F495124

General Info

Members Datasets Scaffolds Average Seq Length
1629 478 3258 260

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0015258|Ga0496105_0015258_996_1808
Length 270
Sequence MSAVVGVNRSAGMNRARSAYRAGLTLMVAAACYEAIARSGYFPAALLPTLPKVASTLWTLTLDGTMLEHSAATMYRVLFGLSLAIAVGLPLGILMGRFRPVENFFLPLSSALMPIPSLAWVPVFILWFGLGNTVAILIVFYALFPMLLNAWSGVRAVNPLWLRAAGAMGADERALFWKVIIPGASPFIITGLRQAFLRAWIAVIGAEMLAASDWGLGWVIFDAKEFLNADVMLAALAVIGLIGFLFERLVFGSIERATVMRWGMVRTAKG

Samples

Sample ID Description Type Environment
1 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
13 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
14 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
15 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
18 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
19 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
20 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
21 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
22 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
23 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
24 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
25 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
59 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
62 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
63 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
64 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
72 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
78 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
79 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
80 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
81 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
82 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
83 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
88 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
89 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
93 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
94 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
95 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
96 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
102 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
103 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
104 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
105 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
106 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
107 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
108 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
109 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
110 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
111 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
112 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
113 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
114 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
115 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
117 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
118 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
119 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
120 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
121 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
122 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
123 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
124 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
125 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
126 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
127 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
128 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
129 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
130 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
131 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
132 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
134 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
135 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
136 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
137 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
138 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
139 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
140 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
141 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
142 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
143 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
144 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
145 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
146 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
147 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
148 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
149 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
150 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
151 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
152 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
153 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
154 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
155 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
156 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
157 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
158 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
159 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
160 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
161 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
162 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
163 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
165 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
166 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
242 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
246 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
247 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
248 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
249 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
250 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
251 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
252 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
253 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
254 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
255 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
256 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
257 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
258 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
259 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
260 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
261 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
262 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
263 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
264 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
265 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
266 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
267 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
268 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
269 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
270 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
271 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
272 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
273 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
274 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
275 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
276 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
277 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
278 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
279 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
280 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
281 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
282 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
283 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
284 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
285 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
286 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
287 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
288 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
289 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
290 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
291 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
292 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
293 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
294 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
295 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
296 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
297 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
298 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
299 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
300 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
301 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
302 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
303 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
304 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
305 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
306 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
307 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
308 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
309 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
310 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
311 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
312 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
313 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
314 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
315 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
316 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
317 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
318 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
319 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
320 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
321 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
322 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
323 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
324 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
325 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
326 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
327 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
328 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
329 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
330 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
331 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
332 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
333 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
334 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
335 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
336 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
337 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
338 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
339 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
340 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
341 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
342 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
343 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
344 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
345 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
346 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
347 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
348 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
349 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
350 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
351 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
352 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
353 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
354 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
355 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
356 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
357 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
358 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
359 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
360 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
361 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
362 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
363 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
364 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
365 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
366 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
367 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
368 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
369 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
370 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
371 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
372 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
373 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
374 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
375 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
376 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
377 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
378 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
379 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
380 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
381 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
382 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
383 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
384 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
385 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
386 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
387 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
388 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
389 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
390 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
391 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
392 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
393 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
394 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
395 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
396 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
397 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
398 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
399 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
400 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
401 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
402 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
403 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
404 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
405 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
406 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
407 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
408 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
409 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
420 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
425 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
426 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
427 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
428 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
429 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
430 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
431 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
432 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
433 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
434 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
435 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
436 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
437 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
438 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
439 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
442 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
443 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
444 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
445 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
446 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
447 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
448 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
449 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
450 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
451 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
452 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
453 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
454 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
455 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
456 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
457 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
458 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
459 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
460 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
461 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
462 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
463 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
464 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
465 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
466 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
467 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
468 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
469 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
470 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
471 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
472 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
473 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
474 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
475 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
476 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
477 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
478 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.21
Nodule 0
Rhizoplane 7.06
Rhizosphere 90.3
Stem 0
Stem Tuber 0
Unclassified 1.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496105_0015258 3300048908 Bacteria 6119
2 2214772980 2209111006 Bacteria 12584
3 ARcpr5oldR_c000026 3300000041 Bacteria 30226
4 ARSoilYngRDRAFT_c00029 3300000042 Bacteria 22121
5 ARcpr5yngRDRAFT_c000044 3300000043 Bacteria 19945
6 ARSoilOldRDRAFT_c000037 3300000044 Bacteria 30277
7 ARCol0yngRDRAFT_1000020 3300000652 Bacteria 30273
8 JGI24032J14994_100929 3300001430 Bacteria 1405
9 JGI24746J21847_1004318 3300001977 Bacteria 2242
10 JGI24739J22299_10004550 3300001989 Bacteria 5302
11 JGI24739J22299_10008850 3300001989 Bacteria 3753
12 JGI24737J22298_10001930 3300001990 Bacteria 7416
13 JGI24743J22301_10002254 3300001991 Bacteria 2866
14 JGI24743J22301_10003452 3300001991 Bacteria 2502
15 JGI24750J21931_1000586 3300002070 Bacteria 5547
16 JGI24750J21931_1006717 3300002070 Bacteria 1438
17 JGI24745J21846_1000864 3300002073 Bacteria 2808
18 JGI24738J21930_10003187 3300002075 Bacteria 4188
19 JGI24744J21845_10000745 3300002077 Bacteria 6048
20 JGI24744J21845_10031793 3300002077 Bacteria 1008
21 JGI24035J26624_1001145 3300002126 Bacteria 2512
22 JGI24033J26618_1000244 3300002155 Bacteria 6086
23 JGI24034J26672_10005584 3300002239 Bacteria 1804
24 JGI24742J22300_10000139 3300002244 Bacteria 10736
25 JGI24751J29686_10025022 3300002459 Bacteria 1239
26 JGI25153J46596_10003184 3300003215 Bacteria 9241
27 rootH2_10006376 3300003320 Bacteria 1061
28 Ga0065717_1003669 3300005276 Bacteria 1206
29 Ga0065716_1001673 3300005277 Bacteria 4322
30 Ga0065712_10036972 3300005290 Bacteria 971
31 Ga0065712_10071735 3300005290 Bacteria 5090
32 Ga0065712_10077193 3300005290 Bacteria 3510
33 Ga0065715_10012820 3300005293 Bacteria 2379
34 Ga0065715_10017550 3300005293 Bacteria 2405
35 Ga0065715_10092917 3300005293 Bacteria 4880
36 Ga0070658_10021114 3300005327 Bacteria 5216
37 Ga0070676_10001078 3300005328 Bacteria 13598
38 Ga0070683_100007390 3300005329 Bacteria 9282
39 Ga0070683_100108972 3300005329 Bacteria 2612
40 Ga0070690_100014887 3300005330 Bacteria 4625
41 Ga0070690_100046335 3300005330 Bacteria 2764
42 Ga0070690_100291210 3300005330 Bacteria 1168
43 Ga0070690_100380229 3300005330 Bacteria 1032
44 Ga0070670_100037546 3300005331 Bacteria 4168
45 Ga0070670_100089771 3300005331 Bacteria 2642
46 Ga0070677_10000668 3300005333 Bacteria 11465
47 Ga0068869_100013686 3300005334 Bacteria 5403
48 Ga0068869_100022846 3300005334 Bacteria 4313
49 Ga0068869_100051408 3300005334 Bacteria 2990
50 Ga0068869_100502095 3300005334 Bacteria 1013
51 Ga0070666_10085683 3300005335 Bacteria 2158
52 Ga0070680_100004715 3300005336 Bacteria 10260
53 Ga0070680_100013186 3300005336 Bacteria 6434
54 Ga0070680_100021923 3300005336 Bacteria 5080
55 Ga0070680_100024576 3300005336 Bacteria 4814
56 Ga0070680_100234127 3300005336 Bacteria 1551
57 Ga0070680_100285286 3300005336 Bacteria 1399
58 Ga0070680_100301660 3300005336 Bacteria 1358
59 Ga0070682_100001091 3300005337 Bacteria 15614
60 Ga0070682_100315815 3300005337 Unclassified 1152
61 Ga0068868_100031802 3300005338 Bacteria 4057
62 Ga0068868_100037790 3300005338 Bacteria 3744
63 Ga0070660_100001398 3300005339 Bacteria 16443
64 Ga0070660_100050299 3300005339 Bacteria 3206
65 Ga0070660_100058854 3300005339 Bacteria 2979
66 Ga0070689_100003399 3300005340 Bacteria 10580
67 Ga0070689_100017677 3300005340 Bacteria 5243
68 Ga0070689_100028202 3300005340 Bacteria 4241
69 Ga0070689_100080413 3300005340 Bacteria 2557
70 Ga0070689_100197151 3300005340 Bacteria 1642
71 Ga0070689_100381444 3300005340 Bacteria 1188
72 Ga0070691_10000769 3300005341 Bacteria 12720
73 Ga0070691_10002420 3300005341 Bacteria 8280
74 Ga0070691_10057313 3300005341 Bacteria 1869
75 Ga0070691_10062640 3300005341 Bacteria 1791
76 Ga0070687_100005958 3300005343 Bacteria 4960
77 Ga0070687_100037605 3300005343 Bacteria 2421
78 Ga0070687_100082540 3300005343 Bacteria 1758
79 Ga0070661_100001076 3300005344 Bacteria 19335
80 Ga0070661_100061862 3300005344 Bacteria 2748
81 Ga0070692_10006678 3300005345 Bacteria 5027
82 Ga0070692_10142810 3300005345 Bacteria 1356
83 Ga0070668_100012317 3300005347 Bacteria 6370
84 Ga0070668_100222315 3300005347 Bacteria 1558
85 Ga0070668_100426049 3300005347 Bacteria 1137
86 Ga0070669_100005888 3300005353 Bacteria 8845
87 Ga0070669_100086940 3300005353 Bacteria 2336
88 Ga0070669_100161681 3300005353 Bacteria 1740
89 Ga0070675_100000727 3300005354 Bacteria 22927
90 Ga0070675_100292551 3300005354 Bacteria 1433
91 Ga0070675_100303869 3300005354 Bacteria 1406
92 Ga0070671_100000438 3300005355 Bacteria 28920
93 Ga0070671_100017456 3300005355 Bacteria 5813
94 Ga0070671_100018195 3300005355 Bacteria 5704
95 Ga0070671_100097382 3300005355 Bacteria 2467
96 Ga0070671_100384509 3300005355 Bacteria 1200
97 Ga0070674_100001976 3300005356 Bacteria 11215
98 Ga0070674_100004009 3300005356 Bacteria 8344
99 Ga0070674_100036693 3300005356 Bacteria 3292
100 Ga0070674_100037164 3300005356 Bacteria 3273
101 Ga0070674_100076955 3300005356 Bacteria 2374
102 Ga0070673_100001186 3300005364 Bacteria 14992
103 Ga0070673_100064845 3300005364 Bacteria 2911
104 Ga0070673_100069361 3300005364 Bacteria 2825
105 Ga0070673_100078510 3300005364 Bacteria 2671
106 Ga0070673_100231226 3300005364 Bacteria 1604
107 Ga0070673_100308282 3300005364 Bacteria 1396
108 Ga0070688_100003863 3300005365 Bacteria 7770
109 Ga0070688_100022325 3300005365 Bacteria 3706
110 Ga0070688_100236361 3300005365 Bacteria 1295
111 Ga0070688_100298893 3300005365 Bacteria 1163
112 Ga0070659_100005874 3300005366 Bacteria 8843
113 Ga0070659_100058285 3300005366 Bacteria 3048
114 Ga0070659_100159515 3300005366 Bacteria 1844
115 Ga0070659_100536262 3300005366 Bacteria 1001
116 Ga0070667_100005963 3300005367 Bacteria 10128
117 Ga0070667_100141067 3300005367 Bacteria 2110
118 Ga0070667_100150888 3300005367 Bacteria 2041
119 Ga0070703_10002528 3300005406 Bacteria 5263
120 Ga0070709_10015469 3300005434 Bacteria 4342
121 Ga0070709_10373331 3300005434 Bacteria 1059
122 Ga0070714_100085977 3300005435 Bacteria 2748
123 Ga0070713_100015791 3300005436 Bacteria 5658
124 Ga0070713_100057053 3300005436 Bacteria 3249
125 Ga0070713_100100725 3300005436 Bacteria 2501
126 Ga0070713_100305905 3300005436 Bacteria 1465
127 Ga0070710_10021397 3300005437 Bacteria 3370
128 Ga0070710_10055864 3300005437 Bacteria 2233
129 Ga0070710_10145315 3300005437 Bacteria 1458
130 Ga0070710_10161886 3300005437 Bacteria 1388
131 Ga0070701_10000339 3300005438 Bacteria 15527
132 Ga0070701_10010726 3300005438 Bacteria 4065
133 Ga0070701_10127112 3300005438 Bacteria 1444
134 Ga0070711_100027442 3300005439 Bacteria 3738
135 Ga0070711_100034179 3300005439 Bacteria 3390
136 Ga0070711_100175493 3300005439 Bacteria 1637
137 Ga0070711_100189934 3300005439 Bacteria 1578
138 Ga0070711_100199417 3300005439 Bacteria 1543
139 Ga0070711_100291549 3300005439 Bacteria 1294
140 Ga0070705_100000010 3300005440 Bacteria 102079
141 Ga0070705_100005352 3300005440 Bacteria 6249
142 Ga0070705_100023818 3300005440 Bacteria 3294
143 Ga0070705_100080736 3300005440 Bacteria 1996
144 Ga0070700_100000783 3300005441 Bacteria 15666
145 Ga0070700_100019322 3300005441 Bacteria 3930
146 Ga0070700_100034755 3300005441 Bacteria 3046
147 Ga0070700_100129382 3300005441 Bacteria 1702
148 Ga0070694_100006633 3300005444 Bacteria 7034
149 Ga0070694_100249244 3300005444 Bacteria 1343
150 Ga0070694_100277901 3300005444 Bacteria 1276
151 Ga0070694_100409326 3300005444 Bacteria 1063
152 Ga0070694_100510658 3300005444 Bacteria 957
153 Ga0070694_100570064 3300005444 Unclassified 908
154 Ga0070708_100015350 3300005445 Bacteria 6324
155 Ga0070663_100017471 3300005455 Bacteria 4682
156 Ga0070663_100025858 3300005455 Bacteria 3968
157 Ga0070663_100033005 3300005455 Bacteria 3573
158 Ga0070663_100040103 3300005455 Bacteria 3276
159 Ga0070663_100134439 3300005455 Bacteria 1882
160 Ga0070663_100225422 3300005455 Bacteria 1473
161 Ga0070678_100006186 3300005456 Bacteria 6997
162 Ga0070678_100011564 3300005456 Bacteria 5451
163 Ga0070678_100026061 3300005456 Bacteria 3947
164 Ga0070678_100045182 3300005456 Bacteria 3149
165 Ga0070678_100077198 3300005456 Bacteria 2512
166 Ga0070678_100160180 3300005456 Bacteria 1822
167 Ga0070662_100017941 3300005457 Bacteria 4778
168 Ga0070662_100065940 3300005457 Bacteria 2655
169 Ga0070662_100093667 3300005457 Bacteria 2260
170 Ga0070662_100121519 3300005457 Bacteria 2002
171 Ga0070662_100364784 3300005457 Bacteria 1186
172 Ga0070681_10046880 3300005458 Bacteria 4320
173 Ga0070681_10051242 3300005458 Bacteria 4117
174 Ga0070681_10077725 3300005458 Bacteria 3276
175 Ga0068867_100031591 3300005459 Bacteria 3824
176 Ga0068867_100046946 3300005459 Bacteria 3174
177 Ga0068867_100060743 3300005459 Bacteria 2804
178 Ga0068867_100696329 3300005459 Bacteria 896
179 Ga0068867_100722585 3300005459 Unclassified 881
180 Ga0070685_10005962 3300005466 Bacteria 6203
181 Ga0070685_10009847 3300005466 Bacteria 4957
182 Ga0070685_10022940 3300005466 Bacteria 3410
183 Ga0070685_10088559 3300005466 Bacteria 1870
184 Ga0070685_10231391 3300005466 Bacteria 1216
185 Ga0070707_100232584 3300005468 Bacteria 1794
186 Ga0070699_100001314 3300005518 Bacteria 22902
187 Ga0070699_100010423 3300005518 Bacteria 8044
188 Ga0070679_100021002 3300005530 Bacteria 6371
189 Ga0070679_100034318 3300005530 Bacteria 5027
190 Ga0070679_100056408 3300005530 Bacteria 3914
191 Ga0070679_100076400 3300005530 Bacteria 3339
192 Ga0070679_100084600 3300005530 Bacteria 3160
193 Ga0070679_100158636 3300005530 Bacteria 2236
194 Ga0070679_100208393 3300005530 Bacteria 1919
195 Ga0070679_100315865 3300005530 Bacteria 1512
196 Ga0070679_100507683 3300005530 Bacteria 1149
197 Ga0070684_100030785 3300005535 Bacteria 4564
198 Ga0070684_100128485 3300005535 Bacteria 2285
199 Ga0070684_100134636 3300005535 Bacteria 2231
200 Ga0070684_100630839 3300005535 Bacteria 997
201 Ga0070697_100039300 3300005536 Bacteria 3825
202 Ga0070697_100441764 3300005536 Bacteria 1132
203 Ga0068853_100004375 3300005539 Bacteria 10933
204 Ga0068853_100042579 3300005539 Bacteria 3883
205 Ga0068853_100579519 3300005539 Bacteria 1064
206 Ga0070672_100011149 3300005543 Bacteria 6259
207 Ga0070672_100078196 3300005543 Bacteria 2647
208 Ga0070672_100448528 3300005543 Bacteria 1111
209 Ga0070686_100006762 3300005544 Bacteria 6383
210 Ga0070686_100049853 3300005544 Bacteria 2658
211 Ga0070686_100103076 3300005544 Bacteria 1931
212 Ga0070686_100151671 3300005544 Bacteria 1624
213 Ga0070686_100213897 3300005544 Bacteria 1389
214 Ga0070686_100266991 3300005544 Bacteria 1257
215 Ga0070686_100416152 3300005544 Bacteria 1026
216 Ga0070695_100001719 3300005545 Bacteria 12317
217 Ga0070695_100030227 3300005545 Bacteria 3371
218 Ga0070695_100066208 3300005545 Bacteria 2354
219 Ga0070695_100260215 3300005545 Bacteria 1267
220 Ga0070696_100002812 3300005546 Bacteria 11557
221 Ga0070696_100029222 3300005546 Bacteria 3766
222 Ga0070693_100000577 3300005547 Bacteria 16215
223 Ga0070693_100010134 3300005547 Bacteria 4709
224 Ga0070665_100076321 3300005548 Bacteria 3358
225 Ga0070665_100085305 3300005548 Bacteria 3163
226 Ga0070704_100028556 3300005549 Bacteria 3713
227 Ga0070704_100295544 3300005549 Bacteria 1347
228 Ga0068855_100014148 3300005563 Bacteria 9611
229 Ga0068855_100138074 3300005563 Bacteria 2780
230 Ga0068855_100190703 3300005563 Bacteria 2312
231 Ga0070664_100002073 3300005564 Bacteria 16008
232 Ga0070664_100070153 3300005564 Bacteria 3000
233 Ga0070664_100138824 3300005564 Bacteria 2139
234 Ga0070664_100145042 3300005564 Bacteria 2093
235 Ga0070664_100167671 3300005564 Bacteria 1946
236 Ga0070664_100175888 3300005564 Bacteria 1900
237 Ga0070664_100386735 3300005564 Bacteria 1278
238 Ga0068857_100008536 3300005577 Bacteria 8859
239 Ga0068857_100011549 3300005577 Bacteria 7685
240 Ga0068857_100447288 3300005577 Bacteria 1207
241 Ga0068857_100511643 3300005577 Bacteria 1128
242 Ga0068854_100001074 3300005578 Bacteria 16449
243 Ga0068854_100049093 3300005578 Bacteria 3013
244 Ga0068854_100539611 3300005578 Bacteria 988
245 Ga0068856_100026335 3300005614 Bacteria 5671
246 Ga0068856_100039625 3300005614 Bacteria 4625
247 Ga0068856_100046914 3300005614 Bacteria 4256
248 Ga0070702_100005245 3300005615 Bacteria 6011
249 Ga0070702_100023173 3300005615 Bacteria 3295
250 Ga0068852_100001086 3300005616 Bacteria 17979
251 Ga0068852_100016187 3300005616 Bacteria 5807
252 Ga0068852_100054483 3300005616 Bacteria 3447
253 Ga0068852_100055479 3300005616 Bacteria 3420
254 Ga0068859_100003708 3300005617 Bacteria 15569
255 Ga0068859_100023234 3300005617 Bacteria 6221
256 Ga0068859_100108837 3300005617 Bacteria 2832
257 Ga0068859_100127411 3300005617 Bacteria 2616
258 Ga0068864_100025772 3300005618 Bacteria 4956
259 Ga0068864_100039525 3300005618 Bacteria 4032
260 Ga0068864_100042873 3300005618 Bacteria 3873
261 Ga0068864_100053465 3300005618 Bacteria 3484
262 Ga0068864_100070454 3300005618 Bacteria 3042
263 Ga0068864_100093083 3300005618 Bacteria 2662
264 Ga0068866_10000403 3300005718 Bacteria 20138
265 Ga0068866_10002088 3300005718 Bacteria 8310
266 Ga0068866_10103993 3300005718 Bacteria 1572
267 Ga0068866_10334537 3300005718 Bacteria 957
268 Ga0068861_100180454 3300005719 Bacteria 1757
269 Ga0068861_100253512 3300005719 Bacteria 1503
270 Ga0068851_10190099 3300005834 Bacteria 1141
271 Ga0068870_10000860 3300005840 Bacteria 11868
272 Ga0068870_10001886 3300005840 Bacteria 8637
273 Ga0068870_10186282 3300005840 Bacteria 1249
274 Ga0068863_100003728 3300005841 Bacteria 15069
275 Ga0068863_100036918 3300005841 Bacteria 4652
276 Ga0068863_100248817 3300005841 Bacteria 1717
277 Ga0068863_100570405 3300005841 Bacteria 1118
278 Ga0068858_100024112 3300005842 Bacteria 5670
279 Ga0068858_100032605 3300005842 Bacteria 4837
280 Ga0068858_100145199 3300005842 Bacteria 2228
281 Ga0068858_100185868 3300005842 Bacteria 1963
282 Ga0068858_100201782 3300005842 Bacteria 1881
283 Ga0068858_100220118 3300005842 Bacteria 1798
284 Ga0068860_100013440 3300005843 Bacteria 8028
285 Ga0068860_100023327 3300005843 Bacteria 5980
286 Ga0068860_100053505 3300005843 Bacteria 3838
287 Ga0068860_100099064 3300005843 Bacteria 2780
288 Ga0068860_100349123 3300005843 Bacteria 1456
289 Ga0068860_100813597 3300005843 Unclassified 948
290 Ga0068862_100003043 3300005844 Bacteria 14604
291 Ga0068862_100024080 3300005844 Bacteria 5105
292 Ga0068862_100177573 3300005844 Bacteria 1910
293 Ga0081455_10000012 3300005937 Bacteria 201668
294 Ga0081455_10007967 3300005937 Bacteria 11076
295 Ga0081455_10119932 3300005937 Bacteria 2074
296 Ga0081455_10188134 3300005937 Bacteria 1558
297 Ga0081455_10286256 3300005937 Bacteria 1188
298 Ga0081538_10018338 3300005981 Bacteria 5260
299 Ga0081538_10047804 3300005981 Bacteria 2619
300 Ga0081540_1002413 3300005983 Bacteria 15223
301 Ga0081540_1024424 3300005983 Bacteria 3507
302 Ga0081540_1027356 3300005983 Bacteria 3233
303 Ga0081540_1031022 3300005983 Bacteria 2949
304 Ga0081540_1084127 3300005983 Bacteria 1421
305 Ga0081539_10080906 3300005985 Bacteria 1707
306 Ga0081539_10197348 3300005985 Bacteria 932
307 Ga0070717_10007114 3300006028 Bacteria 8292
308 Ga0070717_10056934 3300006028 Bacteria 3231
309 Ga0070717_10076908 3300006028 Bacteria 2794
310 Ga0070717_10085547 3300006028 Bacteria 2654
311 Ga0075365_10048846 3300006038 Bacteria 2786
312 Ga0075365_10399680 3300006038 Bacteria 970
313 Ga0075364_10008816 3300006051 Bacteria 6037
314 Ga0075432_10001490 3300006058 Bacteria 7644
315 Ga0070715_10006260 3300006163 Bacteria 4033
316 Ga0070716_100009562 3300006173 Bacteria 4834
317 Ga0070712_100025089 3300006175 Bacteria 3958
318 Ga0070712_100063297 3300006175 Bacteria 2619
319 Ga0070712_100095285 3300006175 Bacteria 2189
320 Ga0070712_100342684 3300006175 Bacteria 1221
321 Ga0075362_10000839 3300006177 Bacteria 9234
322 Ga0075362_10050193 3300006177 Bacteria 1865
323 Ga0075362_10075317 3300006177 Bacteria 1548
324 Ga0075367_10039470 3300006178 Bacteria 2753
325 Ga0075367_10047173 3300006178 Bacteria 2534
326 Ga0075366_10001687 3300006195 Bacteria 11092
327 Ga0097621_100000421 3300006237 Bacteria 29460
328 Ga0097621_100008029 3300006237 Bacteria 7577
329 Ga0097621_100176781 3300006237 Unclassified 1843
330 Ga0097621_100194171 3300006237 Bacteria 1759
331 Ga0075370_10074551 3300006353 Bacteria 1945
332 Ga0068871_100000515 3300006358 Bacteria 26586
333 Ga0068871_100012948 3300006358 Bacteria 6177
334 Ga0068871_100172423 3300006358 Bacteria 1855
335 Ga0075428_100007282 3300006844 Bacteria 12256
336 Ga0075428_100056127 3300006844 Bacteria 4315
337 Ga0075428_100069359 3300006844 Bacteria 3854
338 Ga0075428_100073481 3300006844 Bacteria 3735
339 Ga0075428_100173857 3300006844 Bacteria 2334
340 Ga0075428_100864848 3300006844 Bacteria 960
341 Ga0075430_100028858 3300006846 Bacteria 4711
342 Ga0075430_100060450 3300006846 Bacteria 3184
343 Ga0075431_100001810 3300006847 Bacteria 20184
344 Ga0075431_100072177 3300006847 Bacteria 3562
345 Ga0075431_100120887 3300006847 Bacteria 2702
346 Ga0075431_100143342 3300006847 Bacteria 2462
347 Ga0075431_100264530 3300006847 Bacteria 1745
348 Ga0075433_10002034 3300006852 Bacteria 15272
349 Ga0075433_10006137 3300006852 Bacteria 9468
350 Ga0075433_10008633 3300006852 Bacteria 8131
351 Ga0075433_10062911 3300006852 Bacteria 3250
352 Ga0075434_100000007 3300006871 Bacteria 95975
353 Ga0075434_100000693 3300006871 Bacteria 26314
354 Ga0075434_100001159 3300006871 Bacteria 21806
355 Ga0075434_100042973 3300006871 Bacteria 4481
356 Ga0075434_100060322 3300006871 Bacteria 3773
357 Ga0075434_100128088 3300006871 Bacteria 2556
358 Ga0075434_100152317 3300006871 Bacteria 2332
359 Ga0075429_100240514 3300006880 Bacteria 1586
360 Ga0075429_100561978 3300006880 Bacteria 1000
361 Ga0068865_100002115 3300006881 Bacteria 11728
362 Ga0068865_100033785 3300006881 Bacteria 3426
363 Ga0068865_100251079 3300006881 Bacteria 1396
364 Ga0075436_100002192 3300006914 Bacteria 13473
365 Ga0075436_100004166 3300006914 Bacteria 9922
366 Ga0075436_100027202 3300006914 Bacteria 3937
367 Ga0075436_100131794 3300006914 Bacteria 1753
368 Ga0075436_100357828 3300006914 Bacteria 1053
369 Ga0097620_100003708 3300006931 Bacteria 15569
370 Ga0097620_100023234 3300006931 Bacteria 6221
371 Ga0097620_100108838 3300006931 Bacteria 2832
372 Ga0097620_100127413 3300006931 Bacteria 2616
373 Ga0075435_100000432 3300007076 Bacteria 25629
374 Ga0075435_100025823 3300007076 Bacteria 4577
375 Ga0075435_100032913 3300007076 Bacteria 4097
376 Ga0075435_100039209 3300007076 Bacteria 3780
377 Ga0075435_100105730 3300007076 Bacteria 2336
378 Ga0075435_100228548 3300007076 Bacteria 1580
379 Ga0075435_100260242 3300007076 Bacteria 1478
380 Ga0099795_10093911 3300007788 Bacteria 1167
381 Ga0105244_10049754 3300009036 Bacteria 2140
382 Ga0105250_10131030 3300009092 Bacteria 1035
383 Ga0105240_10037315 3300009093 Bacteria 6246
384 Ga0105240_10294125 3300009093 Bacteria 1860
385 Ga0111539_10004448 3300009094 Bacteria 18316
386 Ga0111539_10005607 3300009094 Bacteria 16233
387 Ga0111539_10013539 3300009094 Bacteria 10195
388 Ga0111539_10017591 3300009094 Bacteria 8846
389 Ga0111539_10019998 3300009094 Bacteria 8247
390 Ga0111539_10061746 3300009094 Bacteria 4439
391 Ga0111539_10087807 3300009094 Bacteria 3653
392 Ga0111539_10197563 3300009094 Bacteria 2346
393 Ga0111539_10518722 3300009094 Bacteria 1388
394 Ga0105245_10002944 3300009098 Bacteria 15281
395 Ga0105245_10069147 3300009098 Bacteria 3202
396 Ga0105245_10119521 3300009098 Bacteria 2460
397 Ga0105245_10215404 3300009098 Bacteria 1850
398 Ga0105245_10353319 3300009098 Unclassified 1457
399 Ga0105245_10994961 3300009098 Bacteria 883
400 Ga0105247_10011296 3300009101 Bacteria 5386
401 Ga0105247_10012837 3300009101 Bacteria 5028
402 Ga0105247_10020997 3300009101 Bacteria 3929
403 Ga0114129_10000742 3300009147 Bacteria 41451
404 Ga0114129_10011756 3300009147 Bacteria 12458
405 Ga0114129_10057318 3300009147 Bacteria 5452
406 Ga0114129_10059035 3300009147 Bacteria 5364
407 Ga0114129_10065278 3300009147 Bacteria 5080
408 Ga0114129_10090263 3300009147 Bacteria 4248
409 Ga0114129_10105879 3300009147 Bacteria 3886
410 Ga0114129_10115499 3300009147 Bacteria 3700
411 Ga0114129_10641417 3300009147 Bacteria 1372
412 Ga0105243_10002574 3300009148 Bacteria 15152
413 Ga0105243_10011951 3300009148 Bacteria 6563
414 Ga0105243_10055144 3300009148 Bacteria 3157
415 Ga0105243_10132540 3300009148 Bacteria 2116
416 Ga0105243_10230745 3300009148 Bacteria 1642
417 Ga0105243_10363934 3300009148 Bacteria 1332
418 Ga0105243_10406274 3300009148 Bacteria 1266
419 Ga0105241_10024036 3300009174 Bacteria 4524
420 Ga0105241_10073396 3300009174 Bacteria 2662
421 Ga0105241_10131225 3300009174 Bacteria 2029
422 Ga0105242_10056433 3300009176 Bacteria 3214
423 Ga0105242_10058622 3300009176 Bacteria 3157
424 Ga0105242_10079357 3300009176 Bacteria 2741
425 Ga0105242_10246851 3300009176 Bacteria 1607
426 Ga0105242_10263768 3300009176 Bacteria 1557
427 Ga0105242_10279010 3300009176 Bacteria 1517
428 Ga0105242_10280681 3300009176 Bacteria 1513
429 Ga0105242_10379756 3300009176 Bacteria 1313
430 Ga0105248_10063653 3300009177 Bacteria 4140
431 Ga0105248_10084997 3300009177 Bacteria 3561
432 Ga0105248_10196174 3300009177 Bacteria 2275
433 Ga0105237_10153564 3300009545 Bacteria 2299
434 Ga0105237_10307346 3300009545 Bacteria 1588
435 Ga0105237_10343928 3300009545 Bacteria 1496
436 Ga0105238_10009936 3300009551 Bacteria 9542
437 Ga0105238_10125728 3300009551 Bacteria 2543
438 Ga0105238_10230806 3300009551 Bacteria 1827
439 Ga0105238_10308501 3300009551 Bacteria 1567
440 Ga0105238_10410489 3300009551 Bacteria 1348
441 Ga0105238_10578225 3300009551 Bacteria 1130
442 Ga0105249_10015879 3300009553 Bacteria 6674
443 Ga0105249_10017602 3300009553 Bacteria 6345
444 Ga0105249_10119957 3300009553 Bacteria 2498
445 Ga0105249_10140512 3300009553 Bacteria 2315
446 Ga0105249_10154222 3300009553 Bacteria 2214
447 Ga0105249_10216131 3300009553 Bacteria 1884
448 Ga0099796_10005153 3300010159 Bacteria 3238
449 Ga0105239_10004537 3300010375 Bacteria 16545
450 Ga0105239_10414429 3300010375 Bacteria 1525
451 Ga0105239_10781048 3300010375 Bacteria 1094
452 Ga0105246_10001092 3300011119 Bacteria 15711
453 Ga0105246_10068302 3300011119 Bacteria 2493
454 Ga0105246_10108258 3300011119 Bacteria 2037
455 Ga0157373_10125287 3300013100 Bacteria 1807
456 Ga0157373_10217607 3300013100 Bacteria 1347
457 Ga0157371_10007315 3300013102 Bacteria 8965
458 Ga0157371_10106396 3300013102 Bacteria 1991
459 Ga0157371_10262381 3300013102 Bacteria 1245
460 Ga0157370_10180697 3300013104 Bacteria 1960
461 Ga0157370_10238648 3300013104 Bacteria 1682
462 Ga0157369_10220624 3300013105 Bacteria 1985
463 Ga0157369_10261134 3300013105 Bacteria 1806
464 Ga0157369_10488880 3300013105 Bacteria 1274
465 Ga0157374_10002049 3300013296 Bacteria 16945
466 Ga0157374_10032857 3300013296 Bacteria 4729
467 Ga0157374_10136595 3300013296 Bacteria 2377
468 Ga0157374_10329981 3300013296 Bacteria 1513
469 Ga0157378_10007541 3300013297 Bacteria 9498
470 Ga0157378_10044852 3300013297 Bacteria 3927
471 Ga0157378_10078787 3300013297 Bacteria 2973
472 Ga0157378_10255188 3300013297 Bacteria 1680
473 Ga0157378_10690813 3300013297 Bacteria 1039
474 Ga0163162_10005029 3300013306 Bacteria 12738
475 Ga0163162_10077208 3300013306 Bacteria 3394
476 Ga0163162_10077995 3300013306 Bacteria 3377
477 Ga0163162_10108051 3300013306 Bacteria 2878
478 Ga0163162_10127619 3300013306 Bacteria 2651
479 Ga0163162_10402046 3300013306 Bacteria 1502
480 Ga0163162_10408190 3300013306 Bacteria 1491
481 Ga0157372_10012748 3300013307 Bacteria 8955
482 Ga0157372_10045191 3300013307 Bacteria 4884
483 Ga0157372_10091294 3300013307 Bacteria 3464
484 Ga0157372_10561435 3300013307 Bacteria 1331
485 Ga0157375_10004037 3300013308 Bacteria 12735
486 Ga0157375_10019784 3300013308 Bacteria 6134
487 Ga0157375_10054327 3300013308 Bacteria 3944
488 Ga0157375_10160750 3300013308 Bacteria 2387
489 Ga0157375_10207198 3300013308 Bacteria 2117
490 Ga0157375_10301436 3300013308 Bacteria 1766
491 Ga0157375_10928382 3300013308 Bacteria 1013
492 Ga0163163_10005574 3300014325 Bacteria 10905
493 Ga0163163_10024568 3300014325 Bacteria 5736
494 Ga0163163_10044684 3300014325 Bacteria 4347
495 Ga0163163_10055637 3300014325 Bacteria 3910
496 Ga0163163_10177888 3300014325 Bacteria 2174
497 Ga0163163_10407254 3300014325 Bacteria 1418
498 Ga0157380_10001279 3300014326 Bacteria 16357
499 Ga0157380_10091519 3300014326 Bacteria 2511
500 Ga0157380_10231218 3300014326 Bacteria 1661
501 Ga0157380_10257088 3300014326 Bacteria 1584
502 Ga0157380_10644173 3300014326 Bacteria 1056
503 Ga0157380_10699440 3300014326 Bacteria 1018
504 Ga0157380_10864854 3300014326 Bacteria 927
505 Ga0157380_10872934 3300014326 Unclassified 923
506 Ga0182008_10032141 3300014497 Bacteria 2638
507 Ga0157377_10000312 3300014745 Bacteria 22340
508 Ga0157377_10010127 3300014745 Bacteria 4652
509 Ga0157379_10001989 3300014968 Bacteria 16918
510 Ga0157379_10029559 3300014968 Bacteria 4872
511 Ga0157379_10063884 3300014968 Bacteria 3291
512 Ga0157379_10088015 3300014968 Bacteria 2784
513 Ga0157379_10161405 3300014968 Unclassified 2023
514 Ga0157376_10001372 3300014969 Bacteria 16037
515 Ga0157376_10037848 3300014969 Bacteria 3921
516 Ga0157376_10054749 3300014969 Bacteria 3327
517 Ga0157376_10067048 3300014969 Bacteria 3035
518 Ga0157376_10735798 3300014969 Bacteria 994
519 Ga0163161_10003480 3300017792 Bacteria 11037
520 Ga0163161_10078656 3300017792 Bacteria 2424
521 Ga0163161_10112250 3300017792 Bacteria 2039
522 Ga0163161_10205986 3300017792 Bacteria 1518
523 Ga0213876_10110816 3300021384 Bacteria 1457
524 Ga0213876_10133655 3300021384 Bacteria 1319
525 Ga0207666_1000038 3300025271 Bacteria 26508
526 Ga0207673_1001708 3300025290 Bacteria 2430
527 Ga0209758_1001233 3300025297 Bacteria 31967
528 Ga0207697_10000373 3300025315 Bacteria 25127
529 Ga0207697_10039973 3300025315 Bacteria 1925
530 Ga0207697_10145323 3300025315 Bacteria 1030
531 Ga0207655_1085718 3300025728 Bacteria 1123
532 Ga0207653_10000559 3300025885 Bacteria 13532
533 Ga0207653_10005254 3300025885 Bacteria 4046
534 Ga0207653_10072307 3300025885 Bacteria 1180
535 Ga0207682_10000071 3300025893 Bacteria 44843
536 Ga0207682_10001862 3300025893 Bacteria 9601
537 Ga0207692_10067079 3300025898 Bacteria 1877
538 Ga0207692_10098281 3300025898 Bacteria 1602
539 Ga0207692_10270858 3300025898 Bacteria 1024
540 Ga0207710_10007122 3300025900 Bacteria 4745
541 Ga0207710_10011401 3300025900 Bacteria 3744
542 Ga0207710_10025753 3300025900 Bacteria 2540
543 Ga0207688_10000237 3300025901 Bacteria 25119
544 Ga0207688_10002075 3300025901 Bacteria 10771
545 Ga0207688_10133137 3300025901 Bacteria 1458
546 Ga0207680_10016997 3300025903 Bacteria 3834
547 Ga0207680_10037949 3300025903 Bacteria 2785
548 Ga0207680_10186825 3300025903 Bacteria 1405
549 Ga0207647_10009005 3300025904 Bacteria 7113
550 Ga0207647_10040967 3300025904 Bacteria 2915
551 Ga0207647_10048394 3300025904 Bacteria 2640
552 Ga0207647_10073935 3300025904 Bacteria 2053
553 Ga0207647_10083625 3300025904 Bacteria 1911
554 Ga0207685_10002917 3300025905 Bacteria 4041
555 Ga0207699_10073451 3300025906 Bacteria 2098
556 Ga0207645_10000779 3300025907 Bacteria 26604
557 Ga0207645_10085716 3300025907 Bacteria 2023
558 Ga0207645_10110454 3300025907 Bacteria 1780
559 Ga0207643_10000276 3300025908 Bacteria 35671
560 Ga0207643_10002314 3300025908 Bacteria 10366
561 Ga0207643_10016243 3300025908 Bacteria 4060
562 Ga0207643_10090843 3300025908 Bacteria 1780
563 Ga0207705_10062534 3300025909 Bacteria 2689
564 Ga0207654_10014702 3300025911 Bacteria 4048
565 Ga0207654_10058895 3300025911 Bacteria 2238
566 Ga0207654_10183138 3300025911 Bacteria 1368
567 Ga0207707_10000454 3300025912 Bacteria 42654
568 Ga0207707_10070862 3300025912 Bacteria 3037
569 Ga0207707_10100506 3300025912 Bacteria 2528
570 Ga0207707_10167955 3300025912 Bacteria 1917
571 Ga0207707_10183377 3300025912 Bacteria 1827
572 Ga0207707_10199840 3300025912 Bacteria 1743
573 Ga0207707_10212418 3300025912 Bacteria 1685
574 Ga0207695_10193073 3300025913 Bacteria 1953
575 Ga0207671_10016484 3300025914 Bacteria 5741
576 Ga0207671_10037376 3300025914 Bacteria 3601
577 Ga0207671_10183842 3300025914 Bacteria 1628
578 Ga0207693_10005073 3300025915 Bacteria 11046
579 Ga0207693_10007312 3300025915 Bacteria 9084
580 Ga0207693_10010718 3300025915 Bacteria 7439
581 Ga0207693_10021275 3300025915 Bacteria 5154
582 Ga0207693_10059589 3300025915 Bacteria 2990
583 Ga0207693_10101245 3300025915 Bacteria 2259
584 Ga0207693_10132910 3300025915 Unclassified 1956
585 Ga0207693_10278799 3300025915 Bacteria 1310
586 Ga0207693_10326774 3300025915 Bacteria 1201
587 Ga0207693_10496060 3300025915 Unclassified 953
588 Ga0207663_10060626 3300025916 Bacteria 2398
589 Ga0207663_10092706 3300025916 Bacteria 2009
590 Ga0207663_10115713 3300025916 Bacteria 1827
591 Ga0207663_10242074 3300025916 Bacteria 1324
592 Ga0207660_10000087 3300025917 Bacteria 49552
593 Ga0207660_10035293 3300025917 Bacteria 3471
594 Ga0207660_10035398 3300025917 Bacteria 3467
595 Ga0207660_10065427 3300025917 Bacteria 2627
596 Ga0207660_10146519 3300025917 Bacteria 1810
597 Ga0207660_10365811 3300025917 Bacteria 1157
598 Ga0207660_10407093 3300025917 Bacteria 1096
599 Ga0207660_10492479 3300025917 Bacteria 994
600 Ga0207662_10000659 3300025918 Bacteria 15653
601 Ga0207662_10006900 3300025918 Bacteria 6157
602 Ga0207662_10009020 3300025918 Bacteria 5479
603 Ga0207662_10037840 3300025918 Bacteria 2826
604 Ga0207662_10047292 3300025918 Bacteria 2548
605 Ga0207657_10003101 3300025919 Bacteria 17768
606 Ga0207657_10005173 3300025919 Bacteria 13682
607 Ga0207657_10019458 3300025919 Bacteria 6446
608 Ga0207657_10090738 3300025919 Bacteria 2550
609 Ga0207649_10000662 3300025920 Bacteria 22982
610 Ga0207649_10013634 3300025920 Bacteria 4541
611 Ga0207649_10039165 3300025920 Bacteria 2872
612 Ga0207649_10061498 3300025920 Bacteria 2364
613 Ga0207649_10169967 3300025920 Unclassified 1517
614 Ga0207652_10001908 3300025921 Bacteria 18069
615 Ga0207652_10008147 3300025921 Bacteria 8415
616 Ga0207652_10023549 3300025921 Bacteria 5101
617 Ga0207652_10050201 3300025921 Bacteria 3574
618 Ga0207652_10065031 3300025921 Bacteria 3157
619 Ga0207652_10111416 3300025921 Bacteria 2427
620 Ga0207652_10133337 3300025921 Bacteria 2217
621 Ga0207652_10459726 3300025921 Bacteria 1147
622 Ga0207681_10001262 3300025923 Bacteria 16334
623 Ga0207681_10038145 3300025923 Bacteria 3181
624 Ga0207681_10228489 3300025923 Bacteria 1443
625 Ga0207681_10308190 3300025923 Bacteria 1255
626 Ga0207681_10390820 3300025923 Bacteria 1122
627 Ga0207694_10017984 3300025924 Bacteria 5342
628 Ga0207694_10166488 3300025924 Bacteria 1783
629 Ga0207650_10005107 3300025925 Bacteria 8956
630 Ga0207650_10159384 3300025925 Bacteria 1787
631 Ga0207659_10000143 3300025926 Bacteria 42200
632 Ga0207659_10026549 3300025926 Bacteria 3909
633 Ga0207659_10057060 3300025926 Bacteria 2798
634 Ga0207659_10070018 3300025926 Bacteria 2557
635 Ga0207659_10202567 3300025926 Bacteria 1586
636 Ga0207659_10401094 3300025926 Bacteria 1147
637 Ga0207687_10000865 3300025927 Bacteria 20461
638 Ga0207687_10052245 3300025927 Bacteria 2852
639 Ga0207687_10120981 3300025927 Bacteria 1958
640 Ga0207687_10235753 3300025927 Bacteria 1448
641 Ga0207700_10000323 3300025928 Bacteria 28133
642 Ga0207700_10034585 3300025928 Bacteria 3629
643 Ga0207700_10063780 3300025928 Bacteria 2804
644 Ga0207700_10070564 3300025928 Bacteria 2686
645 Ga0207700_10078894 3300025928 Bacteria 2563
646 Ga0207700_10229601 3300025928 Bacteria 1577
647 Ga0207700_10431403 3300025928 Bacteria 1159
648 Ga0207664_10075293 3300025929 Bacteria 2729
649 Ga0207664_10511668 3300025929 Bacteria 1075
650 Ga0207644_10000532 3300025931 Bacteria 24677
651 Ga0207644_10015181 3300025931 Bacteria 5166
652 Ga0207644_10045594 3300025931 Bacteria 3119
653 Ga0207644_10166963 3300025931 Bacteria 1715
654 Ga0207690_10000409 3300025932 Bacteria 28156
655 Ga0207690_10074024 3300025932 Bacteria 2358
656 Ga0207690_10186213 3300025932 Bacteria 1567
657 Ga0207706_10001338 3300025933 Bacteria 24639
658 Ga0207706_10006705 3300025933 Bacteria 10645
659 Ga0207706_10026317 3300025933 Bacteria 5207
660 Ga0207706_10037549 3300025933 Bacteria 4300
661 Ga0207706_10058641 3300025933 Bacteria 3390
662 Ga0207706_10121459 3300025933 Bacteria 2297
663 Ga0207686_10000500 3300025934 Bacteria 25713
664 Ga0207686_10082565 3300025934 Bacteria 2101
665 Ga0207686_10173175 3300025934 Bacteria 1524
666 Ga0207686_10301377 3300025934 Bacteria 1190
667 Ga0207709_10001266 3300025935 Bacteria 18089
668 Ga0207709_10037338 3300025935 Bacteria 2886
669 Ga0207709_10161854 3300025935 Bacteria 1561
670 Ga0207709_10196300 3300025935 Bacteria 1438
671 Ga0207709_10203809 3300025935 Unclassified 1415
672 Ga0207670_10000689 3300025936 Bacteria 17866
673 Ga0207670_10004774 3300025936 Bacteria 7352
674 Ga0207670_10007354 3300025936 Bacteria 6140
675 Ga0207670_10064980 3300025936 Bacteria 2503
676 Ga0207670_10156514 3300025936 Bacteria 1697
677 Ga0207670_10370567 3300025936 Bacteria 1138
678 Ga0207669_10001125 3300025937 Bacteria 11423
679 Ga0207669_10036510 3300025937 Bacteria 2809
680 Ga0207669_10051596 3300025937 Bacteria 2465
681 Ga0207669_10409772 3300025937 Bacteria 1064
682 Ga0207704_10000613 3300025938 Bacteria 15794
683 Ga0207704_10075416 3300025938 Bacteria 2156
684 Ga0207665_10001192 3300025939 Bacteria 17511
685 Ga0207665_10052253 3300025939 Bacteria 2753
686 Ga0207665_10088263 3300025939 Bacteria 2145
687 Ga0207665_10352722 3300025939 Bacteria 1111
688 Ga0207691_10002493 3300025940 Bacteria 18001
689 Ga0207691_10003339 3300025940 Bacteria 15624
690 Ga0207691_10024434 3300025940 Bacteria 5683
691 Ga0207691_10128419 3300025940 Bacteria 2241
692 Ga0207691_10321603 3300025940 Bacteria 1326
693 Ga0207711_10009628 3300025941 Bacteria 8051
694 Ga0207711_10029326 3300025941 Bacteria 4640
695 Ga0207711_10032877 3300025941 Bacteria 4387
696 Ga0207711_10041693 3300025941 Bacteria 3909
697 Ga0207711_10050370 3300025941 Bacteria 3565
698 Ga0207711_10192293 3300025941 Bacteria 1860
699 Ga0207689_10000440 3300025942 Bacteria 38932
700 Ga0207689_10021598 3300025942 Bacteria 5412
701 Ga0207689_10046437 3300025942 Bacteria 3589
702 Ga0207689_10065413 3300025942 Bacteria 2990
703 Ga0207689_10382488 3300025942 Bacteria 1172
704 Ga0207661_10043667 3300025944 Bacteria 3539
705 Ga0207661_10059018 3300025944 Bacteria 3090
706 Ga0207661_10059503 3300025944 Bacteria 3079
707 Ga0207661_10061762 3300025944 Bacteria 3028
708 Ga0207679_10000131 3300025945 Bacteria 61363
709 Ga0207679_10016049 3300025945 Bacteria 4965
710 Ga0207679_10052938 3300025945 Bacteria 2979
711 Ga0207679_10093901 3300025945 Bacteria 2328
712 Ga0207679_10156128 3300025945 Bacteria 1863
713 Ga0207667_10028062 3300025949 Bacteria 6115
714 Ga0207667_10040115 3300025949 Bacteria 4985
715 Ga0207667_10088810 3300025949 Bacteria 3196
716 Ga0207667_10092846 3300025949 Bacteria 3117
717 Ga0207667_10659237 3300025949 Bacteria 1051
718 Ga0207651_10000335 3300025960 Bacteria 19911
719 Ga0207651_10734133 3300025960 Bacteria 872
720 Ga0207712_10002448 3300025961 Bacteria 11985
721 Ga0207712_10004065 3300025961 Bacteria 9233
722 Ga0207712_10030909 3300025961 Bacteria 3604
723 Ga0207712_10048380 3300025961 Bacteria 2958
724 Ga0207712_10220854 3300025961 Bacteria 1515
725 Ga0207668_10000065 3300025972 Bacteria 86273
726 Ga0207668_10029098 3300025972 Bacteria 3618
727 Ga0207668_10104967 3300025972 Bacteria 2108
728 Ga0207668_10339016 3300025972 Bacteria 1253
729 Ga0207640_10000339 3300025981 Bacteria 31004
730 Ga0207658_10004428 3300025986 Bacteria 9771
731 Ga0207658_10026143 3300025986 Bacteria 4090
732 Ga0207658_10177132 3300025986 Bacteria 1762
733 Ga0207658_10433482 3300025986 Bacteria 1161
734 Ga0207677_10003580 3300026023 Bacteria 8226
735 Ga0207677_10019568 3300026023 Bacteria 4092
736 Ga0207677_10227626 3300026023 Unclassified 1500
737 Ga0207703_10001885 3300026035 Bacteria 18620
738 Ga0207703_10047628 3300026035 Bacteria 3457
739 Ga0207703_10056702 3300026035 Bacteria 3192
740 Ga0207703_10397386 3300026035 Bacteria 1278
741 Ga0207703_10430245 3300026035 Bacteria 1230
742 Ga0207639_10041384 3300026041 Bacteria 3447
743 Ga0207639_10124568 3300026041 Bacteria 2123
744 Ga0207639_10262440 3300026041 Bacteria 1511
745 Ga0207639_10514061 3300026041 Bacteria 1096
746 Ga0207678_10000944 3300026067 Bacteria 26538
747 Ga0207678_10006342 3300026067 Bacteria 10500
748 Ga0207678_10036592 3300026067 Bacteria 4273
749 Ga0207678_10056937 3300026067 Bacteria 3364
750 Ga0207678_10058587 3300026067 Bacteria 3314
751 Ga0207678_10115709 3300026067 Bacteria 2288
752 Ga0207678_10147555 3300026067 Bacteria 2007
753 Ga0207678_10160477 3300026067 Bacteria 1920
754 Ga0207708_10002019 3300026075 Bacteria 14954
755 Ga0207708_10002166 3300026075 Bacteria 14494
756 Ga0207708_10019423 3300026075 Bacteria 5122
757 Ga0207708_10031033 3300026075 Bacteria 4056
758 Ga0207702_10028991 3300026078 Bacteria 4603
759 Ga0207702_10070772 3300026078 Bacteria 3001
760 Ga0207702_10084985 3300026078 Bacteria 2757
761 Ga0207641_10005810 3300026088 Bacteria 10470
762 Ga0207641_10073016 3300026088 Bacteria 2956
763 Ga0207641_10169305 3300026088 Bacteria 1992
764 Ga0207641_10184921 3300026088 Bacteria 1911
765 Ga0207641_10726252 3300026088 Bacteria 979
766 Ga0207648_10003430 3300026089 Bacteria 16634
767 Ga0207648_10043776 3300026089 Bacteria 3930
768 Ga0207648_10081728 3300026089 Bacteria 2818
769 Ga0207648_10347959 3300026089 Bacteria 1336
770 Ga0207676_10008134 3300026095 Bacteria 7455
771 Ga0207676_10016804 3300026095 Bacteria 5298
772 Ga0207676_10047064 3300026095 Bacteria 3341
773 Ga0207676_10074119 3300026095 Bacteria 2741
774 Ga0207676_10084878 3300026095 Bacteria 2582
775 Ga0207676_10114967 3300026095 Bacteria 2258
776 Ga0207676_10139552 3300026095 Bacteria 2073
777 Ga0207674_10003323 3300026116 Bacteria 19775
778 Ga0207674_10005364 3300026116 Bacteria 15249
779 Ga0207674_10080241 3300026116 Bacteria 3266
780 Ga0207674_10084500 3300026116 Bacteria 3172
781 Ga0207674_10191770 3300026116 Bacteria 1993
782 Ga0207675_100000815 3300026118 Bacteria 31016
783 Ga0207675_100001837 3300026118 Bacteria 21301
784 Ga0207675_100069498 3300026118 Bacteria 3292
785 Ga0207675_100116502 3300026118 Bacteria 2525
786 Ga0207675_100140046 3300026118 Bacteria 2298
787 Ga0207683_10000001 3300026121 Bacteria 352047
788 Ga0207683_10006914 3300026121 Bacteria 9712
789 Ga0207683_10081084 3300026121 Bacteria 2879
790 Ga0207683_10252232 3300026121 Bacteria 1610
791 Ga0207698_10019683 3300026142 Bacteria 4626
792 Ga0207698_10027837 3300026142 Bacteria 4019
793 Ga0207698_10051342 3300026142 Bacteria 3152
794 Ga0207698_10072196 3300026142 Bacteria 2743
795 Ga0209969_1003168 3300027360 Bacteria 2277
796 Ga0209967_1000489 3300027364 Bacteria 5203
797 Ga0209981_1000830 3300027378 Bacteria 3900
798 Ga0210000_1000255 3300027462 Bacteria 7603
799 Ga0209179_1006000 3300027512 Bacteria 1933
800 Ga0209968_1002489 3300027526 Bacteria 2783
801 Ga0210002_1001135 3300027617 Bacteria 3706
802 Ga0210002_1027794 3300027617 Bacteria 932
803 Ga0209966_1000743 3300027695 Bacteria 6783
804 Ga0209998_10001042 3300027717 Bacteria 6950
805 Ga0209998_10002206 3300027717 Bacteria 4515
806 Ga0209974_10004114 3300027876 Bacteria 5197
807 Ga0207428_10000172 3300027907 Bacteria 90200
808 Ga0207428_10000255 3300027907 Bacteria 72962
809 Ga0207428_10003313 3300027907 Bacteria 15665
810 Ga0207428_10013736 3300027907 Bacteria 7059
811 Ga0207428_10016308 3300027907 Bacteria 6392
812 Ga0207428_10138752 3300027907 Bacteria 1857
813 Ga0207428_10184301 3300027907 Bacteria 1576
814 Ga0207428_10267944 3300027907 Bacteria 1271
815 Ga0268266_10020037 3300028379 Bacteria 5701
816 Ga0268266_10107574 3300028379 Bacteria 2466
817 Ga0268265_10009461 3300028380 Bacteria 6580
818 Ga0268265_10029653 3300028380 Bacteria 3930
819 Ga0268265_10055949 3300028380 Bacteria 2999
820 Ga0268265_10165088 3300028380 Bacteria 1886
821 Ga0268265_10173558 3300028380 Bacteria 1845
822 Ga0268264_10001153 3300028381 Bacteria 25764
823 Ga0268264_10006938 3300028381 Bacteria 9501
824 Ga0268264_10086369 3300028381 Bacteria 2695
825 Ga0268264_10236425 3300028381 Unclassified 1690
826 Ga0268264_10408859 3300028381 Bacteria 1306
827 Ga0265337_1010295 3300028556 Bacteria 3282
828 Ga0265318_10055027 3300028577 Bacteria 1490
829 Ga0265338_10035331 3300028800 Bacteria 4807
830 Ga0265338_10143015 3300028800 Bacteria 1871
831 Ga0265338_10198241 3300028800 Bacteria 1516
832 Ga0265330_10039488 3300031235 Bacteria 2097
833 Ga0265330_10081844 3300031235 Bacteria 1390
834 Ga0265330_10169430 3300031235 Bacteria 926
835 Ga0265325_10000901 3300031241 Bacteria 21471
836 Ga0265325_10002536 3300031241 Bacteria 12296
837 Ga0265325_10013945 3300031241 Bacteria 4559
838 Ga0265325_10019710 3300031241 Bacteria 3725
839 Ga0265329_10053302 3300031242 Bacteria 1286
840 Ga0265340_10007715 3300031247 Bacteria 5836
841 Ga0265340_10011101 3300031247 Bacteria 4801
842 Ga0265339_10000091 3300031249 Bacteria 75937
843 Ga0265339_10000387 3300031249 Bacteria 34871
844 Ga0265331_10040106 3300031250 Bacteria 2279
845 Ga0265316_10039292 3300031344 Bacteria 3801
846 Ga0265313_10000850 3300031595 Bacteria 30762
847 Ga0265313_10001068 3300031595 Bacteria 26548
848 Ga0265313_10004004 3300031595 Bacteria 11532
849 Ga0265313_10016620 3300031595 Bacteria 4223
850 Ga0265314_10007897 3300031711 Bacteria 9182
851 Ga0265314_10024428 3300031711 Bacteria 4582
852 Ga0265314_10156525 3300031711 Bacteria 1391
853 Ga0265342_10000196 3300031712 Bacteria 67364
854 Ga0265342_10024497 3300031712 Bacteria 3809
855 Ga0265342_10063512 3300031712 Bacteria 2170
856 Ga0373930_0000014 3300034816 Bacteria 17170
857 Ga0373948_0000493 3300034817 Bacteria 4922
858 Ga0373948_0000950 3300034817 Bacteria 3883
859 Ga0373948_0052100 3300034817 Bacteria 882
860 Ga0373950_0000145 3300034818 Bacteria 11351
861 Ga0373950_0018150 3300034818 Bacteria 1219
862 Ga0373958_0000064 3300034819 Bacteria 10619
863 Ga0373958_0026549 3300034819 Bacteria 1110
864 Ga0373938_0000946 3300034957 Bacteria 4658
865 Ga0373926_0015109 3300035083 Bacteria 2629
866 Ga0373928_0001389 3300035084 Bacteria 4719
867 Ga0373928_0007010 3300035084 Bacteria 2172
868 Ga0373929_0000101 3300035085 Bacteria 14304
869 Ga0373929_0002108 3300035085 Bacteria 3695
870 Ga0373929_0004137 3300035085 Bacteria 2603
871 Ga0373934_0010944 3300035086 Bacteria 3411
872 Ga0373940_0003765 3300035088 Bacteria 3134
873 Ga0373940_0034213 3300035088 Bacteria 1370
874 Ga0373944_0003519 3300035089 Bacteria 4048
875 Ga0373949_0000293 3300035090 Bacteria 18099
876 Ga0373949_0000952 3300035090 Bacteria 8980
877 Ga0373949_0018854 3300035090 Bacteria 1567
878 Ga0373951_0000154 3300035091 Bacteria 25002
879 Ga0373951_0021677 3300035091 Bacteria 1476
880 Ga0373952_0000030 3300035092 Bacteria 16323
881 Ga0373952_0000920 3300035092 Bacteria 5345
882 Ga0373923_0010802 3300035111 Bacteria 3333
883 Ga0373923_0016379 3300035111 Bacteria 2815
884 Ga0373923_0040531 3300035111 Bacteria 1917
885 Ga0373923_0088514 3300035111 Bacteria 1352
886 Ga0373932_0001243 3300035112 Bacteria 7237
887 Ga0373932_0003082 3300035112 Bacteria 4065
888 Ga0373932_0027504 3300035112 Unclassified 1557
889 Ga0373936_0008164 3300035113 Bacteria 3936
890 Ga0373936_0017372 3300035113 Bacteria 2769
891 Ga0373939_0000791 3300035114 Bacteria 7801
892 Ga0373939_0003691 3300035114 Bacteria 3605
893 Ga0373939_0006181 3300035114 Bacteria 2879
894 Ga0373941_0000050 3300035115 Bacteria 17747
895 Ga0373941_0020276 3300035115 Bacteria 1862
896 Ga0373945_0001214 3300035116 Bacteria 7848
897 Ga0373945_0010949 3300035116 Bacteria 2992
898 Ga0373953_0001444 3300035117 Bacteria 6890
899 Ga0373953_0013693 3300035117 Bacteria 2901
900 Ga0373954_0001943 3300035118 Bacteria 8567
901 Ga0373954_0008746 3300035118 Bacteria 4451
902 Ga0373954_0021614 3300035118 Bacteria 2914
903 Ga0373954_0032397 3300035118 Bacteria 2416
904 Ga0373954_0083291 3300035118 Bacteria 1530
905 Ga0373956_0024897 3300035119 Bacteria 2583
906 Ga0373956_0052136 3300035119 Bacteria 1840
907 Ga0373957_0005066 3300035120 Bacteria 4066
908 Ga0373960_0003068 3300035121 Bacteria 3771
909 Ga0373960_0020400 3300035121 Bacteria 1752
910 Ga0373943_0000132 3300035170 Bacteria 28317
911 Ga0373943_0000377 3300035170 Bacteria 18743
912 Ga0373943_0001792 3300035170 Bacteria 9710
913 Ga0373943_0010229 3300035170 Bacteria 4207
914 Ga0373943_0012484 3300035170 Bacteria 3826
915 Ga0373943_0020151 3300035170 Bacteria 3072
916 Ga0373943_0143635 3300035170 Bacteria 1288
917 Ga0373946_0000760 3300035171 Bacteria 10975
918 Ga0373946_0001192 3300035171 Bacteria 9005
919 Ga0373946_0005660 3300035171 Bacteria 4514
920 Ga0373946_0007440 3300035171 Bacteria 4005
921 Ga0373946_0012923 3300035171 Bacteria 3131
922 Ga0373946_0063519 3300035171 Bacteria 1577
923 Ga0373955_0000779 3300035172 Bacteria 13651
924 Ga0373955_0069284 3300035172 Bacteria 1967
925 Ga0373942_0000073 3300035207 Bacteria 21344
926 Ga0373961_0000480 3300035241 Bacteria 15603
927 Ga0373961_0034668 3300035241 Bacteria 1428
928 Ga0373962_0001214 3300035242 Bacteria 6025
929 Ga0373962_0001920 3300035242 Bacteria 4950
930 Ga0373962_0023763 3300035242 Bacteria 1634
931 Ga0373931_0000537 3300035691 Bacteria 15543
932 Ga0373931_0006018 3300035691 Bacteria 5644
933 Ga0373931_0010273 3300035691 Bacteria 4498
934 Ga0373931_0032608 3300035691 Bacteria 2696
935 Ga0373935_0000053 3300035692 Bacteria 46838
936 Ga0373935_0001261 3300035692 Bacteria 13962
937 Ga0373935_0003568 3300035692 Bacteria 9069
938 Ga0373935_0004470 3300035692 Bacteria 8211
939 Ga0373935_0009944 3300035692 Bacteria 5700
940 Ga0373935_0046856 3300035692 Bacteria 2732
941 Ga0373927_0002426 3300035695 Bacteria 13595
942 Ga0373927_0004260 3300035695 Bacteria 10044
943 Ga0373927_0032963 3300035695 Bacteria 3372
944 Ga0373927_0074416 3300035695 Bacteria 2199
945 Ga0373927_0100049 3300035695 Bacteria 1885
946 Ga0373933_0001426 3300035724 Bacteria 14019
947 Ga0373933_0021557 3300035724 Bacteria 3661
948 Ga0373933_0034416 3300035724 Bacteria 2953
949 Ga0373933_0165937 3300035724 Bacteria 1404
950 Ga0373947_0000239 3300035725 Bacteria 30999
951 Ga0373947_0000259 3300035725 Bacteria 29909
952 Ga0373947_0001656 3300035725 Bacteria 13631
953 Ga0373947_0008738 3300035725 Bacteria 5824
954 Ga0373947_0009288 3300035725 Bacteria 5649
955 Ga0373947_0085740 3300035725 Bacteria 1956
956 Ga0373947_0191699 3300035725 Bacteria 1334
957 Ga0373937_0000030 3300036401 Bacteria 122176
958 Ga0373937_0000907 3300036401 Bacteria 25212
959 Ga0373937_0001504 3300036401 Bacteria 19577
960 Ga0373937_0003255 3300036401 Bacteria 13620
961 Ga0373937_0029085 3300036401 Bacteria 5003
962 Ga0373937_0036814 3300036401 Bacteria 4458
963 Ga0373937_0090015 3300036401 Bacteria 2842
964 Ga0373937_0200872 3300036401 Bacteria 1874
965 Ga0373937_0287582 3300036401 Bacteria 1553
966 Ga0373937_0689296 3300036401 Bacteria 968
967 Ga0373925_0000002 3300037068 Bacteria 368879
968 Ga0373925_0000706 3300037068 Bacteria 31254
969 Ga0373925_0019842 3300037068 Bacteria 4890
970 Ga0373925_0024207 3300037068 Bacteria 4432
971 Ga0373925_0043540 3300037068 Bacteria 3332
972 Ga0373925_0044964 3300037068 Bacteria 3279
973 Ga0373925_0057569 3300037068 Bacteria 2912
974 Ga0373925_0120502 3300037068 Bacteria 2036
975 Ga0373925_0264489 3300037068 Bacteria 1382
976 Ga0373925_0346049 3300037068 Bacteria 1206
977 Ga0395900_0009186 3300037418 Bacteria 10132
978 Ga0395898_0003941 3300037466 Bacteria 16375
979 Ga0395898_0024197 3300037466 Bacteria 6126
980 Ga0395901_0075175 3300038443 Bacteria 3524
981 Ga0395901_0161489 3300038443 Bacteria 2353
982 Ga0436365_0005986 3300039437 Bacteria 1429
983 Ga0436365_0733539 3300039437 Bacteria 1504
984 Ga0436361_0561320 3300039447 Bacteria 6955
985 Ga0436363_1296716 3300039450 Bacteria 965
986 Ga0439453_0000288 3300041408 Bacteria 5235
987 Ga0439453_0014947 3300041408 Bacteria 1337
988 Ga0439461_0003514 3300041410 Bacteria 2581
989 Ga0451853_1447647 3300041512 Bacteria 938
990 Ga0439443_003618 3300042003 Bacteria 1965
991 Ga0439448_0182998 3300042005 Bacteria 733
992 Ga0439450_051973 3300042008 Bacteria 975
993 Ga0439455_0019342 3300042012 Bacteria 1605
994 Ga0439463_013245 3300042016 Bacteria 2030
995 Ga0439446_0001019 3300042156 Bacteria 6142
996 Ga0439434_0002451 3300042435 Bacteria 5395
997 Ga0439435_0000002 3300042436 Bacteria 34816
998 Ga0439435_0006285 3300042436 Bacteria 2662
999 Ga0439444_0002652 3300042437 Bacteria 2466
1000 Ga0439440_0017585 3300042993 Bacteria 1576
1001 Ga0466966_0016428 3300044684 Bacteria 4891
1002 Ga0466963_0044109 3300044694 Bacteria 2935
1003 Ga0466963_0096637 3300044694 Bacteria 2018
1004 Ga0466963_0161577 3300044694 Bacteria 1559
1005 Ga0466964_0051022 3300044706 Bacteria 1698
1006 Ga0466971_0008622 3300044719 Bacteria 4448
1007 Ga0466957_0097636 3300044842 Bacteria 1848
1008 Ga0466957_0161700 3300044842 Bacteria 1455
1009 Ga0466957_0380297 3300044842 Bacteria 963
1010 Ga0466959_0150051 3300045049 Bacteria 1643
1011 Ga0466959_0361079 3300045049 Bacteria 990
1012 Ga0451576_0017130 3300045051 Bacteria 7970
1013 Ga0451576_0117936 3300045051 Bacteria 2763
1014 Ga0466958_0016008 3300045836 Bacteria 4311
1015 Ga0466958_0149142 3300045836 Bacteria 1475
1016 Ga0466967_0000135 3300045976 Bacteria 28276
1017 Ga0466967_0006741 3300045976 Bacteria 8174
1018 Ga0466967_0500056 3300045976 Bacteria 1193
1019 Ga0495592_0000046 3300046454 Bacteria 117345
1020 Ga0495592_0001393 3300046454 Bacteria 16741
1021 Ga0495592_0002484 3300046454 Bacteria 13030
1022 Ga0495592_0009550 3300046454 Bacteria 7298
1023 Ga0495592_0078729 3300046454 Bacteria 2387
1024 Ga0495592_0115815 3300046454 Bacteria 1892
1025 Ga0495592_0168976 3300046454 Bacteria 1499
1026 Ga0495603_0002249 3300046455 Bacteria 11338
1027 Ga0495603_0008354 3300046455 Bacteria 6257
1028 Ga0495603_0014184 3300046455 Bacteria 4821
1029 Ga0495603_0050857 3300046455 Bacteria 2463
1030 Ga0495603_0102843 3300046455 Bacteria 1667
1031 Ga0495591_048065 3300046458 Bacteria 1178
1032 Ga0495629_0000594 3300046459 Bacteria 29414
1033 Ga0495629_0001140 3300046459 Bacteria 20980
1034 Ga0495629_0002311 3300046459 Bacteria 14684
1035 Ga0495629_0019080 3300046459 Bacteria 4903
1036 Ga0495629_0024508 3300046459 Bacteria 4297
1037 Ga0495629_0033237 3300046459 Bacteria 3649
1038 Ga0495629_0084401 3300046459 Bacteria 2216
1039 Ga0495629_0100862 3300046459 Bacteria 2014
1040 Ga0495629_0117093 3300046459 Bacteria 1857
1041 Ga0495641_0007754 3300046461 Bacteria 6650
1042 Ga0495641_0011331 3300046461 Bacteria 5090
1043 Ga0495641_0016661 3300046461 Bacteria 3862
1044 Ga0495641_0017820 3300046461 Bacteria 3686
1045 Ga0495641_0142861 3300046461 Bacteria 1069
1046 Ga0495651_0000822 3300046462 Bacteria 24113
1047 Ga0495651_0001833 3300046462 Bacteria 16410
1048 Ga0495651_0004816 3300046462 Bacteria 10326
1049 Ga0495653_0000006 3300046463 Bacteria 363285
1050 Ga0495653_0004798 3300046463 Bacteria 10964
1051 Ga0495653_0024139 3300046463 Bacteria 4904
1052 Ga0495653_0357386 3300046463 Bacteria 938
1053 Ga0495580_0017640 3300046472 Bacteria 5332
1054 Ga0495580_0044484 3300046472 Bacteria 3157
1055 Ga0495582_0000379 3300046473 Bacteria 24152
1056 Ga0495582_0010594 3300046473 Bacteria 5072
1057 Ga0495582_0028169 3300046473 Bacteria 3083
1058 Ga0495582_0032148 3300046473 Bacteria 2887
1059 Ga0495582_0141949 3300046473 Bacteria 1361
1060 Ga0495582_0231817 3300046473 Bacteria 1057
1061 Ga0495582_0284725 3300046473 Bacteria 949
1062 Ga0495605_0023685 3300046474 Bacteria 3224
1063 Ga0495639_0004321 3300046475 Bacteria 6094
1064 Ga0495639_0015125 3300046475 Bacteria 3346
1065 Ga0495639_0030966 3300046475 Bacteria 2379
1066 Ga0495639_0050475 3300046475 Bacteria 1890
1067 Ga0495662_0000084 3300046476 Bacteria 33781
1068 Ga0495662_0000280 3300046476 Bacteria 21964
1069 Ga0495662_0002481 3300046476 Bacteria 9294
1070 Ga0495662_0021388 3300046476 Bacteria 3127
1071 Ga0495662_0068233 3300046476 Bacteria 1722
1072 Ga0495662_0188970 3300046476 Bacteria 1016
1073 Ga0495664_0000002 3300046477 Bacteria 625183
1074 Ga0495664_0000112 3300046477 Bacteria 40522
1075 Ga0495664_0007745 3300046477 Bacteria 5977
1076 Ga0495584_0033756 3300046491 Bacteria 2590
1077 Ga0495584_0037617 3300046491 Bacteria 2447
1078 Ga0495584_0242075 3300046491 Bacteria 917
1079 Ga0495585_0001932 3300046492 Bacteria 15492
1080 Ga0495594_0002726 3300046499 Bacteria 9162
1081 Ga0495594_0009110 3300046499 Bacteria 5124
1082 Ga0495594_0011284 3300046499 Bacteria 4642
1083 Ga0495594_0018037 3300046499 Bacteria 3737
1084 Ga0495583_0102989 3300046506 Bacteria 1217
1085 Ga0495608_0000006 3300046511 Bacteria 324334
1086 Ga0495608_0012927 3300046511 Bacteria 5794
1087 Ga0495608_0017846 3300046511 Bacteria 4905
1088 Ga0495618_0000034 3300046514 Bacteria 104335
1089 Ga0495618_0001016 3300046514 Bacteria 19217
1090 Ga0495618_0001547 3300046514 Bacteria 15443
1091 Ga0495618_0073148 3300046514 Bacteria 2182
1092 Ga0495618_0131903 3300046514 Bacteria 1598
1093 Ga0495618_0287857 3300046514 Unclassified 1023
1094 Ga0495628_0000002 3300046516 Bacteria 589399
1095 Ga0495628_0003624 3300046516 Bacteria 13800
1096 Ga0495628_0027943 3300046516 Bacteria 4586
1097 Ga0495628_0032270 3300046516 Bacteria 4229
1098 Ga0495628_0101756 3300046516 Bacteria 2217
1099 Ga0495630_0000662 3300046517 Bacteria 24856
1100 Ga0495630_0005622 3300046517 Bacteria 8855
1101 Ga0495630_0027968 3300046517 Bacteria 4189
1102 Ga0495630_0042264 3300046517 Bacteria 3404
1103 Ga0495630_0095680 3300046517 Unclassified 2245
1104 Ga0495630_0257836 3300046517 Bacteria 1332
1105 Ga0495637_0020521 3300046520 Bacteria 3041
1106 Ga0495637_0090560 3300046520 Bacteria 1207
1107 Ga0495644_0003085 3300046523 Bacteria 6594
1108 Ga0495663_0013733 3300046525 Bacteria 2265
1109 Ga0495663_0021273 3300046525 Bacteria 1868
1110 Ga0495666_0001508 3300046526 Bacteria 11395
1111 Ga0495666_0012392 3300046526 Bacteria 4250
1112 Ga0495666_0033888 3300046526 Bacteria 2493
1113 Ga0495666_0034119 3300046526 Bacteria 2483
1114 Ga0495652_0000004 3300046529 Bacteria 588877
1115 Ga0495652_0013904 3300046529 Bacteria 7238
1116 Ga0495652_0019057 3300046529 Bacteria 6112
1117 Ga0495652_0026657 3300046529 Bacteria 5103
1118 Ga0495652_0307758 3300046529 Bacteria 1149
1119 Ga0495665_0003909 3300046531 Bacteria 8063
1120 Ga0495665_0014689 3300046531 Bacteria 4221
1121 Ga0495665_0017779 3300046531 Bacteria 3821
1122 Ga0495665_0098481 3300046531 Bacteria 1535
1123 Ga0495640_0000007 3300046533 Bacteria 265481
1124 Ga0495640_0006199 3300046533 Bacteria 9472
1125 Ga0495640_0008881 3300046533 Bacteria 7849
1126 Ga0495640_0010455 3300046533 Bacteria 7168
1127 Ga0495640_0065752 3300046533 Bacteria 2447
1128 Ga0495586_0032879 3300046535 Bacteria 2782
1129 Ga0495587_0000031 3300046536 Bacteria 126721
1130 Ga0495587_0002979 3300046536 Bacteria 11321
1131 Ga0495587_0016339 3300046536 Bacteria 4618
1132 Ga0495587_0018087 3300046536 Bacteria 4371
1133 Ga0495587_0193285 3300046536 Bacteria 1152
1134 Ga0495598_0004396 3300046537 Bacteria 3048
1135 Ga0495598_0087189 3300046537 Bacteria 1011
1136 Ga0495621_0011059 3300046539 Bacteria 2780
1137 Ga0495645_0000003 3300046543 Bacteria 570133
1138 Ga0495645_0005275 3300046543 Bacteria 8852
1139 Ga0495645_0010875 3300046543 Bacteria 6391
1140 Ga0495645_0011025 3300046543 Bacteria 6352
1141 Ga0495645_0263654 3300046543 Bacteria 1140
1142 Ga0495622_0014593 3300046557 Bacteria 3649
1143 Ga0495622_0049494 3300046557 Bacteria 1951
1144 Ga0495633_0057678 3300046558 Bacteria 1824
1145 Ga0495667_0000002 3300046559 Bacteria 437535
1146 Ga0495667_0000202 3300046559 Bacteria 40046
1147 Ga0495667_0032919 3300046559 Bacteria 3470
1148 Ga0495667_0295836 3300046559 Bacteria 1026
1149 Ga0495667_0330463 3300046559 Unclassified 964
1150 Ga0495667_0330949 3300046559 Bacteria 963
1151 Ga0495656_0000360 3300046615 Bacteria 15300
1152 Ga0495656_0023542 3300046615 Bacteria 2424
1153 Ga0495668_0142440 3300046616 Bacteria 1312
1154 Ga0495634_0008544 3300046642 Bacteria 7612
1155 Ga0495634_0021106 3300046642 Bacteria 4610
1156 Ga0495634_0021460 3300046642 Bacteria 4564
1157 Ga0495634_0255009 3300046642 Bacteria 1072
1158 Ga0495611_0053456 3300046648 Bacteria 1823
1159 Ga0495635_0000022 3300046663 Bacteria 160907
1160 Ga0495635_0002093 3300046663 Bacteria 13548
1161 Ga0495635_0013894 3300046663 Bacteria 5633
1162 Ga0495635_0166962 3300046663 Bacteria 1497
1163 Ga0495635_0235696 3300046663 Bacteria 1235
1164 Ga0495635_0473144 3300046663 Bacteria 827
1165 Ga0495659_0037099 3300046664 Bacteria 1725
1166 Ga0495661_0010683 3300046665 Bacteria 6254
1167 Ga0495588_0025753 3300046674 Bacteria 2933
1168 Ga0495588_0075208 3300046674 Bacteria 1759
1169 Ga0495657_0000276 3300046675 Bacteria 46295
1170 Ga0495657_0031463 3300046675 Bacteria 3709
1171 Ga0495599_0000001 3300046678 Bacteria 537563
1172 Ga0495599_0002835 3300046678 Bacteria 10095
1173 Ga0495599_0317649 3300046678 Bacteria 938
1174 Ga0495623_0000094 3300046679 Bacteria 53328
1175 Ga0495623_0001448 3300046679 Bacteria 16089
1176 Ga0495623_0335799 3300046679 Bacteria 826
1177 Ga0495646_0000007 3300046680 Bacteria 236764
1178 Ga0495646_0029532 3300046680 Bacteria 3427
1179 Ga0495646_0033018 3300046680 Bacteria 3219
1180 Ga0495646_0144654 3300046680 Bacteria 1326
1181 Ga0495647_0000122 3300046681 Bacteria 19930
1182 Ga0495647_0000393 3300046681 Bacteria 12484
1183 Ga0495647_0001922 3300046681 Bacteria 6479
1184 Ga0495647_0050007 3300046681 Bacteria 1621
1185 Ga0495658_0000210 3300046683 Bacteria 33648
1186 Ga0495658_0009937 3300046683 Bacteria 4747
1187 Ga0495658_0026729 3300046683 Bacteria 3096
1188 Ga0495658_0081190 3300046683 Bacteria 1903
1189 Ga0495669_0084935 3300046684 Bacteria 1456
1190 Ga0495613_0086199 3300046689 Bacteria 2277
1191 Ga0495624_0000222 3300046690 Bacteria 44293
1192 Ga0495624_0001294 3300046690 Bacteria 19719
1193 Ga0495624_0029382 3300046690 Bacteria 3586
1194 Ga0495624_0031182 3300046690 Bacteria 3469
1195 Ga0495624_0063300 3300046690 Bacteria 2312
1196 Ga0495624_0290652 3300046690 Bacteria 986
1197 Ga0495670_0001624 3300046691 Bacteria 11000
1198 Ga0495670_0047900 3300046691 Bacteria 2137
1199 Ga0495589_0158326 3300046794 Bacteria 1079
1200 Ga0495600_0000033 3300046809 Bacteria 83590
1201 Ga0495600_0000506 3300046809 Bacteria 20198
1202 Ga0495600_0002658 3300046809 Bacteria 10329
1203 Ga0495600_0030323 3300046809 Bacteria 3503
1204 Ga0495600_0194032 3300046809 Bacteria 1305
1205 Ga0495600_0312572 3300046809 Bacteria 989
1206 Ga0495581_0005193 3300047315 Bacteria 7534
1207 Ga0495581_0005649 3300047315 Bacteria 7252
1208 Ga0495581_0020808 3300047315 Bacteria 3806
1209 Ga0495581_0021146 3300047315 Bacteria 3774
1210 Ga0495604_0000005 3300047317 Bacteria 424516
1211 Ga0495604_0001089 3300047317 Bacteria 22540
1212 Ga0495604_0002751 3300047317 Bacteria 14105
1213 Ga0495604_0007025 3300047317 Bacteria 8925
1214 Ga0495604_0082269 3300047317 Bacteria 2408
1215 Ga0495636_0016055 3300047318 Bacteria 2988
1216 Ga0495674_0000003 3300047319 Bacteria 562126
1217 Ga0495674_0001490 3300047319 Bacteria 22945
1218 Ga0495674_0001513 3300047319 Bacteria 22779
1219 Ga0495674_0014630 3300047319 Bacteria 7343
1220 Ga0495674_0026272 3300047319 Bacteria 5329
1221 Ga0495674_0058792 3300047319 Bacteria 3360
1222 Ga0495674_0096001 3300047319 Bacteria 2527
1223 Ga0495674_0240133 3300047319 Bacteria 1493
1224 Ga0495674_0565763 3300047319 Bacteria 903
1225 Ga0495672_0122114 3300047320 Bacteria 1383
1226 Ga0495676_0000289 3300047321 Bacteria 40718
1227 Ga0495676_0021676 3300047321 Bacteria 5605
1228 Ga0495676_0167572 3300047321 Bacteria 1548
1229 Ga0495680_0000091 3300047322 Bacteria 81622
1230 Ga0495680_0001414 3300047322 Bacteria 25878
1231 Ga0495680_0012301 3300047322 Bacteria 7541
1232 Ga0495680_0064482 3300047322 Bacteria 2809
1233 Ga0495675_0000064 3300047444 Bacteria 74132
1234 Ga0495675_0007298 3300047444 Bacteria 6809
1235 Ga0495677_0148172 3300047445 Bacteria 903
1236 Ga0495685_131822 3300047447 Bacteria 817
1237 Ga0495684_0000035 3300047471 Bacteria 107768
1238 Ga0495684_0000075 3300047471 Bacteria 67922
1239 Ga0495684_0000264 3300047471 Bacteria 41677
1240 Ga0495684_0001309 3300047471 Bacteria 20014
1241 Ga0495684_0420568 3300047471 Bacteria 934
1242 Ga0495593_0000228 3300047673 Bacteria 30037
1243 Ga0495593_0001106 3300047673 Bacteria 15737
1244 Ga0495593_0014059 3300047673 Bacteria 4556
1245 Ga0495593_0020031 3300047673 Bacteria 3746
1246 Ga0495593_0037694 3300047673 Bacteria 2613
1247 Ga0495593_0215723 3300047673 Unclassified 963
1248 Ga0495602_0000029 3300048088 Bacteria 142344
1249 Ga0495602_0002033 3300048088 Bacteria 20344
1250 Ga0495602_0018847 3300048088 Bacteria 6872
1251 Ga0495602_0147942 3300048088 Bacteria 1850
1252 Ga0495602_0250469 3300048088 Bacteria 1320
1253 Ga0495602_0298434 3300048088 Bacteria 1180
1254 Ga0495614_0017130 3300048089 Bacteria 3149
1255 Ga0495614_0024948 3300048089 Bacteria 2580
1256 Ga0496100_0000404 3300048903 Bacteria 20908
1257 Ga0496100_0000823 3300048903 Bacteria 14892
1258 Ga0496100_0017884 3300048903 Bacteria 4194
1259 Ga0496100_0021550 3300048903 Bacteria 3883
1260 Ga0496101_0000423 3300048904 Bacteria 27228
1261 Ga0496101_0008909 3300048904 Bacteria 6574
1262 Ga0496101_0013330 3300048904 Bacteria 5504
1263 Ga0496101_0051874 3300048904 Bacteria 2956
1264 Ga0496101_0051974 3300048904 Bacteria 2953
1265 Ga0496101_0060493 3300048904 Bacteria 2748
1266 Ga0496101_0062028 3300048904 Bacteria 2717
1267 Ga0496102_0003323 3300048905 Bacteria 13636
1268 Ga0496102_0047059 3300048905 Bacteria 3918
1269 Ga0496102_0050819 3300048905 Bacteria 3775
1270 Ga0496102_0087854 3300048905 Bacteria 2872
1271 Ga0496102_0149714 3300048905 Bacteria 2192
1272 Ga0496102_0422390 3300048905 Bacteria 1252
1273 Ga0496103_0000967 3300048906 Bacteria 20341
1274 Ga0496103_0009318 3300048906 Bacteria 5817
1275 Ga0496103_0018841 3300048906 Bacteria 4143
1276 Ga0496103_0023575 3300048906 Bacteria 3712
1277 Ga0496103_0059818 3300048906 Bacteria 2367
1278 Ga0496103_0085283 3300048906 Bacteria 1990
1279 Ga0496103_0087744 3300048906 Bacteria 1961
1280 Ga0496103_0514955 3300048906 Bacteria 765
1281 Ga0496104_0000711 3300048907 Bacteria 28620
1282 Ga0496104_0000925 3300048907 Bacteria 25187
1283 Ga0496104_0005217 3300048907 Bacteria 11362
1284 Ga0496104_0005466 3300048907 Bacteria 11129
1285 Ga0496104_0014835 3300048907 Bacteria 7042
1286 Ga0496104_0018532 3300048907 Bacteria 6351
1287 Ga0496104_0018853 3300048907 Bacteria 6302
1288 Ga0496104_0037286 3300048907 Bacteria 4546
1289 Ga0496104_0086618 3300048907 Bacteria 2990
1290 Ga0496104_0181717 3300048907 Bacteria 2014
1291 Ga0496105_0004562 3300048908 Bacteria 10431
1292 Ga0496105_0025218 3300048908 Bacteria 4837
1293 Ga0496105_0079464 3300048908 Bacteria 2708
1294 Ga0496105_0081682 3300048908 Bacteria 2669
1295 Ga0496105_0272168 3300048908 Bacteria 1367
1296 Ga0496106_0002446 3300048909 Bacteria 13839
1297 Ga0496106_0003669 3300048909 Bacteria 11448
1298 Ga0496106_0009344 3300048909 Bacteria 7247
1299 Ga0496106_0015174 3300048909 Bacteria 5701
1300 Ga0496106_0028983 3300048909 Bacteria 4125
1301 Ga0496106_0046079 3300048909 Bacteria 3277
1302 Ga0496106_0050986 3300048909 Bacteria 3120
1303 Ga0496106_0100583 3300048909 Bacteria 2242
1304 Ga0496106_0226765 3300048909 Bacteria 1491
1305 Ga0496107_0000500 3300048910 Bacteria 21655
1306 Ga0496107_0010585 3300048910 Bacteria 6412
1307 Ga0496107_0022186 3300048910 Bacteria 4486
1308 Ga0496107_0035757 3300048910 Bacteria 3561
1309 Ga0496107_0036271 3300048910 Bacteria 3536
1310 Ga0496107_0046339 3300048910 Bacteria 3129
1311 Ga0496107_0356698 3300048910 Bacteria 1088
1312 Ga0496108_0010045 3300048911 Bacteria 7677
1313 Ga0496108_0032769 3300048911 Bacteria 4315
1314 Ga0496108_0039555 3300048911 Bacteria 3930
1315 Ga0496108_0048346 3300048911 Bacteria 3556
1316 Ga0496108_0054148 3300048911 Bacteria 3367
1317 Ga0496108_0129685 3300048911 Bacteria 2167
1318 Ga0496109_0000340 3300048912 Bacteria 43565
1319 Ga0496109_0000359 3300048912 Bacteria 42297
1320 Ga0496109_0000976 3300048912 Bacteria 23658
1321 Ga0496109_0005940 3300048912 Bacteria 10246
1322 Ga0496109_0015600 3300048912 Bacteria 6625
1323 Ga0496109_0060588 3300048912 Bacteria 3458
1324 Ga0496109_0126561 3300048912 Bacteria 2382
1325 Ga0496109_0151191 3300048912 Bacteria 2173
1326 Ga0496109_0356430 3300048912 Bacteria 1382
1327 Ga0496109_0547656 3300048912 Bacteria 1091
1328 Ga0496110_0002357 3300048913 Bacteria 14148
1329 Ga0496110_0003362 3300048913 Bacteria 12213
1330 Ga0496110_0014914 3300048913 Bacteria 6458
1331 Ga0496110_0027384 3300048913 Bacteria 4886
1332 Ga0496110_0034978 3300048913 Bacteria 4355
1333 Ga0496110_0054089 3300048913 Bacteria 3531
1334 Ga0496110_0061174 3300048913 Bacteria 3323
1335 Ga0496110_0180349 3300048913 Bacteria 1917
1336 Ga0496111_0007077 3300048914 Bacteria 7329
1337 Ga0496111_0012965 3300048914 Bacteria 5658
1338 Ga0496111_0021239 3300048914 Bacteria 4530
1339 Ga0496111_0023917 3300048914 Bacteria 4294
1340 Ga0496111_0040590 3300048914 Bacteria 3338
1341 Ga0496111_0069085 3300048914 Bacteria 2569
1342 Ga0496111_0108052 3300048914 Bacteria 2049
1343 Ga0496111_0129596 3300048914 Bacteria 1866
1344 Ga0496111_0149808 3300048914 Bacteria 1730
1345 Ga0496112_0006271 3300048915 Bacteria 10427
1346 Ga0496112_0021049 3300048915 Bacteria 6194
1347 Ga0496112_0044120 3300048915 Bacteria 4367
1348 Ga0496112_0051703 3300048915 Bacteria 4030
1349 Ga0496112_0167221 3300048915 Bacteria 2165
1350 Ga0496112_0176044 3300048915 Bacteria 2104
1351 Ga0496112_0198456 3300048915 Bacteria 1966
1352 Ga0496112_0351325 3300048915 Bacteria 1417
1353 Ga0496113_0000463 3300048916 Bacteria 19814
1354 Ga0496113_0001950 3300048916 Bacteria 11812
1355 Ga0496113_0002665 3300048916 Bacteria 10463
1356 Ga0496113_0008785 3300048916 Bacteria 6598
1357 Ga0496113_0008826 3300048916 Bacteria 6585
1358 Ga0496113_0053025 3300048916 Bacteria 3031
1359 Ga0496113_0431387 3300048916 Bacteria 1059
1360 Ga0496114_0021314 3300048917 Bacteria 5271
1361 Ga0496114_0046871 3300048917 Bacteria 3592
1362 Ga0496114_0081951 3300048917 Bacteria 2726
1363 Ga0496114_0109867 3300048917 Bacteria 2361
1364 Ga0496114_0157710 3300048917 Bacteria 1971
1365 Ga0496115_0009234 3300048918 Bacteria 7323
1366 Ga0496115_0019987 3300048918 Bacteria 5160
1367 Ga0496115_0045224 3300048918 Bacteria 3514
1368 Ga0496115_0067163 3300048918 Bacteria 2899
1369 Ga0496115_0073699 3300048918 Bacteria 2771
1370 Ga0501031_0011742 3300049568 Bacteria 5713
1371 Ga0501031_0156179 3300049568 Bacteria 1491
1372 Ga0501032_0019959 3300049569 Bacteria 4677
1373 Ga0501033_0017940 3300049570 Bacteria 5343
1374 Ga0501033_0190471 3300049570 Bacteria 1468
1375 Ga0501033_0311955 3300049570 Bacteria 1106
1376 Ga0501034_0006692 3300049571 Bacteria 12361
1377 Ga0501034_0020000 3300049571 Bacteria 6837
1378 Ga0501034_0029366 3300049571 Bacteria 5588
1379 Ga0501034_0305192 3300049571 Bacteria 1527
1380 Ga0501034_0931952 3300049571 Bacteria 755
1381 Ga0501036_0018021 3300049572 Bacteria 5912
1382 Ga0501037_0007895 3300049573 Bacteria 7797
1383 Ga0501037_0071272 3300049573 Bacteria 2528
1384 Ga0501037_0102956 3300049573 Bacteria 2059
1385 Ga0501037_0259157 3300049573 Bacteria 1215
1386 Ga0501038_0043904 3300049574 Bacteria 3886
1387 Ga0501038_0064678 3300049574 Bacteria 3118
1388 Ga0501038_0076041 3300049574 Bacteria 2837
1389 Ga0501039_0121235 3300049575 Bacteria 2049
1390 Ga0501039_0188401 3300049575 Bacteria 1623
1391 Ga0501039_0193552 3300049575 Bacteria 1599
1392 Ga0501039_0237492 3300049575 Bacteria 1433
1393 Ga0501040_0012594 3300049576 Bacteria 5545
1394 Ga0501040_0018457 3300049576 Bacteria 4631
1395 Ga0501040_0076897 3300049576 Bacteria 2308
1396 Ga0501040_0213128 3300049576 Bacteria 1373
1397 Ga0501041_0017024 3300049577 Bacteria 4325
1398 Ga0501041_0027793 3300049577 Bacteria 3410
1399 Ga0501041_0075493 3300049577 Bacteria 2073
1400 Ga0501042_0241243 3300049578 Bacteria 1304
1401 Ga0501042_0567114 3300049578 Bacteria 825
1402 Ga0501043_0015891 3300049579 Bacteria 5900
1403 Ga0501043_0050356 3300049579 Bacteria 3274
1404 Ga0501043_0096527 3300049579 Bacteria 2323
1405 Ga0501043_0503787 3300049579 Bacteria 904
1406 Ga0501046_0012829 3300049580 Bacteria 7129
1407 Ga0501046_0031228 3300049580 Bacteria 4320
1408 Ga0501046_0043437 3300049580 Bacteria 3578
1409 Ga0501047_0006347 3300049581 Bacteria 11116
1410 Ga0501047_0009067 3300049581 Bacteria 9395
1411 Ga0501047_0018859 3300049581 Bacteria 6617
1412 Ga0501047_0198550 3300049581 Bacteria 1867
1413 Ga0501048_0004440 3300049582 Bacteria 10687
1414 Ga0501048_0229114 3300049582 Bacteria 1318
1415 Ga0501067_0018631 3300049583 Bacteria 3843
1416 Ga0501068_0043146 3300049584 Bacteria 2713
1417 Ga0501068_0284541 3300049584 Bacteria 1057
1418 Ga0501069_0017442 3300049585 Bacteria 3863
1419 Ga0501069_0046105 3300049585 Bacteria 2417
1420 Ga0501069_0139164 3300049585 Bacteria 1392
1421 Ga0501070_0003185 3300049586 Bacteria 14271
1422 Ga0501070_0004846 3300049586 Bacteria 11495
1423 Ga0501070_0014654 3300049586 Bacteria 6597
1424 Ga0501070_0053740 3300049586 Bacteria 3340
1425 Ga0501070_0359275 3300049586 Bacteria 1182
1426 Ga0501071_0057606 3300049587 Bacteria 2809
1427 Ga0501071_0099765 3300049587 Bacteria 2140
1428 Ga0501072_0011302 3300049588 Bacteria 6820
1429 Ga0501072_0030502 3300049588 Bacteria 4218
1430 Ga0501072_0106645 3300049588 Bacteria 2228
1431 Ga0501072_0106796 3300049588 Bacteria 2227
1432 Ga0501072_0310850 3300049588 Bacteria 1253
1433 Ga0501072_0328612 3300049588 Bacteria 1215
1434 Ga0501073_0029987 3300049589 Bacteria 3885
1435 Ga0501074_0033113 3300049590 Bacteria 3745
1436 Ga0501074_0049131 3300049590 Bacteria 3046
1437 Ga0501074_0099597 3300049590 Bacteria 2081
1438 Ga0501075_0004734 3300049591 Bacteria 9250
1439 Ga0501075_0044232 3300049591 Bacteria 3341
1440 Ga0501075_0085345 3300049591 Bacteria 2392
1441 Ga0501075_0098564 3300049591 Bacteria 2219
1442 Ga0501076_0001405 3300049592 Bacteria 16125
1443 Ga0501076_0010937 3300049592 Bacteria 6749
1444 Ga0501076_0086410 3300049592 Bacteria 2521
1445 Ga0501076_0102344 3300049592 Bacteria 2309
1446 Ga0501076_0186014 3300049592 Bacteria 1694
1447 Ga0501076_0280921 3300049592 Bacteria 1364
1448 Ga0501077_0007341 3300049593 Bacteria 6798
1449 Ga0501077_0034622 3300049593 Bacteria 3214
1450 Ga0501077_0349144 3300049593 Unclassified 944
1451 Ga0501079_0003233 3300049741 Bacteria 11932
1452 Ga0501079_0016017 3300049741 Bacteria 5728
1453 Ga0501079_0048600 3300049741 Bacteria 3274
1454 Ga0501079_0175830 3300049741 Bacteria 1669
1455 Ga0501079_0210955 3300049741 Bacteria 1517
1456 Ga0501079_0323761 3300049741 Bacteria 1207
1457 Ga0501080_0021206 3300049742 Bacteria 6013
1458 Ga0501080_0025076 3300049742 Bacteria 5533
1459 Ga0501080_0247783 3300049742 Bacteria 1625
1460 Ga0501081_0001767 3300049743 Bacteria 13415
1461 Ga0501081_0010499 3300049743 Bacteria 6045
1462 Ga0501081_0038168 3300049743 Bacteria 3280
1463 Ga0501081_0058154 3300049743 Bacteria 2675
1464 Ga0501083_0011824 3300049744 Bacteria 6116
1465 Ga0501083_0026837 3300049744 Bacteria 3979
1466 Ga0501083_0146022 3300049744 Bacteria 1549
1467 Ga0501083_0157043 3300049744 Bacteria 1489
1468 Ga0501035_0000127 3300049822 Bacteria 92397
1469 Ga0501035_0005073 3300049822 Bacteria 12482
1470 Ga0501035_0068477 3300049822 Bacteria 3147
1471 Ga0501035_0255397 3300049822 Bacteria 1487
1472 Ga0501035_0289417 3300049822 Bacteria 1383
1473 Ga0501044_0001312 3300049823 Bacteria 29308
1474 Ga0501044_0008177 3300049823 Bacteria 11483
1475 Ga0501044_0030205 3300049823 Bacteria 5712
1476 Ga0501044_0083642 3300049823 Bacteria 3227
1477 Ga0501044_0117406 3300049823 Bacteria 2664
1478 Ga0501044_0163053 3300049823 Bacteria 2204
1479 Ga0501044_0192296 3300049823 Bacteria 2002
1480 Ga0501044_0208105 3300049823 Bacteria 1911
1481 Ga0501044_0225240 3300049823 Bacteria 1825
1482 Ga0501044_0281404 3300049823 Bacteria 1597
1483 Ga0501045_0018155 3300049824 Bacteria 4999
1484 Ga0501045_0037333 3300049824 Bacteria 3530
1485 Ga0501045_0089530 3300049824 Bacteria 2273
1486 Ga0501045_0163184 3300049824 Bacteria 1659
1487 Ga0501045_0393783 3300049824 Bacteria 1031
1488 Ga0501045_0485933 3300049824 Bacteria 917
1489 nmdc:mga03683_4783_c1 3300050489 Bacteria 4521
1490 nmdc:mga00v17_40420_c1 3300050491 Bacteria 2797
1491 nmdc:mga00v17_4490_c1 3300050491 Bacteria 7264
1492 nmdc:mga0yw44_47840_c1 3300050492 Bacteria 2576
1493 nmdc:mga0yw44_60962_c1 3300050492 Bacteria 2313
1494 nmdc:mga06z11_23201_c1 3300050494 Bacteria 2911
1495 nmdc:mga06z11_26428_c1 3300050494 Bacteria 2762
1496 nmdc:mga05p37_149738_c1 3300050507 Bacteria 2856
1497 nmdc:mga05p37_1808_c2 3300050507 Bacteria 13333
1498 nmdc:mga05p37_193955_c1 3300050507 Bacteria 2464
1499 nmdc:mga05p37_22036_c1 3300050507 Bacteria 7720
1500 nmdc:mga05p37_35541_c1 3300050507 Bacteria 4652
1501 nmdc:mga05p37_45950_c1 3300050507 Bacteria 5370
1502 nmdc:mga05p37_508_c2 3300050507 Bacteria 7955
1503 nmdc:mga05p37_661502_c1 3300050507 Bacteria 1168
1504 nmdc:mga05p37_875422_c1 3300050507 Bacteria 972
1505 nmdc:mga09592_226707_c1 3300050508 Bacteria 1619
1506 nmdc:mga09592_421671_c1 3300050508 Bacteria 1153
1507 nmdc:mga09592_513695_c1 3300050508 Bacteria 1031
1508 nmdc:mga09592_78404_c1 3300050508 Bacteria 2811
1509 nmdc:mga0qj67_335685_c1 3300050509 Bacteria 1223
1510 nmdc:mga0qj67_6112_c1 3300050509 Bacteria 8826
1511 nmdc:mga0qj67_63707_c1 3300050509 Bacteria 2932
1512 nmdc:mga06r32_101497_c1 3300050510 Bacteria 2824
1513 nmdc:mga06r32_142417_c1 3300050510 Bacteria 2374
1514 nmdc:mga06r32_1960_c1 3300050510 Bacteria 18367
1515 nmdc:mga06r32_3441_c1 3300050510 Bacteria 14162
1516 nmdc:mga06r32_59228_c1 3300050510 Bacteria 3682
1517 nmdc:mga08y16_14675_c1 3300050511 Bacteria 8238
1518 nmdc:mga08y16_172282_c1 3300050511 Bacteria 2248
1519 nmdc:mga08y16_2332_c1 3300050511 Bacteria 19466
1520 nmdc:mga08y16_272265_c1 3300050511 Bacteria 1748
1521 nmdc:mga08y16_306842_c1 3300050511 Bacteria 1635
1522 nmdc:mga08y16_3146_c1 3300050511 Bacteria 17090
1523 nmdc:mga08y16_3939_c1 3300050511 Bacteria 15466
1524 nmdc:mga08y16_45632_c1 3300050511 Bacteria 4591
1525 nmdc:mga08y16_643609_c1 3300050511 Bacteria 1065
1526 nmdc:mga08y16_89125_c1 3300050511 Bacteria 3215
1527 nmdc:mga08y16_9215_c1 3300050511 Bacteria 10357
1528 nmdc:mga0n895_141652_c1 3300050512 Bacteria 2433
1529 nmdc:mga0n895_145_c1 3300050512 Bacteria 43408
1530 nmdc:mga0n895_30075_c1 3300050512 Bacteria 5187
1531 nmdc:mga0n895_37534_c1 3300050512 Bacteria 4688
1532 nmdc:mga0n895_4696_c1 3300050512 Bacteria 11271
1533 nmdc:mga0n895_493926_c1 3300050512 Bacteria 1233
1534 nmdc:mga0n895_69426_c1 3300050512 Bacteria 3491
1535 nmdc:mga0n895_952226_c1 3300050512 Bacteria 842
1536 nmdc:mga0rr50_149655_c1 3300050513 Bacteria 1885
1537 nmdc:mga0rr50_1966_c1 3300050513 Bacteria 11411
1538 nmdc:mga0rr50_25674_c1 3300050513 Bacteria 4099
1539 nmdc:mga0rr50_2684_c1 3300050513 Bacteria 10078
1540 nmdc:mga0rr50_367066_c1 3300050513 Bacteria 1212
1541 nmdc:mga0rr50_42859_c1 3300050513 Bacteria 3308
1542 nmdc:mga0rr50_435442_c1 3300050513 Bacteria 1110
1543 nmdc:mga0rr50_48815_c1 3300050513 Bacteria 3131
1544 nmdc:mga0rr50_75948_c1 3300050513 Bacteria 2577
1545 nmdc:mga08x19_1133_c1 3300050514 Bacteria 16621
1546 nmdc:mga08x19_116183_c1 3300050514 Bacteria 1789
1547 nmdc:mga08x19_127257_c1 3300050514 Bacteria 1711
1548 nmdc:mga08x19_21279_c1 3300050514 Bacteria 4001
1549 nmdc:mga08x19_33203_c1 3300050514 Bacteria 3256
1550 nmdc:mga08x19_33421_c1 3300050514 Bacteria 3246
1551 nmdc:mga08x19_46164_c1 3300050514 Bacteria 2785
1552 nmdc:mga08x19_60686_c1 3300050514 Bacteria 2449
1553 nmdc:mga0a205_18201_c1 3300050515 Bacteria 6599
1554 nmdc:mga0a205_1921_c1 3300050515 Bacteria 18059
1555 nmdc:mga0a205_2724_c1 3300050515 Bacteria 15622
1556 nmdc:mga0a205_44400_c1 3300050515 Bacteria 4284
1557 nmdc:mga0a205_50540_c1 3300050515 Bacteria 4013
1558 nmdc:mga0sz30_135475_c1 3300050516 Bacteria 1086
1559 Ga0495601_0000008 3300053077 Bacteria 362152
1560 Ga0495601_0001042 3300053077 Bacteria 15154
1561 Ga0495601_0001925 3300053077 Bacteria 11619
1562 Ga0495601_0004619 3300053077 Bacteria 7965
1563 Ga0495601_0029283 3300053077 Bacteria 3414
1564 Ga0495601_0031011 3300053077 Bacteria 3322
1565 Ga0495601_0096670 3300053077 Bacteria 1905
1566 Ga0495601_0164506 3300053077 Bacteria 1450
1567 Ga0495612_0000026 3300053078 Bacteria 111627
1568 Ga0495612_0000308 3300053078 Bacteria 19880
1569 Ga0495612_0000858 3300053078 Bacteria 12361
1570 Ga0495612_0032977 3300053078 Bacteria 2094
1571 Ga0495612_0111205 3300053078 Bacteria 1172
1572 Ga0500610_0135901 3300053079 Bacteria 1246
1573 Ga0495655_0002363 3300053083 Bacteria 2986
1574 Ga0495655_0023126 3300053083 Bacteria 1429
1575 Ga0495595_0000024 3300053084 Bacteria 108008
1576 Ga0495595_0000879 3300053084 Bacteria 11535
1577 Ga0495595_0006336 3300053084 Bacteria 4819
1578 Ga0495595_0011017 3300053084 Bacteria 3773
1579 Ga0495595_0014880 3300053084 Bacteria 3308
1580 Ga0495619_0000002 3300053085 Bacteria 530226
1581 Ga0495619_0000229 3300053085 Bacteria 40785
1582 Ga0495619_0001598 3300053085 Bacteria 14888
1583 Ga0495619_0005795 3300053085 Bacteria 7828
1584 Ga0495619_0010541 3300053085 Bacteria 5815
1585 Ga0495619_0013992 3300053085 Bacteria 5062
1586 Ga0495619_0014059 3300053085 Bacteria 5050
1587 Ga0495619_0018217 3300053085 Bacteria 4453
1588 Ga0495619_0065633 3300053085 Bacteria 2422
1589 Ga0495619_0067601 3300053085 Bacteria 2386
1590 Ga0495619_0105512 3300053085 Bacteria 1921
1591 Ga0500578_0140554 3300053086 Bacteria 1510
1592 Ga0500644_0002495 3300053088 Bacteria 4601
1593 Ga0500583_0079978 3300053092 Bacteria 1578
1594 Ga0500651_0022942 3300053093 Bacteria 3904
1595 Ga0500651_0326092 3300053093 Bacteria 876
1596 Ga0500595_000010 3300053119 Bacteria 275806
1597 Ga0500652_070981 3300053131 Bacteria 1443
1598 Ga0500573_0187135 3300053140 Bacteria 1109
1599 Ga0500588_0056159 3300053146 Bacteria 1245
1600 Ga0500604_0038365 3300053151 Bacteria 1437
1601 Ga0500616_0000001 3300053153 Bacteria 1986011
1602 Ga0500616_0096643 3300053153 Bacteria 1451
1603 Ga0500611_004286 3300053727 Bacteria 1913
1604 Ga0500645_000015 3300053730 Bacteria 150140
1605 Ga0500645_039412 3300053730 Bacteria 1400
1606 Ga0501084_0101890 3300054114 Bacteria 2411
1607 Ga0501084_0147838 3300054114 Bacteria 1979
1608 Ga0501084_0150596 3300054114 Bacteria 1961
1609 Ga0501084_0261257 3300054114 Bacteria 1462
1610 Ga0501084_0293106 3300054114 Bacteria 1374
1611 Ga0501084_0326409 3300054114 Bacteria 1296
1612 Ga0501084_0361117 3300054114 Bacteria 1227
1613 Ga0501084_0588322 3300054114 Bacteria 940
1614 Ga0590071_011869 3300059421 Bacteria 2040
1615 Ga0590071_014618 3300059421 Bacteria 1842
1616 Ga0501082_0000013 3300060353 Bacteria 119623
1617 Ga0501082_0011829 3300060353 Bacteria 7501
1618 Ga0501082_0013431 3300060353 Bacteria 7039
1619 Ga0501082_0027888 3300060353 Bacteria 4863
1620 Ga0501082_0052297 3300060353 Bacteria 3521
1621 Ga0501082_0060268 3300060353 Bacteria 3268
1622 Ga0501082_0083125 3300060353 Bacteria 2763
1623 Ga0501082_0120127 3300060353 Bacteria 2278
1624 Ga0501082_0395969 3300060353 Bacteria 1205
1625 Ga0466962_0033717 3300061719 Bacteria 2451
1626 Ga0466962_0124513 3300061719 Bacteria 1245
1627 Ga0530510_0000596 3300061734 Bacteria 23255
1628 Ga0530510_0100902 3300061734 Bacteria 2110
1629 Ga0530510_0157817 3300061734 Bacteria 1677
1630 Ga0496105_0015258
1631 2214772980
1632 ARcpr5oldR_c000026
1633 ARSoilYngRDRAFT_c00029
1634 ARcpr5yngRDRAFT_c000044
1635 ARSoilOldRDRAFT_c000037
1636 ARCol0yngRDRAFT_1000020
1637 JGI24032J14994_100929
1638 JGI24746J21847_1004318
1639 JGI24739J22299_10004550
1640 JGI24739J22299_10008850
1641 JGI24737J22298_10001930
1642 JGI24743J22301_10002254
1643 JGI24743J22301_10003452
1644 JGI24750J21931_1000586
1645 JGI24750J21931_1006717
1646 JGI24745J21846_1000864
1647 JGI24738J21930_10003187
1648 JGI24744J21845_10000745
1649 JGI24744J21845_10031793
1650 JGI24035J26624_1001145
1651 JGI24033J26618_1000244
1652 JGI24034J26672_10005584
1653 JGI24742J22300_10000139
1654 JGI24751J29686_10025022
1655 JGI25153J46596_10003184
1656 rootH2_10006376
1657 Ga0065717_1003669
1658 Ga0065716_1001673
1659 Ga0065712_10036972
1660 Ga0065712_10071735
1661 Ga0065712_10077193
1662 Ga0065715_10012820
1663 Ga0065715_10017550
1664 Ga0065715_10092917
1665 Ga0070658_10021114
1666 Ga0070676_10001078
1667 Ga0070683_100007390
1668 Ga0070683_100108972
1669 Ga0070690_100014887
1670 Ga0070690_100046335
1671 Ga0070690_100291210
1672 Ga0070690_100380229
1673 Ga0070670_100037546
1674 Ga0070670_100089771
1675 Ga0070677_10000668
1676 Ga0068869_100013686
1677 Ga0068869_100022846
1678 Ga0068869_100051408
1679 Ga0068869_100502095
1680 Ga0070666_10085683
1681 Ga0070680_100004715
1682 Ga0070680_100013186
1683 Ga0070680_100021923
1684 Ga0070680_100024576
1685 Ga0070680_100234127
1686 Ga0070680_100285286
1687 Ga0070680_100301660
1688 Ga0070682_100001091
1689 Ga0070682_100315815
1690 Ga0068868_100031802
1691 Ga0068868_100037790
1692 Ga0070660_100001398
1693 Ga0070660_100050299
1694 Ga0070660_100058854
1695 Ga0070689_100003399
1696 Ga0070689_100017677
1697 Ga0070689_100028202
1698 Ga0070689_100080413
1699 Ga0070689_100197151
1700 Ga0070689_100381444
1701 Ga0070691_10000769
1702 Ga0070691_10002420
1703 Ga0070691_10057313
1704 Ga0070691_10062640
1705 Ga0070687_100005958
1706 Ga0070687_100037605
1707 Ga0070687_100082540
1708 Ga0070661_100001076
1709 Ga0070661_100061862
1710 Ga0070692_10006678
1711 Ga0070692_10142810
1712 Ga0070668_100012317
1713 Ga0070668_100222315
1714 Ga0070668_100426049
1715 Ga0070669_100005888
1716 Ga0070669_100086940
1717 Ga0070669_100161681
1718 Ga0070675_100000727
1719 Ga0070675_100292551
1720 Ga0070675_100303869
1721 Ga0070671_100000438
1722 Ga0070671_100017456
1723 Ga0070671_100018195
1724 Ga0070671_100097382
1725 Ga0070671_100384509
1726 Ga0070674_100001976
1727 Ga0070674_100004009
1728 Ga0070674_100036693
1729 Ga0070674_100037164
1730 Ga0070674_100076955
1731 Ga0070673_100001186
1732 Ga0070673_100064845
1733 Ga0070673_100069361
1734 Ga0070673_100078510
1735 Ga0070673_100231226
1736 Ga0070673_100308282
1737 Ga0070688_100003863
1738 Ga0070688_100022325
1739 Ga0070688_100236361
1740 Ga0070688_100298893
1741 Ga0070659_100005874
1742 Ga0070659_100058285
1743 Ga0070659_100159515
1744 Ga0070659_100536262
1745 Ga0070667_100005963
1746 Ga0070667_100141067
1747 Ga0070667_100150888
1748 Ga0070703_10002528
1749 Ga0070709_10015469
1750 Ga0070709_10373331
1751 Ga0070714_100085977
1752 Ga0070713_100015791
1753 Ga0070713_100057053
1754 Ga0070713_100100725
1755 Ga0070713_100305905
1756 Ga0070710_10021397
1757 Ga0070710_10055864
1758 Ga0070710_10145315
1759 Ga0070710_10161886
1760 Ga0070701_10000339
1761 Ga0070701_10010726
1762 Ga0070701_10127112
1763 Ga0070711_100027442
1764 Ga0070711_100034179
1765 Ga0070711_100175493
1766 Ga0070711_100189934
1767 Ga0070711_100199417
1768 Ga0070711_100291549
1769 Ga0070705_100000010
1770 Ga0070705_100005352
1771 Ga0070705_100023818
1772 Ga0070705_100080736
1773 Ga0070700_100000783
1774 Ga0070700_100019322
1775 Ga0070700_100034755
1776 Ga0070700_100129382
1777 Ga0070694_100006633
1778 Ga0070694_100249244
1779 Ga0070694_100277901
1780 Ga0070694_100409326
1781 Ga0070694_100510658
1782 Ga0070694_100570064
1783 Ga0070708_100015350
1784 Ga0070663_100017471
1785 Ga0070663_100025858
1786 Ga0070663_100033005
1787 Ga0070663_100040103
1788 Ga0070663_100134439
1789 Ga0070663_100225422
1790 Ga0070678_100006186
1791 Ga0070678_100011564
1792 Ga0070678_100026061
1793 Ga0070678_100045182
1794 Ga0070678_100077198
1795 Ga0070678_100160180
1796 Ga0070662_100017941
1797 Ga0070662_100065940
1798 Ga0070662_100093667
1799 Ga0070662_100121519
1800 Ga0070662_100364784
1801 Ga0070681_10046880
1802 Ga0070681_10051242
1803 Ga0070681_10077725
1804 Ga0068867_100031591
1805 Ga0068867_100046946
1806 Ga0068867_100060743
1807 Ga0068867_100696329
1808 Ga0068867_100722585
1809 Ga0070685_10005962
1810 Ga0070685_10009847
1811 Ga0070685_10022940
1812 Ga0070685_10088559
1813 Ga0070685_10231391
1814 Ga0070707_100232584
1815 Ga0070699_100001314
1816 Ga0070699_100010423
1817 Ga0070679_100021002
1818 Ga0070679_100034318
1819 Ga0070679_100056408
1820 Ga0070679_100076400
1821 Ga0070679_100084600
1822 Ga0070679_100158636
1823 Ga0070679_100208393
1824 Ga0070679_100315865
1825 Ga0070679_100507683
1826 Ga0070684_100030785
1827 Ga0070684_100128485
1828 Ga0070684_100134636
1829 Ga0070684_100630839
1830 Ga0070697_100039300
1831 Ga0070697_100441764
1832 Ga0068853_100004375
1833 Ga0068853_100042579
1834 Ga0068853_100579519
1835 Ga0070672_100011149
1836 Ga0070672_100078196
1837 Ga0070672_100448528
1838 Ga0070686_100006762
1839 Ga0070686_100049853
1840 Ga0070686_100103076
1841 Ga0070686_100151671
1842 Ga0070686_100213897
1843 Ga0070686_100266991
1844 Ga0070686_100416152
1845 Ga0070695_100001719
1846 Ga0070695_100030227
1847 Ga0070695_100066208
1848 Ga0070695_100260215
1849 Ga0070696_100002812
1850 Ga0070696_100029222
1851 Ga0070693_100000577
1852 Ga0070693_100010134
1853 Ga0070665_100076321
1854 Ga0070665_100085305
1855 Ga0070704_100028556
1856 Ga0070704_100295544
1857 Ga0068855_100014148
1858 Ga0068855_100138074
1859 Ga0068855_100190703
1860 Ga0070664_100002073
1861 Ga0070664_100070153
1862 Ga0070664_100138824
1863 Ga0070664_100145042
1864 Ga0070664_100167671
1865 Ga0070664_100175888
1866 Ga0070664_100386735
1867 Ga0068857_100008536
1868 Ga0068857_100011549
1869 Ga0068857_100447288
1870 Ga0068857_100511643
1871 Ga0068854_100001074
1872 Ga0068854_100049093
1873 Ga0068854_100539611
1874 Ga0068856_100026335
1875 Ga0068856_100039625
1876 Ga0068856_100046914
1877 Ga0070702_100005245
1878 Ga0070702_100023173
1879 Ga0068852_100001086
1880 Ga0068852_100016187
1881 Ga0068852_100054483
1882 Ga0068852_100055479
1883 Ga0068859_100003708
1884 Ga0068859_100023234
1885 Ga0068859_100108837
1886 Ga0068859_100127411
1887 Ga0068864_100025772
1888 Ga0068864_100039525
1889 Ga0068864_100042873
1890 Ga0068864_100053465
1891 Ga0068864_100070454
1892 Ga0068864_100093083
1893 Ga0068866_10000403
1894 Ga0068866_10002088
1895 Ga0068866_10103993
1896 Ga0068866_10334537
1897 Ga0068861_100180454
1898 Ga0068861_100253512
1899 Ga0068851_10190099
1900 Ga0068870_10000860
1901 Ga0068870_10001886
1902 Ga0068870_10186282
1903 Ga0068863_100003728
1904 Ga0068863_100036918
1905 Ga0068863_100248817
1906 Ga0068863_100570405
1907 Ga0068858_100024112
1908 Ga0068858_100032605
1909 Ga0068858_100145199
1910 Ga0068858_100185868
1911 Ga0068858_100201782
1912 Ga0068858_100220118
1913 Ga0068860_100013440
1914 Ga0068860_100023327
1915 Ga0068860_100053505
1916 Ga0068860_100099064
1917 Ga0068860_100349123
1918 Ga0068860_100813597
1919 Ga0068862_100003043
1920 Ga0068862_100024080
1921 Ga0068862_100177573
1922 Ga0081455_10000012
1923 Ga0081455_10007967
1924 Ga0081455_10119932
1925 Ga0081455_10188134
1926 Ga0081455_10286256
1927 Ga0081538_10018338
1928 Ga0081538_10047804
1929 Ga0081540_1002413
1930 Ga0081540_1024424
1931 Ga0081540_1027356
1932 Ga0081540_1031022
1933 Ga0081540_1084127
1934 Ga0081539_10080906
1935 Ga0081539_10197348
1936 Ga0070717_10007114
1937 Ga0070717_10056934
1938 Ga0070717_10076908
1939 Ga0070717_10085547
1940 Ga0075365_10048846
1941 Ga0075365_10399680
1942 Ga0075364_10008816
1943 Ga0075432_10001490
1944 Ga0070715_10006260
1945 Ga0070716_100009562
1946 Ga0070712_100025089
1947 Ga0070712_100063297
1948 Ga0070712_100095285
1949 Ga0070712_100342684
1950 Ga0075362_10000839
1951 Ga0075362_10050193
1952 Ga0075362_10075317
1953 Ga0075367_10039470
1954 Ga0075367_10047173
1955 Ga0075366_10001687
1956 Ga0097621_100000421
1957 Ga0097621_100008029
1958 Ga0097621_100176781
1959 Ga0097621_100194171
1960 Ga0075370_10074551
1961 Ga0068871_100000515
1962 Ga0068871_100012948
1963 Ga0068871_100172423
1964 Ga0075428_100007282
1965 Ga0075428_100056127
1966 Ga0075428_100069359
1967 Ga0075428_100073481
1968 Ga0075428_100173857
1969 Ga0075428_100864848
1970 Ga0075430_100028858
1971 Ga0075430_100060450
1972 Ga0075431_100001810
1973 Ga0075431_100072177
1974 Ga0075431_100120887
1975 Ga0075431_100143342
1976 Ga0075431_100264530
1977 Ga0075433_10002034
1978 Ga0075433_10006137
1979 Ga0075433_10008633
1980 Ga0075433_10062911
1981 Ga0075434_100000007
1982 Ga0075434_100000693
1983 Ga0075434_100001159
1984 Ga0075434_100042973
1985 Ga0075434_100060322
1986 Ga0075434_100128088
1987 Ga0075434_100152317
1988 Ga0075429_100240514
1989 Ga0075429_100561978
1990 Ga0068865_100002115
1991 Ga0068865_100033785
1992 Ga0068865_100251079
1993 Ga0075436_100002192
1994 Ga0075436_100004166
1995 Ga0075436_100027202
1996 Ga0075436_100131794
1997 Ga0075436_100357828
1998 Ga0097620_100003708
1999 Ga0097620_100023234
2000 Ga0097620_100108838
2001 Ga0097620_100127413
2002 Ga0075435_100000432
2003 Ga0075435_100025823
2004 Ga0075435_100032913
2005 Ga0075435_100039209
2006 Ga0075435_100105730
2007 Ga0075435_100228548
2008 Ga0075435_100260242
2009 Ga0099795_10093911
2010 Ga0105244_10049754
2011 Ga0105250_10131030
2012 Ga0105240_10037315
2013 Ga0105240_10294125
2014 Ga0111539_10004448
2015 Ga0111539_10005607
2016 Ga0111539_10013539
2017 Ga0111539_10017591
2018 Ga0111539_10019998
2019 Ga0111539_10061746
2020 Ga0111539_10087807
2021 Ga0111539_10197563
2022 Ga0111539_10518722
2023 Ga0105245_10002944
2024 Ga0105245_10069147
2025 Ga0105245_10119521
2026 Ga0105245_10215404
2027 Ga0105245_10353319
2028 Ga0105245_10994961
2029 Ga0105247_10011296
2030 Ga0105247_10012837
2031 Ga0105247_10020997
2032 Ga0114129_10000742
2033 Ga0114129_10011756
2034 Ga0114129_10057318
2035 Ga0114129_10059035
2036 Ga0114129_10065278
2037 Ga0114129_10090263
2038 Ga0114129_10105879
2039 Ga0114129_10115499
2040 Ga0114129_10641417
2041 Ga0105243_10002574
2042 Ga0105243_10011951
2043 Ga0105243_10055144
2044 Ga0105243_10132540
2045 Ga0105243_10230745
2046 Ga0105243_10363934
2047 Ga0105243_10406274
2048 Ga0105241_10024036
2049 Ga0105241_10073396
2050 Ga0105241_10131225
2051 Ga0105242_10056433
2052 Ga0105242_10058622
2053 Ga0105242_10079357
2054 Ga0105242_10246851
2055 Ga0105242_10263768
2056 Ga0105242_10279010
2057 Ga0105242_10280681
2058 Ga0105242_10379756
2059 Ga0105248_10063653
2060 Ga0105248_10084997
2061 Ga0105248_10196174
2062 Ga0105237_10153564
2063 Ga0105237_10307346
2064 Ga0105237_10343928
2065 Ga0105238_10009936
2066 Ga0105238_10125728
2067 Ga0105238_10230806
2068 Ga0105238_10308501
2069 Ga0105238_10410489
2070 Ga0105238_10578225
2071 Ga0105249_10015879
2072 Ga0105249_10017602
2073 Ga0105249_10119957
2074 Ga0105249_10140512
2075 Ga0105249_10154222
2076 Ga0105249_10216131
2077 Ga0099796_10005153
2078 Ga0105239_10004537
2079 Ga0105239_10414429
2080 Ga0105239_10781048
2081 Ga0105246_10001092
2082 Ga0105246_10068302
2083 Ga0105246_10108258
2084 Ga0157373_10125287
2085 Ga0157373_10217607
2086 Ga0157371_10007315
2087 Ga0157371_10106396
2088 Ga0157371_10262381
2089 Ga0157370_10180697
2090 Ga0157370_10238648
2091 Ga0157369_10220624
2092 Ga0157369_10261134
2093 Ga0157369_10488880
2094 Ga0157374_10002049
2095 Ga0157374_10032857
2096 Ga0157374_10136595
2097 Ga0157374_10329981
2098 Ga0157378_10007541
2099 Ga0157378_10044852
2100 Ga0157378_10078787
2101 Ga0157378_10255188
2102 Ga0157378_10690813
2103 Ga0163162_10005029
2104 Ga0163162_10077208
2105 Ga0163162_10077995
2106 Ga0163162_10108051
2107 Ga0163162_10127619
2108 Ga0163162_10402046
2109 Ga0163162_10408190
2110 Ga0157372_10012748
2111 Ga0157372_10045191
2112 Ga0157372_10091294
2113 Ga0157372_10561435
2114 Ga0157375_10004037
2115 Ga0157375_10019784
2116 Ga0157375_10054327
2117 Ga0157375_10160750
2118 Ga0157375_10207198
2119 Ga0157375_10301436
2120 Ga0157375_10928382
2121 Ga0163163_10005574
2122 Ga0163163_10024568
2123 Ga0163163_10044684
2124 Ga0163163_10055637
2125 Ga0163163_10177888
2126 Ga0163163_10407254
2127 Ga0157380_10001279
2128 Ga0157380_10091519
2129 Ga0157380_10231218
2130 Ga0157380_10257088
2131 Ga0157380_10644173
2132 Ga0157380_10699440
2133 Ga0157380_10864854
2134 Ga0157380_10872934
2135 Ga0182008_10032141
2136 Ga0157377_10000312
2137 Ga0157377_10010127
2138 Ga0157379_10001989
2139 Ga0157379_10029559
2140 Ga0157379_10063884
2141 Ga0157379_10088015
2142 Ga0157379_10161405
2143 Ga0157376_10001372
2144 Ga0157376_10037848
2145 Ga0157376_10054749
2146 Ga0157376_10067048
2147 Ga0157376_10735798
2148 Ga0163161_10003480
2149 Ga0163161_10078656
2150 Ga0163161_10112250
2151 Ga0163161_10205986
2152 Ga0213876_10110816
2153 Ga0213876_10133655
2154 Ga0207666_1000038
2155 Ga0207673_1001708
2156 Ga0209758_1001233
2157 Ga0207697_10000373
2158 Ga0207697_10039973
2159 Ga0207697_10145323
2160 Ga0207655_1085718
2161 Ga0207653_10000559
2162 Ga0207653_10005254
2163 Ga0207653_10072307
2164 Ga0207682_10000071
2165 Ga0207682_10001862
2166 Ga0207692_10067079
2167 Ga0207692_10098281
2168 Ga0207692_10270858
2169 Ga0207710_10007122
2170 Ga0207710_10011401
2171 Ga0207710_10025753
2172 Ga0207688_10000237
2173 Ga0207688_10002075
2174 Ga0207688_10133137
2175 Ga0207680_10016997
2176 Ga0207680_10037949
2177 Ga0207680_10186825
2178 Ga0207647_10009005
2179 Ga0207647_10040967
2180 Ga0207647_10048394
2181 Ga0207647_10073935
2182 Ga0207647_10083625
2183 Ga0207685_10002917
2184 Ga0207699_10073451
2185 Ga0207645_10000779
2186 Ga0207645_10085716
2187 Ga0207645_10110454
2188 Ga0207643_10000276
2189 Ga0207643_10002314
2190 Ga0207643_10016243
2191 Ga0207643_10090843
2192 Ga0207705_10062534
2193 Ga0207654_10014702
2194 Ga0207654_10058895
2195 Ga0207654_10183138
2196 Ga0207707_10000454
2197 Ga0207707_10070862
2198 Ga0207707_10100506
2199 Ga0207707_10167955
2200 Ga0207707_10183377
2201 Ga0207707_10199840
2202 Ga0207707_10212418
2203 Ga0207695_10193073
2204 Ga0207671_10016484
2205 Ga0207671_10037376
2206 Ga0207671_10183842
2207 Ga0207693_10005073
2208 Ga0207693_10007312
2209 Ga0207693_10010718
2210 Ga0207693_10021275
2211 Ga0207693_10059589
2212 Ga0207693_10101245
2213 Ga0207693_10132910
2214 Ga0207693_10278799
2215 Ga0207693_10326774
2216 Ga0207693_10496060
2217 Ga0207663_10060626
2218 Ga0207663_10092706
2219 Ga0207663_10115713
2220 Ga0207663_10242074
2221 Ga0207660_10000087
2222 Ga0207660_10035293
2223 Ga0207660_10035398
2224 Ga0207660_10065427
2225 Ga0207660_10146519
2226 Ga0207660_10365811
2227 Ga0207660_10407093
2228 Ga0207660_10492479
2229 Ga0207662_10000659
2230 Ga0207662_10006900
2231 Ga0207662_10009020
2232 Ga0207662_10037840
2233 Ga0207662_10047292
2234 Ga0207657_10003101
2235 Ga0207657_10005173
2236 Ga0207657_10019458
2237 Ga0207657_10090738
2238 Ga0207649_10000662
2239 Ga0207649_10013634
2240 Ga0207649_10039165
2241 Ga0207649_10061498
2242 Ga0207649_10169967
2243 Ga0207652_10001908
2244 Ga0207652_10008147
2245 Ga0207652_10023549
2246 Ga0207652_10050201
2247 Ga0207652_10065031
2248 Ga0207652_10111416
2249 Ga0207652_10133337
2250 Ga0207652_10459726
2251 Ga0207681_10001262
2252 Ga0207681_10038145
2253 Ga0207681_10228489
2254 Ga0207681_10308190
2255 Ga0207681_10390820
2256 Ga0207694_10017984
2257 Ga0207694_10166488
2258 Ga0207650_10005107
2259 Ga0207650_10159384
2260 Ga0207659_10000143
2261 Ga0207659_10026549
2262 Ga0207659_10057060
2263 Ga0207659_10070018
2264 Ga0207659_10202567
2265 Ga0207659_10401094
2266 Ga0207687_10000865
2267 Ga0207687_10052245
2268 Ga0207687_10120981
2269 Ga0207687_10235753
2270 Ga0207700_10000323
2271 Ga0207700_10034585
2272 Ga0207700_10063780
2273 Ga0207700_10070564
2274 Ga0207700_10078894
2275 Ga0207700_10229601
2276 Ga0207700_10431403
2277 Ga0207664_10075293
2278 Ga0207664_10511668
2279 Ga0207644_10000532
2280 Ga0207644_10015181
2281 Ga0207644_10045594
2282 Ga0207644_10166963
2283 Ga0207690_10000409
2284 Ga0207690_10074024
2285 Ga0207690_10186213
2286 Ga0207706_10001338
2287 Ga0207706_10006705
2288 Ga0207706_10026317
2289 Ga0207706_10037549
2290 Ga0207706_10058641
2291 Ga0207706_10121459
2292 Ga0207686_10000500
2293 Ga0207686_10082565
2294 Ga0207686_10173175
2295 Ga0207686_10301377
2296 Ga0207709_10001266
2297 Ga0207709_10037338
2298 Ga0207709_10161854
2299 Ga0207709_10196300
2300 Ga0207709_10203809
2301 Ga0207670_10000689
2302 Ga0207670_10004774
2303 Ga0207670_10007354
2304 Ga0207670_10064980
2305 Ga0207670_10156514
2306 Ga0207670_10370567
2307 Ga0207669_10001125
2308 Ga0207669_10036510
2309 Ga0207669_10051596
2310 Ga0207669_10409772
2311 Ga0207704_10000613
2312 Ga0207704_10075416
2313 Ga0207665_10001192
2314 Ga0207665_10052253
2315 Ga0207665_10088263
2316 Ga0207665_10352722
2317 Ga0207691_10002493
2318 Ga0207691_10003339
2319 Ga0207691_10024434
2320 Ga0207691_10128419
2321 Ga0207691_10321603
2322 Ga0207711_10009628
2323 Ga0207711_10029326
2324 Ga0207711_10032877
2325 Ga0207711_10041693
2326 Ga0207711_10050370
2327 Ga0207711_10192293
2328 Ga0207689_10000440
2329 Ga0207689_10021598
2330 Ga0207689_10046437
2331 Ga0207689_10065413
2332 Ga0207689_10382488
2333 Ga0207661_10043667
2334 Ga0207661_10059018
2335 Ga0207661_10059503
2336 Ga0207661_10061762
2337 Ga0207679_10000131
2338 Ga0207679_10016049
2339 Ga0207679_10052938
2340 Ga0207679_10093901
2341 Ga0207679_10156128
2342 Ga0207667_10028062
2343 Ga0207667_10040115
2344 Ga0207667_10088810
2345 Ga0207667_10092846
2346 Ga0207667_10659237
2347 Ga0207651_10000335
2348 Ga0207651_10734133
2349 Ga0207712_10002448
2350 Ga0207712_10004065
2351 Ga0207712_10030909
2352 Ga0207712_10048380
2353 Ga0207712_10220854
2354 Ga0207668_10000065
2355 Ga0207668_10029098
2356 Ga0207668_10104967
2357 Ga0207668_10339016
2358 Ga0207640_10000339
2359 Ga0207658_10004428
2360 Ga0207658_10026143
2361 Ga0207658_10177132
2362 Ga0207658_10433482
2363 Ga0207677_10003580
2364 Ga0207677_10019568
2365 Ga0207677_10227626
2366 Ga0207703_10001885
2367 Ga0207703_10047628
2368 Ga0207703_10056702
2369 Ga0207703_10397386
2370 Ga0207703_10430245
2371 Ga0207639_10041384
2372 Ga0207639_10124568
2373 Ga0207639_10262440
2374 Ga0207639_10514061
2375 Ga0207678_10000944
2376 Ga0207678_10006342
2377 Ga0207678_10036592
2378 Ga0207678_10056937
2379 Ga0207678_10058587
2380 Ga0207678_10115709
2381 Ga0207678_10147555
2382 Ga0207678_10160477
2383 Ga0207708_10002019
2384 Ga0207708_10002166
2385 Ga0207708_10019423
2386 Ga0207708_10031033
2387 Ga0207702_10028991
2388 Ga0207702_10070772
2389 Ga0207702_10084985
2390 Ga0207641_10005810
2391 Ga0207641_10073016
2392 Ga0207641_10169305
2393 Ga0207641_10184921
2394 Ga0207641_10726252
2395 Ga0207648_10003430
2396 Ga0207648_10043776
2397 Ga0207648_10081728
2398 Ga0207648_10347959
2399 Ga0207676_10008134
2400 Ga0207676_10016804
2401 Ga0207676_10047064
2402 Ga0207676_10074119
2403 Ga0207676_10084878
2404 Ga0207676_10114967
2405 Ga0207676_10139552
2406 Ga0207674_10003323
2407 Ga0207674_10005364
2408 Ga0207674_10080241
2409 Ga0207674_10084500
2410 Ga0207674_10191770
2411 Ga0207675_100000815
2412 Ga0207675_100001837
2413 Ga0207675_100069498
2414 Ga0207675_100116502
2415 Ga0207675_100140046
2416 Ga0207683_10000001
2417 Ga0207683_10006914
2418 Ga0207683_10081084
2419 Ga0207683_10252232
2420 Ga0207698_10019683
2421 Ga0207698_10027837
2422 Ga0207698_10051342
2423 Ga0207698_10072196
2424 Ga0209969_1003168
2425 Ga0209967_1000489
2426 Ga0209981_1000830
2427 Ga0210000_1000255
2428 Ga0209179_1006000
2429 Ga0209968_1002489
2430 Ga0210002_1001135
2431 Ga0210002_1027794
2432 Ga0209966_1000743
2433 Ga0209998_10001042
2434 Ga0209998_10002206
2435 Ga0209974_10004114
2436 Ga0207428_10000172
2437 Ga0207428_10000255
2438 Ga0207428_10003313
2439 Ga0207428_10013736
2440 Ga0207428_10016308
2441 Ga0207428_10138752
2442 Ga0207428_10184301
2443 Ga0207428_10267944
2444 Ga0268266_10020037
2445 Ga0268266_10107574
2446 Ga0268265_10009461
2447 Ga0268265_10029653
2448 Ga0268265_10055949
2449 Ga0268265_10165088
2450 Ga0268265_10173558
2451 Ga0268264_10001153
2452 Ga0268264_10006938
2453 Ga0268264_10086369
2454 Ga0268264_10236425
2455 Ga0268264_10408859
2456 Ga0265337_1010295
2457 Ga0265318_10055027
2458 Ga0265338_10035331
2459 Ga0265338_10143015
2460 Ga0265338_10198241
2461 Ga0265330_10039488
2462 Ga0265330_10081844
2463 Ga0265330_10169430
2464 Ga0265325_10000901
2465 Ga0265325_10002536
2466 Ga0265325_10013945
2467 Ga0265325_10019710
2468 Ga0265329_10053302
2469 Ga0265340_10007715
2470 Ga0265340_10011101
2471 Ga0265339_10000091
2472 Ga0265339_10000387
2473 Ga0265331_10040106
2474 Ga0265316_10039292
2475 Ga0265313_10000850
2476 Ga0265313_10001068
2477 Ga0265313_10004004
2478 Ga0265313_10016620
2479 Ga0265314_10007897
2480 Ga0265314_10024428
2481 Ga0265314_10156525
2482 Ga0265342_10000196
2483 Ga0265342_10024497
2484 Ga0265342_10063512
2485 Ga0373930_0000014
2486 Ga0373948_0000493
2487 Ga0373948_0000950
2488 Ga0373948_0052100
2489 Ga0373950_0000145
2490 Ga0373950_0018150
2491 Ga0373958_0000064
2492 Ga0373958_0026549
2493 Ga0373938_0000946
2494 Ga0373926_0015109
2495 Ga0373928_0001389
2496 Ga0373928_0007010
2497 Ga0373929_0000101
2498 Ga0373929_0002108
2499 Ga0373929_0004137
2500 Ga0373934_0010944
2501 Ga0373940_0003765
2502 Ga0373940_0034213
2503 Ga0373944_0003519
2504 Ga0373949_0000293
2505 Ga0373949_0000952
2506 Ga0373949_0018854
2507 Ga0373951_0000154
2508 Ga0373951_0021677
2509 Ga0373952_0000030
2510 Ga0373952_0000920
2511 Ga0373923_0010802
2512 Ga0373923_0016379
2513 Ga0373923_0040531
2514 Ga0373923_0088514
2515 Ga0373932_0001243
2516 Ga0373932_0003082
2517 Ga0373932_0027504
2518 Ga0373936_0008164
2519 Ga0373936_0017372
2520 Ga0373939_0000791
2521 Ga0373939_0003691
2522 Ga0373939_0006181
2523 Ga0373941_0000050
2524 Ga0373941_0020276
2525 Ga0373945_0001214
2526 Ga0373945_0010949
2527 Ga0373953_0001444
2528 Ga0373953_0013693
2529 Ga0373954_0001943
2530 Ga0373954_0008746
2531 Ga0373954_0021614
2532 Ga0373954_0032397
2533 Ga0373954_0083291
2534 Ga0373956_0024897
2535 Ga0373956_0052136
2536 Ga0373957_0005066
2537 Ga0373960_0003068
2538 Ga0373960_0020400
2539 Ga0373943_0000132
2540 Ga0373943_0000377
2541 Ga0373943_0001792
2542 Ga0373943_0010229
2543 Ga0373943_0012484
2544 Ga0373943_0020151
2545 Ga0373943_0143635
2546 Ga0373946_0000760
2547 Ga0373946_0001192
2548 Ga0373946_0005660
2549 Ga0373946_0007440
2550 Ga0373946_0012923
2551 Ga0373946_0063519
2552 Ga0373955_0000779
2553 Ga0373955_0069284
2554 Ga0373942_0000073
2555 Ga0373961_0000480
2556 Ga0373961_0034668
2557 Ga0373962_0001214
2558 Ga0373962_0001920
2559 Ga0373962_0023763
2560 Ga0373931_0000537
2561 Ga0373931_0006018
2562 Ga0373931_0010273
2563 Ga0373931_0032608
2564 Ga0373935_0000053
2565 Ga0373935_0001261
2566 Ga0373935_0003568
2567 Ga0373935_0004470
2568 Ga0373935_0009944
2569 Ga0373935_0046856
2570 Ga0373927_0002426
2571 Ga0373927_0004260
2572 Ga0373927_0032963
2573 Ga0373927_0074416
2574 Ga0373927_0100049
2575 Ga0373933_0001426
2576 Ga0373933_0021557
2577 Ga0373933_0034416
2578 Ga0373933_0165937
2579 Ga0373947_0000239
2580 Ga0373947_0000259
2581 Ga0373947_0001656
2582 Ga0373947_0008738
2583 Ga0373947_0009288
2584 Ga0373947_0085740
2585 Ga0373947_0191699
2586 Ga0373937_0000030
2587 Ga0373937_0000907
2588 Ga0373937_0001504
2589 Ga0373937_0003255
2590 Ga0373937_0029085
2591 Ga0373937_0036814
2592 Ga0373937_0090015
2593 Ga0373937_0200872
2594 Ga0373937_0287582
2595 Ga0373937_0689296
2596 Ga0373925_0000002
2597 Ga0373925_0000706
2598 Ga0373925_0019842
2599 Ga0373925_0024207
2600 Ga0373925_0043540
2601 Ga0373925_0044964
2602 Ga0373925_0057569
2603 Ga0373925_0120502
2604 Ga0373925_0264489
2605 Ga0373925_0346049
2606 Ga0395900_0009186
2607 Ga0395898_0003941
2608 Ga0395898_0024197
2609 Ga0395901_0075175
2610 Ga0395901_0161489
2611 Ga0436365_0005986
2612 Ga0436365_0733539
2613 Ga0436361_0561320
2614 Ga0436363_1296716
2615 Ga0439453_0000288
2616 Ga0439453_0014947
2617 Ga0439461_0003514
2618 Ga0451853_1447647
2619 Ga0439443_003618
2620 Ga0439448_0182998
2621 Ga0439450_051973
2622 Ga0439455_0019342
2623 Ga0439463_013245
2624 Ga0439446_0001019
2625 Ga0439434_0002451
2626 Ga0439435_0000002
2627 Ga0439435_0006285
2628 Ga0439444_0002652
2629 Ga0439440_0017585
2630 Ga0466966_0016428
2631 Ga0466963_0044109
2632 Ga0466963_0096637
2633 Ga0466963_0161577
2634 Ga0466964_0051022
2635 Ga0466971_0008622
2636 Ga0466957_0097636
2637 Ga0466957_0161700
2638 Ga0466957_0380297
2639 Ga0466959_0150051
2640 Ga0466959_0361079
2641 Ga0451576_0017130
2642 Ga0451576_0117936
2643 Ga0466958_0016008
2644 Ga0466958_0149142
2645 Ga0466967_0000135
2646 Ga0466967_0006741
2647 Ga0466967_0500056
2648 Ga0495592_0000046
2649 Ga0495592_0001393
2650 Ga0495592_0002484
2651 Ga0495592_0009550
2652 Ga0495592_0078729
2653 Ga0495592_0115815
2654 Ga0495592_0168976
2655 Ga0495603_0002249
2656 Ga0495603_0008354
2657 Ga0495603_0014184
2658 Ga0495603_0050857
2659 Ga0495603_0102843
2660 Ga0495591_048065
2661 Ga0495629_0000594
2662 Ga0495629_0001140
2663 Ga0495629_0002311
2664 Ga0495629_0019080
2665 Ga0495629_0024508
2666 Ga0495629_0033237
2667 Ga0495629_0084401
2668 Ga0495629_0100862
2669 Ga0495629_0117093
2670 Ga0495641_0007754
2671 Ga0495641_0011331
2672 Ga0495641_0016661
2673 Ga0495641_0017820
2674 Ga0495641_0142861
2675 Ga0495651_0000822
2676 Ga0495651_0001833
2677 Ga0495651_0004816
2678 Ga0495653_0000006
2679 Ga0495653_0004798
2680 Ga0495653_0024139
2681 Ga0495653_0357386
2682 Ga0495580_0017640
2683 Ga0495580_0044484
2684 Ga0495582_0000379
2685 Ga0495582_0010594
2686 Ga0495582_0028169
2687 Ga0495582_0032148
2688 Ga0495582_0141949
2689 Ga0495582_0231817
2690 Ga0495582_0284725
2691 Ga0495605_0023685
2692 Ga0495639_0004321
2693 Ga0495639_0015125
2694 Ga0495639_0030966
2695 Ga0495639_0050475
2696 Ga0495662_0000084
2697 Ga0495662_0000280
2698 Ga0495662_0002481
2699 Ga0495662_0021388
2700 Ga0495662_0068233
2701 Ga0495662_0188970
2702 Ga0495664_0000002
2703 Ga0495664_0000112
2704 Ga0495664_0007745
2705 Ga0495584_0033756
2706 Ga0495584_0037617
2707 Ga0495584_0242075
2708 Ga0495585_0001932
2709 Ga0495594_0002726
2710 Ga0495594_0009110
2711 Ga0495594_0011284
2712 Ga0495594_0018037
2713 Ga0495583_0102989
2714 Ga0495608_0000006
2715 Ga0495608_0012927
2716 Ga0495608_0017846
2717 Ga0495618_0000034
2718 Ga0495618_0001016
2719 Ga0495618_0001547
2720 Ga0495618_0073148
2721 Ga0495618_0131903
2722 Ga0495618_0287857
2723 Ga0495628_0000002
2724 Ga0495628_0003624
2725 Ga0495628_0027943
2726 Ga0495628_0032270
2727 Ga0495628_0101756
2728 Ga0495630_0000662
2729 Ga0495630_0005622
2730 Ga0495630_0027968
2731 Ga0495630_0042264
2732 Ga0495630_0095680
2733 Ga0495630_0257836
2734 Ga0495637_0020521
2735 Ga0495637_0090560
2736 Ga0495644_0003085
2737 Ga0495663_0013733
2738 Ga0495663_0021273
2739 Ga0495666_0001508
2740 Ga0495666_0012392
2741 Ga0495666_0033888
2742 Ga0495666_0034119
2743 Ga0495652_0000004
2744 Ga0495652_0013904
2745 Ga0495652_0019057
2746 Ga0495652_0026657
2747 Ga0495652_0307758
2748 Ga0495665_0003909
2749 Ga0495665_0014689
2750 Ga0495665_0017779
2751 Ga0495665_0098481
2752 Ga0495640_0000007
2753 Ga0495640_0006199
2754 Ga0495640_0008881
2755 Ga0495640_0010455
2756 Ga0495640_0065752
2757 Ga0495586_0032879
2758 Ga0495587_0000031
2759 Ga0495587_0002979
2760 Ga0495587_0016339
2761 Ga0495587_0018087
2762 Ga0495587_0193285
2763 Ga0495598_0004396
2764 Ga0495598_0087189
2765 Ga0495621_0011059
2766 Ga0495645_0000003
2767 Ga0495645_0005275
2768 Ga0495645_0010875
2769 Ga0495645_0011025
2770 Ga0495645_0263654
2771 Ga0495622_0014593
2772 Ga0495622_0049494
2773 Ga0495633_0057678
2774 Ga0495667_0000002
2775 Ga0495667_0000202
2776 Ga0495667_0032919
2777 Ga0495667_0295836
2778 Ga0495667_0330463
2779 Ga0495667_0330949
2780 Ga0495656_0000360
2781 Ga0495656_0023542
2782 Ga0495668_0142440
2783 Ga0495634_0008544
2784 Ga0495634_0021106
2785 Ga0495634_0021460
2786 Ga0495634_0255009
2787 Ga0495611_0053456
2788 Ga0495635_0000022
2789 Ga0495635_0002093
2790 Ga0495635_0013894
2791 Ga0495635_0166962
2792 Ga0495635_0235696
2793 Ga0495635_0473144
2794 Ga0495659_0037099
2795 Ga0495661_0010683
2796 Ga0495588_0025753
2797 Ga0495588_0075208
2798 Ga0495657_0000276
2799 Ga0495657_0031463
2800 Ga0495599_0000001
2801 Ga0495599_0002835
2802 Ga0495599_0317649
2803 Ga0495623_0000094
2804 Ga0495623_0001448
2805 Ga0495623_0335799
2806 Ga0495646_0000007
2807 Ga0495646_0029532
2808 Ga0495646_0033018
2809 Ga0495646_0144654
2810 Ga0495647_0000122
2811 Ga0495647_0000393
2812 Ga0495647_0001922
2813 Ga0495647_0050007
2814 Ga0495658_0000210
2815 Ga0495658_0009937
2816 Ga0495658_0026729
2817 Ga0495658_0081190
2818 Ga0495669_0084935
2819 Ga0495613_0086199
2820 Ga0495624_0000222
2821 Ga0495624_0001294
2822 Ga0495624_0029382
2823 Ga0495624_0031182
2824 Ga0495624_0063300
2825 Ga0495624_0290652
2826 Ga0495670_0001624
2827 Ga0495670_0047900
2828 Ga0495589_0158326
2829 Ga0495600_0000033
2830 Ga0495600_0000506
2831 Ga0495600_0002658
2832 Ga0495600_0030323
2833 Ga0495600_0194032
2834 Ga0495600_0312572
2835 Ga0495581_0005193
2836 Ga0495581_0005649
2837 Ga0495581_0020808
2838 Ga0495581_0021146
2839 Ga0495604_0000005
2840 Ga0495604_0001089
2841 Ga0495604_0002751
2842 Ga0495604_0007025
2843 Ga0495604_0082269
2844 Ga0495636_0016055
2845 Ga0495674_0000003
2846 Ga0495674_0001490
2847 Ga0495674_0001513
2848 Ga0495674_0014630
2849 Ga0495674_0026272
2850 Ga0495674_0058792
2851 Ga0495674_0096001
2852 Ga0495674_0240133
2853 Ga0495674_0565763
2854 Ga0495672_0122114
2855 Ga0495676_0000289
2856 Ga0495676_0021676
2857 Ga0495676_0167572
2858 Ga0495680_0000091
2859 Ga0495680_0001414
2860 Ga0495680_0012301
2861 Ga0495680_0064482
2862 Ga0495675_0000064
2863 Ga0495675_0007298
2864 Ga0495677_0148172
2865 Ga0495685_131822
2866 Ga0495684_0000035
2867 Ga0495684_0000075
2868 Ga0495684_0000264
2869 Ga0495684_0001309
2870 Ga0495684_0420568
2871 Ga0495593_0000228
2872 Ga0495593_0001106
2873 Ga0495593_0014059
2874 Ga0495593_0020031
2875 Ga0495593_0037694
2876 Ga0495593_0215723
2877 Ga0495602_0000029
2878 Ga0495602_0002033
2879 Ga0495602_0018847
2880 Ga0495602_0147942
2881 Ga0495602_0250469
2882 Ga0495602_0298434
2883 Ga0495614_0017130
2884 Ga0495614_0024948
2885 Ga0496100_0000404
2886 Ga0496100_0000823
2887 Ga0496100_0017884
2888 Ga0496100_0021550
2889 Ga0496101_0000423
2890 Ga0496101_0008909
2891 Ga0496101_0013330
2892 Ga0496101_0051874
2893 Ga0496101_0051974
2894 Ga0496101_0060493
2895 Ga0496101_0062028
2896 Ga0496102_0003323
2897 Ga0496102_0047059
2898 Ga0496102_0050819
2899 Ga0496102_0087854
2900 Ga0496102_0149714
2901 Ga0496102_0422390
2902 Ga0496103_0000967
2903 Ga0496103_0009318
2904 Ga0496103_0018841
2905 Ga0496103_0023575
2906 Ga0496103_0059818
2907 Ga0496103_0085283
2908 Ga0496103_0087744
2909 Ga0496103_0514955
2910 Ga0496104_0000711
2911 Ga0496104_0000925
2912 Ga0496104_0005217
2913 Ga0496104_0005466
2914 Ga0496104_0014835
2915 Ga0496104_0018532
2916 Ga0496104_0018853
2917 Ga0496104_0037286
2918 Ga0496104_0086618
2919 Ga0496104_0181717
2920 Ga0496105_0004562
2921 Ga0496105_0025218
2922 Ga0496105_0079464
2923 Ga0496105_0081682
2924 Ga0496105_0272168
2925 Ga0496106_0002446
2926 Ga0496106_0003669
2927 Ga0496106_0009344
2928 Ga0496106_0015174
2929 Ga0496106_0028983
2930 Ga0496106_0046079
2931 Ga0496106_0050986
2932 Ga0496106_0100583
2933 Ga0496106_0226765
2934 Ga0496107_0000500
2935 Ga0496107_0010585
2936 Ga0496107_0022186
2937 Ga0496107_0035757
2938 Ga0496107_0036271
2939 Ga0496107_0046339
2940 Ga0496107_0356698
2941 Ga0496108_0010045
2942 Ga0496108_0032769
2943 Ga0496108_0039555
2944 Ga0496108_0048346
2945 Ga0496108_0054148
2946 Ga0496108_0129685
2947 Ga0496109_0000340
2948 Ga0496109_0000359
2949 Ga0496109_0000976
2950 Ga0496109_0005940
2951 Ga0496109_0015600
2952 Ga0496109_0060588
2953 Ga0496109_0126561
2954 Ga0496109_0151191
2955 Ga0496109_0356430
2956 Ga0496109_0547656
2957 Ga0496110_0002357
2958 Ga0496110_0003362
2959 Ga0496110_0014914
2960 Ga0496110_0027384
2961 Ga0496110_0034978
2962 Ga0496110_0054089
2963 Ga0496110_0061174
2964 Ga0496110_0180349
2965 Ga0496111_0007077
2966 Ga0496111_0012965
2967 Ga0496111_0021239
2968 Ga0496111_0023917
2969 Ga0496111_0040590
2970 Ga0496111_0069085
2971 Ga0496111_0108052
2972 Ga0496111_0129596
2973 Ga0496111_0149808
2974 Ga0496112_0006271
2975 Ga0496112_0021049
2976 Ga0496112_0044120
2977 Ga0496112_0051703
2978 Ga0496112_0167221
2979 Ga0496112_0176044
2980 Ga0496112_0198456
2981 Ga0496112_0351325
2982 Ga0496113_0000463
2983 Ga0496113_0001950
2984 Ga0496113_0002665
2985 Ga0496113_0008785
2986 Ga0496113_0008826
2987 Ga0496113_0053025
2988 Ga0496113_0431387
2989 Ga0496114_0021314
2990 Ga0496114_0046871
2991 Ga0496114_0081951
2992 Ga0496114_0109867
2993 Ga0496114_0157710
2994 Ga0496115_0009234
2995 Ga0496115_0019987
2996 Ga0496115_0045224
2997 Ga0496115_0067163
2998 Ga0496115_0073699
2999 Ga0501031_0011742
3000 Ga0501031_0156179
3001 Ga0501032_0019959
3002 Ga0501033_0017940
3003 Ga0501033_0190471
3004 Ga0501033_0311955
3005 Ga0501034_0006692
3006 Ga0501034_0020000
3007 Ga0501034_0029366
3008 Ga0501034_0305192
3009 Ga0501034_0931952
3010 Ga0501036_0018021
3011 Ga0501037_0007895
3012 Ga0501037_0071272
3013 Ga0501037_0102956
3014 Ga0501037_0259157
3015 Ga0501038_0043904
3016 Ga0501038_0064678
3017 Ga0501038_0076041
3018 Ga0501039_0121235
3019 Ga0501039_0188401
3020 Ga0501039_0193552
3021 Ga0501039_0237492
3022 Ga0501040_0012594
3023 Ga0501040_0018457
3024 Ga0501040_0076897
3025 Ga0501040_0213128
3026 Ga0501041_0017024
3027 Ga0501041_0027793
3028 Ga0501041_0075493
3029 Ga0501042_0241243
3030 Ga0501042_0567114
3031 Ga0501043_0015891
3032 Ga0501043_0050356
3033 Ga0501043_0096527
3034 Ga0501043_0503787
3035 Ga0501046_0012829
3036 Ga0501046_0031228
3037 Ga0501046_0043437
3038 Ga0501047_0006347
3039 Ga0501047_0009067
3040 Ga0501047_0018859
3041 Ga0501047_0198550
3042 Ga0501048_0004440
3043 Ga0501048_0229114
3044 Ga0501067_0018631
3045 Ga0501068_0043146
3046 Ga0501068_0284541
3047 Ga0501069_0017442
3048 Ga0501069_0046105
3049 Ga0501069_0139164
3050 Ga0501070_0003185
3051 Ga0501070_0004846
3052 Ga0501070_0014654
3053 Ga0501070_0053740
3054 Ga0501070_0359275
3055 Ga0501071_0057606
3056 Ga0501071_0099765
3057 Ga0501072_0011302
3058 Ga0501072_0030502
3059 Ga0501072_0106645
3060 Ga0501072_0106796
3061 Ga0501072_0310850
3062 Ga0501072_0328612
3063 Ga0501073_0029987
3064 Ga0501074_0033113
3065 Ga0501074_0049131
3066 Ga0501074_0099597
3067 Ga0501075_0004734
3068 Ga0501075_0044232
3069 Ga0501075_0085345
3070 Ga0501075_0098564
3071 Ga0501076_0001405
3072 Ga0501076_0010937
3073 Ga0501076_0086410
3074 Ga0501076_0102344
3075 Ga0501076_0186014
3076 Ga0501076_0280921
3077 Ga0501077_0007341
3078 Ga0501077_0034622
3079 Ga0501077_0349144
3080 Ga0501079_0003233
3081 Ga0501079_0016017
3082 Ga0501079_0048600
3083 Ga0501079_0175830
3084 Ga0501079_0210955
3085 Ga0501079_0323761
3086 Ga0501080_0021206
3087 Ga0501080_0025076
3088 Ga0501080_0247783
3089 Ga0501081_0001767
3090 Ga0501081_0010499
3091 Ga0501081_0038168
3092 Ga0501081_0058154
3093 Ga0501083_0011824
3094 Ga0501083_0026837
3095 Ga0501083_0146022
3096 Ga0501083_0157043
3097 Ga0501035_0000127
3098 Ga0501035_0005073
3099 Ga0501035_0068477
3100 Ga0501035_0255397
3101 Ga0501035_0289417
3102 Ga0501044_0001312
3103 Ga0501044_0008177
3104 Ga0501044_0030205
3105 Ga0501044_0083642
3106 Ga0501044_0117406
3107 Ga0501044_0163053
3108 Ga0501044_0192296
3109 Ga0501044_0208105
3110 Ga0501044_0225240
3111 Ga0501044_0281404
3112 Ga0501045_0018155
3113 Ga0501045_0037333
3114 Ga0501045_0089530
3115 Ga0501045_0163184
3116 Ga0501045_0393783
3117 Ga0501045_0485933
3118 nmdc:mga03683_4783_c1
3119 nmdc:mga00v17_40420_c1
3120 nmdc:mga00v17_4490_c1
3121 nmdc:mga0yw44_47840_c1
3122 nmdc:mga0yw44_60962_c1
3123 nmdc:mga06z11_23201_c1
3124 nmdc:mga06z11_26428_c1
3125 nmdc:mga05p37_149738_c1
3126 nmdc:mga05p37_1808_c2
3127 nmdc:mga05p37_193955_c1
3128 nmdc:mga05p37_22036_c1
3129 nmdc:mga05p37_35541_c1
3130 nmdc:mga05p37_45950_c1
3131 nmdc:mga05p37_508_c2
3132 nmdc:mga05p37_661502_c1
3133 nmdc:mga05p37_875422_c1
3134 nmdc:mga09592_226707_c1
3135 nmdc:mga09592_421671_c1
3136 nmdc:mga09592_513695_c1
3137 nmdc:mga09592_78404_c1
3138 nmdc:mga0qj67_335685_c1
3139 nmdc:mga0qj67_6112_c1
3140 nmdc:mga0qj67_63707_c1
3141 nmdc:mga06r32_101497_c1
3142 nmdc:mga06r32_142417_c1
3143 nmdc:mga06r32_1960_c1
3144 nmdc:mga06r32_3441_c1
3145 nmdc:mga06r32_59228_c1
3146 nmdc:mga08y16_14675_c1
3147 nmdc:mga08y16_172282_c1
3148 nmdc:mga08y16_2332_c1
3149 nmdc:mga08y16_272265_c1
3150 nmdc:mga08y16_306842_c1
3151 nmdc:mga08y16_3146_c1
3152 nmdc:mga08y16_3939_c1
3153 nmdc:mga08y16_45632_c1
3154 nmdc:mga08y16_643609_c1
3155 nmdc:mga08y16_89125_c1
3156 nmdc:mga08y16_9215_c1
3157 nmdc:mga0n895_141652_c1
3158 nmdc:mga0n895_145_c1
3159 nmdc:mga0n895_30075_c1
3160 nmdc:mga0n895_37534_c1
3161 nmdc:mga0n895_4696_c1
3162 nmdc:mga0n895_493926_c1
3163 nmdc:mga0n895_69426_c1
3164 nmdc:mga0n895_952226_c1
3165 nmdc:mga0rr50_149655_c1
3166 nmdc:mga0rr50_1966_c1
3167 nmdc:mga0rr50_25674_c1
3168 nmdc:mga0rr50_2684_c1
3169 nmdc:mga0rr50_367066_c1
3170 nmdc:mga0rr50_42859_c1
3171 nmdc:mga0rr50_435442_c1
3172 nmdc:mga0rr50_48815_c1
3173 nmdc:mga0rr50_75948_c1
3174 nmdc:mga08x19_1133_c1
3175 nmdc:mga08x19_116183_c1
3176 nmdc:mga08x19_127257_c1
3177 nmdc:mga08x19_21279_c1
3178 nmdc:mga08x19_33203_c1
3179 nmdc:mga08x19_33421_c1
3180 nmdc:mga08x19_46164_c1
3181 nmdc:mga08x19_60686_c1
3182 nmdc:mga0a205_18201_c1
3183 nmdc:mga0a205_1921_c1
3184 nmdc:mga0a205_2724_c1
3185 nmdc:mga0a205_44400_c1
3186 nmdc:mga0a205_50540_c1
3187 nmdc:mga0sz30_135475_c1
3188 Ga0495601_0000008
3189 Ga0495601_0001042
3190 Ga0495601_0001925
3191 Ga0495601_0004619
3192 Ga0495601_0029283
3193 Ga0495601_0031011
3194 Ga0495601_0096670
3195 Ga0495601_0164506
3196 Ga0495612_0000026
3197 Ga0495612_0000308
3198 Ga0495612_0000858
3199 Ga0495612_0032977
3200 Ga0495612_0111205
3201 Ga0500610_0135901
3202 Ga0495655_0002363
3203 Ga0495655_0023126
3204 Ga0495595_0000024
3205 Ga0495595_0000879
3206 Ga0495595_0006336
3207 Ga0495595_0011017
3208 Ga0495595_0014880
3209 Ga0495619_0000002
3210 Ga0495619_0000229
3211 Ga0495619_0001598
3212 Ga0495619_0005795
3213 Ga0495619_0010541
3214 Ga0495619_0013992
3215 Ga0495619_0014059
3216 Ga0495619_0018217
3217 Ga0495619_0065633
3218 Ga0495619_0067601
3219 Ga0495619_0105512
3220 Ga0500578_0140554
3221 Ga0500644_0002495
3222 Ga0500583_0079978
3223 Ga0500651_0022942
3224 Ga0500651_0326092
3225 Ga0500595_000010
3226 Ga0500652_070981
3227 Ga0500573_0187135
3228 Ga0500588_0056159
3229 Ga0500604_0038365
3230 Ga0500616_0000001
3231 Ga0500616_0096643
3232 Ga0500611_004286
3233 Ga0500645_000015
3234 Ga0500645_039412
3235 Ga0501084_0101890
3236 Ga0501084_0147838
3237 Ga0501084_0150596
3238 Ga0501084_0261257
3239 Ga0501084_0293106
3240 Ga0501084_0326409
3241 Ga0501084_0361117
3242 Ga0501084_0588322
3243 Ga0590071_011869
3244 Ga0590071_014618
3245 Ga0501082_0000013
3246 Ga0501082_0011829
3247 Ga0501082_0013431
3248 Ga0501082_0027888
3249 Ga0501082_0052297
3250 Ga0501082_0060268
3251 Ga0501082_0083125
3252 Ga0501082_0120127
3253 Ga0501082_0395969
3254 Ga0466962_0033717
3255 Ga0466962_0124513
3256 Ga0530510_0000596
3257 Ga0530510_0100902
3258 Ga0530510_0157817

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

88

257

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7702 57 251
3dhw-assembly2.cif.gz_E crystal structure of methionine importer metni 0.7559 56 238
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.7371 58 240
4tqu-assembly1.cif.gz_M crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.7268 47 250
3dhw-assembly2.cif.gz_F crystal structure of methionine importer metni 0.7165 57 240
ID Description Score Start End Superfamily
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8973 54 248 1.10.3720.10
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8919 59 249 1.10.3720.10
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8846 54 248 1.10.3720.10
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8782 61 251 1.10.3720.10
af_Q2G1I4_54_251_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.872 56 254 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A537V064-F1-model_v4 ABC transporter permease 0.9117 7 258 GO:0005886
GO:0055085
AF-A0A351SMG1-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9047 8 258 GO:0005886
GO:0055085
AF-A0A4V2UWZ3-F1-model_v4 NitT/TauT family transport system permease protein/taurine transport system permease protein/sulfonate transport system permease protein 0.9042 6 258 GO:0005886
GO:0055085
AF-A0A1F4BPC8-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9038 16 258 GO:0005886
GO:0055085
AF-A0A1I0AFD3-F1-model_v4 NitT/TauT family transport system permease protein 0.9032 9 254 GO:0005886
GO:0055085

Map