F495133
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1631 | 462 | 3262 | 362 |
Family's Representative Sequence
| Representative Sequence | 3300049576|Ga0501040_0015481|Ga0501040_0015481_2255_3532 |
| Length | 425 |
| Sequence | LNHVSDRGPRIQLSLAIQKHFSGGGRRTAAADPVILFSVKRVRVGVLYGGRSGEHEVSLASAAAVIANLDRTRYEPVAIRIDKDGRWGLAERAPTASSAAEVIEQARLEAARPSRSGREVHLVARPSEETILAIDRGSRRGEIDAGQVIVTGMNLDVIFPVLHGPYGEDGTIQGLLELANVPYVGAGVLPSAVGMDKALMKVVFAASSLPVCPYRAFLRREWNGRRDDLVRELVAVLGFPMFVKPANLGSSVGISKAKDAAALAGAIDLAGSFDRKIVVEAAVPEAREIECAVLGNDDPAASVPGEVVPSREFYDYEAKYLDEGSRTIIPAELPPATTAEIQRLAIASFQAIDCAGMARIDFLLSRSSGAIFVNEVNTIPGFTTISMYSKLWAASGLAYPELLDRLIGLAFERHAEKQQLRTSVS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 89 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 91 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 92 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 93 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 94 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 95 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 98 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 101 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 102 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 103 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 104 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 105 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 106 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 107 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 108 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 109 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 112 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 137 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 141 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 145 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 208 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 212 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 213 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 214 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 216 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 218 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 221 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 224 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 225 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 226 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 227 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 228 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 229 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 230 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 231 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 232 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 233 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 234 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 235 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 236 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 237 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 239 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 240 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 241 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 242 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 243 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 244 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 245 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 246 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 247 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 248 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 249 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 250 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 251 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 252 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 254 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 256 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 257 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 259 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 261 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 262 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 263 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 264 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 266 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 267 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 268 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 270 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 271 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 273 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 274 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 275 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 276 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 277 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 278 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 279 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 280 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 281 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 282 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 283 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 284 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 285 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 286 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 287 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 288 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 289 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 290 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 291 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 292 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 293 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 294 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 295 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 296 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 297 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 298 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 299 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 300 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 301 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 302 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 303 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 304 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 305 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 306 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 307 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 308 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 309 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 310 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 311 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 312 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 313 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 314 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 315 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 316 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 317 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 318 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 355 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 356 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 357 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 358 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 359 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 360 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 362 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 363 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 364 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 365 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 366 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 367 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 368 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 369 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 370 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 371 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 372 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 373 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 374 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 375 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 403 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 408 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 412 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 413 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 414 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 415 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 416 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 417 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 430 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 431 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 432 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 433 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 434 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 435 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 436 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 437 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 438 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 440 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 441 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 442 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 444 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 445 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 446 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 447 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 448 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 449 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 450 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 451 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 452 | 2904430863 | Curtobacterium oceanosedimentum 1519 | Isolate | Rhizosphere |
| 453 | 2904501621 | Curtobacterium sp. 1909 | Isolate | Unclassified |
| 454 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 455 | 2909074476 | Curtobacterium sp. 1310 | Isolate | Rhizosphere |
| 456 | 2919039151 | Curtobacterium sp. 260 | Isolate | Rhizosphere |
| 457 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 458 | 2928104781 | Curtobacterium sp. 1544 | Isolate | Rhizosphere |
| 459 | 2928500415 | Curtobacterium oceanosedimentum 1257 | Isolate | Rhizosphere |
| 460 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 461 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 462 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.41 |
| Metatranscriptomes | 0.49 |
| Isolates | 1.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.06 |
| Bulb | 0 |
| Endosphere | 3.13 |
| Nodule | 0.06 |
| Rhizoplane | 3.86 |
| Rhizosphere | 89.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501040_0015481 | 3300049576 | Bacteria | 5040 |
| 2 | JGI24744J21845_10015159 | 3300002077 | Bacteria | 1542 |
| 3 | JGI25406J46586_10001453 | 3300003203 | Bacteria | 11169 |
| 4 | JGI25406J46586_10002115 | 3300003203 | Bacteria | 9373 |
| 5 | JGI25406J46586_10003867 | 3300003203 | Bacteria | 7001 |
| 6 | JGI25406J46586_10020800 | 3300003203 | Bacteria | 2645 |
| 7 | rootH1_10003792 | 3300003316 | Bacteria | 7262 |
| 8 | rootH1_10015730 | 3300003316 | Bacteria | 1731 |
| 9 | rootH1_10130565 | 3300003316 | Bacteria | 1965 |
| 10 | rootH2_10029474 | 3300003320 | Bacteria | 14064 |
| 11 | rootH2_10077888 | 3300003320 | Unclassified | 3554 |
| 12 | rootH2_10246637 | 3300003320 | Unclassified | 1691 |
| 13 | rootL2_10072383 | 3300003322 | Bacteria | 19068 |
| 14 | rootL2_10147111 | 3300003322 | Bacteria | 14666 |
| 15 | rootL2_10218153 | 3300003322 | Unclassified | 3063 |
| 16 | rootH1_10000715 | 3300003323 | Bacteria | 71212 |
| 17 | rootH1_10017154 | 3300003323 | Bacteria | 13652 |
| 18 | rootH1_10038814 | 3300003323 | Bacteria | 11585 |
| 19 | rootH1_10052808 | 3300003323 | Bacteria | 5340 |
| 20 | rootH1_10072353 | 3300003323 | Bacteria | 9071 |
| 21 | rootH1_10074058 | 3300003323 | Bacteria | 8116 |
| 22 | rootH1_10271435 | 3300003323 | Bacteria | 3399 |
| 23 | rootH1_10309830 | 3300003323 | Unclassified | 3417 |
| 24 | JGI25407J50210_10001911 | 3300003373 | Bacteria | 4834 |
| 25 | Ga0055531_10000197 | 3300003794 | Bacteria | 66822 |
| 26 | Ga0065704_10090251 | 3300005289 | Bacteria | 2801 |
| 27 | Ga0065712_10000291 | 3300005290 | Bacteria | 19019 |
| 28 | Ga0065712_10004042 | 3300005290 | Bacteria | 7055 |
| 29 | Ga0065712_10069922 | 3300005290 | Bacteria | 6509 |
| 30 | Ga0065715_10007485 | 3300005293 | Bacteria | 6998 |
| 31 | Ga0065715_10088927 | 3300005293 | Bacteria | 28121 |
| 32 | Ga0065715_10093813 | 3300005293 | Bacteria | 4545 |
| 33 | Ga0065715_10115116 | 3300005293 | Bacteria | 2426 |
| 34 | Ga0065707_10002597 | 3300005295 | Bacteria | 7059 |
| 35 | Ga0065707_10095335 | 3300005295 | Bacteria | 3389 |
| 36 | Ga0065707_10137250 | 3300005295 | Bacteria | 1823 |
| 37 | Ga0070658_10004558 | 3300005327 | Bacteria | 11265 |
| 38 | Ga0070658_10021319 | 3300005327 | Bacteria | 5193 |
| 39 | Ga0070658_10047664 | 3300005327 | Bacteria | 3467 |
| 40 | Ga0070658_10063213 | 3300005327 | Bacteria | 3017 |
| 41 | Ga0070676_10001001 | 3300005328 | Bacteria | 14035 |
| 42 | Ga0070676_10004892 | 3300005328 | Bacteria | 7098 |
| 43 | Ga0070683_100014524 | 3300005329 | Bacteria | 6892 |
| 44 | Ga0070683_100066029 | 3300005329 | Bacteria | 3370 |
| 45 | Ga0070683_100072617 | 3300005329 | Bacteria | 3212 |
| 46 | Ga0070683_100080888 | 3300005329 | Bacteria | 3041 |
| 47 | Ga0070690_100020399 | 3300005330 | Bacteria | 4037 |
| 48 | Ga0070690_100046269 | 3300005330 | Bacteria | 2766 |
| 49 | Ga0070690_100082498 | 3300005330 | Bacteria | 2105 |
| 50 | Ga0070690_100115957 | 3300005330 | Bacteria | 1793 |
| 51 | Ga0070670_100002473 | 3300005331 | Bacteria | 15248 |
| 52 | Ga0070670_100037369 | 3300005331 | Bacteria | 4178 |
| 53 | Ga0070670_100048794 | 3300005331 | Bacteria | 3643 |
| 54 | Ga0070670_100194418 | 3300005331 | Bacteria | 1762 |
| 55 | Ga0070677_10004528 | 3300005333 | Bacteria | 4536 |
| 56 | Ga0070677_10007902 | 3300005333 | Bacteria | 3560 |
| 57 | Ga0070677_10020902 | 3300005333 | Bacteria | 2393 |
| 58 | Ga0070677_10038389 | 3300005333 | Bacteria | 1874 |
| 59 | Ga0068869_100011797 | 3300005334 | Bacteria | 5748 |
| 60 | Ga0068869_100015575 | 3300005334 | Bacteria | 5105 |
| 61 | Ga0068869_100051024 | 3300005334 | Bacteria | 3000 |
| 62 | Ga0068869_100189935 | 3300005334 | Bacteria | 1615 |
| 63 | Ga0070666_10017347 | 3300005335 | Bacteria | 4615 |
| 64 | Ga0070666_10038037 | 3300005335 | Bacteria | 3201 |
| 65 | Ga0070666_10039300 | 3300005335 | Bacteria | 3153 |
| 66 | Ga0070666_10124172 | 3300005335 | Bacteria | 1791 |
| 67 | Ga0070666_10185287 | 3300005335 | Bacteria | 1461 |
| 68 | Ga0070680_100001439 | 3300005336 | Bacteria | 17241 |
| 69 | Ga0070680_100121292 | 3300005336 | Bacteria | 2183 |
| 70 | Ga0070682_100012961 | 3300005337 | Bacteria | 4786 |
| 71 | Ga0070682_100192315 | 3300005337 | Bacteria | 1433 |
| 72 | Ga0068868_100004371 | 3300005338 | Bacteria | 9905 |
| 73 | Ga0068868_100028174 | 3300005338 | Bacteria | 4292 |
| 74 | Ga0068868_100107984 | 3300005338 | Bacteria | 2259 |
| 75 | Ga0068868_100147442 | 3300005338 | Bacteria | 1936 |
| 76 | Ga0070660_100015905 | 3300005339 | Bacteria | 5447 |
| 77 | Ga0070660_100049144 | 3300005339 | Bacteria | 3241 |
| 78 | Ga0070660_100086389 | 3300005339 | Bacteria | 2468 |
| 79 | Ga0070689_100014123 | 3300005340 | Bacteria | 5794 |
| 80 | Ga0070689_100040242 | 3300005340 | Bacteria | 3583 |
| 81 | Ga0070689_100085455 | 3300005340 | Bacteria | 2481 |
| 82 | Ga0070689_100099802 | 3300005340 | Bacteria | 2297 |
| 83 | Ga0070689_100202478 | 3300005340 | Bacteria | 1622 |
| 84 | Ga0070689_100273604 | 3300005340 | Bacteria | 1399 |
| 85 | Ga0070691_10000641 | 3300005341 | Bacteria | 13508 |
| 86 | Ga0070691_10024585 | 3300005341 | Bacteria | 2800 |
| 87 | Ga0070687_100012056 | 3300005343 | Bacteria | 3803 |
| 88 | Ga0070661_100003449 | 3300005344 | Bacteria | 10918 |
| 89 | Ga0070661_100075997 | 3300005344 | Bacteria | 2475 |
| 90 | Ga0070661_100106273 | 3300005344 | Bacteria | 2093 |
| 91 | Ga0070692_10019617 | 3300005345 | Bacteria | 3265 |
| 92 | Ga0070668_100028688 | 3300005347 | Bacteria | 4223 |
| 93 | Ga0070668_100051252 | 3300005347 | Bacteria | 3180 |
| 94 | Ga0070668_100054752 | 3300005347 | Bacteria | 3077 |
| 95 | Ga0070668_100255113 | 3300005347 | Bacteria | 1457 |
| 96 | Ga0070669_100019309 | 3300005353 | Bacteria | 4867 |
| 97 | Ga0070669_100024441 | 3300005353 | Bacteria | 4331 |
| 98 | Ga0070669_100027704 | 3300005353 | Bacteria | 4079 |
| 99 | Ga0070669_100055599 | 3300005353 | Bacteria | 2900 |
| 100 | Ga0070669_100113862 | 3300005353 | Bacteria | 2056 |
| 101 | Ga0070669_100125363 | 3300005353 | Bacteria | 1965 |
| 102 | Ga0070675_100000253 | 3300005354 | Bacteria | 34898 |
| 103 | Ga0070675_100000801 | 3300005354 | Bacteria | 22093 |
| 104 | Ga0070675_100010643 | 3300005354 | Bacteria | 7191 |
| 105 | Ga0070675_100012438 | 3300005354 | Bacteria | 6667 |
| 106 | Ga0070675_100016586 | 3300005354 | Bacteria | 5847 |
| 107 | Ga0070675_100024137 | 3300005354 | Bacteria | 4869 |
| 108 | Ga0070675_100033328 | 3300005354 | Bacteria | 4176 |
| 109 | Ga0070675_100036573 | 3300005354 | Bacteria | 3996 |
| 110 | Ga0070675_100047989 | 3300005354 | Bacteria | 3500 |
| 111 | Ga0070675_100051450 | 3300005354 | Bacteria | 3385 |
| 112 | Ga0070675_100118766 | 3300005354 | Bacteria | 2245 |
| 113 | Ga0070675_100127945 | 3300005354 | Bacteria | 2162 |
| 114 | Ga0070675_100154473 | 3300005354 | Bacteria | 1969 |
| 115 | Ga0070675_100159515 | 3300005354 | Bacteria | 1939 |
| 116 | Ga0070675_100216181 | 3300005354 | Bacteria | 1668 |
| 117 | Ga0070675_100306837 | 3300005354 | Bacteria | 1399 |
| 118 | Ga0070671_100010783 | 3300005355 | Bacteria | 7332 |
| 119 | Ga0070671_100012745 | 3300005355 | Bacteria | 6778 |
| 120 | Ga0070671_100081478 | 3300005355 | Bacteria | 2706 |
| 121 | Ga0070671_100126264 | 3300005355 | Bacteria | 2154 |
| 122 | Ga0070671_100133600 | 3300005355 | Bacteria | 2091 |
| 123 | Ga0070671_100251314 | 3300005355 | Bacteria | 1502 |
| 124 | Ga0070674_100008245 | 3300005356 | Bacteria | 6192 |
| 125 | Ga0070674_100011162 | 3300005356 | Bacteria | 5457 |
| 126 | Ga0070674_100021567 | 3300005356 | Bacteria | 4140 |
| 127 | Ga0070674_100025985 | 3300005356 | Bacteria | 3819 |
| 128 | Ga0070674_100106384 | 3300005356 | Bacteria | 2053 |
| 129 | Ga0070673_100003415 | 3300005364 | Bacteria | 9888 |
| 130 | Ga0070673_100010744 | 3300005364 | Bacteria | 6212 |
| 131 | Ga0070673_100011536 | 3300005364 | Bacteria | 6035 |
| 132 | Ga0070673_100031373 | 3300005364 | Bacteria | 3987 |
| 133 | Ga0070673_100039829 | 3300005364 | Bacteria | 3600 |
| 134 | Ga0070673_100046128 | 3300005364 | Bacteria | 3383 |
| 135 | Ga0070673_100141248 | 3300005364 | Bacteria | 2031 |
| 136 | Ga0070673_100161682 | 3300005364 | Bacteria | 1905 |
| 137 | Ga0070673_100370344 | 3300005364 | Bacteria | 1275 |
| 138 | Ga0070688_100001161 | 3300005365 | Bacteria | 13117 |
| 139 | Ga0070688_100003997 | 3300005365 | Bacteria | 7645 |
| 140 | Ga0070688_100011267 | 3300005365 | Bacteria | 4964 |
| 141 | Ga0070688_100032333 | 3300005365 | Bacteria | 3154 |
| 142 | Ga0070688_100110805 | 3300005365 | Bacteria | 1825 |
| 143 | Ga0070688_100134579 | 3300005365 | Bacteria | 1672 |
| 144 | Ga0070659_100012472 | 3300005366 | Bacteria | 6301 |
| 145 | Ga0070659_100196671 | 3300005366 | Bacteria | 1658 |
| 146 | Ga0070659_100197851 | 3300005366 | Bacteria | 1653 |
| 147 | Ga0070667_100022929 | 3300005367 | Bacteria | 5175 |
| 148 | Ga0070667_100106195 | 3300005367 | Bacteria | 2430 |
| 149 | Ga0070667_100110257 | 3300005367 | Bacteria | 2386 |
| 150 | Ga0070667_100270192 | 3300005367 | Bacteria | 1524 |
| 151 | Ga0070709_10005949 | 3300005434 | Bacteria | 6623 |
| 152 | Ga0070714_100004846 | 3300005435 | Bacteria | 10215 |
| 153 | Ga0070714_100008730 | 3300005435 | Bacteria | 7921 |
| 154 | Ga0070714_100037767 | 3300005435 | Bacteria | 4060 |
| 155 | Ga0070713_100039343 | 3300005436 | Bacteria | 3837 |
| 156 | Ga0070701_10003780 | 3300005438 | Bacteria | 6046 |
| 157 | Ga0070701_10006652 | 3300005438 | Bacteria | 4879 |
| 158 | Ga0070701_10018766 | 3300005438 | Bacteria | 3255 |
| 159 | Ga0070701_10074729 | 3300005438 | Bacteria | 1821 |
| 160 | Ga0070701_10143987 | 3300005438 | Bacteria | 1366 |
| 161 | Ga0070705_100006809 | 3300005440 | Bacteria | 5618 |
| 162 | Ga0070705_100009951 | 3300005440 | Bacteria | 4746 |
| 163 | Ga0070700_100067464 | 3300005441 | Bacteria | 2272 |
| 164 | Ga0070694_100000107 | 3300005444 | Bacteria | 40436 |
| 165 | Ga0070694_100010050 | 3300005444 | Bacteria | 5818 |
| 166 | Ga0070694_100095545 | 3300005444 | Bacteria | 2093 |
| 167 | Ga0070708_100009182 | 3300005445 | Bacteria | 7973 |
| 168 | Ga0070708_100023470 | 3300005445 | Bacteria | 5247 |
| 169 | Ga0070708_100025793 | 3300005445 | Bacteria | 5026 |
| 170 | Ga0070708_100033340 | 3300005445 | Bacteria | 4474 |
| 171 | Ga0070708_100036455 | 3300005445 | Bacteria | 4289 |
| 172 | Ga0070708_100045037 | 3300005445 | Bacteria | 3885 |
| 173 | Ga0070708_100085577 | 3300005445 | Bacteria | 2862 |
| 174 | Ga0070708_100147932 | 3300005445 | Bacteria | 2183 |
| 175 | Ga0070663_100093338 | 3300005455 | Bacteria | 2233 |
| 176 | Ga0070663_100130434 | 3300005455 | Bacteria | 1908 |
| 177 | Ga0070678_100002431 | 3300005456 | Bacteria | 10202 |
| 178 | Ga0070678_100007740 | 3300005456 | Bacteria | 6389 |
| 179 | Ga0070678_100014125 | 3300005456 | Bacteria | 5028 |
| 180 | Ga0070678_100079193 | 3300005456 | Bacteria | 2484 |
| 181 | Ga0070678_100290583 | 3300005456 | Bacteria | 1385 |
| 182 | Ga0070662_100027802 | 3300005457 | Bacteria | 3931 |
| 183 | Ga0070662_100104796 | 3300005457 | Bacteria | 2146 |
| 184 | Ga0070662_100105552 | 3300005457 | Bacteria | 2139 |
| 185 | Ga0070662_100119446 | 3300005457 | Bacteria | 2019 |
| 186 | Ga0070662_100185094 | 3300005457 | Bacteria | 1644 |
| 187 | Ga0070681_10097714 | 3300005458 | Bacteria | 2883 |
| 188 | Ga0070681_10104952 | 3300005458 | Bacteria | 2768 |
| 189 | Ga0070681_10115744 | 3300005458 | Bacteria | 2619 |
| 190 | Ga0070681_10204787 | 3300005458 | Bacteria | 1890 |
| 191 | Ga0070681_10369968 | 3300005458 | Bacteria | 1344 |
| 192 | Ga0068867_100002815 | 3300005459 | Bacteria | 12228 |
| 193 | Ga0068867_100003246 | 3300005459 | Bacteria | 11462 |
| 194 | Ga0068867_100136856 | 3300005459 | Bacteria | 1910 |
| 195 | Ga0070685_10004772 | 3300005466 | Bacteria | 6864 |
| 196 | Ga0070685_10046696 | 3300005466 | Bacteria | 2487 |
| 197 | Ga0070685_10058265 | 3300005466 | Bacteria | 2251 |
| 198 | Ga0070706_100060461 | 3300005467 | Bacteria | 3498 |
| 199 | Ga0070706_100115262 | 3300005467 | Bacteria | 2502 |
| 200 | Ga0070706_100273176 | 3300005467 | Bacteria | 1577 |
| 201 | Ga0070707_100001749 | 3300005468 | Bacteria | 20908 |
| 202 | Ga0070707_100005817 | 3300005468 | Bacteria | 11501 |
| 203 | Ga0070707_100073832 | 3300005468 | Bacteria | 3289 |
| 204 | Ga0070707_100247852 | 3300005468 | Bacteria | 1733 |
| 205 | Ga0070698_100007001 | 3300005471 | Bacteria | 12212 |
| 206 | Ga0070698_100060247 | 3300005471 | Bacteria | 3830 |
| 207 | Ga0070698_100124924 | 3300005471 | Bacteria | 2530 |
| 208 | Ga0070699_100010678 | 3300005518 | Bacteria | 7949 |
| 209 | Ga0070699_100017590 | 3300005518 | Bacteria | 6136 |
| 210 | Ga0070699_100042598 | 3300005518 | Bacteria | 3929 |
| 211 | Ga0070699_100064384 | 3300005518 | Bacteria | 3180 |
| 212 | Ga0070699_100077001 | 3300005518 | Bacteria | 2903 |
| 213 | Ga0070679_100024192 | 3300005530 | Bacteria | 5951 |
| 214 | Ga0070679_100062464 | 3300005530 | Bacteria | 3714 |
| 215 | Ga0070679_100210201 | 3300005530 | Bacteria | 1910 |
| 216 | Ga0070684_100000213 | 3300005535 | Bacteria | 40774 |
| 217 | Ga0070684_100023808 | 3300005535 | Bacteria | 5129 |
| 218 | Ga0070684_100052441 | 3300005535 | Bacteria | 3548 |
| 219 | Ga0070684_100086426 | 3300005535 | Bacteria | 2783 |
| 220 | Ga0070684_100139022 | 3300005535 | Bacteria | 2195 |
| 221 | Ga0070684_100169766 | 3300005535 | Bacteria | 1981 |
| 222 | Ga0070684_100171779 | 3300005535 | Bacteria | 1969 |
| 223 | Ga0070684_100173029 | 3300005535 | Bacteria | 1961 |
| 224 | Ga0070697_100036753 | 3300005536 | Bacteria | 3956 |
| 225 | Ga0070697_100045110 | 3300005536 | Bacteria | 3572 |
| 226 | Ga0070697_100058647 | 3300005536 | Bacteria | 3133 |
| 227 | Ga0070697_100152772 | 3300005536 | Bacteria | 1946 |
| 228 | Ga0070697_100171230 | 3300005536 | Bacteria | 1838 |
| 229 | Ga0068853_100011384 | 3300005539 | Bacteria | 7225 |
| 230 | Ga0068853_100089669 | 3300005539 | Bacteria | 2701 |
| 231 | Ga0068853_100209435 | 3300005539 | Bacteria | 1776 |
| 232 | Ga0070672_100006459 | 3300005543 | Bacteria | 7881 |
| 233 | Ga0070672_100016774 | 3300005543 | Bacteria | 5251 |
| 234 | Ga0070672_100021164 | 3300005543 | Bacteria | 4754 |
| 235 | Ga0070672_100027841 | 3300005543 | Bacteria | 4220 |
| 236 | Ga0070672_100079330 | 3300005543 | Bacteria | 2628 |
| 237 | Ga0070672_100088071 | 3300005543 | Bacteria | 2499 |
| 238 | Ga0070672_100110689 | 3300005543 | Bacteria | 2238 |
| 239 | Ga0070672_100129850 | 3300005543 | Bacteria | 2070 |
| 240 | Ga0070686_100002473 | 3300005544 | Bacteria | 10175 |
| 241 | Ga0070686_100023123 | 3300005544 | Bacteria | 3712 |
| 242 | Ga0070686_100046276 | 3300005544 | Bacteria | 2745 |
| 243 | Ga0070695_100001868 | 3300005545 | Bacteria | 11896 |
| 244 | Ga0070695_100066492 | 3300005545 | Bacteria | 2349 |
| 245 | Ga0070696_100022563 | 3300005546 | Bacteria | 4277 |
| 246 | Ga0070696_100025334 | 3300005546 | Bacteria | 4032 |
| 247 | Ga0070693_100032240 | 3300005547 | Bacteria | 2880 |
| 248 | Ga0070693_100036425 | 3300005547 | Bacteria | 2735 |
| 249 | Ga0070693_100124278 | 3300005547 | Bacteria | 1604 |
| 250 | Ga0070665_100002991 | 3300005548 | Bacteria | 18259 |
| 251 | Ga0070665_100021844 | 3300005548 | Bacteria | 6435 |
| 252 | Ga0070665_100044289 | 3300005548 | Bacteria | 4469 |
| 253 | Ga0070665_100176423 | 3300005548 | Bacteria | 2138 |
| 254 | Ga0070704_100008238 | 3300005549 | Bacteria | 6237 |
| 255 | Ga0070704_100033130 | 3300005549 | Bacteria | 3491 |
| 256 | Ga0068855_100009123 | 3300005563 | Bacteria | 11980 |
| 257 | Ga0068855_100108732 | 3300005563 | Bacteria | 3184 |
| 258 | Ga0068855_100119594 | 3300005563 | Bacteria | 3016 |
| 259 | Ga0068855_100133775 | 3300005563 | Bacteria | 2830 |
| 260 | Ga0068855_100168419 | 3300005563 | Bacteria | 2482 |
| 261 | Ga0068855_100379915 | 3300005563 | Bacteria | 1551 |
| 262 | Ga0070664_100000586 | 3300005564 | Bacteria | 27743 |
| 263 | Ga0070664_100003485 | 3300005564 | Bacteria | 12706 |
| 264 | Ga0070664_100017864 | 3300005564 | Bacteria | 5823 |
| 265 | Ga0070664_100042073 | 3300005564 | Bacteria | 3858 |
| 266 | Ga0070664_100130673 | 3300005564 | Bacteria | 2206 |
| 267 | Ga0070664_100163765 | 3300005564 | Bacteria | 1969 |
| 268 | Ga0070664_100287132 | 3300005564 | Bacteria | 1485 |
| 269 | Ga0068857_100085189 | 3300005577 | Bacteria | 2824 |
| 270 | Ga0068857_100132500 | 3300005577 | Bacteria | 2248 |
| 271 | Ga0068854_100030643 | 3300005578 | Bacteria | 3732 |
| 272 | Ga0068854_100059050 | 3300005578 | Bacteria | 2771 |
| 273 | Ga0068854_100113415 | 3300005578 | Bacteria | 2048 |
| 274 | Ga0068854_100296381 | 3300005578 | Bacteria | 1307 |
| 275 | Ga0068856_100051081 | 3300005614 | Unclassified | 4077 |
| 276 | Ga0068856_100220826 | 3300005614 | Bacteria | 1910 |
| 277 | Ga0070702_100002472 | 3300005615 | Bacteria | 7992 |
| 278 | Ga0070702_100029233 | 3300005615 | Bacteria | 2995 |
| 279 | Ga0070702_100057673 | 3300005615 | Bacteria | 2247 |
| 280 | Ga0070702_100139159 | 3300005615 | Bacteria | 1544 |
| 281 | Ga0070702_100150313 | 3300005615 | Bacteria | 1494 |
| 282 | Ga0068852_100045599 | 3300005616 | Bacteria | 3730 |
| 283 | Ga0068852_100064492 | 3300005616 | Bacteria | 3193 |
| 284 | Ga0068852_100166839 | 3300005616 | Bacteria | 2061 |
| 285 | Ga0068859_100029439 | 3300005617 | Bacteria | 5509 |
| 286 | Ga0068859_100033086 | 3300005617 | Bacteria | 5193 |
| 287 | Ga0068859_100041652 | 3300005617 | Bacteria | 4612 |
| 288 | Ga0068859_100073857 | 3300005617 | Bacteria | 3448 |
| 289 | Ga0068859_100136215 | 3300005617 | Bacteria | 2528 |
| 290 | Ga0068859_100162559 | 3300005617 | Bacteria | 2312 |
| 291 | Ga0068859_100228236 | 3300005617 | Bacteria | 1950 |
| 292 | Ga0068864_100003807 | 3300005618 | Bacteria | 12440 |
| 293 | Ga0068864_100012301 | 3300005618 | Bacteria | 7073 |
| 294 | Ga0068864_100030047 | 3300005618 | Bacteria | 4605 |
| 295 | Ga0068864_100071533 | 3300005618 | Bacteria | 3020 |
| 296 | Ga0068864_100129009 | 3300005618 | Bacteria | 2269 |
| 297 | Ga0068864_100194065 | 3300005618 | Bacteria | 1862 |
| 298 | Ga0068864_100375659 | 3300005618 | Bacteria | 1346 |
| 299 | Ga0068866_10038903 | 3300005718 | Bacteria | 2346 |
| 300 | Ga0068861_100006139 | 3300005719 | Bacteria | 8175 |
| 301 | Ga0068861_100015207 | 3300005719 | Bacteria | 5418 |
| 302 | Ga0068861_100028959 | 3300005719 | Bacteria | 4045 |
| 303 | Ga0068851_10024137 | 3300005834 | Bacteria | 2977 |
| 304 | Ga0068851_10028093 | 3300005834 | Bacteria | 2777 |
| 305 | Ga0068851_10037183 | 3300005834 | Bacteria | 2440 |
| 306 | Ga0068870_10083230 | 3300005840 | Bacteria | 1773 |
| 307 | Ga0068863_100046319 | 3300005841 | Bacteria | 4127 |
| 308 | Ga0068863_100152745 | 3300005841 | Bacteria | 2210 |
| 309 | Ga0068863_100213775 | 3300005841 | Bacteria | 1857 |
| 310 | Ga0068863_100393234 | 3300005841 | Bacteria | 1355 |
| 311 | Ga0068858_100000002 | 3300005842 | Bacteria | 351633 |
| 312 | Ga0068858_100005689 | 3300005842 | Bacteria | 12184 |
| 313 | Ga0068858_100018354 | 3300005842 | Bacteria | 6550 |
| 314 | Ga0068858_100035040 | 3300005842 | Bacteria | 4656 |
| 315 | Ga0068858_100096443 | 3300005842 | Bacteria | 2755 |
| 316 | Ga0068858_100312344 | 3300005842 | Bacteria | 1501 |
| 317 | Ga0068860_100014438 | 3300005843 | Bacteria | 7737 |
| 318 | Ga0068860_100059285 | 3300005843 | Bacteria | 3639 |
| 319 | Ga0068860_100097700 | 3300005843 | Bacteria | 2800 |
| 320 | Ga0068860_100108479 | 3300005843 | Bacteria | 2653 |
| 321 | Ga0068860_100202888 | 3300005843 | Bacteria | 1922 |
| 322 | Ga0068862_100000192 | 3300005844 | Bacteria | 67711 |
| 323 | Ga0068862_100016510 | 3300005844 | Bacteria | 6146 |
| 324 | Ga0068862_100096827 | 3300005844 | Bacteria | 2576 |
| 325 | Ga0068862_100157271 | 3300005844 | Bacteria | 2027 |
| 326 | Ga0068862_100224329 | 3300005844 | Bacteria | 1702 |
| 327 | Ga0081455_10000995 | 3300005937 | Bacteria | 35927 |
| 328 | Ga0081455_10049132 | 3300005937 | Bacteria | 3639 |
| 329 | Ga0081455_10120691 | 3300005937 | Bacteria | 2066 |
| 330 | Ga0081538_10000004 | 3300005981 | Bacteria | 194737 |
| 331 | Ga0081539_10000024 | 3300005985 | Bacteria | 354702 |
| 332 | Ga0081539_10000035 | 3300005985 | Bacteria | 302689 |
| 333 | Ga0081539_10000244 | 3300005985 | Bacteria | 127514 |
| 334 | Ga0081539_10014216 | 3300005985 | Bacteria | 5910 |
| 335 | Ga0081539_10017051 | 3300005985 | Bacteria | 5131 |
| 336 | Ga0081539_10022783 | 3300005985 | Bacteria | 4128 |
| 337 | Ga0081539_10054855 | 3300005985 | Bacteria | 2221 |
| 338 | Ga0081539_10092488 | 3300005985 | Bacteria | 1560 |
| 339 | Ga0081539_10094365 | 3300005985 | Bacteria | 1539 |
| 340 | Ga0070717_10070185 | 3300006028 | Bacteria | 2919 |
| 341 | Ga0075365_10036265 | 3300006038 | Bacteria | 3194 |
| 342 | Ga0075365_10054928 | 3300006038 | Bacteria | 2642 |
| 343 | Ga0075365_10055190 | 3300006038 | Bacteria | 2636 |
| 344 | Ga0075365_10065905 | 3300006038 | Bacteria | 2428 |
| 345 | Ga0075368_10002301 | 3300006042 | Bacteria | 6203 |
| 346 | Ga0075368_10017923 | 3300006042 | Bacteria | 2655 |
| 347 | Ga0075363_100000364 | 3300006048 | Bacteria | 13662 |
| 348 | Ga0075363_100004611 | 3300006048 | Bacteria | 6052 |
| 349 | Ga0075363_100019594 | 3300006048 | Bacteria | 3383 |
| 350 | Ga0075364_10035090 | 3300006051 | Bacteria | 3240 |
| 351 | Ga0075364_10059297 | 3300006051 | Bacteria | 2508 |
| 352 | Ga0075364_10094090 | 3300006051 | Bacteria | 1990 |
| 353 | Ga0075364_10138463 | 3300006051 | Bacteria | 1636 |
| 354 | Ga0075432_10022092 | 3300006058 | Bacteria | 2175 |
| 355 | Ga0075432_10038984 | 3300006058 | Bacteria | 1656 |
| 356 | Ga0070712_100069113 | 3300006175 | Bacteria | 2519 |
| 357 | Ga0075367_10036217 | 3300006178 | Bacteria | 2860 |
| 358 | Ga0075367_10123291 | 3300006178 | Bacteria | 1598 |
| 359 | Ga0075369_10001831 | 3300006186 | Bacteria | 7419 |
| 360 | Ga0075366_10006958 | 3300006195 | Bacteria | 6227 |
| 361 | Ga0097621_100000510 | 3300006237 | Bacteria | 27211 |
| 362 | Ga0097621_100023601 | 3300006237 | Bacteria | 4790 |
| 363 | Ga0097621_100082245 | 3300006237 | Bacteria | 2681 |
| 364 | Ga0097621_100092591 | 3300006237 | Bacteria | 2532 |
| 365 | Ga0097621_100099825 | 3300006237 | Bacteria | 2441 |
| 366 | Ga0097621_100108084 | 3300006237 | Bacteria | 2348 |
| 367 | Ga0097621_100116772 | 3300006237 | Bacteria | 2260 |
| 368 | Ga0097621_100125172 | 3300006237 | Bacteria | 2183 |
| 369 | Ga0097621_100135672 | 3300006237 | Bacteria | 2099 |
| 370 | Ga0075370_10013756 | 3300006353 | Bacteria | 4306 |
| 371 | Ga0075370_10034318 | 3300006353 | Bacteria | 2844 |
| 372 | Ga0075370_10047475 | 3300006353 | Bacteria | 2431 |
| 373 | Ga0068871_100000108 | 3300006358 | Bacteria | 50255 |
| 374 | Ga0068871_100001762 | 3300006358 | Bacteria | 14573 |
| 375 | Ga0068871_100005779 | 3300006358 | Bacteria | 8691 |
| 376 | Ga0068871_100044770 | 3300006358 | Bacteria | 3561 |
| 377 | Ga0068871_100080567 | 3300006358 | Bacteria | 2696 |
| 378 | Ga0068871_100129739 | 3300006358 | Bacteria | 2136 |
| 379 | Ga0068871_100195840 | 3300006358 | Bacteria | 1743 |
| 380 | Ga0075428_100000100 | 3300006844 | Bacteria | 72697 |
| 381 | Ga0075428_100001176 | 3300006844 | Bacteria | 28020 |
| 382 | Ga0075428_100002267 | 3300006844 | Bacteria | 20832 |
| 383 | Ga0075428_100002710 | 3300006844 | Bacteria | 19287 |
| 384 | Ga0075428_100003258 | 3300006844 | Bacteria | 17774 |
| 385 | Ga0075428_100004744 | 3300006844 | Bacteria | 15048 |
| 386 | Ga0075428_100011875 | 3300006844 | Bacteria | 9686 |
| 387 | Ga0075428_100020681 | 3300006844 | Bacteria | 7288 |
| 388 | Ga0075428_100021454 | 3300006844 | Bacteria | 7148 |
| 389 | Ga0075428_100058385 | 3300006844 | Bacteria | 4224 |
| 390 | Ga0075428_100061209 | 3300006844 | Bacteria | 4122 |
| 391 | Ga0075428_100069973 | 3300006844 | Bacteria | 3836 |
| 392 | Ga0075428_100072723 | 3300006844 | Bacteria | 3755 |
| 393 | Ga0075428_100092312 | 3300006844 | Bacteria | 3301 |
| 394 | Ga0075428_100106053 | 3300006844 | Bacteria | 3063 |
| 395 | Ga0075428_100109485 | 3300006844 | Bacteria | 3010 |
| 396 | Ga0075430_100002969 | 3300006846 | Bacteria | 14207 |
| 397 | Ga0075430_100007284 | 3300006846 | Bacteria | 9338 |
| 398 | Ga0075430_100015760 | 3300006846 | Bacteria | 6438 |
| 399 | Ga0075430_100034006 | 3300006846 | Bacteria | 4325 |
| 400 | Ga0075430_100045040 | 3300006846 | Bacteria | 3729 |
| 401 | Ga0075430_100079058 | 3300006846 | Bacteria | 2757 |
| 402 | Ga0075430_100090238 | 3300006846 | Bacteria | 2564 |
| 403 | Ga0075430_100134779 | 3300006846 | Bacteria | 2058 |
| 404 | Ga0075431_100001491 | 3300006847 | Bacteria | 21644 |
| 405 | Ga0075431_100002445 | 3300006847 | Bacteria | 17879 |
| 406 | Ga0075431_100003423 | 3300006847 | Bacteria | 15391 |
| 407 | Ga0075431_100004448 | 3300006847 | Bacteria | 13746 |
| 408 | Ga0075431_100008897 | 3300006847 | Bacteria | 10058 |
| 409 | Ga0075431_100009529 | 3300006847 | Bacteria | 9755 |
| 410 | Ga0075431_100009670 | 3300006847 | Bacteria | 9683 |
| 411 | Ga0075431_100015256 | 3300006847 | Bacteria | 7786 |
| 412 | Ga0075431_100018729 | 3300006847 | Bacteria | 7053 |
| 413 | Ga0075431_100026022 | 3300006847 | Bacteria | 5999 |
| 414 | Ga0075431_100076459 | 3300006847 | Bacteria | 3455 |
| 415 | Ga0075431_100179361 | 3300006847 | Bacteria | 2174 |
| 416 | Ga0075431_100217028 | 3300006847 | Bacteria | 1952 |
| 417 | Ga0075433_10000348 | 3300006852 | Bacteria | 28818 |
| 418 | Ga0075433_10006016 | 3300006852 | Bacteria | 9559 |
| 419 | Ga0075433_10013934 | 3300006852 | Bacteria | 6554 |
| 420 | Ga0075433_10026871 | 3300006852 | Bacteria | 4877 |
| 421 | Ga0075433_10029614 | 3300006852 | Bacteria | 4667 |
| 422 | Ga0075433_10082409 | 3300006852 | Bacteria | 2837 |
| 423 | Ga0075433_10116262 | 3300006852 | Bacteria | 2373 |
| 424 | Ga0075434_100002451 | 3300006871 | Bacteria | 16337 |
| 425 | Ga0075434_100009109 | 3300006871 | Bacteria | 9249 |
| 426 | Ga0075434_100017333 | 3300006871 | Bacteria | 6936 |
| 427 | Ga0075434_100019774 | 3300006871 | Bacteria | 6519 |
| 428 | Ga0075434_100021900 | 3300006871 | Bacteria | 6221 |
| 429 | Ga0075434_100023769 | 3300006871 | Bacteria | 5980 |
| 430 | Ga0075434_100041223 | 3300006871 | Bacteria | 4574 |
| 431 | Ga0075434_100092342 | 3300006871 | Bacteria | 3029 |
| 432 | Ga0075434_100106257 | 3300006871 | Bacteria | 2817 |
| 433 | Ga0075434_100391167 | 3300006871 | Bacteria | 1411 |
| 434 | Ga0075429_100000082 | 3300006880 | Bacteria | 49180 |
| 435 | Ga0075429_100005845 | 3300006880 | Bacteria | 10615 |
| 436 | Ga0075429_100008969 | 3300006880 | Bacteria | 8687 |
| 437 | Ga0075429_100009769 | 3300006880 | Bacteria | 8318 |
| 438 | Ga0075429_100055229 | 3300006880 | Bacteria | 3456 |
| 439 | Ga0075429_100057994 | 3300006880 | Bacteria | 3372 |
| 440 | Ga0075429_100071554 | 3300006880 | Bacteria | 3020 |
| 441 | Ga0075429_100103843 | 3300006880 | Bacteria | 2482 |
| 442 | Ga0075429_100160770 | 3300006880 | Bacteria | 1967 |
| 443 | Ga0075429_100278492 | 3300006880 | Bacteria | 1465 |
| 444 | Ga0075429_100305469 | 3300006880 | Bacteria | 1393 |
| 445 | Ga0068865_100004918 | 3300006881 | Bacteria | 8076 |
| 446 | Ga0068865_100051701 | 3300006881 | Bacteria | 2845 |
| 447 | Ga0068865_100083553 | 3300006881 | Bacteria | 2299 |
| 448 | Ga0068865_100103385 | 3300006881 | Bacteria | 2089 |
| 449 | Ga0068865_100179413 | 3300006881 | Bacteria | 1630 |
| 450 | Ga0068865_100202672 | 3300006881 | Bacteria | 1541 |
| 451 | Ga0075436_100003014 | 3300006914 | Bacteria | 11541 |
| 452 | Ga0075436_100058685 | 3300006914 | Bacteria | 2658 |
| 453 | Ga0097620_100029436 | 3300006931 | Bacteria | 5509 |
| 454 | Ga0097620_100033086 | 3300006931 | Bacteria | 5193 |
| 455 | Ga0097620_100041655 | 3300006931 | Bacteria | 4612 |
| 456 | Ga0097620_100073858 | 3300006931 | Bacteria | 3448 |
| 457 | Ga0097620_100136213 | 3300006931 | Bacteria | 2528 |
| 458 | Ga0097620_100162560 | 3300006931 | Bacteria | 2312 |
| 459 | Ga0097620_100228244 | 3300006931 | Bacteria | 1950 |
| 460 | Ga0075435_100003226 | 3300007076 | Bacteria | 11043 |
| 461 | Ga0075435_100003893 | 3300007076 | Bacteria | 10196 |
| 462 | Ga0075435_100020624 | 3300007076 | Bacteria | 5055 |
| 463 | Ga0075435_100040892 | 3300007076 | Bacteria | 3704 |
| 464 | Ga0075435_100042755 | 3300007076 | Bacteria | 3625 |
| 465 | Ga0075435_100064482 | 3300007076 | Bacteria | 2977 |
| 466 | Ga0075435_100101013 | 3300007076 | Bacteria | 2390 |
| 467 | Ga0099794_10002655 | 3300007265 | Bacteria | 6655 |
| 468 | Ga0099794_10008572 | 3300007265 | Bacteria | 4255 |
| 469 | Ga0105240_10021429 | 3300009093 | Bacteria | 8593 |
| 470 | Ga0105240_10275252 | 3300009093 | Bacteria | 1937 |
| 471 | Ga0105240_10405961 | 3300009093 | Bacteria | 1533 |
| 472 | Ga0111539_10003771 | 3300009094 | Bacteria | 19940 |
| 473 | Ga0111539_10004229 | 3300009094 | Bacteria | 18819 |
| 474 | Ga0111539_10004348 | 3300009094 | Bacteria | 18553 |
| 475 | Ga0111539_10009801 | 3300009094 | Bacteria | 12091 |
| 476 | Ga0111539_10021661 | 3300009094 | Bacteria | 7906 |
| 477 | Ga0111539_10029039 | 3300009094 | Bacteria | 6742 |
| 478 | Ga0111539_10034471 | 3300009094 | Bacteria | 6137 |
| 479 | Ga0111539_10037135 | 3300009094 | Bacteria | 5884 |
| 480 | Ga0111539_10048226 | 3300009094 | Bacteria | 5087 |
| 481 | Ga0111539_10075167 | 3300009094 | Bacteria | 3981 |
| 482 | Ga0111539_10092226 | 3300009094 | Bacteria | 3559 |
| 483 | Ga0111539_10096271 | 3300009094 | Bacteria | 3477 |
| 484 | Ga0111539_10108999 | 3300009094 | Bacteria | 3249 |
| 485 | Ga0111539_10147900 | 3300009094 | Bacteria | 2750 |
| 486 | Ga0111539_10159359 | 3300009094 | Bacteria | 2640 |
| 487 | Ga0111539_10218455 | 3300009094 | Bacteria | 2220 |
| 488 | Ga0111539_10229966 | 3300009094 | Bacteria | 2159 |
| 489 | Ga0111539_10238610 | 3300009094 | Bacteria | 2116 |
| 490 | Ga0111539_10576760 | 3300009094 | Bacteria | 1310 |
| 491 | Ga0105245_10018518 | 3300009098 | Bacteria | 6090 |
| 492 | Ga0105245_10049152 | 3300009098 | Bacteria | 3775 |
| 493 | Ga0105245_10064134 | 3300009098 | Bacteria | 3320 |
| 494 | Ga0105247_10011104 | 3300009101 | Bacteria | 5432 |
| 495 | Ga0105247_10018503 | 3300009101 | Bacteria | 4178 |
| 496 | Ga0114129_10000032 | 3300009147 | Bacteria | 111487 |
| 497 | Ga0114129_10000127 | 3300009147 | Bacteria | 77507 |
| 498 | Ga0114129_10000939 | 3300009147 | Bacteria | 38096 |
| 499 | Ga0114129_10003134 | 3300009147 | Bacteria | 23200 |
| 500 | Ga0114129_10003744 | 3300009147 | Bacteria | 21440 |
| 501 | Ga0114129_10006207 | 3300009147 | Bacteria | 16951 |
| 502 | Ga0114129_10006952 | 3300009147 | Bacteria | 16099 |
| 503 | Ga0114129_10011327 | 3300009147 | Bacteria | 12704 |
| 504 | Ga0114129_10015037 | 3300009147 | Bacteria | 11018 |
| 505 | Ga0114129_10017930 | 3300009147 | Bacteria | 10079 |
| 506 | Ga0114129_10029973 | 3300009147 | Bacteria | 7704 |
| 507 | Ga0114129_10033131 | 3300009147 | Bacteria | 7301 |
| 508 | Ga0114129_10037256 | 3300009147 | Bacteria | 6867 |
| 509 | Ga0114129_10071958 | 3300009147 | Bacteria | 4820 |
| 510 | Ga0114129_10157201 | 3300009147 | Bacteria | 3108 |
| 511 | Ga0114129_10185545 | 3300009147 | Bacteria | 2827 |
| 512 | Ga0114129_10200567 | 3300009147 | Bacteria | 2702 |
| 513 | Ga0114129_10210827 | 3300009147 | Bacteria | 2626 |
| 514 | Ga0114129_10556086 | 3300009147 | Bacteria | 1491 |
| 515 | Ga0105243_10002886 | 3300009148 | Bacteria | 14242 |
| 516 | Ga0105243_10006221 | 3300009148 | Bacteria | 9229 |
| 517 | Ga0105243_10009076 | 3300009148 | Bacteria | 7596 |
| 518 | Ga0105243_10013026 | 3300009148 | Bacteria | 6283 |
| 519 | Ga0105243_10036259 | 3300009148 | Bacteria | 3827 |
| 520 | Ga0105243_10054643 | 3300009148 | Bacteria | 3171 |
| 521 | Ga0105243_10057372 | 3300009148 | Bacteria | 3100 |
| 522 | Ga0105243_10163848 | 3300009148 | Bacteria | 1919 |
| 523 | Ga0105243_10350370 | 3300009148 | Bacteria | 1355 |
| 524 | Ga0105243_10411699 | 3300009148 | Bacteria | 1258 |
| 525 | Ga0105241_10009863 | 3300009174 | Bacteria | 7019 |
| 526 | Ga0105241_10122279 | 3300009174 | Bacteria | 2098 |
| 527 | Ga0105242_10002197 | 3300009176 | Bacteria | 15395 |
| 528 | Ga0105242_10026154 | 3300009176 | Bacteria | 4624 |
| 529 | Ga0105242_10026311 | 3300009176 | Bacteria | 4611 |
| 530 | Ga0105242_10109442 | 3300009176 | Bacteria | 2353 |
| 531 | Ga0105242_10113762 | 3300009176 | Bacteria | 2311 |
| 532 | Ga0105242_10114559 | 3300009176 | Bacteria | 2304 |
| 533 | Ga0105242_10121863 | 3300009176 | Bacteria | 2239 |
| 534 | Ga0105242_10190971 | 3300009176 | Bacteria | 1813 |
| 535 | Ga0105248_10000943 | 3300009177 | Bacteria | 32364 |
| 536 | Ga0105248_10007178 | 3300009177 | Bacteria | 12223 |
| 537 | Ga0105248_10009334 | 3300009177 | Bacteria | 10803 |
| 538 | Ga0105248_10012226 | 3300009177 | Bacteria | 9466 |
| 539 | Ga0105248_10018050 | 3300009177 | Bacteria | 7788 |
| 540 | Ga0105248_10029846 | 3300009177 | Bacteria | 6085 |
| 541 | Ga0105248_10079334 | 3300009177 | Bacteria | 3690 |
| 542 | Ga0105248_10098948 | 3300009177 | Bacteria | 3286 |
| 543 | Ga0105248_10120483 | 3300009177 | Bacteria | 2960 |
| 544 | Ga0105248_10177132 | 3300009177 | Bacteria | 2403 |
| 545 | Ga0105248_10318894 | 3300009177 | Bacteria | 1750 |
| 546 | Ga0105248_10368026 | 3300009177 | Bacteria | 1618 |
| 547 | Ga0105238_10005510 | 3300009551 | Bacteria | 12501 |
| 548 | Ga0105238_10038120 | 3300009551 | Bacteria | 4882 |
| 549 | Ga0105238_10137774 | 3300009551 | Bacteria | 2418 |
| 550 | Ga0105238_10170887 | 3300009551 | Bacteria | 2150 |
| 551 | Ga0105238_10197339 | 3300009551 | Bacteria | 1988 |
| 552 | Ga0105249_10003805 | 3300009553 | Bacteria | 13025 |
| 553 | Ga0105249_10009569 | 3300009553 | Bacteria | 8493 |
| 554 | Ga0105249_10028809 | 3300009553 | Bacteria | 5012 |
| 555 | Ga0105249_10412692 | 3300009553 | Bacteria | 1382 |
| 556 | Ga0105239_10081521 | 3300010375 | Bacteria | 3561 |
| 557 | Ga0105239_10112876 | 3300010375 | Bacteria | 3013 |
| 558 | Ga0105239_10274524 | 3300010375 | Bacteria | 1897 |
| 559 | Ga0105246_10002150 | 3300011119 | Bacteria | 11883 |
| 560 | Ga0105246_10021870 | 3300011119 | Bacteria | 4122 |
| 561 | Ga0105246_10136664 | 3300011119 | Bacteria | 1838 |
| 562 | Ga0105246_10143116 | 3300011119 | Bacteria | 1801 |
| 563 | Ga0105246_10147169 | 3300011119 | Bacteria | 1779 |
| 564 | Ga0157371_10024677 | 3300013102 | Bacteria | 4387 |
| 565 | Ga0157370_10016729 | 3300013104 | Bacteria | 7421 |
| 566 | Ga0157370_10042219 | 3300013104 | Bacteria | 4396 |
| 567 | Ga0157370_10116970 | 3300013104 | Bacteria | 2490 |
| 568 | Ga0157369_10011406 | 3300013105 | Bacteria | 10092 |
| 569 | Ga0157369_10012708 | 3300013105 | Bacteria | 9548 |
| 570 | Ga0157374_10191254 | 3300013296 | Bacteria | 2002 |
| 571 | Ga0157374_10242036 | 3300013296 | Bacteria | 1774 |
| 572 | Ga0157378_10090899 | 3300013297 | Bacteria | 2775 |
| 573 | Ga0157378_10120861 | 3300013297 | Bacteria | 2414 |
| 574 | Ga0157378_10171200 | 3300013297 | Bacteria | 2037 |
| 575 | Ga0157378_10391349 | 3300013297 | Bacteria | 1367 |
| 576 | Ga0163162_10008524 | 3300013306 | Bacteria | 9993 |
| 577 | Ga0163162_10008622 | 3300013306 | Bacteria | 9935 |
| 578 | Ga0163162_10092279 | 3300013306 | Bacteria | 3112 |
| 579 | Ga0163162_10331878 | 3300013306 | Bacteria | 1653 |
| 580 | Ga0157372_10046056 | 3300013307 | Bacteria | 4840 |
| 581 | Ga0157372_10079042 | 3300013307 | Bacteria | 3718 |
| 582 | Ga0157372_10265210 | 3300013307 | Bacteria | 1994 |
| 583 | Ga0157375_10017505 | 3300013308 | Bacteria | 6469 |
| 584 | Ga0157375_10047330 | 3300013308 | Bacteria | 4199 |
| 585 | Ga0157375_10066597 | 3300013308 | Bacteria | 3597 |
| 586 | Ga0157375_10074179 | 3300013308 | Bacteria | 3423 |
| 587 | Ga0157375_10107640 | 3300013308 | Bacteria | 2881 |
| 588 | Ga0157375_10114966 | 3300013308 | Bacteria | 2793 |
| 589 | Ga0157375_10211661 | 3300013308 | Bacteria | 2096 |
| 590 | Ga0163163_10008055 | 3300014325 | Bacteria | 9335 |
| 591 | Ga0163163_10017879 | 3300014325 | Bacteria | 6620 |
| 592 | Ga0163163_10022835 | 3300014325 | Bacteria | 5930 |
| 593 | Ga0163163_10047022 | 3300014325 | Bacteria | 4240 |
| 594 | Ga0163163_10071192 | 3300014325 | Bacteria | 3464 |
| 595 | Ga0163163_10087836 | 3300014325 | Bacteria | 3120 |
| 596 | Ga0163163_10136659 | 3300014325 | Bacteria | 2492 |
| 597 | Ga0163163_10210525 | 3300014325 | Bacteria | 1993 |
| 598 | Ga0163163_10544418 | 3300014325 | Bacteria | 1223 |
| 599 | Ga0157380_10001491 | 3300014326 | Bacteria | 15326 |
| 600 | Ga0157380_10010921 | 3300014326 | Bacteria | 6549 |
| 601 | Ga0157380_10014471 | 3300014326 | Bacteria | 5772 |
| 602 | Ga0157380_10029501 | 3300014326 | Bacteria | 4192 |
| 603 | Ga0157380_10030663 | 3300014326 | Bacteria | 4121 |
| 604 | Ga0157380_10036819 | 3300014326 | Bacteria | 3788 |
| 605 | Ga0157380_10037074 | 3300014326 | Bacteria | 3777 |
| 606 | Ga0157380_10064627 | 3300014326 | Bacteria | 2938 |
| 607 | Ga0157380_10067423 | 3300014326 | Bacteria | 2881 |
| 608 | Ga0157380_10116889 | 3300014326 | Bacteria | 2252 |
| 609 | Ga0157380_10175468 | 3300014326 | Bacteria | 1877 |
| 610 | Ga0157380_10204849 | 3300014326 | Bacteria | 1753 |
| 611 | Ga0157380_10344942 | 3300014326 | Bacteria | 1391 |
| 612 | Ga0157380_10367117 | 3300014326 | Bacteria | 1353 |
| 613 | Ga0157380_10367951 | 3300014326 | Bacteria | 1352 |
| 614 | Ga0182008_10006801 | 3300014497 | Bacteria | 6363 |
| 615 | Ga0157377_10005968 | 3300014745 | Bacteria | 5769 |
| 616 | Ga0157377_10011755 | 3300014745 | Bacteria | 4379 |
| 617 | Ga0157377_10109470 | 3300014745 | Bacteria | 1658 |
| 618 | Ga0157379_10000007 | 3300014968 | Bacteria | 142402 |
| 619 | Ga0157379_10003064 | 3300014968 | Bacteria | 14133 |
| 620 | Ga0157379_10013575 | 3300014968 | Bacteria | 7138 |
| 621 | Ga0157379_10017832 | 3300014968 | Bacteria | 6255 |
| 622 | Ga0157379_10044088 | 3300014968 | Bacteria | 3982 |
| 623 | Ga0157379_10069016 | 3300014968 | Bacteria | 3160 |
| 624 | Ga0157379_10190944 | 3300014968 | Bacteria | 1851 |
| 625 | Ga0157379_10203540 | 3300014968 | Bacteria | 1790 |
| 626 | Ga0157376_10011280 | 3300014969 | Bacteria | 6579 |
| 627 | Ga0157376_10036613 | 3300014969 | Bacteria | 3976 |
| 628 | Ga0157376_10070517 | 3300014969 | Bacteria | 2967 |
| 629 | Ga0157376_10299891 | 3300014969 | Bacteria | 1521 |
| 630 | Ga0182007_10023328 | 3300015262 | Bacteria | 2176 |
| 631 | Ga0163161_10028324 | 3300017792 | Bacteria | 3978 |
| 632 | Ga0163161_10078278 | 3300017792 | Bacteria | 2430 |
| 633 | Ga0206356_10209910 | 3300020070 | Bacteria | 4669 |
| 634 | Ga0206353_10257956 | 3300020082 | Bacteria | 1212 |
| 635 | Ga0206353_10390452 | 3300020082 | Bacteria | 14670 |
| 636 | Ga0206353_11931331 | 3300020082 | Bacteria | 4097 |
| 637 | Ga0213876_10086674 | 3300021384 | Bacteria | 1657 |
| 638 | Ga0209050_1002956 | 3300025298 | Bacteria | 13286 |
| 639 | Ga0209257_1000006 | 3300025304 | Bacteria | 1570111 |
| 640 | Ga0207697_10002059 | 3300025315 | Bacteria | 10589 |
| 641 | Ga0207697_10002496 | 3300025315 | Bacteria | 9506 |
| 642 | Ga0207697_10028256 | 3300025315 | Bacteria | 2294 |
| 643 | Ga0207697_10068738 | 3300025315 | Bacteria | 1482 |
| 644 | Ga0207656_10045227 | 3300025321 | Bacteria | 1883 |
| 645 | Ga0207682_10002902 | 3300025893 | Bacteria | 7559 |
| 646 | Ga0207682_10003368 | 3300025893 | Bacteria | 6959 |
| 647 | Ga0207682_10011854 | 3300025893 | Bacteria | 3405 |
| 648 | Ga0207642_10036849 | 3300025899 | Bacteria | 2103 |
| 649 | Ga0207688_10004310 | 3300025901 | Bacteria | 7760 |
| 650 | Ga0207688_10010791 | 3300025901 | Bacteria | 4972 |
| 651 | Ga0207688_10063280 | 3300025901 | Bacteria | 2087 |
| 652 | Ga0207688_10092310 | 3300025901 | Bacteria | 1740 |
| 653 | Ga0207680_10053614 | 3300025903 | Bacteria | 2422 |
| 654 | Ga0207680_10111437 | 3300025903 | Bacteria | 1775 |
| 655 | Ga0207699_10014716 | 3300025906 | Bacteria | 4043 |
| 656 | Ga0207645_10001211 | 3300025907 | Bacteria | 21295 |
| 657 | Ga0207645_10002990 | 3300025907 | Bacteria | 13067 |
| 658 | Ga0207645_10054617 | 3300025907 | Bacteria | 2551 |
| 659 | Ga0207645_10056145 | 3300025907 | Bacteria | 2514 |
| 660 | Ga0207645_10079852 | 3300025907 | Bacteria | 2097 |
| 661 | Ga0207645_10080516 | 3300025907 | Bacteria | 2088 |
| 662 | Ga0207643_10006077 | 3300025908 | Bacteria | 6452 |
| 663 | Ga0207643_10010032 | 3300025908 | Bacteria | 5092 |
| 664 | Ga0207643_10014099 | 3300025908 | Bacteria | 4339 |
| 665 | Ga0207643_10021872 | 3300025908 | Bacteria | 3518 |
| 666 | Ga0207643_10037355 | 3300025908 | Bacteria | 2725 |
| 667 | Ga0207643_10048157 | 3300025908 | Bacteria | 2414 |
| 668 | Ga0207643_10132954 | 3300025908 | Bacteria | 1482 |
| 669 | Ga0207705_10003753 | 3300025909 | Bacteria | 11574 |
| 670 | Ga0207705_10054656 | 3300025909 | Bacteria | 2878 |
| 671 | Ga0207705_10069859 | 3300025909 | Bacteria | 2544 |
| 672 | Ga0207684_10000491 | 3300025910 | Bacteria | 50201 |
| 673 | Ga0207684_10031743 | 3300025910 | Bacteria | 4493 |
| 674 | Ga0207684_10311778 | 3300025910 | Bacteria | 1356 |
| 675 | Ga0207654_10014370 | 3300025911 | Bacteria | 4089 |
| 676 | Ga0207707_10019997 | 3300025912 | Bacteria | 5842 |
| 677 | Ga0207695_10014226 | 3300025913 | Bacteria | 9438 |
| 678 | Ga0207695_10059773 | 3300025913 | Bacteria | 3950 |
| 679 | Ga0207695_10158762 | 3300025913 | Bacteria | 2194 |
| 680 | Ga0207693_10120583 | 3300025915 | Bacteria | 2059 |
| 681 | Ga0207660_10015632 | 3300025917 | Bacteria | 5012 |
| 682 | Ga0207662_10019025 | 3300025918 | Bacteria | 3902 |
| 683 | Ga0207662_10022979 | 3300025918 | Bacteria | 3579 |
| 684 | Ga0207662_10084746 | 3300025918 | Bacteria | 1939 |
| 685 | Ga0207662_10088745 | 3300025918 | Bacteria | 1899 |
| 686 | Ga0207662_10185391 | 3300025918 | Bacteria | 1341 |
| 687 | Ga0207657_10024642 | 3300025919 | Bacteria | 5565 |
| 688 | Ga0207657_10040322 | 3300025919 | Bacteria | 4138 |
| 689 | Ga0207657_10100137 | 3300025919 | Bacteria | 2406 |
| 690 | Ga0207649_10023474 | 3300025920 | Bacteria | 3573 |
| 691 | Ga0207649_10043227 | 3300025920 | Bacteria | 2754 |
| 692 | Ga0207649_10129224 | 3300025920 | Bacteria | 1714 |
| 693 | Ga0207652_10047440 | 3300025921 | Bacteria | 3669 |
| 694 | Ga0207646_10001586 | 3300025922 | Bacteria | 27768 |
| 695 | Ga0207646_10002404 | 3300025922 | Bacteria | 22088 |
| 696 | Ga0207646_10009215 | 3300025922 | Bacteria | 9784 |
| 697 | Ga0207646_10012777 | 3300025922 | Bacteria | 8053 |
| 698 | Ga0207646_10017164 | 3300025922 | Bacteria | 6779 |
| 699 | Ga0207646_10028693 | 3300025922 | Bacteria | 5063 |
| 700 | Ga0207646_10092641 | 3300025922 | Bacteria | 2705 |
| 701 | Ga0207681_10009853 | 3300025923 | Bacteria | 5844 |
| 702 | Ga0207681_10020691 | 3300025923 | Bacteria | 4173 |
| 703 | Ga0207681_10111301 | 3300025923 | Bacteria | 1992 |
| 704 | Ga0207681_10135371 | 3300025923 | Bacteria | 1827 |
| 705 | Ga0207681_10220191 | 3300025923 | Bacteria | 1468 |
| 706 | Ga0207694_10015342 | 3300025924 | Bacteria | 5781 |
| 707 | Ga0207650_10032986 | 3300025925 | Bacteria | 3748 |
| 708 | Ga0207650_10142047 | 3300025925 | Bacteria | 1888 |
| 709 | Ga0207650_10191455 | 3300025925 | Bacteria | 1634 |
| 710 | Ga0207659_10000209 | 3300025926 | Bacteria | 35219 |
| 711 | Ga0207659_10000854 | 3300025926 | Bacteria | 18070 |
| 712 | Ga0207659_10002047 | 3300025926 | Bacteria | 11973 |
| 713 | Ga0207659_10006129 | 3300025926 | Bacteria | 7345 |
| 714 | Ga0207659_10009478 | 3300025926 | Bacteria | 6087 |
| 715 | Ga0207659_10011484 | 3300025926 | Bacteria | 5596 |
| 716 | Ga0207659_10030752 | 3300025926 | Bacteria | 3671 |
| 717 | Ga0207659_10035003 | 3300025926 | Bacteria | 3468 |
| 718 | Ga0207659_10036189 | 3300025926 | Bacteria | 3417 |
| 719 | Ga0207659_10045322 | 3300025926 | Bacteria | 3100 |
| 720 | Ga0207659_10056908 | 3300025926 | Bacteria | 2801 |
| 721 | Ga0207687_10016974 | 3300025927 | Bacteria | 4785 |
| 722 | Ga0207700_10195584 | 3300025928 | Bacteria | 1701 |
| 723 | Ga0207664_10028758 | 3300025929 | Bacteria | 4227 |
| 724 | Ga0207664_10083724 | 3300025929 | Bacteria | 2601 |
| 725 | Ga0207644_10038219 | 3300025931 | Bacteria | 3380 |
| 726 | Ga0207644_10039388 | 3300025931 | Bacteria | 3336 |
| 727 | Ga0207644_10040682 | 3300025931 | Bacteria | 3286 |
| 728 | Ga0207644_10153803 | 3300025931 | Bacteria | 1782 |
| 729 | Ga0207644_10204901 | 3300025931 | Bacteria | 1557 |
| 730 | Ga0207706_10009358 | 3300025933 | Bacteria | 8996 |
| 731 | Ga0207706_10015076 | 3300025933 | Bacteria | 6996 |
| 732 | Ga0207706_10038166 | 3300025933 | Bacteria | 4261 |
| 733 | Ga0207706_10038926 | 3300025933 | Bacteria | 4217 |
| 734 | Ga0207706_10041924 | 3300025933 | Bacteria | 4056 |
| 735 | Ga0207706_10082819 | 3300025933 | Bacteria | 2820 |
| 736 | Ga0207706_10087790 | 3300025933 | Bacteria | 2735 |
| 737 | Ga0207686_10003421 | 3300025934 | Bacteria | 8521 |
| 738 | Ga0207686_10006274 | 3300025934 | Bacteria | 6397 |
| 739 | Ga0207686_10010825 | 3300025934 | Bacteria | 4973 |
| 740 | Ga0207686_10217860 | 3300025934 | Bacteria | 1376 |
| 741 | Ga0207709_10008062 | 3300025935 | Bacteria | 5834 |
| 742 | Ga0207709_10010140 | 3300025935 | Bacteria | 5189 |
| 743 | Ga0207709_10017542 | 3300025935 | Bacteria | 3996 |
| 744 | Ga0207709_10028476 | 3300025935 | Bacteria | 3230 |
| 745 | Ga0207709_10058745 | 3300025935 | Bacteria | 2391 |
| 746 | Ga0207709_10061172 | 3300025935 | Bacteria | 2352 |
| 747 | Ga0207709_10167256 | 3300025935 | Bacteria | 1540 |
| 748 | Ga0207670_10003370 | 3300025936 | Bacteria | 8479 |
| 749 | Ga0207670_10050656 | 3300025936 | Bacteria | 2784 |
| 750 | Ga0207670_10058770 | 3300025936 | Bacteria | 2613 |
| 751 | Ga0207670_10058784 | 3300025936 | Bacteria | 2613 |
| 752 | Ga0207670_10149525 | 3300025936 | Bacteria | 1731 |
| 753 | Ga0207670_10198646 | 3300025936 | Bacteria | 1522 |
| 754 | Ga0207670_10199551 | 3300025936 | Bacteria | 1519 |
| 755 | Ga0207670_10200801 | 3300025936 | Bacteria | 1515 |
| 756 | Ga0207670_10235702 | 3300025936 | Bacteria | 1407 |
| 757 | Ga0207670_10274841 | 3300025936 | Bacteria | 1311 |
| 758 | Ga0207669_10016067 | 3300025937 | Bacteria | 3792 |
| 759 | Ga0207669_10019064 | 3300025937 | Bacteria | 3563 |
| 760 | Ga0207669_10058122 | 3300025937 | Bacteria | 2358 |
| 761 | Ga0207704_10043620 | 3300025938 | Bacteria | 2650 |
| 762 | Ga0207704_10075104 | 3300025938 | Bacteria | 2160 |
| 763 | Ga0207691_10006867 | 3300025940 | Bacteria | 10983 |
| 764 | Ga0207691_10006894 | 3300025940 | Bacteria | 10958 |
| 765 | Ga0207691_10029696 | 3300025940 | Bacteria | 5113 |
| 766 | Ga0207691_10030061 | 3300025940 | Bacteria | 5079 |
| 767 | Ga0207691_10036136 | 3300025940 | Bacteria | 4578 |
| 768 | Ga0207691_10051484 | 3300025940 | Bacteria | 3764 |
| 769 | Ga0207691_10081206 | 3300025940 | Bacteria | 2915 |
| 770 | Ga0207691_10087850 | 3300025940 | Bacteria | 2789 |
| 771 | Ga0207691_10150241 | 3300025940 | Bacteria | 2048 |
| 772 | Ga0207711_10001278 | 3300025941 | Bacteria | 23847 |
| 773 | Ga0207711_10010515 | 3300025941 | Bacteria | 7688 |
| 774 | Ga0207711_10011686 | 3300025941 | Bacteria | 7295 |
| 775 | Ga0207711_10018748 | 3300025941 | Bacteria | 5753 |
| 776 | Ga0207711_10062275 | 3300025941 | Bacteria | 3218 |
| 777 | Ga0207711_10090877 | 3300025941 | Bacteria | 2685 |
| 778 | Ga0207711_10097778 | 3300025941 | Bacteria | 2592 |
| 779 | Ga0207689_10006638 | 3300025942 | Bacteria | 10203 |
| 780 | Ga0207689_10036444 | 3300025942 | Bacteria | 4083 |
| 781 | Ga0207689_10038079 | 3300025942 | Bacteria | 3984 |
| 782 | Ga0207689_10092527 | 3300025942 | Bacteria | 2484 |
| 783 | Ga0207689_10292362 | 3300025942 | Bacteria | 1350 |
| 784 | Ga0207661_10001430 | 3300025944 | Bacteria | 16095 |
| 785 | Ga0207661_10001693 | 3300025944 | Bacteria | 15030 |
| 786 | Ga0207661_10017151 | 3300025944 | Bacteria | 5352 |
| 787 | Ga0207661_10043583 | 3300025944 | Bacteria | 3542 |
| 788 | Ga0207661_10059670 | 3300025944 | Bacteria | 3075 |
| 789 | Ga0207661_10105298 | 3300025944 | Bacteria | 2376 |
| 790 | Ga0207679_10007694 | 3300025945 | Bacteria | 6844 |
| 791 | Ga0207679_10037475 | 3300025945 | Bacteria | 3447 |
| 792 | Ga0207679_10059730 | 3300025945 | Bacteria | 2830 |
| 793 | Ga0207679_10090800 | 3300025945 | Bacteria | 2362 |
| 794 | Ga0207679_10117062 | 3300025945 | Bacteria | 2114 |
| 795 | Ga0207679_10167973 | 3300025945 | Bacteria | 1803 |
| 796 | Ga0207679_10168597 | 3300025945 | Bacteria | 1800 |
| 797 | Ga0207667_10073659 | 3300025949 | Bacteria | 3548 |
| 798 | Ga0207667_10086606 | 3300025949 | Bacteria | 3242 |
| 799 | Ga0207667_10250735 | 3300025949 | Bacteria | 1811 |
| 800 | Ga0207651_10009269 | 3300025960 | Bacteria | 5375 |
| 801 | Ga0207651_10026264 | 3300025960 | Bacteria | 3634 |
| 802 | Ga0207651_10028137 | 3300025960 | Bacteria | 3541 |
| 803 | Ga0207651_10105102 | 3300025960 | Bacteria | 2105 |
| 804 | Ga0207651_10121253 | 3300025960 | Bacteria | 1983 |
| 805 | Ga0207651_10203723 | 3300025960 | Bacteria | 1587 |
| 806 | Ga0207651_10326444 | 3300025960 | Bacteria | 1284 |
| 807 | Ga0207712_10016816 | 3300025961 | Bacteria | 4742 |
| 808 | Ga0207712_10023448 | 3300025961 | Bacteria | 4072 |
| 809 | Ga0207712_10035472 | 3300025961 | Bacteria | 3389 |
| 810 | Ga0207712_10048939 | 3300025961 | Bacteria | 2943 |
| 811 | Ga0207712_10105025 | 3300025961 | Bacteria | 2107 |
| 812 | Ga0207640_10063796 | 3300025981 | Bacteria | 2449 |
| 813 | Ga0207640_10109378 | 3300025981 | Bacteria | 1955 |
| 814 | Ga0207640_10145833 | 3300025981 | Bacteria | 1732 |
| 815 | Ga0207658_10105918 | 3300025986 | Bacteria | 2213 |
| 816 | Ga0207658_10194161 | 3300025986 | Bacteria | 1690 |
| 817 | Ga0207677_10005324 | 3300026023 | Bacteria | 6976 |
| 818 | Ga0207677_10123707 | 3300026023 | Bacteria | 1951 |
| 819 | Ga0207677_10181823 | 3300026023 | Bacteria | 1655 |
| 820 | Ga0207703_10000001 | 3300026035 | Bacteria | 822925 |
| 821 | Ga0207703_10001811 | 3300026035 | Bacteria | 19051 |
| 822 | Ga0207703_10003450 | 3300026035 | Bacteria | 13241 |
| 823 | Ga0207703_10028221 | 3300026035 | Bacteria | 4422 |
| 824 | Ga0207703_10064866 | 3300026035 | Bacteria | 2999 |
| 825 | Ga0207639_10175722 | 3300026041 | Bacteria | 1818 |
| 826 | Ga0207639_10205469 | 3300026041 | Bacteria | 1692 |
| 827 | Ga0207678_10004486 | 3300026067 | Bacteria | 12554 |
| 828 | Ga0207678_10036465 | 3300026067 | Bacteria | 4280 |
| 829 | Ga0207678_10045317 | 3300026067 | Bacteria | 3803 |
| 830 | Ga0207678_10067075 | 3300026067 | Bacteria | 3080 |
| 831 | Ga0207678_10074382 | 3300026067 | Bacteria | 2911 |
| 832 | Ga0207678_10112554 | 3300026067 | Bacteria | 2321 |
| 833 | Ga0207678_10121680 | 3300026067 | Bacteria | 2227 |
| 834 | Ga0207708_10003212 | 3300026075 | Bacteria | 12042 |
| 835 | Ga0207708_10003477 | 3300026075 | Bacteria | 11612 |
| 836 | Ga0207708_10008663 | 3300026075 | Bacteria | 7531 |
| 837 | Ga0207708_10014140 | 3300026075 | Bacteria | 5966 |
| 838 | Ga0207708_10018446 | 3300026075 | Bacteria | 5255 |
| 839 | Ga0207708_10051556 | 3300026075 | Bacteria | 3133 |
| 840 | Ga0207708_10056058 | 3300026075 | Bacteria | 3006 |
| 841 | Ga0207708_10081767 | 3300026075 | Bacteria | 2483 |
| 842 | Ga0207708_10082413 | 3300026075 | Bacteria | 2473 |
| 843 | Ga0207708_10147771 | 3300026075 | Bacteria | 1848 |
| 844 | Ga0207708_10314022 | 3300026075 | Bacteria | 1277 |
| 845 | Ga0207702_10032147 | 3300026078 | Bacteria | 4379 |
| 846 | Ga0207702_10135040 | 3300026078 | Bacteria | 2225 |
| 847 | Ga0207702_10216984 | 3300026078 | Bacteria | 1781 |
| 848 | Ga0207641_10087888 | 3300026088 | Bacteria | 2712 |
| 849 | Ga0207641_10122856 | 3300026088 | Bacteria | 2320 |
| 850 | Ga0207641_10148860 | 3300026088 | Bacteria | 2119 |
| 851 | Ga0207648_10001129 | 3300026089 | Bacteria | 29973 |
| 852 | Ga0207648_10004649 | 3300026089 | Bacteria | 14051 |
| 853 | Ga0207648_10013721 | 3300026089 | Bacteria | 7521 |
| 854 | Ga0207648_10023072 | 3300026089 | Bacteria | 5581 |
| 855 | Ga0207648_10023618 | 3300026089 | Bacteria | 5504 |
| 856 | Ga0207648_10031547 | 3300026089 | Bacteria | 4684 |
| 857 | Ga0207648_10031931 | 3300026089 | Bacteria | 4652 |
| 858 | Ga0207648_10046921 | 3300026089 | Bacteria | 3787 |
| 859 | Ga0207648_10054768 | 3300026089 | Bacteria | 3483 |
| 860 | Ga0207648_10063665 | 3300026089 | Bacteria | 3214 |
| 861 | Ga0207648_10113510 | 3300026089 | Bacteria | 2379 |
| 862 | Ga0207648_10191481 | 3300026089 | Bacteria | 1813 |
| 863 | Ga0207648_10305520 | 3300026089 | Bacteria | 1427 |
| 864 | Ga0207676_10022681 | 3300026095 | Bacteria | 4619 |
| 865 | Ga0207676_10047034 | 3300026095 | Bacteria | 3342 |
| 866 | Ga0207676_10087204 | 3300026095 | Bacteria | 2552 |
| 867 | Ga0207676_10124781 | 3300026095 | Bacteria | 2178 |
| 868 | Ga0207674_10019100 | 3300026116 | Bacteria | 7430 |
| 869 | Ga0207674_10046794 | 3300026116 | Bacteria | 4439 |
| 870 | Ga0207674_10071773 | 3300026116 | Bacteria | 3479 |
| 871 | Ga0207674_10096765 | 3300026116 | Bacteria | 2936 |
| 872 | Ga0207674_10124853 | 3300026116 | Bacteria | 2540 |
| 873 | Ga0207674_10169714 | 3300026116 | Bacteria | 2136 |
| 874 | Ga0207674_10227804 | 3300026116 | Bacteria | 1812 |
| 875 | Ga0207675_100010366 | 3300026118 | Bacteria | 8731 |
| 876 | Ga0207675_100012983 | 3300026118 | Bacteria | 7776 |
| 877 | Ga0207675_100043996 | 3300026118 | Bacteria | 4170 |
| 878 | Ga0207675_100052039 | 3300026118 | Bacteria | 3822 |
| 879 | Ga0207683_10000190 | 3300026121 | Bacteria | 52505 |
| 880 | Ga0207683_10003923 | 3300026121 | Bacteria | 12898 |
| 881 | Ga0207683_10007767 | 3300026121 | Bacteria | 9177 |
| 882 | Ga0207683_10054688 | 3300026121 | Bacteria | 3500 |
| 883 | Ga0207683_10056469 | 3300026121 | Bacteria | 3444 |
| 884 | Ga0207683_10082387 | 3300026121 | Bacteria | 2858 |
| 885 | Ga0207683_10124695 | 3300026121 | Bacteria | 2314 |
| 886 | Ga0207683_10140584 | 3300026121 | Bacteria | 2175 |
| 887 | Ga0207698_10060892 | 3300026142 | Bacteria | 2938 |
| 888 | Ga0207698_10238718 | 3300026142 | Bacteria | 1655 |
| 889 | Ga0209588_1022596 | 3300027671 | Unclassified | 1979 |
| 890 | Ga0209588_1028619 | 3300027671 | Bacteria | 1774 |
| 891 | Ga0209998_10010271 | 3300027717 | Bacteria | 1939 |
| 892 | Ga0207428_10000393 | 3300027907 | Bacteria | 54718 |
| 893 | Ga0207428_10000574 | 3300027907 | Bacteria | 43446 |
| 894 | Ga0207428_10001100 | 3300027907 | Bacteria | 29381 |
| 895 | Ga0207428_10011660 | 3300027907 | Bacteria | 7755 |
| 896 | Ga0207428_10016192 | 3300027907 | Bacteria | 6419 |
| 897 | Ga0207428_10038835 | 3300027907 | Bacteria | 3867 |
| 898 | Ga0207428_10063561 | 3300027907 | Bacteria | 2915 |
| 899 | Ga0207428_10084280 | 3300027907 | Bacteria | 2477 |
| 900 | Ga0207428_10084727 | 3300027907 | Bacteria | 2469 |
| 901 | Ga0207428_10086614 | 3300027907 | Bacteria | 2438 |
| 902 | Ga0207428_10089007 | 3300027907 | Bacteria | 2400 |
| 903 | Ga0207428_10161341 | 3300027907 | Bacteria | 1702 |
| 904 | Ga0207428_10178367 | 3300027907 | Bacteria | 1606 |
| 905 | Ga0207428_10244222 | 3300027907 | Bacteria | 1341 |
| 906 | Ga0268266_10004015 | 3300028379 | Bacteria | 14232 |
| 907 | Ga0268266_10012762 | 3300028379 | Bacteria | 7259 |
| 908 | Ga0268265_10000185 | 3300028380 | Bacteria | 73947 |
| 909 | Ga0268265_10030738 | 3300028380 | Bacteria | 3871 |
| 910 | Ga0268265_10051363 | 3300028380 | Bacteria | 3112 |
| 911 | Ga0268265_10089961 | 3300028380 | Bacteria | 2451 |
| 912 | Ga0268265_10191468 | 3300028380 | Bacteria | 1767 |
| 913 | Ga0268264_10007749 | 3300028381 | Bacteria | 8940 |
| 914 | Ga0268264_10062017 | 3300028381 | Bacteria | 3138 |
| 915 | Ga0268264_10303755 | 3300028381 | Bacteria | 1503 |
| 916 | Ga0265337_1014920 | 3300028556 | Bacteria | 2563 |
| 917 | Ga0265337_1026590 | 3300028556 | Bacteria | 1751 |
| 918 | Ga0265326_10000821 | 3300028558 | Bacteria | 11439 |
| 919 | Ga0265319_1004075 | 3300028563 | Bacteria | 7367 |
| 920 | Ga0265334_10011902 | 3300028573 | Bacteria | 3654 |
| 921 | Ga0265318_10010683 | 3300028577 | Bacteria | 3988 |
| 922 | Ga0265336_10014135 | 3300028666 | Bacteria | 2648 |
| 923 | Ga0307515_10002908 | 3300028794 | Bacteria | 36383 |
| 924 | Ga0307515_10099224 | 3300028794 | Unclassified | 3538 |
| 925 | Ga0265338_10007839 | 3300028800 | Bacteria | 13118 |
| 926 | Ga0265324_10002985 | 3300029957 | Bacteria | 8268 |
| 927 | Ga0316176_1037086 | 3300030732 | Bacteria | 3136 |
| 928 | Ga0265770_1007359 | 3300030878 | Bacteria | 1548 |
| 929 | Ga0265330_10015743 | 3300031235 | Bacteria | 3496 |
| 930 | Ga0265332_10020389 | 3300031238 | Bacteria | 2926 |
| 931 | Ga0265328_10041085 | 3300031239 | Bacteria | 1703 |
| 932 | Ga0265320_10002308 | 3300031240 | Bacteria | 13378 |
| 933 | Ga0265320_10004075 | 3300031240 | Bacteria | 9600 |
| 934 | Ga0265325_10013604 | 3300031241 | Bacteria | 4626 |
| 935 | Ga0265329_10004508 | 3300031242 | Bacteria | 5780 |
| 936 | Ga0265340_10000470 | 3300031247 | Bacteria | 21864 |
| 937 | Ga0265327_10004586 | 3300031251 | Bacteria | 12162 |
| 938 | Ga0265316_10010209 | 3300031344 | Bacteria | 8573 |
| 939 | Ga0265316_10011723 | 3300031344 | Bacteria | 7890 |
| 940 | Ga0265316_10238937 | 3300031344 | Bacteria | 1336 |
| 941 | Ga0307513_10000007 | 3300031456 | Bacteria | 451043 |
| 942 | Ga0307509_10032339 | 3300031507 | Bacteria | 5765 |
| 943 | Ga0307509_10078800 | 3300031507 | Unclassified | 3412 |
| 944 | Ga0307408_100013432 | 3300031548 | Bacteria | 5435 |
| 945 | Ga0307408_100059644 | 3300031548 | Unclassified | 2778 |
| 946 | Ga0307408_100203948 | 3300031548 | Bacteria | 1602 |
| 947 | Ga0307408_100220969 | 3300031548 | Bacteria | 1546 |
| 948 | Ga0265313_10038254 | 3300031595 | Bacteria | 2391 |
| 949 | Ga0316575_10000826 | 3300031665 | Bacteria | 9421 |
| 950 | Ga0316575_10001083 | 3300031665 | Bacteria | 8488 |
| 951 | Ga0316575_10009431 | 3300031665 | Bacteria | 3574 |
| 952 | Ga0316579_10008036 | 3300031691 | Bacteria | 4381 |
| 953 | Ga0316579_10020391 | 3300031691 | Bacteria | 2940 |
| 954 | Ga0316579_10039001 | 3300031691 | Bacteria | 2199 |
| 955 | Ga0265314_10002620 | 3300031711 | Bacteria | 18168 |
| 956 | Ga0265314_10015520 | 3300031711 | Bacteria | 6044 |
| 957 | Ga0265314_10027079 | 3300031711 | Bacteria | 4297 |
| 958 | Ga0265314_10052424 | 3300031711 | Bacteria | 2836 |
| 959 | Ga0316576_10003639 | 3300031727 | Bacteria | 9084 |
| 960 | Ga0316576_10006146 | 3300031727 | Bacteria | 7440 |
| 961 | Ga0316576_10011842 | 3300031727 | Bacteria | 5736 |
| 962 | Ga0316576_10027074 | 3300031727 | Unclassified | 4028 |
| 963 | Ga0316576_10056092 | 3300031727 | Bacteria | 2877 |
| 964 | Ga0316576_10071907 | 3300031727 | Bacteria | 2552 |
| 965 | Ga0316576_10082011 | 3300031727 | Bacteria | 2394 |
| 966 | Ga0316576_10100244 | 3300031727 | Bacteria | 2164 |
| 967 | Ga0316576_10139728 | 3300031727 | Bacteria | 1823 |
| 968 | Ga0316578_10001433 | 3300031728 | Bacteria | 9668 |
| 969 | Ga0316578_10001971 | 3300031728 | Bacteria | 8709 |
| 970 | Ga0316578_10041392 | 3300031728 | Bacteria | 2668 |
| 971 | Ga0316578_10041628 | 3300031728 | Bacteria | 2661 |
| 972 | Ga0316578_10117930 | 3300031728 | Bacteria | 1595 |
| 973 | Ga0307405_10058926 | 3300031731 | Bacteria | 2418 |
| 974 | Ga0307405_10091025 | 3300031731 | Unclassified | 2020 |
| 975 | Ga0307405_10104994 | 3300031731 | Bacteria | 1902 |
| 976 | Ga0316577_10000080 | 3300031733 | Bacteria | 25210 |
| 977 | Ga0316577_10000089 | 3300031733 | Bacteria | 24350 |
| 978 | Ga0316577_10000636 | 3300031733 | Bacteria | 14588 |
| 979 | Ga0316577_10004746 | 3300031733 | Bacteria | 7060 |
| 980 | Ga0316577_10005239 | 3300031733 | Bacteria | 6786 |
| 981 | Ga0316577_10089796 | 3300031733 | Bacteria | 1720 |
| 982 | Ga0307413_10039012 | 3300031824 | Bacteria | 2758 |
| 983 | Ga0307413_10054017 | 3300031824 | Bacteria | 2435 |
| 984 | Ga0307413_10062645 | 3300031824 | Bacteria | 2302 |
| 985 | Ga0307410_10019576 | 3300031852 | Bacteria | 4121 |
| 986 | Ga0307410_10025569 | 3300031852 | Bacteria | 3706 |
| 987 | Ga0307410_10103711 | 3300031852 | Bacteria | 2043 |
| 988 | Ga0307406_10081494 | 3300031901 | Bacteria | 2152 |
| 989 | Ga0307412_10087758 | 3300031911 | Bacteria | 2168 |
| 990 | Ga0307409_100027899 | 3300031995 | Bacteria | 4011 |
| 991 | Ga0307409_100037964 | 3300031995 | Bacteria | 3557 |
| 992 | Ga0307409_100144540 | 3300031995 | Bacteria | 2055 |
| 993 | Ga0307416_100008589 | 3300032002 | Bacteria | 6605 |
| 994 | Ga0307416_100016633 | 3300032002 | Bacteria | 5120 |
| 995 | Ga0307416_100165180 | 3300032002 | Bacteria | 2052 |
| 996 | Ga0307416_100178783 | 3300032002 | Bacteria | 1986 |
| 997 | Ga0307415_100018876 | 3300032126 | Unclassified | 4175 |
| 998 | Ga0316583_10009047 | 3300032133 | Bacteria | 3591 |
| 999 | Ga0316583_10020931 | 3300032133 | Bacteria | 2345 |
| 1000 | Ga0316583_10021849 | 3300032133 | Bacteria | 2293 |
| 1001 | Ga0316583_10068207 | 3300032133 | Bacteria | 1244 |
| 1002 | Ga0316585_10021473 | 3300032137 | Bacteria | 1983 |
| 1003 | Ga0316585_10053676 | 3300032137 | Unclassified | 1296 |
| 1004 | Ga0316580_10001255 | 3300032139 | Bacteria | 6534 |
| 1005 | Ga0316580_10006543 | 3300032139 | Bacteria | 3443 |
| 1006 | Ga0316593_10008734 | 3300032168 | Bacteria | 2836 |
| 1007 | Ga0373923_0045215 | 3300035111 | Bacteria | 1828 |
| 1008 | Ga0373932_0018875 | 3300035112 | Bacteria | 1790 |
| 1009 | Ga0373945_0059996 | 3300035116 | Bacteria | 1418 |
| 1010 | Ga0373954_0023176 | 3300035118 | Bacteria | 2821 |
| 1011 | Ga0373956_0052479 | 3300035119 | Bacteria | 1834 |
| 1012 | Ga0373943_0015607 | 3300035170 | Bacteria | 3453 |
| 1013 | Ga0373943_0038565 | 3300035170 | Bacteria | 2298 |
| 1014 | Ga0373946_0024979 | 3300035171 | Bacteria | 2347 |
| 1015 | Ga0373955_0033485 | 3300035172 | Bacteria | 2707 |
| 1016 | Ga0373962_0023654 | 3300035242 | Bacteria | 1638 |
| 1017 | Ga0316574_0000151 | 3300035398 | Bacteria | 22405 |
| 1018 | Ga0316574_0001153 | 3300035398 | Bacteria | 12184 |
| 1019 | Ga0316574_0001764 | 3300035398 | Bacteria | 10495 |
| 1020 | Ga0316574_0066657 | 3300035398 | Bacteria | 2269 |
| 1021 | Ga0316574_0080492 | 3300035398 | Bacteria | 2067 |
| 1022 | Ga0373924_0007928 | 3300035410 | Bacteria | 3844 |
| 1023 | Ga0373931_0016904 | 3300035691 | Bacteria | 3598 |
| 1024 | Ga0373931_0035227 | 3300035691 | Bacteria | 2601 |
| 1025 | Ga0373935_0076680 | 3300035692 | Bacteria | 2165 |
| 1026 | Ga0373935_0141213 | 3300035692 | Bacteria | 1627 |
| 1027 | Ga0373927_0022808 | 3300035695 | Bacteria | 4100 |
| 1028 | Ga0373947_0002973 | 3300035725 | Bacteria | 10111 |
| 1029 | Ga0373947_0013397 | 3300035725 | Bacteria | 4699 |
| 1030 | Ga0373937_0008628 | 3300036401 | Bacteria | 8854 |
| 1031 | Ga0373937_0055725 | 3300036401 | Bacteria | 3630 |
| 1032 | Ga0373937_0210739 | 3300036401 | Bacteria | 1828 |
| 1033 | Ga0373937_0243687 | 3300036401 | Bacteria | 1694 |
| 1034 | Ga0316582_0000480 | 3300036647 | Bacteria | 14910 |
| 1035 | Ga0316582_0006227 | 3300036647 | Bacteria | 6240 |
| 1036 | Ga0316582_0015286 | 3300036647 | Bacteria | 4384 |
| 1037 | Ga0316582_0043091 | 3300036647 | Bacteria | 2830 |
| 1038 | Ga0316582_0137838 | 3300036647 | Bacteria | 1643 |
| 1039 | Ga0316582_0154380 | 3300036647 | Bacteria | 1553 |
| 1040 | Ga0316584_0000413 | 3300036712 | Bacteria | 22346 |
| 1041 | Ga0316584_0001506 | 3300036712 | Bacteria | 14029 |
| 1042 | Ga0316584_0010138 | 3300036712 | Bacteria | 6576 |
| 1043 | Ga0316584_0011733 | 3300036712 | Bacteria | 6166 |
| 1044 | Ga0316584_0023624 | 3300036712 | Bacteria | 4492 |
| 1045 | Ga0316584_0046235 | 3300036712 | Bacteria | 3250 |
| 1046 | Ga0316584_0061249 | 3300036712 | Bacteria | 2818 |
| 1047 | Ga0316584_0203567 | 3300036712 | Bacteria | 1460 |
| 1048 | Ga0373925_0021612 | 3300037068 | Bacteria | 4690 |
| 1049 | Ga0373925_0029664 | 3300037068 | Bacteria | 4013 |
| 1050 | Ga0373925_0044438 | 3300037068 | Bacteria | 3298 |
| 1051 | Ga0395900_0147181 | 3300037418 | Bacteria | 2408 |
| 1052 | Ga0395900_0327770 | 3300037418 | Bacteria | 1510 |
| 1053 | Ga0395898_0076611 | 3300037466 | Bacteria | 3229 |
| 1054 | Ga0395905_0035481 | 3300037471 | Bacteria | 4683 |
| 1055 | Ga0436364_0619729 | 3300037853 | Bacteria | 11470 |
| 1056 | Ga0395901_0006804 | 3300038443 | Bacteria | 11552 |
| 1057 | Ga0395901_0023635 | 3300038443 | Bacteria | 6301 |
| 1058 | Ga0395901_0157581 | 3300038443 | Bacteria | 2384 |
| 1059 | Ga0400484_12566 | 3300038725 | Bacteria | 11306 |
| 1060 | Ga0400490_37255 | 3300038726 | Bacteria | 31974 |
| 1061 | Ga0400490_39545 | 3300038726 | Bacteria | 12070 |
| 1062 | Ga0400490_42916 | 3300038726 | Bacteria | 2138 |
| 1063 | Ga0400491_05038 | 3300038727 | Bacteria | 2416 |
| 1064 | Ga0400491_07905 | 3300038727 | Bacteria | 7863 |
| 1065 | Ga0400485_03365 | 3300038735 | Bacteria | 8632 |
| 1066 | Ga0400485_09643 | 3300038735 | Bacteria | 2009 |
| 1067 | Ga0400488_06186 | 3300038741 | Bacteria | 2520 |
| 1068 | Ga0400488_41691 | 3300038741 | Bacteria | 5506 |
| 1069 | Ga0400486_13051 | 3300038742 | Bacteria | 12497 |
| 1070 | Ga0400483_032670 | 3300039062 | Bacteria | 4098 |
| 1071 | Ga0400483_123874 | 3300039062 | Bacteria | 1403 |
| 1072 | Ga0400483_155563 | 3300039062 | Bacteria | 6344 |
| 1073 | Ga0400489_27482 | 3300039093 | Bacteria | 35511 |
| 1074 | Ga0436365_0895231 | 3300039437 | Bacteria | 2488 |
| 1075 | Ga0439439_0000378 | 3300041406 | Bacteria | 7310 |
| 1076 | Ga0439465_0015220 | 3300041413 | Bacteria | 2400 |
| 1077 | Ga0451789_0440849 | 3300041443 | Bacteria | 5430 |
| 1078 | Ga0451791_0426296 | 3300041451 | Bacteria | 2831 |
| 1079 | Ga0451793_0141268 | 3300041452 | Bacteria | 1282 |
| 1080 | Ga0451793_0476113 | 3300041452 | Bacteria | 4486 |
| 1081 | Ga0451800_0714665 | 3300041459 | Bacteria | 1503 |
| 1082 | Ga0451841_0256531 | 3300041498 | Bacteria | 1460 |
| 1083 | Ga0451843_0257713 | 3300041509 | Bacteria | 4028 |
| 1084 | Ga0451853_3751897 | 3300041512 | Bacteria | 1692 |
| 1085 | Ga0439433_0013975 | 3300041999 | Bacteria | 1766 |
| 1086 | Ga0439449_0008770 | 3300042007 | Bacteria | 3837 |
| 1087 | Ga0439449_0010419 | 3300042007 | Bacteria | 3510 |
| 1088 | Ga0439454_004658 | 3300042011 | Bacteria | 1595 |
| 1089 | Ga0439457_010577 | 3300042014 | Bacteria | 2118 |
| 1090 | Ga0450920_001937 | 3300042122 | Bacteria | 3483 |
| 1091 | Ga0450923_004384 | 3300042125 | Bacteria | 2216 |
| 1092 | Ga0450907_002845 | 3300042146 | Bacteria | 3194 |
| 1093 | Ga0439435_0002282 | 3300042436 | Bacteria | 3774 |
| 1094 | Ga0439435_0008994 | 3300042436 | Bacteria | 2332 |
| 1095 | Ga0439435_0038192 | 3300042436 | Bacteria | 1334 |
| 1096 | Ga0439460_0020898 | 3300042461 | Bacteria | 1784 |
| 1097 | Ga0451577_0052810 | 3300042876 | Unclassified | 3629 |
| 1098 | Ga0451577_0085446 | 3300042876 | Bacteria | 2815 |
| 1099 | Ga0451577_0280582 | 3300042876 | Bacteria | 1509 |
| 1100 | Ga0466972_0006816 | 3300044658 | Bacteria | 5733 |
| 1101 | Ga0453683_0065627 | 3300044673 | Bacteria | 2269 |
| 1102 | Ga0453683_0193185 | 3300044673 | Bacteria | 1292 |
| 1103 | Ga0466966_0037157 | 3300044684 | Bacteria | 3142 |
| 1104 | Ga0466963_0064225 | 3300044694 | Bacteria | 2459 |
| 1105 | Ga0466963_0152872 | 3300044694 | Bacteria | 1603 |
| 1106 | Ga0466963_0169693 | 3300044694 | Bacteria | 1521 |
| 1107 | Ga0453684_0000173 | 3300044712 | Bacteria | 285446 |
| 1108 | Ga0453684_0001703 | 3300044712 | Bacteria | 59231 |
| 1109 | Ga0453684_0007129 | 3300044712 | Bacteria | 20828 |
| 1110 | Ga0453684_0015989 | 3300044712 | Bacteria | 11792 |
| 1111 | Ga0453684_0080375 | 3300044712 | Bacteria | 4071 |
| 1112 | Ga0453684_0115462 | 3300044712 | Bacteria | 3253 |
| 1113 | Ga0453684_0166957 | 3300044712 | Bacteria | 2598 |
| 1114 | Ga0453684_0360157 | 3300044712 | Bacteria | 1638 |
| 1115 | Ga0466971_0051355 | 3300044719 | Bacteria | 1856 |
| 1116 | Ga0466968_0025832 | 3300044735 | Bacteria | 2407 |
| 1117 | Ga0466970_0013084 | 3300044765 | Bacteria | 4252 |
| 1118 | Ga0466970_0017062 | 3300044765 | Bacteria | 3749 |
| 1119 | Ga0466957_0039512 | 3300044842 | Bacteria | 2847 |
| 1120 | Ga0466957_0047436 | 3300044842 | Bacteria | 2610 |
| 1121 | Ga0466959_0009315 | 3300045049 | Bacteria | 6979 |
| 1122 | Ga0451576_0008442 | 3300045051 | Bacteria | 12094 |
| 1123 | Ga0451576_0008949 | 3300045051 | Bacteria | 11677 |
| 1124 | Ga0451576_0153042 | 3300045051 | Bacteria | 2405 |
| 1125 | Ga0451576_0165470 | 3300045051 | Bacteria | 2308 |
| 1126 | Ga0451576_0201454 | 3300045051 | Bacteria | 2079 |
| 1127 | Ga0466958_0009420 | 3300045836 | Bacteria | 5442 |
| 1128 | Ga0466958_0064423 | 3300045836 | Bacteria | 2235 |
| 1129 | Ga0466958_0099781 | 3300045836 | Bacteria | 1804 |
| 1130 | Ga0466958_0139498 | 3300045836 | Bacteria | 1525 |
| 1131 | Ga0466967_0005268 | 3300045976 | Bacteria | 8920 |
| 1132 | Ga0466967_0022309 | 3300045976 | Bacteria | 5163 |
| 1133 | Ga0466967_0091982 | 3300045976 | Bacteria | 2757 |
| 1134 | Ga0466967_0133259 | 3300045976 | Bacteria | 2309 |
| 1135 | Ga0466967_0163140 | 3300045976 | Bacteria | 2093 |
| 1136 | Ga0495603_0008241 | 3300046455 | Bacteria | 6298 |
| 1137 | Ga0495603_0013562 | 3300046455 | Bacteria | 4931 |
| 1138 | Ga0495629_0000523 | 3300046459 | Bacteria | 32051 |
| 1139 | Ga0495638_0000003 | 3300046460 | Bacteria | 888792 |
| 1140 | Ga0495653_0017324 | 3300046463 | Bacteria | 5860 |
| 1141 | Ga0495653_0093503 | 3300046463 | Bacteria | 2193 |
| 1142 | Ga0495580_0000346 | 3300046472 | Bacteria | 37864 |
| 1143 | Ga0495580_0073561 | 3300046472 | Bacteria | 2386 |
| 1144 | Ga0495580_0172151 | 3300046472 | Bacteria | 1497 |
| 1145 | Ga0495582_0008009 | 3300046473 | Bacteria | 5832 |
| 1146 | Ga0495582_0098518 | 3300046473 | Bacteria | 1636 |
| 1147 | Ga0495639_0008933 | 3300046475 | Bacteria | 4295 |
| 1148 | Ga0495594_0076126 | 3300046499 | Bacteria | 1871 |
| 1149 | Ga0495594_0201852 | 3300046499 | Bacteria | 1133 |
| 1150 | Ga0495608_0020626 | 3300046511 | Bacteria | 4528 |
| 1151 | Ga0495618_0235901 | 3300046514 | Bacteria | 1151 |
| 1152 | Ga0495628_0003293 | 3300046516 | Bacteria | 14451 |
| 1153 | Ga0495628_0011434 | 3300046516 | Bacteria | 7506 |
| 1154 | Ga0495628_0122326 | 3300046516 | Bacteria | 1995 |
| 1155 | Ga0495630_0009089 | 3300046517 | Bacteria | 7142 |
| 1156 | Ga0495630_0013143 | 3300046517 | Bacteria | 6019 |
| 1157 | Ga0495666_0121750 | 3300046526 | Bacteria | 1221 |
| 1158 | Ga0495665_0108169 | 3300046531 | Bacteria | 1459 |
| 1159 | Ga0495640_0018120 | 3300046533 | Bacteria | 5232 |
| 1160 | Ga0495640_0094151 | 3300046533 | Bacteria | 1973 |
| 1161 | Ga0495586_0168486 | 3300046535 | Bacteria | 1237 |
| 1162 | Ga0495587_0081896 | 3300046536 | Bacteria | 1870 |
| 1163 | Ga0495609_0033729 | 3300046538 | Bacteria | 2323 |
| 1164 | Ga0495621_0000799 | 3300046539 | Bacteria | 7962 |
| 1165 | Ga0495621_0001364 | 3300046539 | Bacteria | 6315 |
| 1166 | Ga0495621_0013561 | 3300046539 | Bacteria | 2564 |
| 1167 | Ga0495645_0000509 | 3300046543 | Bacteria | 26861 |
| 1168 | Ga0495667_0021852 | 3300046559 | Bacteria | 4314 |
| 1169 | Ga0495635_0132119 | 3300046663 | Bacteria | 1702 |
| 1170 | Ga0495659_0022356 | 3300046664 | Bacteria | 2139 |
| 1171 | Ga0495659_0024145 | 3300046664 | Bacteria | 2070 |
| 1172 | Ga0495588_0044414 | 3300046674 | Bacteria | 2276 |
| 1173 | Ga0495647_0030358 | 3300046681 | Bacteria | 2005 |
| 1174 | Ga0495658_0001090 | 3300046683 | Bacteria | 14314 |
| 1175 | Ga0495658_0034283 | 3300046683 | Bacteria | 2785 |
| 1176 | Ga0495658_0048533 | 3300046683 | Bacteria | 2394 |
| 1177 | Ga0495658_0219255 | 3300046683 | Bacteria | 1190 |
| 1178 | Ga0495669_0011838 | 3300046684 | Bacteria | 3709 |
| 1179 | Ga0495669_0108264 | 3300046684 | Bacteria | 1296 |
| 1180 | Ga0495613_0008520 | 3300046689 | Bacteria | 7612 |
| 1181 | Ga0495613_0124506 | 3300046689 | Bacteria | 1849 |
| 1182 | Ga0495613_0227618 | 3300046689 | Bacteria | 1307 |
| 1183 | Ga0495600_0098163 | 3300046809 | Bacteria | 1909 |
| 1184 | Ga0495581_0043855 | 3300047315 | Bacteria | 2586 |
| 1185 | Ga0495674_0021360 | 3300047319 | Bacteria | 5988 |
| 1186 | Ga0495674_0051535 | 3300047319 | Bacteria | 3628 |
| 1187 | Ga0495672_0000242 | 3300047320 | Bacteria | 76766 |
| 1188 | Ga0495672_0004208 | 3300047320 | Bacteria | 11921 |
| 1189 | Ga0495677_0044018 | 3300047445 | Bacteria | 1637 |
| 1190 | Ga0495684_0001676 | 3300047471 | Bacteria | 17798 |
| 1191 | Ga0495602_0136664 | 3300048088 | Bacteria | 1946 |
| 1192 | Ga0496101_0156636 | 3300048904 | Bacteria | 1745 |
| 1193 | Ga0496101_0236363 | 3300048904 | Bacteria | 1421 |
| 1194 | Ga0496102_0043243 | 3300048905 | Bacteria | 4084 |
| 1195 | Ga0496102_0072640 | 3300048905 | Bacteria | 3162 |
| 1196 | Ga0496102_0079705 | 3300048905 | Bacteria | 3016 |
| 1197 | Ga0496102_0093756 | 3300048905 | Bacteria | 2781 |
| 1198 | Ga0496102_0119680 | 3300048905 | Bacteria | 2459 |
| 1199 | Ga0496104_0003311 | 3300048907 | Bacteria | 13902 |
| 1200 | Ga0496104_0010031 | 3300048907 | Bacteria | 8455 |
| 1201 | Ga0496104_0020628 | 3300048907 | Bacteria | 6043 |
| 1202 | Ga0496104_0079682 | 3300048907 | Bacteria | 3122 |
| 1203 | Ga0496104_0243987 | 3300048907 | Bacteria | 1709 |
| 1204 | Ga0496105_0000513 | 3300048908 | Bacteria | 25567 |
| 1205 | Ga0496105_0092061 | 3300048908 | Bacteria | 2504 |
| 1206 | Ga0496105_0096560 | 3300048908 | Bacteria | 2441 |
| 1207 | Ga0496105_0161757 | 3300048908 | Bacteria | 1838 |
| 1208 | Ga0496106_0006809 | 3300048909 | Bacteria | 8459 |
| 1209 | Ga0496106_0029816 | 3300048909 | Bacteria | 4067 |
| 1210 | Ga0496106_0110583 | 3300048909 | Bacteria | 2139 |
| 1211 | Ga0496106_0159907 | 3300048909 | Bacteria | 1781 |
| 1212 | Ga0496107_0003244 | 3300048910 | Bacteria | 10823 |
| 1213 | Ga0496107_0082562 | 3300048910 | Bacteria | 2344 |
| 1214 | Ga0496108_0002685 | 3300048911 | Bacteria | 14243 |
| 1215 | Ga0496108_0005882 | 3300048911 | Bacteria | 9943 |
| 1216 | Ga0496108_0024891 | 3300048911 | Bacteria | 4930 |
| 1217 | Ga0496108_0074259 | 3300048911 | Bacteria | 2871 |
| 1218 | Ga0496108_0168024 | 3300048911 | Bacteria | 1897 |
| 1219 | Ga0496109_0001158 | 3300048912 | Bacteria | 21942 |
| 1220 | Ga0496109_0003151 | 3300048912 | Bacteria | 13754 |
| 1221 | Ga0496109_0030856 | 3300048912 | Bacteria | 4805 |
| 1222 | Ga0496109_0265194 | 3300048912 | Bacteria | 1618 |
| 1223 | Ga0496110_0006677 | 3300048913 | Bacteria | 9168 |
| 1224 | Ga0496110_0013256 | 3300048913 | Bacteria | 6807 |
| 1225 | Ga0496110_0017224 | 3300048913 | Bacteria | 6043 |
| 1226 | Ga0496110_0092227 | 3300048913 | Bacteria | 2710 |
| 1227 | Ga0496111_0006838 | 3300048914 | Bacteria | 7439 |
| 1228 | Ga0496111_0010934 | 3300048914 | Bacteria | 6105 |
| 1229 | Ga0496111_0076714 | 3300048914 | Bacteria | 2436 |
| 1230 | Ga0496111_0219971 | 3300048914 | Bacteria | 1411 |
| 1231 | Ga0496112_0001156 | 3300048915 | Bacteria | 19704 |
| 1232 | Ga0496112_0041108 | 3300048915 | Bacteria | 4523 |
| 1233 | Ga0496112_0088517 | 3300048915 | Bacteria | 3064 |
| 1234 | Ga0496112_0157512 | 3300048915 | Bacteria | 2238 |
| 1235 | Ga0496112_0194101 | 3300048915 | Bacteria | 1992 |
| 1236 | Ga0496112_0436367 | 3300048915 | Bacteria | 1248 |
| 1237 | Ga0496113_0008939 | 3300048916 | Bacteria | 6558 |
| 1238 | Ga0496113_0012915 | 3300048916 | Bacteria | 5633 |
| 1239 | Ga0496113_0021398 | 3300048916 | Bacteria | 4562 |
| 1240 | Ga0496113_0025915 | 3300048916 | Bacteria | 4187 |
| 1241 | Ga0496114_0005398 | 3300048917 | Bacteria | 9998 |
| 1242 | Ga0496114_0014629 | 3300048917 | Bacteria | 6303 |
| 1243 | Ga0496114_0080620 | 3300048917 | Bacteria | 2749 |
| 1244 | Ga0496114_0144195 | 3300048917 | Bacteria | 2064 |
| 1245 | Ga0496114_0174311 | 3300048917 | Bacteria | 1876 |
| 1246 | Ga0496114_0467976 | 3300048917 | Bacteria | 1116 |
| 1247 | Ga0496115_0001888 | 3300048918 | Bacteria | 14992 |
| 1248 | Ga0496115_0053909 | 3300048918 | Bacteria | 3229 |
| 1249 | Ga0496115_0056811 | 3300048918 | Bacteria | 3146 |
| 1250 | Ga0496117_0004173 | 3300048920 | Bacteria | 16158 |
| 1251 | Ga0496118_0000909 | 3300048921 | Bacteria | 46249 |
| 1252 | Ga0496121_0000025 | 3300048924 | Bacteria | 453467 |
| 1253 | Ga0496122_0002058 | 3300048925 | Bacteria | 29852 |
| 1254 | Ga0496122_0111496 | 3300048925 | Bacteria | 1794 |
| 1255 | Ga0496123_0006537 | 3300048926 | Bacteria | 11257 |
| 1256 | Ga0496123_0011752 | 3300048926 | Bacteria | 7543 |
| 1257 | Ga0496123_0121298 | 3300048926 | Bacteria | 1470 |
| 1258 | Ga0496124_0000639 | 3300048927 | Bacteria | 57891 |
| 1259 | Ga0496124_0132995 | 3300048927 | Bacteria | 1974 |
| 1260 | Ga0496124_0162442 | 3300048927 | Bacteria | 1739 |
| 1261 | Ga0496126_0027150 | 3300048929 | Bacteria | 5475 |
| 1262 | Ga0501300_001453 | 3300049523 | Bacteria | 3549 |
| 1263 | Ga0501323_004435 | 3300049539 | Bacteria | 1485 |
| 1264 | Ga0501325_001364 | 3300049541 | Bacteria | 1483 |
| 1265 | Ga0501031_0001166 | 3300049568 | Bacteria | 15986 |
| 1266 | Ga0501031_0016519 | 3300049568 | Bacteria | 4794 |
| 1267 | Ga0501031_0019548 | 3300049568 | Bacteria | 4413 |
| 1268 | Ga0501031_0087488 | 3300049568 | Bacteria | 2032 |
| 1269 | Ga0501032_0002307 | 3300049569 | Bacteria | 14975 |
| 1270 | Ga0501033_0000941 | 3300049570 | Bacteria | 26478 |
| 1271 | Ga0501033_0019917 | 3300049570 | Bacteria | 5071 |
| 1272 | Ga0501033_0063719 | 3300049570 | Bacteria | 2713 |
| 1273 | Ga0501033_0078188 | 3300049570 | Bacteria | 2428 |
| 1274 | Ga0501034_0002121 | 3300049571 | Bacteria | 24658 |
| 1275 | Ga0501034_0008189 | 3300049571 | Bacteria | 11084 |
| 1276 | Ga0501034_0164197 | 3300049571 | Bacteria | 2190 |
| 1277 | Ga0501034_0201836 | 3300049571 | Bacteria | 1946 |
| 1278 | Ga0501036_0000057 | 3300049572 | Bacteria | 72542 |
| 1279 | Ga0501036_0001775 | 3300049572 | Bacteria | 16746 |
| 1280 | Ga0501036_0022956 | 3300049572 | Bacteria | 5253 |
| 1281 | Ga0501036_0051933 | 3300049572 | Bacteria | 3472 |
| 1282 | Ga0501036_0103190 | 3300049572 | Bacteria | 2412 |
| 1283 | Ga0501036_0137854 | 3300049572 | Bacteria | 2059 |
| 1284 | Ga0501037_0001310 | 3300049573 | Bacteria | 18313 |
| 1285 | Ga0501037_0009021 | 3300049573 | Bacteria | 7309 |
| 1286 | Ga0501037_0030509 | 3300049573 | Bacteria | 3984 |
| 1287 | Ga0501038_0000391 | 3300049574 | Bacteria | 37957 |
| 1288 | Ga0501038_0027841 | 3300049574 | Bacteria | 5022 |
| 1289 | Ga0501038_0086524 | 3300049574 | Bacteria | 2633 |
| 1290 | Ga0501038_0134033 | 3300049574 | Bacteria | 2031 |
| 1291 | Ga0501039_0000309 | 3300049575 | Bacteria | 34600 |
| 1292 | Ga0501039_0013387 | 3300049575 | Bacteria | 6270 |
| 1293 | Ga0501039_0021253 | 3300049575 | Bacteria | 4980 |
| 1294 | Ga0501039_0028801 | 3300049575 | Bacteria | 4277 |
| 1295 | Ga0501039_0043221 | 3300049575 | Bacteria | 3481 |
| 1296 | Ga0501039_0114050 | 3300049575 | Bacteria | 2114 |
| 1297 | Ga0501039_0206551 | 3300049575 | Bacteria | 1544 |
| 1298 | Ga0501040_0004086 | 3300049576 | Bacteria | 9486 |
| 1299 | Ga0501040_0009350 | 3300049576 | Bacteria | 6386 |
| 1300 | Ga0501040_0016992 | 3300049576 | Bacteria | 4824 |
| 1301 | Ga0501040_0020914 | 3300049576 | Bacteria | 4363 |
| 1302 | Ga0501040_0021385 | 3300049576 | Bacteria | 4320 |
| 1303 | Ga0501040_0033917 | 3300049576 | Bacteria | 3459 |
| 1304 | Ga0501040_0166529 | 3300049576 | Bacteria | 1560 |
| 1305 | Ga0501040_0176649 | 3300049576 | Bacteria | 1513 |
| 1306 | Ga0501041_0002498 | 3300049577 | Bacteria | 10468 |
| 1307 | Ga0501041_0014933 | 3300049577 | Bacteria | 4612 |
| 1308 | Ga0501041_0018696 | 3300049577 | Bacteria | 4127 |
| 1309 | Ga0501041_0123376 | 3300049577 | Bacteria | 1611 |
| 1310 | Ga0501041_0126730 | 3300049577 | Bacteria | 1590 |
| 1311 | Ga0501042_0002039 | 3300049578 | Bacteria | 12242 |
| 1312 | Ga0501042_0003181 | 3300049578 | Bacteria | 10244 |
| 1313 | Ga0501042_0011677 | 3300049578 | Bacteria | 5934 |
| 1314 | Ga0501042_0050630 | 3300049578 | Bacteria | 2962 |
| 1315 | Ga0501042_0058483 | 3300049578 | Bacteria | 2752 |
| 1316 | Ga0501042_0092036 | 3300049578 | Bacteria | 2177 |
| 1317 | Ga0501042_0099901 | 3300049578 | Bacteria | 2086 |
| 1318 | Ga0501042_0104152 | 3300049578 | Bacteria | 2041 |
| 1319 | Ga0501042_0241435 | 3300049578 | Bacteria | 1303 |
| 1320 | Ga0501043_0000111 | 3300049579 | Bacteria | 76773 |
| 1321 | Ga0501043_0043834 | 3300049579 | Bacteria | 3517 |
| 1322 | Ga0501043_0118797 | 3300049579 | Bacteria | 2073 |
| 1323 | Ga0501046_0000307 | 3300049580 | Bacteria | 49550 |
| 1324 | Ga0501046_0014958 | 3300049580 | Bacteria | 6529 |
| 1325 | Ga0501046_0114077 | 3300049580 | Bacteria | 2062 |
| 1326 | Ga0501046_0125431 | 3300049580 | Bacteria | 1951 |
| 1327 | Ga0501047_0000289 | 3300049581 | Bacteria | 57793 |
| 1328 | Ga0501047_0002400 | 3300049581 | Bacteria | 17896 |
| 1329 | Ga0501048_0000298 | 3300049582 | Bacteria | 33825 |
| 1330 | Ga0501048_0005925 | 3300049582 | Bacteria | 9304 |
| 1331 | Ga0501048_0016854 | 3300049582 | Bacteria | 5386 |
| 1332 | Ga0501048_0022284 | 3300049582 | Bacteria | 4635 |
| 1333 | Ga0501048_0165633 | 3300049582 | Bacteria | 1565 |
| 1334 | Ga0501067_0000065 | 3300049583 | Bacteria | 59946 |
| 1335 | Ga0501067_0013273 | 3300049583 | Bacteria | 4562 |
| 1336 | Ga0501067_0016818 | 3300049583 | Bacteria | 4040 |
| 1337 | Ga0501067_0020205 | 3300049583 | Bacteria | 3684 |
| 1338 | Ga0501067_0036773 | 3300049583 | Bacteria | 2718 |
| 1339 | Ga0501067_0146587 | 3300049583 | Bacteria | 1315 |
| 1340 | Ga0501068_0000099 | 3300049584 | Bacteria | 37456 |
| 1341 | Ga0501068_0039468 | 3300049584 | Bacteria | 2831 |
| 1342 | Ga0501068_0043827 | 3300049584 | Bacteria | 2692 |
| 1343 | Ga0501068_0054740 | 3300049584 | Bacteria | 2417 |
| 1344 | Ga0501068_0068423 | 3300049584 | Bacteria | 2164 |
| 1345 | Ga0501068_0103014 | 3300049584 | Bacteria | 1770 |
| 1346 | Ga0501069_0001404 | 3300049585 | Bacteria | 11809 |
| 1347 | Ga0501069_0006770 | 3300049585 | Bacteria | 6001 |
| 1348 | Ga0501069_0046809 | 3300049585 | Bacteria | 2400 |
| 1349 | Ga0501070_0001132 | 3300049586 | Bacteria | 23911 |
| 1350 | Ga0501070_0016772 | 3300049586 | Bacteria | 6148 |
| 1351 | Ga0501070_0024597 | 3300049586 | Bacteria | 5050 |
| 1352 | Ga0501070_0073617 | 3300049586 | Bacteria | 2826 |
| 1353 | Ga0501070_0146802 | 3300049586 | Bacteria | 1947 |
| 1354 | Ga0501071_0000488 | 3300049587 | Bacteria | 20060 |
| 1355 | Ga0501071_0003854 | 3300049587 | Bacteria | 9442 |
| 1356 | Ga0501071_0005549 | 3300049587 | Bacteria | 8126 |
| 1357 | Ga0501071_0019597 | 3300049587 | Bacteria | 4695 |
| 1358 | Ga0501071_0020005 | 3300049587 | Bacteria | 4650 |
| 1359 | Ga0501071_0025545 | 3300049587 | Bacteria | 4139 |
| 1360 | Ga0501071_0039050 | 3300049587 | Bacteria | 3395 |
| 1361 | Ga0501071_0048161 | 3300049587 | Bacteria | 3064 |
| 1362 | Ga0501071_0075934 | 3300049587 | Bacteria | 2453 |
| 1363 | Ga0501071_0116344 | 3300049587 | Bacteria | 1979 |
| 1364 | Ga0501071_0184437 | 3300049587 | Bacteria | 1564 |
| 1365 | Ga0501072_0004844 | 3300049588 | Bacteria | 10248 |
| 1366 | Ga0501072_0009359 | 3300049588 | Bacteria | 7448 |
| 1367 | Ga0501072_0009420 | 3300049588 | Bacteria | 7425 |
| 1368 | Ga0501072_0013185 | 3300049588 | Bacteria | 6329 |
| 1369 | Ga0501072_0017150 | 3300049588 | Bacteria | 5564 |
| 1370 | Ga0501072_0029963 | 3300049588 | Bacteria | 4252 |
| 1371 | Ga0501072_0031779 | 3300049588 | Bacteria | 4133 |
| 1372 | Ga0501072_0032367 | 3300049588 | Bacteria | 4095 |
| 1373 | Ga0501072_0061470 | 3300049588 | Bacteria | 2963 |
| 1374 | Ga0501072_0071964 | 3300049588 | Bacteria | 2732 |
| 1375 | Ga0501072_0105608 | 3300049588 | Bacteria | 2239 |
| 1376 | Ga0501072_0303699 | 3300049588 | Bacteria | 1269 |
| 1377 | Ga0501073_0007238 | 3300049589 | Bacteria | 8263 |
| 1378 | Ga0501073_0013683 | 3300049589 | Bacteria | 5903 |
| 1379 | Ga0501073_0015002 | 3300049589 | Bacteria | 5621 |
| 1380 | Ga0501073_0126313 | 3300049589 | Bacteria | 1773 |
| 1381 | Ga0501073_0214598 | 3300049589 | Bacteria | 1330 |
| 1382 | Ga0501074_0000074 | 3300049590 | Bacteria | 48322 |
| 1383 | Ga0501074_0019499 | 3300049590 | Bacteria | 4925 |
| 1384 | Ga0501074_0058553 | 3300049590 | Bacteria | 2776 |
| 1385 | Ga0501074_0088881 | 3300049590 | Bacteria | 2212 |
| 1386 | Ga0501074_0106746 | 3300049590 | Bacteria | 2005 |
| 1387 | Ga0501075_0003648 | 3300049591 | Bacteria | 10323 |
| 1388 | Ga0501075_0018685 | 3300049591 | Bacteria | 5019 |
| 1389 | Ga0501075_0025444 | 3300049591 | Bacteria | 4348 |
| 1390 | Ga0501075_0040497 | 3300049591 | Bacteria | 3489 |
| 1391 | Ga0501075_0041989 | 3300049591 | Bacteria | 3429 |
| 1392 | Ga0501075_0073297 | 3300049591 | Bacteria | 2589 |
| 1393 | Ga0501075_0098365 | 3300049591 | Bacteria | 2221 |
| 1394 | Ga0501075_0233080 | 3300049591 | Bacteria | 1404 |
| 1395 | Ga0501076_0002631 | 3300049592 | Bacteria | 12381 |
| 1396 | Ga0501076_0007851 | 3300049592 | Bacteria | 7775 |
| 1397 | Ga0501076_0011199 | 3300049592 | Bacteria | 6676 |
| 1398 | Ga0501076_0011969 | 3300049592 | Bacteria | 6481 |
| 1399 | Ga0501076_0041077 | 3300049592 | Bacteria | 3637 |
| 1400 | Ga0501076_0105052 | 3300049592 | Bacteria | 2279 |
| 1401 | Ga0501076_0200901 | 3300049592 | Bacteria | 1628 |
| 1402 | Ga0501076_0257598 | 3300049592 | Bacteria | 1428 |
| 1403 | Ga0501077_0016934 | 3300049593 | Bacteria | 4597 |
| 1404 | Ga0501077_0062494 | 3300049593 | Bacteria | 2363 |
| 1405 | Ga0501077_0100103 | 3300049593 | Bacteria | 1837 |
| 1406 | Ga0501077_0176385 | 3300049593 | Bacteria | 1358 |
| 1407 | Ga0501221_014438 | 3300049704 | Bacteria | 1468 |
| 1408 | Ga0501079_0005025 | 3300049741 | Bacteria | 9816 |
| 1409 | Ga0501079_0018044 | 3300049741 | Bacteria | 5389 |
| 1410 | Ga0501079_0024592 | 3300049741 | Bacteria | 4622 |
| 1411 | Ga0501079_0047886 | 3300049741 | Bacteria | 3299 |
| 1412 | Ga0501079_0061460 | 3300049741 | Bacteria | 2898 |
| 1413 | Ga0501079_0100333 | 3300049741 | Bacteria | 2244 |
| 1414 | Ga0501079_0106723 | 3300049741 | Bacteria | 2173 |
| 1415 | Ga0501079_0107212 | 3300049741 | Bacteria | 2169 |
| 1416 | Ga0501079_0170704 | 3300049741 | Bacteria | 1696 |
| 1417 | Ga0501080_0000244 | 3300049742 | Bacteria | 40757 |
| 1418 | Ga0501080_0000414 | 3300049742 | Bacteria | 32763 |
| 1419 | Ga0501080_0070329 | 3300049742 | Bacteria | 3255 |
| 1420 | Ga0501080_0096840 | 3300049742 | Bacteria | 2740 |
| 1421 | Ga0501080_0104895 | 3300049742 | Bacteria | 2621 |
| 1422 | Ga0501080_0161284 | 3300049742 | Bacteria | 2071 |
| 1423 | Ga0501081_0000754 | 3300049743 | Bacteria | 18935 |
| 1424 | Ga0501081_0008776 | 3300049743 | Bacteria | 6570 |
| 1425 | Ga0501081_0011798 | 3300049743 | Bacteria | 5724 |
| 1426 | Ga0501081_0090290 | 3300049743 | Bacteria | 2153 |
| 1427 | Ga0501081_0138662 | 3300049743 | Bacteria | 1742 |
| 1428 | Ga0501081_0142686 | 3300049743 | Bacteria | 1717 |
| 1429 | Ga0501081_0195964 | 3300049743 | Bacteria | 1464 |
| 1430 | Ga0501083_0019965 | 3300049744 | Bacteria | 4663 |
| 1431 | Ga0501083_0036872 | 3300049744 | Bacteria | 3332 |
| 1432 | Ga0501083_0192587 | 3300049744 | Bacteria | 1331 |
| 1433 | Ga0501264_000063 | 3300049761 | Bacteria | 15044 |
| 1434 | Ga0501035_0000262 | 3300049822 | Bacteria | 62472 |
| 1435 | Ga0501035_0013824 | 3300049822 | Bacteria | 7450 |
| 1436 | Ga0501035_0108437 | 3300049822 | Bacteria | 2435 |
| 1437 | Ga0501044_0000312 | 3300049823 | Bacteria | 61322 |
| 1438 | Ga0501045_0003035 | 3300049824 | Bacteria | 11480 |
| 1439 | Ga0501045_0003799 | 3300049824 | Bacteria | 10386 |
| 1440 | Ga0501045_0011531 | 3300049824 | Bacteria | 6208 |
| 1441 | Ga0501045_0017723 | 3300049824 | Bacteria | 5057 |
| 1442 | Ga0501045_0025444 | 3300049824 | Bacteria | 4254 |
| 1443 | Ga0501045_0034416 | 3300049824 | Bacteria | 3677 |
| 1444 | Ga0501045_0074245 | 3300049824 | Bacteria | 2504 |
| 1445 | Ga0501045_0082011 | 3300049824 | Bacteria | 2378 |
| 1446 | Ga0501045_0147944 | 3300049824 | Bacteria | 1747 |
| 1447 | nmdc:mga03n38_31977_c1 | 3300050490 | Bacteria | 2225 |
| 1448 | nmdc:mga00v17_102676_c1 | 3300050491 | Bacteria | 1806 |
| 1449 | nmdc:mga00v17_105147_c1 | 3300050491 | Bacteria | 1786 |
| 1450 | nmdc:mga0yw44_12118_c1 | 3300050492 | Bacteria | 4482 |
| 1451 | nmdc:mga0yw44_148377_c1 | 3300050492 | Bacteria | 1528 |
| 1452 | nmdc:mga0yw44_18976_c1 | 3300050492 | Bacteria | 3355 |
| 1453 | nmdc:mga0yw44_52124_c1 | 3300050492 | Bacteria | 2480 |
| 1454 | nmdc:mga0yw44_64894_c1 | 3300050492 | Bacteria | 2248 |
| 1455 | nmdc:mga0k408_24679_c1 | 3300050493 | Bacteria | 3400 |
| 1456 | nmdc:mga0k408_76416_c1 | 3300050493 | Bacteria | 1957 |
| 1457 | nmdc:mga06z11_50726_c1 | 3300050494 | Bacteria | 2122 |
| 1458 | nmdc:mga06z11_98093_c1 | 3300050494 | Bacteria | 1603 |
| 1459 | nmdc:mga07m45_24539_c1 | 3300050496 | Bacteria | 3305 |
| 1460 | nmdc:mga07m45_25794_c1 | 3300050496 | Bacteria | 3227 |
| 1461 | nmdc:mga05p37_10188_c1 | 3300050507 | Bacteria | 11159 |
| 1462 | nmdc:mga05p37_115999_c1 | 3300050507 | Bacteria | 3291 |
| 1463 | nmdc:mga05p37_123154_c1 | 3300050507 | Bacteria | 3185 |
| 1464 | nmdc:mga05p37_12946_c1 | 3300050507 | Bacteria | 9978 |
| 1465 | nmdc:mga05p37_13104_c1 | 3300050507 | Bacteria | 9923 |
| 1466 | nmdc:mga05p37_13976_c1 | 3300050507 | Bacteria | 9626 |
| 1467 | nmdc:mga05p37_147215_c1 | 3300050507 | Bacteria | 2882 |
| 1468 | nmdc:mga05p37_156577_c1 | 3300050507 | Bacteria | 2784 |
| 1469 | nmdc:mga05p37_16959_c1 | 3300050507 | Bacteria | 8785 |
| 1470 | nmdc:mga05p37_275_c1 | 3300050507 | Bacteria | 53593 |
| 1471 | nmdc:mga05p37_3361_c1 | 3300050507 | Bacteria | 18671 |
| 1472 | nmdc:mga05p37_441566_c1 | 3300050507 | Bacteria | 1509 |
| 1473 | nmdc:mga05p37_444686_c1 | 3300050507 | Bacteria | 1502 |
| 1474 | nmdc:mga05p37_45778_c1 | 3300050507 | Bacteria | 5380 |
| 1475 | nmdc:mga05p37_482297_c1 | 3300050507 | Bacteria | 1428 |
| 1476 | nmdc:mga05p37_6361_c1 | 3300050507 | Bacteria | 13918 |
| 1477 | nmdc:mga05p37_63640_c1 | 3300050507 | Bacteria | 4539 |
| 1478 | nmdc:mga05p37_65409_c1 | 3300050507 | Bacteria | 4474 |
| 1479 | nmdc:mga09592_12832_c1 | 3300050508 | Bacteria | 6831 |
| 1480 | nmdc:mga09592_137332_c1 | 3300050508 | Bacteria | 2106 |
| 1481 | nmdc:mga09592_182953_c1 | 3300050508 | Bacteria | 1813 |
| 1482 | nmdc:mga09592_183003_c1 | 3300050508 | Bacteria | 1813 |
| 1483 | nmdc:mga09592_252817_c1 | 3300050508 | Bacteria | 1528 |
| 1484 | nmdc:mga09592_302676_c1 | 3300050508 | Bacteria | 1386 |
| 1485 | nmdc:mga09592_5612_c1 | 3300050508 | Bacteria | 10225 |
| 1486 | nmdc:mga09592_65081_c1 | 3300050508 | Bacteria | 3087 |
| 1487 | nmdc:mga09592_67270_c1 | 3300050508 | Bacteria | 3038 |
| 1488 | nmdc:mga09592_70846_c1 | 3300050508 | Bacteria | 2959 |
| 1489 | nmdc:mga09592_953_c1 | 3300050508 | Bacteria | 22761 |
| 1490 | nmdc:mga09592_96657_c1 | 3300050508 | Bacteria | 2527 |
| 1491 | nmdc:mga0qj67_13711_c1 | 3300050509 | Bacteria | 6117 |
| 1492 | nmdc:mga0qj67_21101_c1 | 3300050509 | Bacteria | 4995 |
| 1493 | nmdc:mga0qj67_24595_c1 | 3300050509 | Bacteria | 4644 |
| 1494 | nmdc:mga0qj67_245972_c1 | 3300050509 | Bacteria | 1451 |
| 1495 | nmdc:mga0qj67_2517_c1 | 3300050509 | Bacteria | 13091 |
| 1496 | nmdc:mga0qj67_2598_c1 | 3300050509 | Bacteria | 12929 |
| 1497 | nmdc:mga0qj67_75052_c1 | 3300050509 | Bacteria | 2702 |
| 1498 | nmdc:mga0qj67_95202_c1 | 3300050509 | Bacteria | 2396 |
| 1499 | nmdc:mga06r32_10914_c1 | 3300050510 | Bacteria | 8179 |
| 1500 | nmdc:mga06r32_113653_c1 | 3300050510 | Bacteria | 2665 |
| 1501 | nmdc:mga06r32_113980_c1 | 3300050510 | Bacteria | 2661 |
| 1502 | nmdc:mga06r32_14263_c1 | 3300050510 | Bacteria | 7208 |
| 1503 | nmdc:mga06r32_14472_c1 | 3300050510 | Bacteria | 7159 |
| 1504 | nmdc:mga06r32_15782_c1 | 3300050510 | Bacteria | 6866 |
| 1505 | nmdc:mga06r32_220850_c1 | 3300050510 | Bacteria | 1883 |
| 1506 | nmdc:mga06r32_4670_c1 | 3300050510 | Bacteria | 12295 |
| 1507 | nmdc:mga06r32_46937_c1 | 3300050510 | Bacteria | 4124 |
| 1508 | nmdc:mga06r32_48535_c1 | 3300050510 | Bacteria | 4058 |
| 1509 | nmdc:mga06r32_52312_c1 | 3300050510 | Bacteria | 3911 |
| 1510 | nmdc:mga06r32_66280_c1 | 3300050510 | Bacteria | 3484 |
| 1511 | nmdc:mga06r32_66410_c1 | 3300050510 | Bacteria | 3481 |
| 1512 | nmdc:mga06r32_6887_c1 | 3300050510 | Bacteria | 10217 |
| 1513 | nmdc:mga06r32_7657_c1 | 3300050510 | Bacteria | 9712 |
| 1514 | nmdc:mga08y16_103170_c1 | 3300050511 | Bacteria | 2969 |
| 1515 | nmdc:mga08y16_11284_c1 | 3300050511 | Bacteria | 9388 |
| 1516 | nmdc:mga08y16_185985_c1 | 3300050511 | Bacteria | 2156 |
| 1517 | nmdc:mga08y16_269854_c1 | 3300050511 | Bacteria | 1757 |
| 1518 | nmdc:mga08y16_2708_c1 | 3300050511 | Bacteria | 18180 |
| 1519 | nmdc:mga08y16_273965_c1 | 3300050511 | Bacteria | 1742 |
| 1520 | nmdc:mga08y16_282487_c1 | 3300050511 | Bacteria | 1712 |
| 1521 | nmdc:mga08y16_28869_c1 | 3300050511 | Bacteria | 5848 |
| 1522 | nmdc:mga08y16_32443_c1 | 3300050511 | Bacteria | 5490 |
| 1523 | nmdc:mga08y16_3393_c1 | 3300050511 | Bacteria | 16521 |
| 1524 | nmdc:mga08y16_46864_c1 | 3300050511 | Bacteria | 4525 |
| 1525 | nmdc:mga08y16_504_c1 | 3300050511 | Bacteria | 36040 |
| 1526 | nmdc:mga08y16_6332_c1 | 3300050511 | Bacteria | 12414 |
| 1527 | nmdc:mga08y16_8405_c1 | 3300050511 | Bacteria | 10802 |
| 1528 | nmdc:mga0n895_10806_c1 | 3300050512 | Bacteria | 8100 |
| 1529 | nmdc:mga0n895_118817_c1 | 3300050512 | Bacteria | 2664 |
| 1530 | nmdc:mga0n895_11991_c1 | 3300050512 | Bacteria | 7756 |
| 1531 | nmdc:mga0n895_130462_c1 | 3300050512 | Bacteria | 2538 |
| 1532 | nmdc:mga0n895_18517_c1 | 3300050512 | Bacteria | 6446 |
| 1533 | nmdc:mga0n895_20427_c1 | 3300050512 | Bacteria | 6178 |
| 1534 | nmdc:mga0n895_2106_c1 | 3300050512 | Bacteria | 15347 |
| 1535 | nmdc:mga0n895_28190_c1 | 3300050512 | Bacteria | 5342 |
| 1536 | nmdc:mga0n895_50397_c1 | 3300050512 | Bacteria | 4082 |
| 1537 | nmdc:mga0n895_5966_c1 | 3300050512 | Bacteria | 10256 |
| 1538 | nmdc:mga0n895_62888_c1 | 3300050512 | Bacteria | 3669 |
| 1539 | nmdc:mga0n895_78707_c1 | 3300050512 | Bacteria | 3281 |
| 1540 | nmdc:mga0n895_829_c1 | 3300050512 | Bacteria | 22161 |
| 1541 | nmdc:mga0rr50_145299_c1 | 3300050513 | Bacteria | 1912 |
| 1542 | nmdc:mga0rr50_151407_c1 | 3300050513 | Bacteria | 1875 |
| 1543 | nmdc:mga0rr50_167056_c1 | 3300050513 | Bacteria | 1790 |
| 1544 | nmdc:mga0rr50_32236_c1 | 3300050513 | Bacteria | 3732 |
| 1545 | nmdc:mga0rr50_354_c1 | 3300050513 | Bacteria | 24902 |
| 1546 | nmdc:mga0rr50_7956_c1 | 3300050513 | Bacteria | 6579 |
| 1547 | nmdc:mga0rr50_80461_c1 | 3300050513 | Bacteria | 2512 |
| 1548 | nmdc:mga08x19_2446_c1 | 3300050514 | Bacteria | 11284 |
| 1549 | nmdc:mga0a205_1093_c1 | 3300050515 | Bacteria | 22518 |
| 1550 | nmdc:mga0a205_140551_c1 | 3300050515 | Bacteria | 2315 |
| 1551 | nmdc:mga0a205_141186_c1 | 3300050515 | Bacteria | 2309 |
| 1552 | nmdc:mga0a205_14504_c1 | 3300050515 | Bacteria | 7352 |
| 1553 | nmdc:mga0a205_146419_c1 | 3300050515 | Bacteria | 2262 |
| 1554 | nmdc:mga0a205_18128_c1 | 3300050515 | Bacteria | 6614 |
| 1555 | nmdc:mga0a205_2072_c1 | 3300050515 | Bacteria | 17539 |
| 1556 | nmdc:mga0a205_3147_c1 | 3300050515 | Bacteria | 14638 |
| 1557 | nmdc:mga0a205_38110_c1 | 3300050515 | Bacteria | 4624 |
| 1558 | nmdc:mga0a205_72728_c1 | 3300050515 | Bacteria | 3322 |
| 1559 | nmdc:mga0a205_74669_c1 | 3300050515 | Bacteria | 2099 |
| 1560 | Ga0495601_0006657 | 3300053077 | Bacteria | 6763 |
| 1561 | Ga0495595_0006010 | 3300053084 | Bacteria | 4931 |
| 1562 | Ga0495619_0003726 | 3300053085 | Bacteria | 9825 |
| 1563 | Ga0495619_0011460 | 3300053085 | Bacteria | 5587 |
| 1564 | Ga0495619_0074185 | 3300053085 | Bacteria | 2281 |
| 1565 | Ga0495619_0081543 | 3300053085 | Bacteria | 2178 |
| 1566 | Ga0495619_0088962 | 3300053085 | Bacteria | 2089 |
| 1567 | Ga0500643_000913 | 3300053087 | Bacteria | 18624 |
| 1568 | Ga0500644_0000106 | 3300053088 | Bacteria | 52751 |
| 1569 | Ga0500641_0002700 | 3300053096 | Bacteria | 6267 |
| 1570 | Ga0500556_0000001 | 3300053104 | Bacteria | 1135060 |
| 1571 | Ga0500568_0000003 | 3300053139 | Bacteria | 863587 |
| 1572 | Ga0500568_0032010 | 3300053139 | Bacteria | 2164 |
| 1573 | Ga0500604_0002802 | 3300053151 | Bacteria | 4732 |
| 1574 | Ga0500616_0000007 | 3300053153 | Bacteria | 836875 |
| 1575 | Ga0500616_0000205 | 3300053153 | Bacteria | 96713 |
| 1576 | Ga0500616_0037765 | 3300053153 | Bacteria | 2613 |
| 1577 | Ga0500622_0000066 | 3300053156 | Bacteria | 124842 |
| 1578 | Ga0500622_0000179 | 3300053156 | Bacteria | 68943 |
| 1579 | Ga0500622_0001539 | 3300053156 | Bacteria | 18262 |
| 1580 | Ga0500645_001172 | 3300053730 | Bacteria | 14012 |
| 1581 | Ga0501084_0001637 | 3300054114 | Bacteria | 17781 |
| 1582 | Ga0501084_0006547 | 3300054114 | Bacteria | 9576 |
| 1583 | Ga0501084_0023342 | 3300054114 | Bacteria | 5163 |
| 1584 | Ga0501084_0023478 | 3300054114 | Bacteria | 5145 |
| 1585 | Ga0501084_0026974 | 3300054114 | Bacteria | 4799 |
| 1586 | Ga0501084_0043651 | 3300054114 | Bacteria | 3750 |
| 1587 | Ga0501084_0053078 | 3300054114 | Bacteria | 3390 |
| 1588 | Ga0501084_0066241 | 3300054114 | Bacteria | 3022 |
| 1589 | Ga0501084_0135199 | 3300054114 | Bacteria | 2076 |
| 1590 | Ga0501084_0167806 | 3300054114 | Bacteria | 1853 |
| 1591 | Ga0501084_0282519 | 3300054114 | Bacteria | 1402 |
| 1592 | Ga0590071_014634 | 3300059421 | Bacteria | 1840 |
| 1593 | Ga0590075_000348 | 3300059424 | Bacteria | 12914 |
| 1594 | Ga0590075_000928 | 3300059424 | Bacteria | 7624 |
| 1595 | Ga0590077_000323 | 3300059426 | Bacteria | 13559 |
| 1596 | Ga0590077_003620 | 3300059426 | Bacteria | 3192 |
| 1597 | Ga0501082_0002453 | 3300060353 | Bacteria | 16280 |
| 1598 | Ga0501082_0007432 | 3300060353 | Bacteria | 9454 |
| 1599 | Ga0501082_0012030 | 3300060353 | Bacteria | 7439 |
| 1600 | Ga0501082_0022921 | 3300060353 | Bacteria | 5380 |
| 1601 | Ga0501082_0038929 | 3300060353 | Bacteria | 4101 |
| 1602 | Ga0501082_0063921 | 3300060353 | Bacteria | 3169 |
| 1603 | Ga0501082_0073646 | 3300060353 | Bacteria | 2942 |
| 1604 | Ga0501082_0107841 | 3300060353 | Bacteria | 2410 |
| 1605 | Ga0466962_0006259 | 3300061719 | Bacteria | 5719 |
| 1606 | Ga0530510_0002726 | 3300061734 | Bacteria | 12164 |
| 1607 | Ga0530510_0017917 | 3300061734 | Bacteria | 5021 |
| 1608 | Ga0530510_0022875 | 3300061734 | Bacteria | 4454 |
| 1609 | Ga0530510_0027284 | 3300061734 | Bacteria | 4092 |
| 1610 | Ga0530510_0029713 | 3300061734 | Bacteria | 3923 |
| 1611 | Ga0530510_0034058 | 3300061734 | Bacteria | 3668 |
| 1612 | Ga0530510_0041103 | 3300061734 | Bacteria | 3338 |
| 1613 | Ga0530510_0078292 | 3300061734 | Bacteria | 2403 |
| 1614 | 2644131281 | 2643221623 | Bacteria | 5239945 |
| 1615 | 2739310205 | 2738543024 | Bacteria | 5603683 |
| 1616 | 2753302454 | 2751185788 | Bacteria | 4541048 |
| 1617 | 2844856075 | 2844852863 | Bacteria | 3849151 |
| 1618 | 2852646055 | 2852643534 | Bacteria | 3013378 |
| 1619 | 2857734016 | 2857733635 | Bacteria | 3532004 |
| 1620 | 2895661688 | 2895660088 | Bacteria | 3782833 |
| 1621 | 2904432919 | 2904430863 | Bacteria | 3486923 |
| 1622 | 2904503372 | 2904501621 | Bacteria | 3401437 |
| 1623 | 2908675451 | 2908674828 | Bacteria | 3382763 |
| 1624 | 2909074507 | 2909074476 | Bacteria | 3436050 |
| 1625 | 2919041481 | 2919039151 | Bacteria | 3391018 |
| 1626 | 2919045610 | 2919042368 | Bacteria | 3905917 |
| 1627 | 2928107441 | 2928104781 | Bacteria | 3877447 |
| 1628 | 2928500436 | 2928500415 | Bacteria | 3384541 |
| 1629 | 2984554623 | 2984551494 | Bacteria | 3877562 |
| 1630 | 8002290462 | 8002285264 | Bacteria | 6717907 |
| 1631 | 8056056240 | 8056054917 | Bacteria | 5736694 |
| 1632 | Ga0501040_0015481 | |||
| 1633 | JGI24744J21845_10015159 | |||
| 1634 | JGI25406J46586_10001453 | |||
| 1635 | JGI25406J46586_10002115 | |||
| 1636 | JGI25406J46586_10003867 | |||
| 1637 | JGI25406J46586_10020800 | |||
| 1638 | rootH1_10003792 | |||
| 1639 | rootH1_10015730 | |||
| 1640 | rootH1_10130565 | |||
| 1641 | rootH2_10029474 | |||
| 1642 | rootH2_10077888 | |||
| 1643 | rootH2_10246637 | |||
| 1644 | rootL2_10072383 | |||
| 1645 | rootL2_10147111 | |||
| 1646 | rootL2_10218153 | |||
| 1647 | rootH1_10000715 | |||
| 1648 | rootH1_10017154 | |||
| 1649 | rootH1_10038814 | |||
| 1650 | rootH1_10052808 | |||
| 1651 | rootH1_10072353 | |||
| 1652 | rootH1_10074058 | |||
| 1653 | rootH1_10271435 | |||
| 1654 | rootH1_10309830 | |||
| 1655 | JGI25407J50210_10001911 | |||
| 1656 | Ga0055531_10000197 | |||
| 1657 | Ga0065704_10090251 | |||
| 1658 | Ga0065712_10000291 | |||
| 1659 | Ga0065712_10004042 | |||
| 1660 | Ga0065712_10069922 | |||
| 1661 | Ga0065715_10007485 | |||
| 1662 | Ga0065715_10088927 | |||
| 1663 | Ga0065715_10093813 | |||
| 1664 | Ga0065715_10115116 | |||
| 1665 | Ga0065707_10002597 | |||
| 1666 | Ga0065707_10095335 | |||
| 1667 | Ga0065707_10137250 | |||
| 1668 | Ga0070658_10004558 | |||
| 1669 | Ga0070658_10021319 | |||
| 1670 | Ga0070658_10047664 | |||
| 1671 | Ga0070658_10063213 | |||
| 1672 | Ga0070676_10001001 | |||
| 1673 | Ga0070676_10004892 | |||
| 1674 | Ga0070683_100014524 | |||
| 1675 | Ga0070683_100066029 | |||
| 1676 | Ga0070683_100072617 | |||
| 1677 | Ga0070683_100080888 | |||
| 1678 | Ga0070690_100020399 | |||
| 1679 | Ga0070690_100046269 | |||
| 1680 | Ga0070690_100082498 | |||
| 1681 | Ga0070690_100115957 | |||
| 1682 | Ga0070670_100002473 | |||
| 1683 | Ga0070670_100037369 | |||
| 1684 | Ga0070670_100048794 | |||
| 1685 | Ga0070670_100194418 | |||
| 1686 | Ga0070677_10004528 | |||
| 1687 | Ga0070677_10007902 | |||
| 1688 | Ga0070677_10020902 | |||
| 1689 | Ga0070677_10038389 | |||
| 1690 | Ga0068869_100011797 | |||
| 1691 | Ga0068869_100015575 | |||
| 1692 | Ga0068869_100051024 | |||
| 1693 | Ga0068869_100189935 | |||
| 1694 | Ga0070666_10017347 | |||
| 1695 | Ga0070666_10038037 | |||
| 1696 | Ga0070666_10039300 | |||
| 1697 | Ga0070666_10124172 | |||
| 1698 | Ga0070666_10185287 | |||
| 1699 | Ga0070680_100001439 | |||
| 1700 | Ga0070680_100121292 | |||
| 1701 | Ga0070682_100012961 | |||
| 1702 | Ga0070682_100192315 | |||
| 1703 | Ga0068868_100004371 | |||
| 1704 | Ga0068868_100028174 | |||
| 1705 | Ga0068868_100107984 | |||
| 1706 | Ga0068868_100147442 | |||
| 1707 | Ga0070660_100015905 | |||
| 1708 | Ga0070660_100049144 | |||
| 1709 | Ga0070660_100086389 | |||
| 1710 | Ga0070689_100014123 | |||
| 1711 | Ga0070689_100040242 | |||
| 1712 | Ga0070689_100085455 | |||
| 1713 | Ga0070689_100099802 | |||
| 1714 | Ga0070689_100202478 | |||
| 1715 | Ga0070689_100273604 | |||
| 1716 | Ga0070691_10000641 | |||
| 1717 | Ga0070691_10024585 | |||
| 1718 | Ga0070687_100012056 | |||
| 1719 | Ga0070661_100003449 | |||
| 1720 | Ga0070661_100075997 | |||
| 1721 | Ga0070661_100106273 | |||
| 1722 | Ga0070692_10019617 | |||
| 1723 | Ga0070668_100028688 | |||
| 1724 | Ga0070668_100051252 | |||
| 1725 | Ga0070668_100054752 | |||
| 1726 | Ga0070668_100255113 | |||
| 1727 | Ga0070669_100019309 | |||
| 1728 | Ga0070669_100024441 | |||
| 1729 | Ga0070669_100027704 | |||
| 1730 | Ga0070669_100055599 | |||
| 1731 | Ga0070669_100113862 | |||
| 1732 | Ga0070669_100125363 | |||
| 1733 | Ga0070675_100000253 | |||
| 1734 | Ga0070675_100000801 | |||
| 1735 | Ga0070675_100010643 | |||
| 1736 | Ga0070675_100012438 | |||
| 1737 | Ga0070675_100016586 | |||
| 1738 | Ga0070675_100024137 | |||
| 1739 | Ga0070675_100033328 | |||
| 1740 | Ga0070675_100036573 | |||
| 1741 | Ga0070675_100047989 | |||
| 1742 | Ga0070675_100051450 | |||
| 1743 | Ga0070675_100118766 | |||
| 1744 | Ga0070675_100127945 | |||
| 1745 | Ga0070675_100154473 | |||
| 1746 | Ga0070675_100159515 | |||
| 1747 | Ga0070675_100216181 | |||
| 1748 | Ga0070675_100306837 | |||
| 1749 | Ga0070671_100010783 | |||
| 1750 | Ga0070671_100012745 | |||
| 1751 | Ga0070671_100081478 | |||
| 1752 | Ga0070671_100126264 | |||
| 1753 | Ga0070671_100133600 | |||
| 1754 | Ga0070671_100251314 | |||
| 1755 | Ga0070674_100008245 | |||
| 1756 | Ga0070674_100011162 | |||
| 1757 | Ga0070674_100021567 | |||
| 1758 | Ga0070674_100025985 | |||
| 1759 | Ga0070674_100106384 | |||
| 1760 | Ga0070673_100003415 | |||
| 1761 | Ga0070673_100010744 | |||
| 1762 | Ga0070673_100011536 | |||
| 1763 | Ga0070673_100031373 | |||
| 1764 | Ga0070673_100039829 | |||
| 1765 | Ga0070673_100046128 | |||
| 1766 | Ga0070673_100141248 | |||
| 1767 | Ga0070673_100161682 | |||
| 1768 | Ga0070673_100370344 | |||
| 1769 | Ga0070688_100001161 | |||
| 1770 | Ga0070688_100003997 | |||
| 1771 | Ga0070688_100011267 | |||
| 1772 | Ga0070688_100032333 | |||
| 1773 | Ga0070688_100110805 | |||
| 1774 | Ga0070688_100134579 | |||
| 1775 | Ga0070659_100012472 | |||
| 1776 | Ga0070659_100196671 | |||
| 1777 | Ga0070659_100197851 | |||
| 1778 | Ga0070667_100022929 | |||
| 1779 | Ga0070667_100106195 | |||
| 1780 | Ga0070667_100110257 | |||
| 1781 | Ga0070667_100270192 | |||
| 1782 | Ga0070709_10005949 | |||
| 1783 | Ga0070714_100004846 | |||
| 1784 | Ga0070714_100008730 | |||
| 1785 | Ga0070714_100037767 | |||
| 1786 | Ga0070713_100039343 | |||
| 1787 | Ga0070701_10003780 | |||
| 1788 | Ga0070701_10006652 | |||
| 1789 | Ga0070701_10018766 | |||
| 1790 | Ga0070701_10074729 | |||
| 1791 | Ga0070701_10143987 | |||
| 1792 | Ga0070705_100006809 | |||
| 1793 | Ga0070705_100009951 | |||
| 1794 | Ga0070700_100067464 | |||
| 1795 | Ga0070694_100000107 | |||
| 1796 | Ga0070694_100010050 | |||
| 1797 | Ga0070694_100095545 | |||
| 1798 | Ga0070708_100009182 | |||
| 1799 | Ga0070708_100023470 | |||
| 1800 | Ga0070708_100025793 | |||
| 1801 | Ga0070708_100033340 | |||
| 1802 | Ga0070708_100036455 | |||
| 1803 | Ga0070708_100045037 | |||
| 1804 | Ga0070708_100085577 | |||
| 1805 | Ga0070708_100147932 | |||
| 1806 | Ga0070663_100093338 | |||
| 1807 | Ga0070663_100130434 | |||
| 1808 | Ga0070678_100002431 | |||
| 1809 | Ga0070678_100007740 | |||
| 1810 | Ga0070678_100014125 | |||
| 1811 | Ga0070678_100079193 | |||
| 1812 | Ga0070678_100290583 | |||
| 1813 | Ga0070662_100027802 | |||
| 1814 | Ga0070662_100104796 | |||
| 1815 | Ga0070662_100105552 | |||
| 1816 | Ga0070662_100119446 | |||
| 1817 | Ga0070662_100185094 | |||
| 1818 | Ga0070681_10097714 | |||
| 1819 | Ga0070681_10104952 | |||
| 1820 | Ga0070681_10115744 | |||
| 1821 | Ga0070681_10204787 | |||
| 1822 | Ga0070681_10369968 | |||
| 1823 | Ga0068867_100002815 | |||
| 1824 | Ga0068867_100003246 | |||
| 1825 | Ga0068867_100136856 | |||
| 1826 | Ga0070685_10004772 | |||
| 1827 | Ga0070685_10046696 | |||
| 1828 | Ga0070685_10058265 | |||
| 1829 | Ga0070706_100060461 | |||
| 1830 | Ga0070706_100115262 | |||
| 1831 | Ga0070706_100273176 | |||
| 1832 | Ga0070707_100001749 | |||
| 1833 | Ga0070707_100005817 | |||
| 1834 | Ga0070707_100073832 | |||
| 1835 | Ga0070707_100247852 | |||
| 1836 | Ga0070698_100007001 | |||
| 1837 | Ga0070698_100060247 | |||
| 1838 | Ga0070698_100124924 | |||
| 1839 | Ga0070699_100010678 | |||
| 1840 | Ga0070699_100017590 | |||
| 1841 | Ga0070699_100042598 | |||
| 1842 | Ga0070699_100064384 | |||
| 1843 | Ga0070699_100077001 | |||
| 1844 | Ga0070679_100024192 | |||
| 1845 | Ga0070679_100062464 | |||
| 1846 | Ga0070679_100210201 | |||
| 1847 | Ga0070684_100000213 | |||
| 1848 | Ga0070684_100023808 | |||
| 1849 | Ga0070684_100052441 | |||
| 1850 | Ga0070684_100086426 | |||
| 1851 | Ga0070684_100139022 | |||
| 1852 | Ga0070684_100169766 | |||
| 1853 | Ga0070684_100171779 | |||
| 1854 | Ga0070684_100173029 | |||
| 1855 | Ga0070697_100036753 | |||
| 1856 | Ga0070697_100045110 | |||
| 1857 | Ga0070697_100058647 | |||
| 1858 | Ga0070697_100152772 | |||
| 1859 | Ga0070697_100171230 | |||
| 1860 | Ga0068853_100011384 | |||
| 1861 | Ga0068853_100089669 | |||
| 1862 | Ga0068853_100209435 | |||
| 1863 | Ga0070672_100006459 | |||
| 1864 | Ga0070672_100016774 | |||
| 1865 | Ga0070672_100021164 | |||
| 1866 | Ga0070672_100027841 | |||
| 1867 | Ga0070672_100079330 | |||
| 1868 | Ga0070672_100088071 | |||
| 1869 | Ga0070672_100110689 | |||
| 1870 | Ga0070672_100129850 | |||
| 1871 | Ga0070686_100002473 | |||
| 1872 | Ga0070686_100023123 | |||
| 1873 | Ga0070686_100046276 | |||
| 1874 | Ga0070695_100001868 | |||
| 1875 | Ga0070695_100066492 | |||
| 1876 | Ga0070696_100022563 | |||
| 1877 | Ga0070696_100025334 | |||
| 1878 | Ga0070693_100032240 | |||
| 1879 | Ga0070693_100036425 | |||
| 1880 | Ga0070693_100124278 | |||
| 1881 | Ga0070665_100002991 | |||
| 1882 | Ga0070665_100021844 | |||
| 1883 | Ga0070665_100044289 | |||
| 1884 | Ga0070665_100176423 | |||
| 1885 | Ga0070704_100008238 | |||
| 1886 | Ga0070704_100033130 | |||
| 1887 | Ga0068855_100009123 | |||
| 1888 | Ga0068855_100108732 | |||
| 1889 | Ga0068855_100119594 | |||
| 1890 | Ga0068855_100133775 | |||
| 1891 | Ga0068855_100168419 | |||
| 1892 | Ga0068855_100379915 | |||
| 1893 | Ga0070664_100000586 | |||
| 1894 | Ga0070664_100003485 | |||
| 1895 | Ga0070664_100017864 | |||
| 1896 | Ga0070664_100042073 | |||
| 1897 | Ga0070664_100130673 | |||
| 1898 | Ga0070664_100163765 | |||
| 1899 | Ga0070664_100287132 | |||
| 1900 | Ga0068857_100085189 | |||
| 1901 | Ga0068857_100132500 | |||
| 1902 | Ga0068854_100030643 | |||
| 1903 | Ga0068854_100059050 | |||
| 1904 | Ga0068854_100113415 | |||
| 1905 | Ga0068854_100296381 | |||
| 1906 | Ga0068856_100051081 | |||
| 1907 | Ga0068856_100220826 | |||
| 1908 | Ga0070702_100002472 | |||
| 1909 | Ga0070702_100029233 | |||
| 1910 | Ga0070702_100057673 | |||
| 1911 | Ga0070702_100139159 | |||
| 1912 | Ga0070702_100150313 | |||
| 1913 | Ga0068852_100045599 | |||
| 1914 | Ga0068852_100064492 | |||
| 1915 | Ga0068852_100166839 | |||
| 1916 | Ga0068859_100029439 | |||
| 1917 | Ga0068859_100033086 | |||
| 1918 | Ga0068859_100041652 | |||
| 1919 | Ga0068859_100073857 | |||
| 1920 | Ga0068859_100136215 | |||
| 1921 | Ga0068859_100162559 | |||
| 1922 | Ga0068859_100228236 | |||
| 1923 | Ga0068864_100003807 | |||
| 1924 | Ga0068864_100012301 | |||
| 1925 | Ga0068864_100030047 | |||
| 1926 | Ga0068864_100071533 | |||
| 1927 | Ga0068864_100129009 | |||
| 1928 | Ga0068864_100194065 | |||
| 1929 | Ga0068864_100375659 | |||
| 1930 | Ga0068866_10038903 | |||
| 1931 | Ga0068861_100006139 | |||
| 1932 | Ga0068861_100015207 | |||
| 1933 | Ga0068861_100028959 | |||
| 1934 | Ga0068851_10024137 | |||
| 1935 | Ga0068851_10028093 | |||
| 1936 | Ga0068851_10037183 | |||
| 1937 | Ga0068870_10083230 | |||
| 1938 | Ga0068863_100046319 | |||
| 1939 | Ga0068863_100152745 | |||
| 1940 | Ga0068863_100213775 | |||
| 1941 | Ga0068863_100393234 | |||
| 1942 | Ga0068858_100000002 | |||
| 1943 | Ga0068858_100005689 | |||
| 1944 | Ga0068858_100018354 | |||
| 1945 | Ga0068858_100035040 | |||
| 1946 | Ga0068858_100096443 | |||
| 1947 | Ga0068858_100312344 | |||
| 1948 | Ga0068860_100014438 | |||
| 1949 | Ga0068860_100059285 | |||
| 1950 | Ga0068860_100097700 | |||
| 1951 | Ga0068860_100108479 | |||
| 1952 | Ga0068860_100202888 | |||
| 1953 | Ga0068862_100000192 | |||
| 1954 | Ga0068862_100016510 | |||
| 1955 | Ga0068862_100096827 | |||
| 1956 | Ga0068862_100157271 | |||
| 1957 | Ga0068862_100224329 | |||
| 1958 | Ga0081455_10000995 | |||
| 1959 | Ga0081455_10049132 | |||
| 1960 | Ga0081455_10120691 | |||
| 1961 | Ga0081538_10000004 | |||
| 1962 | Ga0081539_10000024 | |||
| 1963 | Ga0081539_10000035 | |||
| 1964 | Ga0081539_10000244 | |||
| 1965 | Ga0081539_10014216 | |||
| 1966 | Ga0081539_10017051 | |||
| 1967 | Ga0081539_10022783 | |||
| 1968 | Ga0081539_10054855 | |||
| 1969 | Ga0081539_10092488 | |||
| 1970 | Ga0081539_10094365 | |||
| 1971 | Ga0070717_10070185 | |||
| 1972 | Ga0075365_10036265 | |||
| 1973 | Ga0075365_10054928 | |||
| 1974 | Ga0075365_10055190 | |||
| 1975 | Ga0075365_10065905 | |||
| 1976 | Ga0075368_10002301 | |||
| 1977 | Ga0075368_10017923 | |||
| 1978 | Ga0075363_100000364 | |||
| 1979 | Ga0075363_100004611 | |||
| 1980 | Ga0075363_100019594 | |||
| 1981 | Ga0075364_10035090 | |||
| 1982 | Ga0075364_10059297 | |||
| 1983 | Ga0075364_10094090 | |||
| 1984 | Ga0075364_10138463 | |||
| 1985 | Ga0075432_10022092 | |||
| 1986 | Ga0075432_10038984 | |||
| 1987 | Ga0070712_100069113 | |||
| 1988 | Ga0075367_10036217 | |||
| 1989 | Ga0075367_10123291 | |||
| 1990 | Ga0075369_10001831 | |||
| 1991 | Ga0075366_10006958 | |||
| 1992 | Ga0097621_100000510 | |||
| 1993 | Ga0097621_100023601 | |||
| 1994 | Ga0097621_100082245 | |||
| 1995 | Ga0097621_100092591 | |||
| 1996 | Ga0097621_100099825 | |||
| 1997 | Ga0097621_100108084 | |||
| 1998 | Ga0097621_100116772 | |||
| 1999 | Ga0097621_100125172 | |||
| 2000 | Ga0097621_100135672 | |||
| 2001 | Ga0075370_10013756 | |||
| 2002 | Ga0075370_10034318 | |||
| 2003 | Ga0075370_10047475 | |||
| 2004 | Ga0068871_100000108 | |||
| 2005 | Ga0068871_100001762 | |||
| 2006 | Ga0068871_100005779 | |||
| 2007 | Ga0068871_100044770 | |||
| 2008 | Ga0068871_100080567 | |||
| 2009 | Ga0068871_100129739 | |||
| 2010 | Ga0068871_100195840 | |||
| 2011 | Ga0075428_100000100 | |||
| 2012 | Ga0075428_100001176 | |||
| 2013 | Ga0075428_100002267 | |||
| 2014 | Ga0075428_100002710 | |||
| 2015 | Ga0075428_100003258 | |||
| 2016 | Ga0075428_100004744 | |||
| 2017 | Ga0075428_100011875 | |||
| 2018 | Ga0075428_100020681 | |||
| 2019 | Ga0075428_100021454 | |||
| 2020 | Ga0075428_100058385 | |||
| 2021 | Ga0075428_100061209 | |||
| 2022 | Ga0075428_100069973 | |||
| 2023 | Ga0075428_100072723 | |||
| 2024 | Ga0075428_100092312 | |||
| 2025 | Ga0075428_100106053 | |||
| 2026 | Ga0075428_100109485 | |||
| 2027 | Ga0075430_100002969 | |||
| 2028 | Ga0075430_100007284 | |||
| 2029 | Ga0075430_100015760 | |||
| 2030 | Ga0075430_100034006 | |||
| 2031 | Ga0075430_100045040 | |||
| 2032 | Ga0075430_100079058 | |||
| 2033 | Ga0075430_100090238 | |||
| 2034 | Ga0075430_100134779 | |||
| 2035 | Ga0075431_100001491 | |||
| 2036 | Ga0075431_100002445 | |||
| 2037 | Ga0075431_100003423 | |||
| 2038 | Ga0075431_100004448 | |||
| 2039 | Ga0075431_100008897 | |||
| 2040 | Ga0075431_100009529 | |||
| 2041 | Ga0075431_100009670 | |||
| 2042 | Ga0075431_100015256 | |||
| 2043 | Ga0075431_100018729 | |||
| 2044 | Ga0075431_100026022 | |||
| 2045 | Ga0075431_100076459 | |||
| 2046 | Ga0075431_100179361 | |||
| 2047 | Ga0075431_100217028 | |||
| 2048 | Ga0075433_10000348 | |||
| 2049 | Ga0075433_10006016 | |||
| 2050 | Ga0075433_10013934 | |||
| 2051 | Ga0075433_10026871 | |||
| 2052 | Ga0075433_10029614 | |||
| 2053 | Ga0075433_10082409 | |||
| 2054 | Ga0075433_10116262 | |||
| 2055 | Ga0075434_100002451 | |||
| 2056 | Ga0075434_100009109 | |||
| 2057 | Ga0075434_100017333 | |||
| 2058 | Ga0075434_100019774 | |||
| 2059 | Ga0075434_100021900 | |||
| 2060 | Ga0075434_100023769 | |||
| 2061 | Ga0075434_100041223 | |||
| 2062 | Ga0075434_100092342 | |||
| 2063 | Ga0075434_100106257 | |||
| 2064 | Ga0075434_100391167 | |||
| 2065 | Ga0075429_100000082 | |||
| 2066 | Ga0075429_100005845 | |||
| 2067 | Ga0075429_100008969 | |||
| 2068 | Ga0075429_100009769 | |||
| 2069 | Ga0075429_100055229 | |||
| 2070 | Ga0075429_100057994 | |||
| 2071 | Ga0075429_100071554 | |||
| 2072 | Ga0075429_100103843 | |||
| 2073 | Ga0075429_100160770 | |||
| 2074 | Ga0075429_100278492 | |||
| 2075 | Ga0075429_100305469 | |||
| 2076 | Ga0068865_100004918 | |||
| 2077 | Ga0068865_100051701 | |||
| 2078 | Ga0068865_100083553 | |||
| 2079 | Ga0068865_100103385 | |||
| 2080 | Ga0068865_100179413 | |||
| 2081 | Ga0068865_100202672 | |||
| 2082 | Ga0075436_100003014 | |||
| 2083 | Ga0075436_100058685 | |||
| 2084 | Ga0097620_100029436 | |||
| 2085 | Ga0097620_100033086 | |||
| 2086 | Ga0097620_100041655 | |||
| 2087 | Ga0097620_100073858 | |||
| 2088 | Ga0097620_100136213 | |||
| 2089 | Ga0097620_100162560 | |||
| 2090 | Ga0097620_100228244 | |||
| 2091 | Ga0075435_100003226 | |||
| 2092 | Ga0075435_100003893 | |||
| 2093 | Ga0075435_100020624 | |||
| 2094 | Ga0075435_100040892 | |||
| 2095 | Ga0075435_100042755 | |||
| 2096 | Ga0075435_100064482 | |||
| 2097 | Ga0075435_100101013 | |||
| 2098 | Ga0099794_10002655 | |||
| 2099 | Ga0099794_10008572 | |||
| 2100 | Ga0105240_10021429 | |||
| 2101 | Ga0105240_10275252 | |||
| 2102 | Ga0105240_10405961 | |||
| 2103 | Ga0111539_10003771 | |||
| 2104 | Ga0111539_10004229 | |||
| 2105 | Ga0111539_10004348 | |||
| 2106 | Ga0111539_10009801 | |||
| 2107 | Ga0111539_10021661 | |||
| 2108 | Ga0111539_10029039 | |||
| 2109 | Ga0111539_10034471 | |||
| 2110 | Ga0111539_10037135 | |||
| 2111 | Ga0111539_10048226 | |||
| 2112 | Ga0111539_10075167 | |||
| 2113 | Ga0111539_10092226 | |||
| 2114 | Ga0111539_10096271 | |||
| 2115 | Ga0111539_10108999 | |||
| 2116 | Ga0111539_10147900 | |||
| 2117 | Ga0111539_10159359 | |||
| 2118 | Ga0111539_10218455 | |||
| 2119 | Ga0111539_10229966 | |||
| 2120 | Ga0111539_10238610 | |||
| 2121 | Ga0111539_10576760 | |||
| 2122 | Ga0105245_10018518 | |||
| 2123 | Ga0105245_10049152 | |||
| 2124 | Ga0105245_10064134 | |||
| 2125 | Ga0105247_10011104 | |||
| 2126 | Ga0105247_10018503 | |||
| 2127 | Ga0114129_10000032 | |||
| 2128 | Ga0114129_10000127 | |||
| 2129 | Ga0114129_10000939 | |||
| 2130 | Ga0114129_10003134 | |||
| 2131 | Ga0114129_10003744 | |||
| 2132 | Ga0114129_10006207 | |||
| 2133 | Ga0114129_10006952 | |||
| 2134 | Ga0114129_10011327 | |||
| 2135 | Ga0114129_10015037 | |||
| 2136 | Ga0114129_10017930 | |||
| 2137 | Ga0114129_10029973 | |||
| 2138 | Ga0114129_10033131 | |||
| 2139 | Ga0114129_10037256 | |||
| 2140 | Ga0114129_10071958 | |||
| 2141 | Ga0114129_10157201 | |||
| 2142 | Ga0114129_10185545 | |||
| 2143 | Ga0114129_10200567 | |||
| 2144 | Ga0114129_10210827 | |||
| 2145 | Ga0114129_10556086 | |||
| 2146 | Ga0105243_10002886 | |||
| 2147 | Ga0105243_10006221 | |||
| 2148 | Ga0105243_10009076 | |||
| 2149 | Ga0105243_10013026 | |||
| 2150 | Ga0105243_10036259 | |||
| 2151 | Ga0105243_10054643 | |||
| 2152 | Ga0105243_10057372 | |||
| 2153 | Ga0105243_10163848 | |||
| 2154 | Ga0105243_10350370 | |||
| 2155 | Ga0105243_10411699 | |||
| 2156 | Ga0105241_10009863 | |||
| 2157 | Ga0105241_10122279 | |||
| 2158 | Ga0105242_10002197 | |||
| 2159 | Ga0105242_10026154 | |||
| 2160 | Ga0105242_10026311 | |||
| 2161 | Ga0105242_10109442 | |||
| 2162 | Ga0105242_10113762 | |||
| 2163 | Ga0105242_10114559 | |||
| 2164 | Ga0105242_10121863 | |||
| 2165 | Ga0105242_10190971 | |||
| 2166 | Ga0105248_10000943 | |||
| 2167 | Ga0105248_10007178 | |||
| 2168 | Ga0105248_10009334 | |||
| 2169 | Ga0105248_10012226 | |||
| 2170 | Ga0105248_10018050 | |||
| 2171 | Ga0105248_10029846 | |||
| 2172 | Ga0105248_10079334 | |||
| 2173 | Ga0105248_10098948 | |||
| 2174 | Ga0105248_10120483 | |||
| 2175 | Ga0105248_10177132 | |||
| 2176 | Ga0105248_10318894 | |||
| 2177 | Ga0105248_10368026 | |||
| 2178 | Ga0105238_10005510 | |||
| 2179 | Ga0105238_10038120 | |||
| 2180 | Ga0105238_10137774 | |||
| 2181 | Ga0105238_10170887 | |||
| 2182 | Ga0105238_10197339 | |||
| 2183 | Ga0105249_10003805 | |||
| 2184 | Ga0105249_10009569 | |||
| 2185 | Ga0105249_10028809 | |||
| 2186 | Ga0105249_10412692 | |||
| 2187 | Ga0105239_10081521 | |||
| 2188 | Ga0105239_10112876 | |||
| 2189 | Ga0105239_10274524 | |||
| 2190 | Ga0105246_10002150 | |||
| 2191 | Ga0105246_10021870 | |||
| 2192 | Ga0105246_10136664 | |||
| 2193 | Ga0105246_10143116 | |||
| 2194 | Ga0105246_10147169 | |||
| 2195 | Ga0157371_10024677 | |||
| 2196 | Ga0157370_10016729 | |||
| 2197 | Ga0157370_10042219 | |||
| 2198 | Ga0157370_10116970 | |||
| 2199 | Ga0157369_10011406 | |||
| 2200 | Ga0157369_10012708 | |||
| 2201 | Ga0157374_10191254 | |||
| 2202 | Ga0157374_10242036 | |||
| 2203 | Ga0157378_10090899 | |||
| 2204 | Ga0157378_10120861 | |||
| 2205 | Ga0157378_10171200 | |||
| 2206 | Ga0157378_10391349 | |||
| 2207 | Ga0163162_10008524 | |||
| 2208 | Ga0163162_10008622 | |||
| 2209 | Ga0163162_10092279 | |||
| 2210 | Ga0163162_10331878 | |||
| 2211 | Ga0157372_10046056 | |||
| 2212 | Ga0157372_10079042 | |||
| 2213 | Ga0157372_10265210 | |||
| 2214 | Ga0157375_10017505 | |||
| 2215 | Ga0157375_10047330 | |||
| 2216 | Ga0157375_10066597 | |||
| 2217 | Ga0157375_10074179 | |||
| 2218 | Ga0157375_10107640 | |||
| 2219 | Ga0157375_10114966 | |||
| 2220 | Ga0157375_10211661 | |||
| 2221 | Ga0163163_10008055 | |||
| 2222 | Ga0163163_10017879 | |||
| 2223 | Ga0163163_10022835 | |||
| 2224 | Ga0163163_10047022 | |||
| 2225 | Ga0163163_10071192 | |||
| 2226 | Ga0163163_10087836 | |||
| 2227 | Ga0163163_10136659 | |||
| 2228 | Ga0163163_10210525 | |||
| 2229 | Ga0163163_10544418 | |||
| 2230 | Ga0157380_10001491 | |||
| 2231 | Ga0157380_10010921 | |||
| 2232 | Ga0157380_10014471 | |||
| 2233 | Ga0157380_10029501 | |||
| 2234 | Ga0157380_10030663 | |||
| 2235 | Ga0157380_10036819 | |||
| 2236 | Ga0157380_10037074 | |||
| 2237 | Ga0157380_10064627 | |||
| 2238 | Ga0157380_10067423 | |||
| 2239 | Ga0157380_10116889 | |||
| 2240 | Ga0157380_10175468 | |||
| 2241 | Ga0157380_10204849 | |||
| 2242 | Ga0157380_10344942 | |||
| 2243 | Ga0157380_10367117 | |||
| 2244 | Ga0157380_10367951 | |||
| 2245 | Ga0182008_10006801 | |||
| 2246 | Ga0157377_10005968 | |||
| 2247 | Ga0157377_10011755 | |||
| 2248 | Ga0157377_10109470 | |||
| 2249 | Ga0157379_10000007 | |||
| 2250 | Ga0157379_10003064 | |||
| 2251 | Ga0157379_10013575 | |||
| 2252 | Ga0157379_10017832 | |||
| 2253 | Ga0157379_10044088 | |||
| 2254 | Ga0157379_10069016 | |||
| 2255 | Ga0157379_10190944 | |||
| 2256 | Ga0157379_10203540 | |||
| 2257 | Ga0157376_10011280 | |||
| 2258 | Ga0157376_10036613 | |||
| 2259 | Ga0157376_10070517 | |||
| 2260 | Ga0157376_10299891 | |||
| 2261 | Ga0182007_10023328 | |||
| 2262 | Ga0163161_10028324 | |||
| 2263 | Ga0163161_10078278 | |||
| 2264 | Ga0206356_10209910 | |||
| 2265 | Ga0206353_10257956 | |||
| 2266 | Ga0206353_10390452 | |||
| 2267 | Ga0206353_11931331 | |||
| 2268 | Ga0213876_10086674 | |||
| 2269 | Ga0209050_1002956 | |||
| 2270 | Ga0209257_1000006 | |||
| 2271 | Ga0207697_10002059 | |||
| 2272 | Ga0207697_10002496 | |||
| 2273 | Ga0207697_10028256 | |||
| 2274 | Ga0207697_10068738 | |||
| 2275 | Ga0207656_10045227 | |||
| 2276 | Ga0207682_10002902 | |||
| 2277 | Ga0207682_10003368 | |||
| 2278 | Ga0207682_10011854 | |||
| 2279 | Ga0207642_10036849 | |||
| 2280 | Ga0207688_10004310 | |||
| 2281 | Ga0207688_10010791 | |||
| 2282 | Ga0207688_10063280 | |||
| 2283 | Ga0207688_10092310 | |||
| 2284 | Ga0207680_10053614 | |||
| 2285 | Ga0207680_10111437 | |||
| 2286 | Ga0207699_10014716 | |||
| 2287 | Ga0207645_10001211 | |||
| 2288 | Ga0207645_10002990 | |||
| 2289 | Ga0207645_10054617 | |||
| 2290 | Ga0207645_10056145 | |||
| 2291 | Ga0207645_10079852 | |||
| 2292 | Ga0207645_10080516 | |||
| 2293 | Ga0207643_10006077 | |||
| 2294 | Ga0207643_10010032 | |||
| 2295 | Ga0207643_10014099 | |||
| 2296 | Ga0207643_10021872 | |||
| 2297 | Ga0207643_10037355 | |||
| 2298 | Ga0207643_10048157 | |||
| 2299 | Ga0207643_10132954 | |||
| 2300 | Ga0207705_10003753 | |||
| 2301 | Ga0207705_10054656 | |||
| 2302 | Ga0207705_10069859 | |||
| 2303 | Ga0207684_10000491 | |||
| 2304 | Ga0207684_10031743 | |||
| 2305 | Ga0207684_10311778 | |||
| 2306 | Ga0207654_10014370 | |||
| 2307 | Ga0207707_10019997 | |||
| 2308 | Ga0207695_10014226 | |||
| 2309 | Ga0207695_10059773 | |||
| 2310 | Ga0207695_10158762 | |||
| 2311 | Ga0207693_10120583 | |||
| 2312 | Ga0207660_10015632 | |||
| 2313 | Ga0207662_10019025 | |||
| 2314 | Ga0207662_10022979 | |||
| 2315 | Ga0207662_10084746 | |||
| 2316 | Ga0207662_10088745 | |||
| 2317 | Ga0207662_10185391 | |||
| 2318 | Ga0207657_10024642 | |||
| 2319 | Ga0207657_10040322 | |||
| 2320 | Ga0207657_10100137 | |||
| 2321 | Ga0207649_10023474 | |||
| 2322 | Ga0207649_10043227 | |||
| 2323 | Ga0207649_10129224 | |||
| 2324 | Ga0207652_10047440 | |||
| 2325 | Ga0207646_10001586 | |||
| 2326 | Ga0207646_10002404 | |||
| 2327 | Ga0207646_10009215 | |||
| 2328 | Ga0207646_10012777 | |||
| 2329 | Ga0207646_10017164 | |||
| 2330 | Ga0207646_10028693 | |||
| 2331 | Ga0207646_10092641 | |||
| 2332 | Ga0207681_10009853 | |||
| 2333 | Ga0207681_10020691 | |||
| 2334 | Ga0207681_10111301 | |||
| 2335 | Ga0207681_10135371 | |||
| 2336 | Ga0207681_10220191 | |||
| 2337 | Ga0207694_10015342 | |||
| 2338 | Ga0207650_10032986 | |||
| 2339 | Ga0207650_10142047 | |||
| 2340 | Ga0207650_10191455 | |||
| 2341 | Ga0207659_10000209 | |||
| 2342 | Ga0207659_10000854 | |||
| 2343 | Ga0207659_10002047 | |||
| 2344 | Ga0207659_10006129 | |||
| 2345 | Ga0207659_10009478 | |||
| 2346 | Ga0207659_10011484 | |||
| 2347 | Ga0207659_10030752 | |||
| 2348 | Ga0207659_10035003 | |||
| 2349 | Ga0207659_10036189 | |||
| 2350 | Ga0207659_10045322 | |||
| 2351 | Ga0207659_10056908 | |||
| 2352 | Ga0207687_10016974 | |||
| 2353 | Ga0207700_10195584 | |||
| 2354 | Ga0207664_10028758 | |||
| 2355 | Ga0207664_10083724 | |||
| 2356 | Ga0207644_10038219 | |||
| 2357 | Ga0207644_10039388 | |||
| 2358 | Ga0207644_10040682 | |||
| 2359 | Ga0207644_10153803 | |||
| 2360 | Ga0207644_10204901 | |||
| 2361 | Ga0207706_10009358 | |||
| 2362 | Ga0207706_10015076 | |||
| 2363 | Ga0207706_10038166 | |||
| 2364 | Ga0207706_10038926 | |||
| 2365 | Ga0207706_10041924 | |||
| 2366 | Ga0207706_10082819 | |||
| 2367 | Ga0207706_10087790 | |||
| 2368 | Ga0207686_10003421 | |||
| 2369 | Ga0207686_10006274 | |||
| 2370 | Ga0207686_10010825 | |||
| 2371 | Ga0207686_10217860 | |||
| 2372 | Ga0207709_10008062 | |||
| 2373 | Ga0207709_10010140 | |||
| 2374 | Ga0207709_10017542 | |||
| 2375 | Ga0207709_10028476 | |||
| 2376 | Ga0207709_10058745 | |||
| 2377 | Ga0207709_10061172 | |||
| 2378 | Ga0207709_10167256 | |||
| 2379 | Ga0207670_10003370 | |||
| 2380 | Ga0207670_10050656 | |||
| 2381 | Ga0207670_10058770 | |||
| 2382 | Ga0207670_10058784 | |||
| 2383 | Ga0207670_10149525 | |||
| 2384 | Ga0207670_10198646 | |||
| 2385 | Ga0207670_10199551 | |||
| 2386 | Ga0207670_10200801 | |||
| 2387 | Ga0207670_10235702 | |||
| 2388 | Ga0207670_10274841 | |||
| 2389 | Ga0207669_10016067 | |||
| 2390 | Ga0207669_10019064 | |||
| 2391 | Ga0207669_10058122 | |||
| 2392 | Ga0207704_10043620 | |||
| 2393 | Ga0207704_10075104 | |||
| 2394 | Ga0207691_10006867 | |||
| 2395 | Ga0207691_10006894 | |||
| 2396 | Ga0207691_10029696 | |||
| 2397 | Ga0207691_10030061 | |||
| 2398 | Ga0207691_10036136 | |||
| 2399 | Ga0207691_10051484 | |||
| 2400 | Ga0207691_10081206 | |||
| 2401 | Ga0207691_10087850 | |||
| 2402 | Ga0207691_10150241 | |||
| 2403 | Ga0207711_10001278 | |||
| 2404 | Ga0207711_10010515 | |||
| 2405 | Ga0207711_10011686 | |||
| 2406 | Ga0207711_10018748 | |||
| 2407 | Ga0207711_10062275 | |||
| 2408 | Ga0207711_10090877 | |||
| 2409 | Ga0207711_10097778 | |||
| 2410 | Ga0207689_10006638 | |||
| 2411 | Ga0207689_10036444 | |||
| 2412 | Ga0207689_10038079 | |||
| 2413 | Ga0207689_10092527 | |||
| 2414 | Ga0207689_10292362 | |||
| 2415 | Ga0207661_10001430 | |||
| 2416 | Ga0207661_10001693 | |||
| 2417 | Ga0207661_10017151 | |||
| 2418 | Ga0207661_10043583 | |||
| 2419 | Ga0207661_10059670 | |||
| 2420 | Ga0207661_10105298 | |||
| 2421 | Ga0207679_10007694 | |||
| 2422 | Ga0207679_10037475 | |||
| 2423 | Ga0207679_10059730 | |||
| 2424 | Ga0207679_10090800 | |||
| 2425 | Ga0207679_10117062 | |||
| 2426 | Ga0207679_10167973 | |||
| 2427 | Ga0207679_10168597 | |||
| 2428 | Ga0207667_10073659 | |||
| 2429 | Ga0207667_10086606 | |||
| 2430 | Ga0207667_10250735 | |||
| 2431 | Ga0207651_10009269 | |||
| 2432 | Ga0207651_10026264 | |||
| 2433 | Ga0207651_10028137 | |||
| 2434 | Ga0207651_10105102 | |||
| 2435 | Ga0207651_10121253 | |||
| 2436 | Ga0207651_10203723 | |||
| 2437 | Ga0207651_10326444 | |||
| 2438 | Ga0207712_10016816 | |||
| 2439 | Ga0207712_10023448 | |||
| 2440 | Ga0207712_10035472 | |||
| 2441 | Ga0207712_10048939 | |||
| 2442 | Ga0207712_10105025 | |||
| 2443 | Ga0207640_10063796 | |||
| 2444 | Ga0207640_10109378 | |||
| 2445 | Ga0207640_10145833 | |||
| 2446 | Ga0207658_10105918 | |||
| 2447 | Ga0207658_10194161 | |||
| 2448 | Ga0207677_10005324 | |||
| 2449 | Ga0207677_10123707 | |||
| 2450 | Ga0207677_10181823 | |||
| 2451 | Ga0207703_10000001 | |||
| 2452 | Ga0207703_10001811 | |||
| 2453 | Ga0207703_10003450 | |||
| 2454 | Ga0207703_10028221 | |||
| 2455 | Ga0207703_10064866 | |||
| 2456 | Ga0207639_10175722 | |||
| 2457 | Ga0207639_10205469 | |||
| 2458 | Ga0207678_10004486 | |||
| 2459 | Ga0207678_10036465 | |||
| 2460 | Ga0207678_10045317 | |||
| 2461 | Ga0207678_10067075 | |||
| 2462 | Ga0207678_10074382 | |||
| 2463 | Ga0207678_10112554 | |||
| 2464 | Ga0207678_10121680 | |||
| 2465 | Ga0207708_10003212 | |||
| 2466 | Ga0207708_10003477 | |||
| 2467 | Ga0207708_10008663 | |||
| 2468 | Ga0207708_10014140 | |||
| 2469 | Ga0207708_10018446 | |||
| 2470 | Ga0207708_10051556 | |||
| 2471 | Ga0207708_10056058 | |||
| 2472 | Ga0207708_10081767 | |||
| 2473 | Ga0207708_10082413 | |||
| 2474 | Ga0207708_10147771 | |||
| 2475 | Ga0207708_10314022 | |||
| 2476 | Ga0207702_10032147 | |||
| 2477 | Ga0207702_10135040 | |||
| 2478 | Ga0207702_10216984 | |||
| 2479 | Ga0207641_10087888 | |||
| 2480 | Ga0207641_10122856 | |||
| 2481 | Ga0207641_10148860 | |||
| 2482 | Ga0207648_10001129 | |||
| 2483 | Ga0207648_10004649 | |||
| 2484 | Ga0207648_10013721 | |||
| 2485 | Ga0207648_10023072 | |||
| 2486 | Ga0207648_10023618 | |||
| 2487 | Ga0207648_10031547 | |||
| 2488 | Ga0207648_10031931 | |||
| 2489 | Ga0207648_10046921 | |||
| 2490 | Ga0207648_10054768 | |||
| 2491 | Ga0207648_10063665 | |||
| 2492 | Ga0207648_10113510 | |||
| 2493 | Ga0207648_10191481 | |||
| 2494 | Ga0207648_10305520 | |||
| 2495 | Ga0207676_10022681 | |||
| 2496 | Ga0207676_10047034 | |||
| 2497 | Ga0207676_10087204 | |||
| 2498 | Ga0207676_10124781 | |||
| 2499 | Ga0207674_10019100 | |||
| 2500 | Ga0207674_10046794 | |||
| 2501 | Ga0207674_10071773 | |||
| 2502 | Ga0207674_10096765 | |||
| 2503 | Ga0207674_10124853 | |||
| 2504 | Ga0207674_10169714 | |||
| 2505 | Ga0207674_10227804 | |||
| 2506 | Ga0207675_100010366 | |||
| 2507 | Ga0207675_100012983 | |||
| 2508 | Ga0207675_100043996 | |||
| 2509 | Ga0207675_100052039 | |||
| 2510 | Ga0207683_10000190 | |||
| 2511 | Ga0207683_10003923 | |||
| 2512 | Ga0207683_10007767 | |||
| 2513 | Ga0207683_10054688 | |||
| 2514 | Ga0207683_10056469 | |||
| 2515 | Ga0207683_10082387 | |||
| 2516 | Ga0207683_10124695 | |||
| 2517 | Ga0207683_10140584 | |||
| 2518 | Ga0207698_10060892 | |||
| 2519 | Ga0207698_10238718 | |||
| 2520 | Ga0209588_1022596 | |||
| 2521 | Ga0209588_1028619 | |||
| 2522 | Ga0209998_10010271 | |||
| 2523 | Ga0207428_10000393 | |||
| 2524 | Ga0207428_10000574 | |||
| 2525 | Ga0207428_10001100 | |||
| 2526 | Ga0207428_10011660 | |||
| 2527 | Ga0207428_10016192 | |||
| 2528 | Ga0207428_10038835 | |||
| 2529 | Ga0207428_10063561 | |||
| 2530 | Ga0207428_10084280 | |||
| 2531 | Ga0207428_10084727 | |||
| 2532 | Ga0207428_10086614 | |||
| 2533 | Ga0207428_10089007 | |||
| 2534 | Ga0207428_10161341 | |||
| 2535 | Ga0207428_10178367 | |||
| 2536 | Ga0207428_10244222 | |||
| 2537 | Ga0268266_10004015 | |||
| 2538 | Ga0268266_10012762 | |||
| 2539 | Ga0268265_10000185 | |||
| 2540 | Ga0268265_10030738 | |||
| 2541 | Ga0268265_10051363 | |||
| 2542 | Ga0268265_10089961 | |||
| 2543 | Ga0268265_10191468 | |||
| 2544 | Ga0268264_10007749 | |||
| 2545 | Ga0268264_10062017 | |||
| 2546 | Ga0268264_10303755 | |||
| 2547 | Ga0265337_1014920 | |||
| 2548 | Ga0265337_1026590 | |||
| 2549 | Ga0265326_10000821 | |||
| 2550 | Ga0265319_1004075 | |||
| 2551 | Ga0265334_10011902 | |||
| 2552 | Ga0265318_10010683 | |||
| 2553 | Ga0265336_10014135 | |||
| 2554 | Ga0307515_10002908 | |||
| 2555 | Ga0307515_10099224 | |||
| 2556 | Ga0265338_10007839 | |||
| 2557 | Ga0265324_10002985 | |||
| 2558 | Ga0316176_1037086 | |||
| 2559 | Ga0265770_1007359 | |||
| 2560 | Ga0265330_10015743 | |||
| 2561 | Ga0265332_10020389 | |||
| 2562 | Ga0265328_10041085 | |||
| 2563 | Ga0265320_10002308 | |||
| 2564 | Ga0265320_10004075 | |||
| 2565 | Ga0265325_10013604 | |||
| 2566 | Ga0265329_10004508 | |||
| 2567 | Ga0265340_10000470 | |||
| 2568 | Ga0265327_10004586 | |||
| 2569 | Ga0265316_10010209 | |||
| 2570 | Ga0265316_10011723 | |||
| 2571 | Ga0265316_10238937 | |||
| 2572 | Ga0307513_10000007 | |||
| 2573 | Ga0307509_10032339 | |||
| 2574 | Ga0307509_10078800 | |||
| 2575 | Ga0307408_100013432 | |||
| 2576 | Ga0307408_100059644 | |||
| 2577 | Ga0307408_100203948 | |||
| 2578 | Ga0307408_100220969 | |||
| 2579 | Ga0265313_10038254 | |||
| 2580 | Ga0316575_10000826 | |||
| 2581 | Ga0316575_10001083 | |||
| 2582 | Ga0316575_10009431 | |||
| 2583 | Ga0316579_10008036 | |||
| 2584 | Ga0316579_10020391 | |||
| 2585 | Ga0316579_10039001 | |||
| 2586 | Ga0265314_10002620 | |||
| 2587 | Ga0265314_10015520 | |||
| 2588 | Ga0265314_10027079 | |||
| 2589 | Ga0265314_10052424 | |||
| 2590 | Ga0316576_10003639 | |||
| 2591 | Ga0316576_10006146 | |||
| 2592 | Ga0316576_10011842 | |||
| 2593 | Ga0316576_10027074 | |||
| 2594 | Ga0316576_10056092 | |||
| 2595 | Ga0316576_10071907 | |||
| 2596 | Ga0316576_10082011 | |||
| 2597 | Ga0316576_10100244 | |||
| 2598 | Ga0316576_10139728 | |||
| 2599 | Ga0316578_10001433 | |||
| 2600 | Ga0316578_10001971 | |||
| 2601 | Ga0316578_10041392 | |||
| 2602 | Ga0316578_10041628 | |||
| 2603 | Ga0316578_10117930 | |||
| 2604 | Ga0307405_10058926 | |||
| 2605 | Ga0307405_10091025 | |||
| 2606 | Ga0307405_10104994 | |||
| 2607 | Ga0316577_10000080 | |||
| 2608 | Ga0316577_10000089 | |||
| 2609 | Ga0316577_10000636 | |||
| 2610 | Ga0316577_10004746 | |||
| 2611 | Ga0316577_10005239 | |||
| 2612 | Ga0316577_10089796 | |||
| 2613 | Ga0307413_10039012 | |||
| 2614 | Ga0307413_10054017 | |||
| 2615 | Ga0307413_10062645 | |||
| 2616 | Ga0307410_10019576 | |||
| 2617 | Ga0307410_10025569 | |||
| 2618 | Ga0307410_10103711 | |||
| 2619 | Ga0307406_10081494 | |||
| 2620 | Ga0307412_10087758 | |||
| 2621 | Ga0307409_100027899 | |||
| 2622 | Ga0307409_100037964 | |||
| 2623 | Ga0307409_100144540 | |||
| 2624 | Ga0307416_100008589 | |||
| 2625 | Ga0307416_100016633 | |||
| 2626 | Ga0307416_100165180 | |||
| 2627 | Ga0307416_100178783 | |||
| 2628 | Ga0307415_100018876 | |||
| 2629 | Ga0316583_10009047 | |||
| 2630 | Ga0316583_10020931 | |||
| 2631 | Ga0316583_10021849 | |||
| 2632 | Ga0316583_10068207 | |||
| 2633 | Ga0316585_10021473 | |||
| 2634 | Ga0316585_10053676 | |||
| 2635 | Ga0316580_10001255 | |||
| 2636 | Ga0316580_10006543 | |||
| 2637 | Ga0316593_10008734 | |||
| 2638 | Ga0373923_0045215 | |||
| 2639 | Ga0373932_0018875 | |||
| 2640 | Ga0373945_0059996 | |||
| 2641 | Ga0373954_0023176 | |||
| 2642 | Ga0373956_0052479 | |||
| 2643 | Ga0373943_0015607 | |||
| 2644 | Ga0373943_0038565 | |||
| 2645 | Ga0373946_0024979 | |||
| 2646 | Ga0373955_0033485 | |||
| 2647 | Ga0373962_0023654 | |||
| 2648 | Ga0316574_0000151 | |||
| 2649 | Ga0316574_0001153 | |||
| 2650 | Ga0316574_0001764 | |||
| 2651 | Ga0316574_0066657 | |||
| 2652 | Ga0316574_0080492 | |||
| 2653 | Ga0373924_0007928 | |||
| 2654 | Ga0373931_0016904 | |||
| 2655 | Ga0373931_0035227 | |||
| 2656 | Ga0373935_0076680 | |||
| 2657 | Ga0373935_0141213 | |||
| 2658 | Ga0373927_0022808 | |||
| 2659 | Ga0373947_0002973 | |||
| 2660 | Ga0373947_0013397 | |||
| 2661 | Ga0373937_0008628 | |||
| 2662 | Ga0373937_0055725 | |||
| 2663 | Ga0373937_0210739 | |||
| 2664 | Ga0373937_0243687 | |||
| 2665 | Ga0316582_0000480 | |||
| 2666 | Ga0316582_0006227 | |||
| 2667 | Ga0316582_0015286 | |||
| 2668 | Ga0316582_0043091 | |||
| 2669 | Ga0316582_0137838 | |||
| 2670 | Ga0316582_0154380 | |||
| 2671 | Ga0316584_0000413 | |||
| 2672 | Ga0316584_0001506 | |||
| 2673 | Ga0316584_0010138 | |||
| 2674 | Ga0316584_0011733 | |||
| 2675 | Ga0316584_0023624 | |||
| 2676 | Ga0316584_0046235 | |||
| 2677 | Ga0316584_0061249 | |||
| 2678 | Ga0316584_0203567 | |||
| 2679 | Ga0373925_0021612 | |||
| 2680 | Ga0373925_0029664 | |||
| 2681 | Ga0373925_0044438 | |||
| 2682 | Ga0395900_0147181 | |||
| 2683 | Ga0395900_0327770 | |||
| 2684 | Ga0395898_0076611 | |||
| 2685 | Ga0395905_0035481 | |||
| 2686 | Ga0436364_0619729 | |||
| 2687 | Ga0395901_0006804 | |||
| 2688 | Ga0395901_0023635 | |||
| 2689 | Ga0395901_0157581 | |||
| 2690 | Ga0400484_12566 | |||
| 2691 | Ga0400490_37255 | |||
| 2692 | Ga0400490_39545 | |||
| 2693 | Ga0400490_42916 | |||
| 2694 | Ga0400491_05038 | |||
| 2695 | Ga0400491_07905 | |||
| 2696 | Ga0400485_03365 | |||
| 2697 | Ga0400485_09643 | |||
| 2698 | Ga0400488_06186 | |||
| 2699 | Ga0400488_41691 | |||
| 2700 | Ga0400486_13051 | |||
| 2701 | Ga0400483_032670 | |||
| 2702 | Ga0400483_123874 | |||
| 2703 | Ga0400483_155563 | |||
| 2704 | Ga0400489_27482 | |||
| 2705 | Ga0436365_0895231 | |||
| 2706 | Ga0439439_0000378 | |||
| 2707 | Ga0439465_0015220 | |||
| 2708 | Ga0451789_0440849 | |||
| 2709 | Ga0451791_0426296 | |||
| 2710 | Ga0451793_0141268 | |||
| 2711 | Ga0451793_0476113 | |||
| 2712 | Ga0451800_0714665 | |||
| 2713 | Ga0451841_0256531 | |||
| 2714 | Ga0451843_0257713 | |||
| 2715 | Ga0451853_3751897 | |||
| 2716 | Ga0439433_0013975 | |||
| 2717 | Ga0439449_0008770 | |||
| 2718 | Ga0439449_0010419 | |||
| 2719 | Ga0439454_004658 | |||
| 2720 | Ga0439457_010577 | |||
| 2721 | Ga0450920_001937 | |||
| 2722 | Ga0450923_004384 | |||
| 2723 | Ga0450907_002845 | |||
| 2724 | Ga0439435_0002282 | |||
| 2725 | Ga0439435_0008994 | |||
| 2726 | Ga0439435_0038192 | |||
| 2727 | Ga0439460_0020898 | |||
| 2728 | Ga0451577_0052810 | |||
| 2729 | Ga0451577_0085446 | |||
| 2730 | Ga0451577_0280582 | |||
| 2731 | Ga0466972_0006816 | |||
| 2732 | Ga0453683_0065627 | |||
| 2733 | Ga0453683_0193185 | |||
| 2734 | Ga0466966_0037157 | |||
| 2735 | Ga0466963_0064225 | |||
| 2736 | Ga0466963_0152872 | |||
| 2737 | Ga0466963_0169693 | |||
| 2738 | Ga0453684_0000173 | |||
| 2739 | Ga0453684_0001703 | |||
| 2740 | Ga0453684_0007129 | |||
| 2741 | Ga0453684_0015989 | |||
| 2742 | Ga0453684_0080375 | |||
| 2743 | Ga0453684_0115462 | |||
| 2744 | Ga0453684_0166957 | |||
| 2745 | Ga0453684_0360157 | |||
| 2746 | Ga0466971_0051355 | |||
| 2747 | Ga0466968_0025832 | |||
| 2748 | Ga0466970_0013084 | |||
| 2749 | Ga0466970_0017062 | |||
| 2750 | Ga0466957_0039512 | |||
| 2751 | Ga0466957_0047436 | |||
| 2752 | Ga0466959_0009315 | |||
| 2753 | Ga0451576_0008442 | |||
| 2754 | Ga0451576_0008949 | |||
| 2755 | Ga0451576_0153042 | |||
| 2756 | Ga0451576_0165470 | |||
| 2757 | Ga0451576_0201454 | |||
| 2758 | Ga0466958_0009420 | |||
| 2759 | Ga0466958_0064423 | |||
| 2760 | Ga0466958_0099781 | |||
| 2761 | Ga0466958_0139498 | |||
| 2762 | Ga0466967_0005268 | |||
| 2763 | Ga0466967_0022309 | |||
| 2764 | Ga0466967_0091982 | |||
| 2765 | Ga0466967_0133259 | |||
| 2766 | Ga0466967_0163140 | |||
| 2767 | Ga0495603_0008241 | |||
| 2768 | Ga0495603_0013562 | |||
| 2769 | Ga0495629_0000523 | |||
| 2770 | Ga0495638_0000003 | |||
| 2771 | Ga0495653_0017324 | |||
| 2772 | Ga0495653_0093503 | |||
| 2773 | Ga0495580_0000346 | |||
| 2774 | Ga0495580_0073561 | |||
| 2775 | Ga0495580_0172151 | |||
| 2776 | Ga0495582_0008009 | |||
| 2777 | Ga0495582_0098518 | |||
| 2778 | Ga0495639_0008933 | |||
| 2779 | Ga0495594_0076126 | |||
| 2780 | Ga0495594_0201852 | |||
| 2781 | Ga0495608_0020626 | |||
| 2782 | Ga0495618_0235901 | |||
| 2783 | Ga0495628_0003293 | |||
| 2784 | Ga0495628_0011434 | |||
| 2785 | Ga0495628_0122326 | |||
| 2786 | Ga0495630_0009089 | |||
| 2787 | Ga0495630_0013143 | |||
| 2788 | Ga0495666_0121750 | |||
| 2789 | Ga0495665_0108169 | |||
| 2790 | Ga0495640_0018120 | |||
| 2791 | Ga0495640_0094151 | |||
| 2792 | Ga0495586_0168486 | |||
| 2793 | Ga0495587_0081896 | |||
| 2794 | Ga0495609_0033729 | |||
| 2795 | Ga0495621_0000799 | |||
| 2796 | Ga0495621_0001364 | |||
| 2797 | Ga0495621_0013561 | |||
| 2798 | Ga0495645_0000509 | |||
| 2799 | Ga0495667_0021852 | |||
| 2800 | Ga0495635_0132119 | |||
| 2801 | Ga0495659_0022356 | |||
| 2802 | Ga0495659_0024145 | |||
| 2803 | Ga0495588_0044414 | |||
| 2804 | Ga0495647_0030358 | |||
| 2805 | Ga0495658_0001090 | |||
| 2806 | Ga0495658_0034283 | |||
| 2807 | Ga0495658_0048533 | |||
| 2808 | Ga0495658_0219255 | |||
| 2809 | Ga0495669_0011838 | |||
| 2810 | Ga0495669_0108264 | |||
| 2811 | Ga0495613_0008520 | |||
| 2812 | Ga0495613_0124506 | |||
| 2813 | Ga0495613_0227618 | |||
| 2814 | Ga0495600_0098163 | |||
| 2815 | Ga0495581_0043855 | |||
| 2816 | Ga0495674_0021360 | |||
| 2817 | Ga0495674_0051535 | |||
| 2818 | Ga0495672_0000242 | |||
| 2819 | Ga0495672_0004208 | |||
| 2820 | Ga0495677_0044018 | |||
| 2821 | Ga0495684_0001676 | |||
| 2822 | Ga0495602_0136664 | |||
| 2823 | Ga0496101_0156636 | |||
| 2824 | Ga0496101_0236363 | |||
| 2825 | Ga0496102_0043243 | |||
| 2826 | Ga0496102_0072640 | |||
| 2827 | Ga0496102_0079705 | |||
| 2828 | Ga0496102_0093756 | |||
| 2829 | Ga0496102_0119680 | |||
| 2830 | Ga0496104_0003311 | |||
| 2831 | Ga0496104_0010031 | |||
| 2832 | Ga0496104_0020628 | |||
| 2833 | Ga0496104_0079682 | |||
| 2834 | Ga0496104_0243987 | |||
| 2835 | Ga0496105_0000513 | |||
| 2836 | Ga0496105_0092061 | |||
| 2837 | Ga0496105_0096560 | |||
| 2838 | Ga0496105_0161757 | |||
| 2839 | Ga0496106_0006809 | |||
| 2840 | Ga0496106_0029816 | |||
| 2841 | Ga0496106_0110583 | |||
| 2842 | Ga0496106_0159907 | |||
| 2843 | Ga0496107_0003244 | |||
| 2844 | Ga0496107_0082562 | |||
| 2845 | Ga0496108_0002685 | |||
| 2846 | Ga0496108_0005882 | |||
| 2847 | Ga0496108_0024891 | |||
| 2848 | Ga0496108_0074259 | |||
| 2849 | Ga0496108_0168024 | |||
| 2850 | Ga0496109_0001158 | |||
| 2851 | Ga0496109_0003151 | |||
| 2852 | Ga0496109_0030856 | |||
| 2853 | Ga0496109_0265194 | |||
| 2854 | Ga0496110_0006677 | |||
| 2855 | Ga0496110_0013256 | |||
| 2856 | Ga0496110_0017224 | |||
| 2857 | Ga0496110_0092227 | |||
| 2858 | Ga0496111_0006838 | |||
| 2859 | Ga0496111_0010934 | |||
| 2860 | Ga0496111_0076714 | |||
| 2861 | Ga0496111_0219971 | |||
| 2862 | Ga0496112_0001156 | |||
| 2863 | Ga0496112_0041108 | |||
| 2864 | Ga0496112_0088517 | |||
| 2865 | Ga0496112_0157512 | |||
| 2866 | Ga0496112_0194101 | |||
| 2867 | Ga0496112_0436367 | |||
| 2868 | Ga0496113_0008939 | |||
| 2869 | Ga0496113_0012915 | |||
| 2870 | Ga0496113_0021398 | |||
| 2871 | Ga0496113_0025915 | |||
| 2872 | Ga0496114_0005398 | |||
| 2873 | Ga0496114_0014629 | |||
| 2874 | Ga0496114_0080620 | |||
| 2875 | Ga0496114_0144195 | |||
| 2876 | Ga0496114_0174311 | |||
| 2877 | Ga0496114_0467976 | |||
| 2878 | Ga0496115_0001888 | |||
| 2879 | Ga0496115_0053909 | |||
| 2880 | Ga0496115_0056811 | |||
| 2881 | Ga0496117_0004173 | |||
| 2882 | Ga0496118_0000909 | |||
| 2883 | Ga0496121_0000025 | |||
| 2884 | Ga0496122_0002058 | |||
| 2885 | Ga0496122_0111496 | |||
| 2886 | Ga0496123_0006537 | |||
| 2887 | Ga0496123_0011752 | |||
| 2888 | Ga0496123_0121298 | |||
| 2889 | Ga0496124_0000639 | |||
| 2890 | Ga0496124_0132995 | |||
| 2891 | Ga0496124_0162442 | |||
| 2892 | Ga0496126_0027150 | |||
| 2893 | Ga0501300_001453 | |||
| 2894 | Ga0501323_004435 | |||
| 2895 | Ga0501325_001364 | |||
| 2896 | Ga0501031_0001166 | |||
| 2897 | Ga0501031_0016519 | |||
| 2898 | Ga0501031_0019548 | |||
| 2899 | Ga0501031_0087488 | |||
| 2900 | Ga0501032_0002307 | |||
| 2901 | Ga0501033_0000941 | |||
| 2902 | Ga0501033_0019917 | |||
| 2903 | Ga0501033_0063719 | |||
| 2904 | Ga0501033_0078188 | |||
| 2905 | Ga0501034_0002121 | |||
| 2906 | Ga0501034_0008189 | |||
| 2907 | Ga0501034_0164197 | |||
| 2908 | Ga0501034_0201836 | |||
| 2909 | Ga0501036_0000057 | |||
| 2910 | Ga0501036_0001775 | |||
| 2911 | Ga0501036_0022956 | |||
| 2912 | Ga0501036_0051933 | |||
| 2913 | Ga0501036_0103190 | |||
| 2914 | Ga0501036_0137854 | |||
| 2915 | Ga0501037_0001310 | |||
| 2916 | Ga0501037_0009021 | |||
| 2917 | Ga0501037_0030509 | |||
| 2918 | Ga0501038_0000391 | |||
| 2919 | Ga0501038_0027841 | |||
| 2920 | Ga0501038_0086524 | |||
| 2921 | Ga0501038_0134033 | |||
| 2922 | Ga0501039_0000309 | |||
| 2923 | Ga0501039_0013387 | |||
| 2924 | Ga0501039_0021253 | |||
| 2925 | Ga0501039_0028801 | |||
| 2926 | Ga0501039_0043221 | |||
| 2927 | Ga0501039_0114050 | |||
| 2928 | Ga0501039_0206551 | |||
| 2929 | Ga0501040_0004086 | |||
| 2930 | Ga0501040_0009350 | |||
| 2931 | Ga0501040_0016992 | |||
| 2932 | Ga0501040_0020914 | |||
| 2933 | Ga0501040_0021385 | |||
| 2934 | Ga0501040_0033917 | |||
| 2935 | Ga0501040_0166529 | |||
| 2936 | Ga0501040_0176649 | |||
| 2937 | Ga0501041_0002498 | |||
| 2938 | Ga0501041_0014933 | |||
| 2939 | Ga0501041_0018696 | |||
| 2940 | Ga0501041_0123376 | |||
| 2941 | Ga0501041_0126730 | |||
| 2942 | Ga0501042_0002039 | |||
| 2943 | Ga0501042_0003181 | |||
| 2944 | Ga0501042_0011677 | |||
| 2945 | Ga0501042_0050630 | |||
| 2946 | Ga0501042_0058483 | |||
| 2947 | Ga0501042_0092036 | |||
| 2948 | Ga0501042_0099901 | |||
| 2949 | Ga0501042_0104152 | |||
| 2950 | Ga0501042_0241435 | |||
| 2951 | Ga0501043_0000111 | |||
| 2952 | Ga0501043_0043834 | |||
| 2953 | Ga0501043_0118797 | |||
| 2954 | Ga0501046_0000307 | |||
| 2955 | Ga0501046_0014958 | |||
| 2956 | Ga0501046_0114077 | |||
| 2957 | Ga0501046_0125431 | |||
| 2958 | Ga0501047_0000289 | |||
| 2959 | Ga0501047_0002400 | |||
| 2960 | Ga0501048_0000298 | |||
| 2961 | Ga0501048_0005925 | |||
| 2962 | Ga0501048_0016854 | |||
| 2963 | Ga0501048_0022284 | |||
| 2964 | Ga0501048_0165633 | |||
| 2965 | Ga0501067_0000065 | |||
| 2966 | Ga0501067_0013273 | |||
| 2967 | Ga0501067_0016818 | |||
| 2968 | Ga0501067_0020205 | |||
| 2969 | Ga0501067_0036773 | |||
| 2970 | Ga0501067_0146587 | |||
| 2971 | Ga0501068_0000099 | |||
| 2972 | Ga0501068_0039468 | |||
| 2973 | Ga0501068_0043827 | |||
| 2974 | Ga0501068_0054740 | |||
| 2975 | Ga0501068_0068423 | |||
| 2976 | Ga0501068_0103014 | |||
| 2977 | Ga0501069_0001404 | |||
| 2978 | Ga0501069_0006770 | |||
| 2979 | Ga0501069_0046809 | |||
| 2980 | Ga0501070_0001132 | |||
| 2981 | Ga0501070_0016772 | |||
| 2982 | Ga0501070_0024597 | |||
| 2983 | Ga0501070_0073617 | |||
| 2984 | Ga0501070_0146802 | |||
| 2985 | Ga0501071_0000488 | |||
| 2986 | Ga0501071_0003854 | |||
| 2987 | Ga0501071_0005549 | |||
| 2988 | Ga0501071_0019597 | |||
| 2989 | Ga0501071_0020005 | |||
| 2990 | Ga0501071_0025545 | |||
| 2991 | Ga0501071_0039050 | |||
| 2992 | Ga0501071_0048161 | |||
| 2993 | Ga0501071_0075934 | |||
| 2994 | Ga0501071_0116344 | |||
| 2995 | Ga0501071_0184437 | |||
| 2996 | Ga0501072_0004844 | |||
| 2997 | Ga0501072_0009359 | |||
| 2998 | Ga0501072_0009420 | |||
| 2999 | Ga0501072_0013185 | |||
| 3000 | Ga0501072_0017150 | |||
| 3001 | Ga0501072_0029963 | |||
| 3002 | Ga0501072_0031779 | |||
| 3003 | Ga0501072_0032367 | |||
| 3004 | Ga0501072_0061470 | |||
| 3005 | Ga0501072_0071964 | |||
| 3006 | Ga0501072_0105608 | |||
| 3007 | Ga0501072_0303699 | |||
| 3008 | Ga0501073_0007238 | |||
| 3009 | Ga0501073_0013683 | |||
| 3010 | Ga0501073_0015002 | |||
| 3011 | Ga0501073_0126313 | |||
| 3012 | Ga0501073_0214598 | |||
| 3013 | Ga0501074_0000074 | |||
| 3014 | Ga0501074_0019499 | |||
| 3015 | Ga0501074_0058553 | |||
| 3016 | Ga0501074_0088881 | |||
| 3017 | Ga0501074_0106746 | |||
| 3018 | Ga0501075_0003648 | |||
| 3019 | Ga0501075_0018685 | |||
| 3020 | Ga0501075_0025444 | |||
| 3021 | Ga0501075_0040497 | |||
| 3022 | Ga0501075_0041989 | |||
| 3023 | Ga0501075_0073297 | |||
| 3024 | Ga0501075_0098365 | |||
| 3025 | Ga0501075_0233080 | |||
| 3026 | Ga0501076_0002631 | |||
| 3027 | Ga0501076_0007851 | |||
| 3028 | Ga0501076_0011199 | |||
| 3029 | Ga0501076_0011969 | |||
| 3030 | Ga0501076_0041077 | |||
| 3031 | Ga0501076_0105052 | |||
| 3032 | Ga0501076_0200901 | |||
| 3033 | Ga0501076_0257598 | |||
| 3034 | Ga0501077_0016934 | |||
| 3035 | Ga0501077_0062494 | |||
| 3036 | Ga0501077_0100103 | |||
| 3037 | Ga0501077_0176385 | |||
| 3038 | Ga0501221_014438 | |||
| 3039 | Ga0501079_0005025 | |||
| 3040 | Ga0501079_0018044 | |||
| 3041 | Ga0501079_0024592 | |||
| 3042 | Ga0501079_0047886 | |||
| 3043 | Ga0501079_0061460 | |||
| 3044 | Ga0501079_0100333 | |||
| 3045 | Ga0501079_0106723 | |||
| 3046 | Ga0501079_0107212 | |||
| 3047 | Ga0501079_0170704 | |||
| 3048 | Ga0501080_0000244 | |||
| 3049 | Ga0501080_0000414 | |||
| 3050 | Ga0501080_0070329 | |||
| 3051 | Ga0501080_0096840 | |||
| 3052 | Ga0501080_0104895 | |||
| 3053 | Ga0501080_0161284 | |||
| 3054 | Ga0501081_0000754 | |||
| 3055 | Ga0501081_0008776 | |||
| 3056 | Ga0501081_0011798 | |||
| 3057 | Ga0501081_0090290 | |||
| 3058 | Ga0501081_0138662 | |||
| 3059 | Ga0501081_0142686 | |||
| 3060 | Ga0501081_0195964 | |||
| 3061 | Ga0501083_0019965 | |||
| 3062 | Ga0501083_0036872 | |||
| 3063 | Ga0501083_0192587 | |||
| 3064 | Ga0501264_000063 | |||
| 3065 | Ga0501035_0000262 | |||
| 3066 | Ga0501035_0013824 | |||
| 3067 | Ga0501035_0108437 | |||
| 3068 | Ga0501044_0000312 | |||
| 3069 | Ga0501045_0003035 | |||
| 3070 | Ga0501045_0003799 | |||
| 3071 | Ga0501045_0011531 | |||
| 3072 | Ga0501045_0017723 | |||
| 3073 | Ga0501045_0025444 | |||
| 3074 | Ga0501045_0034416 | |||
| 3075 | Ga0501045_0074245 | |||
| 3076 | Ga0501045_0082011 | |||
| 3077 | Ga0501045_0147944 | |||
| 3078 | nmdc:mga03n38_31977_c1 | |||
| 3079 | nmdc:mga00v17_102676_c1 | |||
| 3080 | nmdc:mga00v17_105147_c1 | |||
| 3081 | nmdc:mga0yw44_12118_c1 | |||
| 3082 | nmdc:mga0yw44_148377_c1 | |||
| 3083 | nmdc:mga0yw44_18976_c1 | |||
| 3084 | nmdc:mga0yw44_52124_c1 | |||
| 3085 | nmdc:mga0yw44_64894_c1 | |||
| 3086 | nmdc:mga0k408_24679_c1 | |||
| 3087 | nmdc:mga0k408_76416_c1 | |||
| 3088 | nmdc:mga06z11_50726_c1 | |||
| 3089 | nmdc:mga06z11_98093_c1 | |||
| 3090 | nmdc:mga07m45_24539_c1 | |||
| 3091 | nmdc:mga07m45_25794_c1 | |||
| 3092 | nmdc:mga05p37_10188_c1 | |||
| 3093 | nmdc:mga05p37_115999_c1 | |||
| 3094 | nmdc:mga05p37_123154_c1 | |||
| 3095 | nmdc:mga05p37_12946_c1 | |||
| 3096 | nmdc:mga05p37_13104_c1 | |||
| 3097 | nmdc:mga05p37_13976_c1 | |||
| 3098 | nmdc:mga05p37_147215_c1 | |||
| 3099 | nmdc:mga05p37_156577_c1 | |||
| 3100 | nmdc:mga05p37_16959_c1 | |||
| 3101 | nmdc:mga05p37_275_c1 | |||
| 3102 | nmdc:mga05p37_3361_c1 | |||
| 3103 | nmdc:mga05p37_441566_c1 | |||
| 3104 | nmdc:mga05p37_444686_c1 | |||
| 3105 | nmdc:mga05p37_45778_c1 | |||
| 3106 | nmdc:mga05p37_482297_c1 | |||
| 3107 | nmdc:mga05p37_6361_c1 | |||
| 3108 | nmdc:mga05p37_63640_c1 | |||
| 3109 | nmdc:mga05p37_65409_c1 | |||
| 3110 | nmdc:mga09592_12832_c1 | |||
| 3111 | nmdc:mga09592_137332_c1 | |||
| 3112 | nmdc:mga09592_182953_c1 | |||
| 3113 | nmdc:mga09592_183003_c1 | |||
| 3114 | nmdc:mga09592_252817_c1 | |||
| 3115 | nmdc:mga09592_302676_c1 | |||
| 3116 | nmdc:mga09592_5612_c1 | |||
| 3117 | nmdc:mga09592_65081_c1 | |||
| 3118 | nmdc:mga09592_67270_c1 | |||
| 3119 | nmdc:mga09592_70846_c1 | |||
| 3120 | nmdc:mga09592_953_c1 | |||
| 3121 | nmdc:mga09592_96657_c1 | |||
| 3122 | nmdc:mga0qj67_13711_c1 | |||
| 3123 | nmdc:mga0qj67_21101_c1 | |||
| 3124 | nmdc:mga0qj67_24595_c1 | |||
| 3125 | nmdc:mga0qj67_245972_c1 | |||
| 3126 | nmdc:mga0qj67_2517_c1 | |||
| 3127 | nmdc:mga0qj67_2598_c1 | |||
| 3128 | nmdc:mga0qj67_75052_c1 | |||
| 3129 | nmdc:mga0qj67_95202_c1 | |||
| 3130 | nmdc:mga06r32_10914_c1 | |||
| 3131 | nmdc:mga06r32_113653_c1 | |||
| 3132 | nmdc:mga06r32_113980_c1 | |||
| 3133 | nmdc:mga06r32_14263_c1 | |||
| 3134 | nmdc:mga06r32_14472_c1 | |||
| 3135 | nmdc:mga06r32_15782_c1 | |||
| 3136 | nmdc:mga06r32_220850_c1 | |||
| 3137 | nmdc:mga06r32_4670_c1 | |||
| 3138 | nmdc:mga06r32_46937_c1 | |||
| 3139 | nmdc:mga06r32_48535_c1 | |||
| 3140 | nmdc:mga06r32_52312_c1 | |||
| 3141 | nmdc:mga06r32_66280_c1 | |||
| 3142 | nmdc:mga06r32_66410_c1 | |||
| 3143 | nmdc:mga06r32_6887_c1 | |||
| 3144 | nmdc:mga06r32_7657_c1 | |||
| 3145 | nmdc:mga08y16_103170_c1 | |||
| 3146 | nmdc:mga08y16_11284_c1 | |||
| 3147 | nmdc:mga08y16_185985_c1 | |||
| 3148 | nmdc:mga08y16_269854_c1 | |||
| 3149 | nmdc:mga08y16_2708_c1 | |||
| 3150 | nmdc:mga08y16_273965_c1 | |||
| 3151 | nmdc:mga08y16_282487_c1 | |||
| 3152 | nmdc:mga08y16_28869_c1 | |||
| 3153 | nmdc:mga08y16_32443_c1 | |||
| 3154 | nmdc:mga08y16_3393_c1 | |||
| 3155 | nmdc:mga08y16_46864_c1 | |||
| 3156 | nmdc:mga08y16_504_c1 | |||
| 3157 | nmdc:mga08y16_6332_c1 | |||
| 3158 | nmdc:mga08y16_8405_c1 | |||
| 3159 | nmdc:mga0n895_10806_c1 | |||
| 3160 | nmdc:mga0n895_118817_c1 | |||
| 3161 | nmdc:mga0n895_11991_c1 | |||
| 3162 | nmdc:mga0n895_130462_c1 | |||
| 3163 | nmdc:mga0n895_18517_c1 | |||
| 3164 | nmdc:mga0n895_20427_c1 | |||
| 3165 | nmdc:mga0n895_2106_c1 | |||
| 3166 | nmdc:mga0n895_28190_c1 | |||
| 3167 | nmdc:mga0n895_50397_c1 | |||
| 3168 | nmdc:mga0n895_5966_c1 | |||
| 3169 | nmdc:mga0n895_62888_c1 | |||
| 3170 | nmdc:mga0n895_78707_c1 | |||
| 3171 | nmdc:mga0n895_829_c1 | |||
| 3172 | nmdc:mga0rr50_145299_c1 | |||
| 3173 | nmdc:mga0rr50_151407_c1 | |||
| 3174 | nmdc:mga0rr50_167056_c1 | |||
| 3175 | nmdc:mga0rr50_32236_c1 | |||
| 3176 | nmdc:mga0rr50_354_c1 | |||
| 3177 | nmdc:mga0rr50_7956_c1 | |||
| 3178 | nmdc:mga0rr50_80461_c1 | |||
| 3179 | nmdc:mga08x19_2446_c1 | |||
| 3180 | nmdc:mga0a205_1093_c1 | |||
| 3181 | nmdc:mga0a205_140551_c1 | |||
| 3182 | nmdc:mga0a205_141186_c1 | |||
| 3183 | nmdc:mga0a205_14504_c1 | |||
| 3184 | nmdc:mga0a205_146419_c1 | |||
| 3185 | nmdc:mga0a205_18128_c1 | |||
| 3186 | nmdc:mga0a205_2072_c1 | |||
| 3187 | nmdc:mga0a205_3147_c1 | |||
| 3188 | nmdc:mga0a205_38110_c1 | |||
| 3189 | nmdc:mga0a205_72728_c1 | |||
| 3190 | nmdc:mga0a205_74669_c1 | |||
| 3191 | Ga0495601_0006657 | |||
| 3192 | Ga0495595_0006010 | |||
| 3193 | Ga0495619_0003726 | |||
| 3194 | Ga0495619_0011460 | |||
| 3195 | Ga0495619_0074185 | |||
| 3196 | Ga0495619_0081543 | |||
| 3197 | Ga0495619_0088962 | |||
| 3198 | Ga0500643_000913 | |||
| 3199 | Ga0500644_0000106 | |||
| 3200 | Ga0500641_0002700 | |||
| 3201 | Ga0500556_0000001 | |||
| 3202 | Ga0500568_0000003 | |||
| 3203 | Ga0500568_0032010 | |||
| 3204 | Ga0500604_0002802 | |||
| 3205 | Ga0500616_0000007 | |||
| 3206 | Ga0500616_0000205 | |||
| 3207 | Ga0500616_0037765 | |||
| 3208 | Ga0500622_0000066 | |||
| 3209 | Ga0500622_0000179 | |||
| 3210 | Ga0500622_0001539 | |||
| 3211 | Ga0500645_001172 | |||
| 3212 | Ga0501084_0001637 | |||
| 3213 | Ga0501084_0006547 | |||
| 3214 | Ga0501084_0023342 | |||
| 3215 | Ga0501084_0023478 | |||
| 3216 | Ga0501084_0026974 | |||
| 3217 | Ga0501084_0043651 | |||
| 3218 | Ga0501084_0053078 | |||
| 3219 | Ga0501084_0066241 | |||
| 3220 | Ga0501084_0135199 | |||
| 3221 | Ga0501084_0167806 | |||
| 3222 | Ga0501084_0282519 | |||
| 3223 | Ga0590071_014634 | |||
| 3224 | Ga0590075_000348 | |||
| 3225 | Ga0590075_000928 | |||
| 3226 | Ga0590077_000323 | |||
| 3227 | Ga0590077_003620 | |||
| 3228 | Ga0501082_0002453 | |||
| 3229 | Ga0501082_0007432 | |||
| 3230 | Ga0501082_0012030 | |||
| 3231 | Ga0501082_0022921 | |||
| 3232 | Ga0501082_0038929 | |||
| 3233 | Ga0501082_0063921 | |||
| 3234 | Ga0501082_0073646 | |||
| 3235 | Ga0501082_0107841 | |||
| 3236 | Ga0466962_0006259 | |||
| 3237 | Ga0530510_0002726 | |||
| 3238 | Ga0530510_0017917 | |||
| 3239 | Ga0530510_0022875 | |||
| 3240 | Ga0530510_0027284 | |||
| 3241 | Ga0530510_0029713 | |||
| 3242 | Ga0530510_0034058 | |||
| 3243 | Ga0530510_0041103 | |||
| 3244 | Ga0530510_0078292 | |||
| 3245 | 2644131281 | |||
| 3246 | 2739310205 | |||
| 3247 | 2753302454 | |||
| 3248 | 2844856075 | |||
| 3249 | 2852646055 | |||
| 3250 | 2857734016 | |||
| 3251 | 2895661688 | |||
| 3252 | 2904432919 | |||
| 3253 | 2904503372 | |||
| 3254 | 2908675451 | |||
| 3255 | 2909074507 | |||
| 3256 | 2919041481 | |||
| 3257 | 2919045610 | |||
| 3258 | 2928107441 | |||
| 3259 | 2928500436 | |||
| 3260 | 2984554623 | |||
| 3261 | 8002290462 | |||
| 3262 | 8056056240 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3r5f-assembly1.cif.gz_A-2 | crystal structure of d-alanine-d-alnine ligase from xanthomonas oryzae pv. oryzae with atp | 0.9306 | 3 | 386 |
| 4me6-assembly1.cif.gz_A-2 | crystal structure of d-alanine-d-alanine ligase a from xanthomonas oryzae pathovar oryzae with adp | 0.9302 | 2 | 386 |
| 3rfc-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9282 | 2 | 385 |
| 3r5f-assembly1.cif.gz_A-2 | crystal structure of d-alanine-d-alnine ligase from xanthomonas oryzae pv. oryzae with atp | 0.9279 | 3 | 386 |
| 4me6-assembly1.cif.gz_A-2 | crystal structure of d-alanine-d-alanine ligase a from xanthomonas oryzae pathovar oryzae with adp | 0.9276 | 2 | 386 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3q1kB02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9541 | 146 | 384 | 3.30.470.20 |
| 5bpfD02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9505 | 146 | 371 | 3.30.470.20 |
| 3q1kB02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9477 | 146 | 384 | 3.30.470.20 |
| 1ehiB02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9429 | 244 | 382 | 3.30.470.20 |
| 5bpfD02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9377 | 146 | 371 | 3.30.470.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535FBX8-F1-model_v4 | D-alanine--D-alanine ligase | 0.9939 | 131 | 384 |
GO:0005524
GO:0005829 GO:0008360 GO:0008716 GO:0009252 GO:0046872 GO:0071555 |
| AF-A0A7X6VCQ7-F1-model_v4 | ATP-grasp domain-containing protein | 0.991 | 216 | 380 |
GO:0005524
GO:0005829 GO:0008360 GO:0008716 GO:0009252 GO:0046872 |
| AF-A0A357CRR7-F1-model_v4 | D-alanine--D-alanine ligase A | 0.9895 | 117 | 378 |
GO:0005524
GO:0005829 GO:0008360 GO:0008716 GO:0009252 GO:0046872 GO:0071555 |
| AF-A0A7W0ZQ39-F1-model_v4 | ATP-grasp domain-containing protein | 0.9865 | 216 | 380 |
GO:0005524
GO:0005829 GO:0008360 GO:0008716 GO:0009252 GO:0046872 |
| AF-A0A535FBX8-F1-model_v4 | D-alanine--D-alanine ligase | 0.9862 | 131 | 384 |
GO:0005524
GO:0005829 GO:0008360 GO:0008716 GO:0009252 GO:0046872 GO:0071555 |