | 0.977 | 3 | 67 | 3.30.1550.10 |
| 1hc8A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain | 0.9765 | 67 | 140 | 1.10.10.250 |
| 1vq4I00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain | 0.9725 | 73 | 140 | 1.10.10.250 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S7TEL3-F1-model_v4 | deleted | 1.002 | 73 | 140 |
|
| AF-A0A645A187-F1-model_v4 | 50S ribosomal protein L11 | 1.002 | 78 | 140 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-A0A3C2CCG8-F1-model_v4 | deleted | 1.002 | 80 | 140 |
|
| AF-A0A5N9EE46-F1-model_v4 | 50S ribosomal protein L11 | 1.001 | 1 | 67 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-A0A2D7JF69-F1-model_v4 | 50S ribosomal protein L11 | 1 | 1 | 71 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |