F495133

General Info

Members Datasets Scaffolds Average Seq Length
1631 462 3262 362

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0015481|Ga0501040_0015481_2255_3532
Length 425
Sequence LNHVSDRGPRIQLSLAIQKHFSGGGRRTAAADPVILFSVKRVRVGVLYGGRSGEHEVSLASAAAVIANLDRTRYEPVAIRIDKDGRWGLAERAPTASSAAEVIEQARLEAARPSRSGREVHLVARPSEETILAIDRGSRRGEIDAGQVIVTGMNLDVIFPVLHGPYGEDGTIQGLLELANVPYVGAGVLPSAVGMDKALMKVVFAASSLPVCPYRAFLRREWNGRRDDLVRELVAVLGFPMFVKPANLGSSVGISKAKDAAALAGAIDLAGSFDRKIVVEAAVPEAREIECAVLGNDDPAASVPGEVVPSREFYDYEAKYLDEGSRTIIPAELPPATTAEIQRLAIASFQAIDCAGMARIDFLLSRSSGAIFVNEVNTIPGFTTISMYSKLWAASGLAYPELLDRLIGLAFERHAEKQQLRTSVS

Samples

Sample ID Description Type Environment
1 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
104 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
105 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
106 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
107 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
136 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
145 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
212 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
213 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
214 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
215 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
216 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
217 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
218 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
219 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
220 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
221 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
223 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
224 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
225 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
226 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
227 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
228 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
229 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
230 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
231 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
232 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
233 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
234 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
235 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
236 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
237 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
238 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
239 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
240 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
241 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
242 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
243 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
244 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
245 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
246 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
247 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
248 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
249 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
250 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
251 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
252 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
254 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
255 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
256 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
257 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
258 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
259 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
260 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
261 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
262 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
263 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
264 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
265 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
267 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
268 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
269 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
270 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
271 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
272 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
273 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
274 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
275 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
276 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
277 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
278 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
279 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
280 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
281 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
282 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
283 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
284 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
285 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
286 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
287 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
288 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
289 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
290 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
291 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
292 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
293 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
294 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
295 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
296 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
297 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
298 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
299 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
300 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
301 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
302 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
303 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
304 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
305 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
306 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
307 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
308 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
309 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
310 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
311 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
312 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
313 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
314 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
315 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
316 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
317 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
318 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
319 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
320 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
321 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
322 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
323 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
324 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
325 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
326 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
327 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
328 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
329 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
330 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
331 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
332 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
333 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
334 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
335 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
336 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
337 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
338 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
339 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
340 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
341 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
342 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
343 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
344 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
345 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
346 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
347 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
348 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
349 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
350 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
351 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
352 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
353 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
354 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
355 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
356 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
357 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
358 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
359 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
360 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
361 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
362 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
363 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
364 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
365 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
366 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
367 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
368 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
369 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
370 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
371 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
372 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
373 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
374 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
375 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
392 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
393 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
394 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
395 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
396 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
397 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
398 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
399 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
400 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
401 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
402 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
403 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
404 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
405 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
406 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
407 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
408 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
411 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
412 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
413 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
414 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
415 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
416 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
417 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
418 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
419 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
420 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
421 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
422 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
423 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
424 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
425 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
426 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
427 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
428 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
429 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
430 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
431 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
432 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
433 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
434 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
435 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
436 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
437 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
438 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
439 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
440 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
441 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
442 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
443 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
444 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
445 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
446 2738543024 Aminobacter sp. AP02 Isolate Unclassified
447 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
448 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
449 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
450 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
451 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
452 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
453 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
454 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
455 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
456 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
457 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
458 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
459 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
460 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
461 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
462 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 0.49
Isolates 1.1

Biome Distribution

Category Percentage (%)
Aerial Root 0.06
Bulb 0
Endosphere 3.13
Nodule 0.06
Rhizoplane 3.86
Rhizosphere 89.21
Stem 0
Stem Tuber 0
Unclassified 0.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501040_0015481 3300049576 Bacteria 5040
2 JGI24744J21845_10015159 3300002077 Bacteria 1542
3 JGI25406J46586_10001453 3300003203 Bacteria 11169
4 JGI25406J46586_10002115 3300003203 Bacteria 9373
5 JGI25406J46586_10003867 3300003203 Bacteria 7001
6 JGI25406J46586_10020800 3300003203 Bacteria 2645
7 rootH1_10003792 3300003316 Bacteria 7262
8 rootH1_10015730 3300003316 Bacteria 1731
9 rootH1_10130565 3300003316 Bacteria 1965
10 rootH2_10029474 3300003320 Bacteria 14064
11 rootH2_10077888 3300003320 Unclassified 3554
12 rootH2_10246637 3300003320 Unclassified 1691
13 rootL2_10072383 3300003322 Bacteria 19068
14 rootL2_10147111 3300003322 Bacteria 14666
15 rootL2_10218153 3300003322 Unclassified 3063
16 rootH1_10000715 3300003323 Bacteria 71212
17 rootH1_10017154 3300003323 Bacteria 13652
18 rootH1_10038814 3300003323 Bacteria 11585
19 rootH1_10052808 3300003323 Bacteria 5340
20 rootH1_10072353 3300003323 Bacteria 9071
21 rootH1_10074058 3300003323 Bacteria 8116
22 rootH1_10271435 3300003323 Bacteria 3399
23 rootH1_10309830 3300003323 Unclassified 3417
24 JGI25407J50210_10001911 3300003373 Bacteria 4834
25 Ga0055531_10000197 3300003794 Bacteria 66822
26 Ga0065704_10090251 3300005289 Bacteria 2801
27 Ga0065712_10000291 3300005290 Bacteria 19019
28 Ga0065712_10004042 3300005290 Bacteria 7055
29 Ga0065712_10069922 3300005290 Bacteria 6509
30 Ga0065715_10007485 3300005293 Bacteria 6998
31 Ga0065715_10088927 3300005293 Bacteria 28121
32 Ga0065715_10093813 3300005293 Bacteria 4545
33 Ga0065715_10115116 3300005293 Bacteria 2426
34 Ga0065707_10002597 3300005295 Bacteria 7059
35 Ga0065707_10095335 3300005295 Bacteria 3389
36 Ga0065707_10137250 3300005295 Bacteria 1823
37 Ga0070658_10004558 3300005327 Bacteria 11265
38 Ga0070658_10021319 3300005327 Bacteria 5193
39 Ga0070658_10047664 3300005327 Bacteria 3467
40 Ga0070658_10063213 3300005327 Bacteria 3017
41 Ga0070676_10001001 3300005328 Bacteria 14035
42 Ga0070676_10004892 3300005328 Bacteria 7098
43 Ga0070683_100014524 3300005329 Bacteria 6892
44 Ga0070683_100066029 3300005329 Bacteria 3370
45 Ga0070683_100072617 3300005329 Bacteria 3212
46 Ga0070683_100080888 3300005329 Bacteria 3041
47 Ga0070690_100020399 3300005330 Bacteria 4037
48 Ga0070690_100046269 3300005330 Bacteria 2766
49 Ga0070690_100082498 3300005330 Bacteria 2105
50 Ga0070690_100115957 3300005330 Bacteria 1793
51 Ga0070670_100002473 3300005331 Bacteria 15248
52 Ga0070670_100037369 3300005331 Bacteria 4178
53 Ga0070670_100048794 3300005331 Bacteria 3643
54 Ga0070670_100194418 3300005331 Bacteria 1762
55 Ga0070677_10004528 3300005333 Bacteria 4536
56 Ga0070677_10007902 3300005333 Bacteria 3560
57 Ga0070677_10020902 3300005333 Bacteria 2393
58 Ga0070677_10038389 3300005333 Bacteria 1874
59 Ga0068869_100011797 3300005334 Bacteria 5748
60 Ga0068869_100015575 3300005334 Bacteria 5105
61 Ga0068869_100051024 3300005334 Bacteria 3000
62 Ga0068869_100189935 3300005334 Bacteria 1615
63 Ga0070666_10017347 3300005335 Bacteria 4615
64 Ga0070666_10038037 3300005335 Bacteria 3201
65 Ga0070666_10039300 3300005335 Bacteria 3153
66 Ga0070666_10124172 3300005335 Bacteria 1791
67 Ga0070666_10185287 3300005335 Bacteria 1461
68 Ga0070680_100001439 3300005336 Bacteria 17241
69 Ga0070680_100121292 3300005336 Bacteria 2183
70 Ga0070682_100012961 3300005337 Bacteria 4786
71 Ga0070682_100192315 3300005337 Bacteria 1433
72 Ga0068868_100004371 3300005338 Bacteria 9905
73 Ga0068868_100028174 3300005338 Bacteria 4292
74 Ga0068868_100107984 3300005338 Bacteria 2259
75 Ga0068868_100147442 3300005338 Bacteria 1936
76 Ga0070660_100015905 3300005339 Bacteria 5447
77 Ga0070660_100049144 3300005339 Bacteria 3241
78 Ga0070660_100086389 3300005339 Bacteria 2468
79 Ga0070689_100014123 3300005340 Bacteria 5794
80 Ga0070689_100040242 3300005340 Bacteria 3583
81 Ga0070689_100085455 3300005340 Bacteria 2481
82 Ga0070689_100099802 3300005340 Bacteria 2297
83 Ga0070689_100202478 3300005340 Bacteria 1622
84 Ga0070689_100273604 3300005340 Bacteria 1399
85 Ga0070691_10000641 3300005341 Bacteria 13508
86 Ga0070691_10024585 3300005341 Bacteria 2800
87 Ga0070687_100012056 3300005343 Bacteria 3803
88 Ga0070661_100003449 3300005344 Bacteria 10918
89 Ga0070661_100075997 3300005344 Bacteria 2475
90 Ga0070661_100106273 3300005344 Bacteria 2093
91 Ga0070692_10019617 3300005345 Bacteria 3265
92 Ga0070668_100028688 3300005347 Bacteria 4223
93 Ga0070668_100051252 3300005347 Bacteria 3180
94 Ga0070668_100054752 3300005347 Bacteria 3077
95 Ga0070668_100255113 3300005347 Bacteria 1457
96 Ga0070669_100019309 3300005353 Bacteria 4867
97 Ga0070669_100024441 3300005353 Bacteria 4331
98 Ga0070669_100027704 3300005353 Bacteria 4079
99 Ga0070669_100055599 3300005353 Bacteria 2900
100 Ga0070669_100113862 3300005353 Bacteria 2056
101 Ga0070669_100125363 3300005353 Bacteria 1965
102 Ga0070675_100000253 3300005354 Bacteria 34898
103 Ga0070675_100000801 3300005354 Bacteria 22093
104 Ga0070675_100010643 3300005354 Bacteria 7191
105 Ga0070675_100012438 3300005354 Bacteria 6667
106 Ga0070675_100016586 3300005354 Bacteria 5847
107 Ga0070675_100024137 3300005354 Bacteria 4869
108 Ga0070675_100033328 3300005354 Bacteria 4176
109 Ga0070675_100036573 3300005354 Bacteria 3996
110 Ga0070675_100047989 3300005354 Bacteria 3500
111 Ga0070675_100051450 3300005354 Bacteria 3385
112 Ga0070675_100118766 3300005354 Bacteria 2245
113 Ga0070675_100127945 3300005354 Bacteria 2162
114 Ga0070675_100154473 3300005354 Bacteria 1969
115 Ga0070675_100159515 3300005354 Bacteria 1939
116 Ga0070675_100216181 3300005354 Bacteria 1668
117 Ga0070675_100306837 3300005354 Bacteria 1399
118 Ga0070671_100010783 3300005355 Bacteria 7332
119 Ga0070671_100012745 3300005355 Bacteria 6778
120 Ga0070671_100081478 3300005355 Bacteria 2706
121 Ga0070671_100126264 3300005355 Bacteria 2154
122 Ga0070671_100133600 3300005355 Bacteria 2091
123 Ga0070671_100251314 3300005355 Bacteria 1502
124 Ga0070674_100008245 3300005356 Bacteria 6192
125 Ga0070674_100011162 3300005356 Bacteria 5457
126 Ga0070674_100021567 3300005356 Bacteria 4140
127 Ga0070674_100025985 3300005356 Bacteria 3819
128 Ga0070674_100106384 3300005356 Bacteria 2053
129 Ga0070673_100003415 3300005364 Bacteria 9888
130 Ga0070673_100010744 3300005364 Bacteria 6212
131 Ga0070673_100011536 3300005364 Bacteria 6035
132 Ga0070673_100031373 3300005364 Bacteria 3987
133 Ga0070673_100039829 3300005364 Bacteria 3600
134 Ga0070673_100046128 3300005364 Bacteria 3383
135 Ga0070673_100141248 3300005364 Bacteria 2031
136 Ga0070673_100161682 3300005364 Bacteria 1905
137 Ga0070673_100370344 3300005364 Bacteria 1275
138 Ga0070688_100001161 3300005365 Bacteria 13117
139 Ga0070688_100003997 3300005365 Bacteria 7645
140 Ga0070688_100011267 3300005365 Bacteria 4964
141 Ga0070688_100032333 3300005365 Bacteria 3154
142 Ga0070688_100110805 3300005365 Bacteria 1825
143 Ga0070688_100134579 3300005365 Bacteria 1672
144 Ga0070659_100012472 3300005366 Bacteria 6301
145 Ga0070659_100196671 3300005366 Bacteria 1658
146 Ga0070659_100197851 3300005366 Bacteria 1653
147 Ga0070667_100022929 3300005367 Bacteria 5175
148 Ga0070667_100106195 3300005367 Bacteria 2430
149 Ga0070667_100110257 3300005367 Bacteria 2386
150 Ga0070667_100270192 3300005367 Bacteria 1524
151 Ga0070709_10005949 3300005434 Bacteria 6623
152 Ga0070714_100004846 3300005435 Bacteria 10215
153 Ga0070714_100008730 3300005435 Bacteria 7921
154 Ga0070714_100037767 3300005435 Bacteria 4060
155 Ga0070713_100039343 3300005436 Bacteria 3837
156 Ga0070701_10003780 3300005438 Bacteria 6046
157 Ga0070701_10006652 3300005438 Bacteria 4879
158 Ga0070701_10018766 3300005438 Bacteria 3255
159 Ga0070701_10074729 3300005438 Bacteria 1821
160 Ga0070701_10143987 3300005438 Bacteria 1366
161 Ga0070705_100006809 3300005440 Bacteria 5618
162 Ga0070705_100009951 3300005440 Bacteria 4746
163 Ga0070700_100067464 3300005441 Bacteria 2272
164 Ga0070694_100000107 3300005444 Bacteria 40436
165 Ga0070694_100010050 3300005444 Bacteria 5818
166 Ga0070694_100095545 3300005444 Bacteria 2093
167 Ga0070708_100009182 3300005445 Bacteria 7973
168 Ga0070708_100023470 3300005445 Bacteria 5247
169 Ga0070708_100025793 3300005445 Bacteria 5026
170 Ga0070708_100033340 3300005445 Bacteria 4474
171 Ga0070708_100036455 3300005445 Bacteria 4289
172 Ga0070708_100045037 3300005445 Bacteria 3885
173 Ga0070708_100085577 3300005445 Bacteria 2862
174 Ga0070708_100147932 3300005445 Bacteria 2183
175 Ga0070663_100093338 3300005455 Bacteria 2233
176 Ga0070663_100130434 3300005455 Bacteria 1908
177 Ga0070678_100002431 3300005456 Bacteria 10202
178 Ga0070678_100007740 3300005456 Bacteria 6389
179 Ga0070678_100014125 3300005456 Bacteria 5028
180 Ga0070678_100079193 3300005456 Bacteria 2484
181 Ga0070678_100290583 3300005456 Bacteria 1385
182 Ga0070662_100027802 3300005457 Bacteria 3931
183 Ga0070662_100104796 3300005457 Bacteria 2146
184 Ga0070662_100105552 3300005457 Bacteria 2139
185 Ga0070662_100119446 3300005457 Bacteria 2019
186 Ga0070662_100185094 3300005457 Bacteria 1644
187 Ga0070681_10097714 3300005458 Bacteria 2883
188 Ga0070681_10104952 3300005458 Bacteria 2768
189 Ga0070681_10115744 3300005458 Bacteria 2619
190 Ga0070681_10204787 3300005458 Bacteria 1890
191 Ga0070681_10369968 3300005458 Bacteria 1344
192 Ga0068867_100002815 3300005459 Bacteria 12228
193 Ga0068867_100003246 3300005459 Bacteria 11462
194 Ga0068867_100136856 3300005459 Bacteria 1910
195 Ga0070685_10004772 3300005466 Bacteria 6864
196 Ga0070685_10046696 3300005466 Bacteria 2487
197 Ga0070685_10058265 3300005466 Bacteria 2251
198 Ga0070706_100060461 3300005467 Bacteria 3498
199 Ga0070706_100115262 3300005467 Bacteria 2502
200 Ga0070706_100273176 3300005467 Bacteria 1577
201 Ga0070707_100001749 3300005468 Bacteria 20908
202 Ga0070707_100005817 3300005468 Bacteria 11501
203 Ga0070707_100073832 3300005468 Bacteria 3289
204 Ga0070707_100247852 3300005468 Bacteria 1733
205 Ga0070698_100007001 3300005471 Bacteria 12212
206 Ga0070698_100060247 3300005471 Bacteria 3830
207 Ga0070698_100124924 3300005471 Bacteria 2530
208 Ga0070699_100010678 3300005518 Bacteria 7949
209 Ga0070699_100017590 3300005518 Bacteria 6136
210 Ga0070699_100042598 3300005518 Bacteria 3929
211 Ga0070699_100064384 3300005518 Bacteria 3180
212 Ga0070699_100077001 3300005518 Bacteria 2903
213 Ga0070679_100024192 3300005530 Bacteria 5951
214 Ga0070679_100062464 3300005530 Bacteria 3714
215 Ga0070679_100210201 3300005530 Bacteria 1910
216 Ga0070684_100000213 3300005535 Bacteria 40774
217 Ga0070684_100023808 3300005535 Bacteria 5129
218 Ga0070684_100052441 3300005535 Bacteria 3548
219 Ga0070684_100086426 3300005535 Bacteria 2783
220 Ga0070684_100139022 3300005535 Bacteria 2195
221 Ga0070684_100169766 3300005535 Bacteria 1981
222 Ga0070684_100171779 3300005535 Bacteria 1969
223 Ga0070684_100173029 3300005535 Bacteria 1961
224 Ga0070697_100036753 3300005536 Bacteria 3956
225 Ga0070697_100045110 3300005536 Bacteria 3572
226 Ga0070697_100058647 3300005536 Bacteria 3133
227 Ga0070697_100152772 3300005536 Bacteria 1946
228 Ga0070697_100171230 3300005536 Bacteria 1838
229 Ga0068853_100011384 3300005539 Bacteria 7225
230 Ga0068853_100089669 3300005539 Bacteria 2701
231 Ga0068853_100209435 3300005539 Bacteria 1776
232 Ga0070672_100006459 3300005543 Bacteria 7881
233 Ga0070672_100016774 3300005543 Bacteria 5251
234 Ga0070672_100021164 3300005543 Bacteria 4754
235 Ga0070672_100027841 3300005543 Bacteria 4220
236 Ga0070672_100079330 3300005543 Bacteria 2628
237 Ga0070672_100088071 3300005543 Bacteria 2499
238 Ga0070672_100110689 3300005543 Bacteria 2238
239 Ga0070672_100129850 3300005543 Bacteria 2070
240 Ga0070686_100002473 3300005544 Bacteria 10175
241 Ga0070686_100023123 3300005544 Bacteria 3712
242 Ga0070686_100046276 3300005544 Bacteria 2745
243 Ga0070695_100001868 3300005545 Bacteria 11896
244 Ga0070695_100066492 3300005545 Bacteria 2349
245 Ga0070696_100022563 3300005546 Bacteria 4277
246 Ga0070696_100025334 3300005546 Bacteria 4032
247 Ga0070693_100032240 3300005547 Bacteria 2880
248 Ga0070693_100036425 3300005547 Bacteria 2735
249 Ga0070693_100124278 3300005547 Bacteria 1604
250 Ga0070665_100002991 3300005548 Bacteria 18259
251 Ga0070665_100021844 3300005548 Bacteria 6435
252 Ga0070665_100044289 3300005548 Bacteria 4469
253 Ga0070665_100176423 3300005548 Bacteria 2138
254 Ga0070704_100008238 3300005549 Bacteria 6237
255 Ga0070704_100033130 3300005549 Bacteria 3491
256 Ga0068855_100009123 3300005563 Bacteria 11980
257 Ga0068855_100108732 3300005563 Bacteria 3184
258 Ga0068855_100119594 3300005563 Bacteria 3016
259 Ga0068855_100133775 3300005563 Bacteria 2830
260 Ga0068855_100168419 3300005563 Bacteria 2482
261 Ga0068855_100379915 3300005563 Bacteria 1551
262 Ga0070664_100000586 3300005564 Bacteria 27743
263 Ga0070664_100003485 3300005564 Bacteria 12706
264 Ga0070664_100017864 3300005564 Bacteria 5823
265 Ga0070664_100042073 3300005564 Bacteria 3858
266 Ga0070664_100130673 3300005564 Bacteria 2206
267 Ga0070664_100163765 3300005564 Bacteria 1969
268 Ga0070664_100287132 3300005564 Bacteria 1485
269 Ga0068857_100085189 3300005577 Bacteria 2824
270 Ga0068857_100132500 3300005577 Bacteria 2248
271 Ga0068854_100030643 3300005578 Bacteria 3732
272 Ga0068854_100059050 3300005578 Bacteria 2771
273 Ga0068854_100113415 3300005578 Bacteria 2048
274 Ga0068854_100296381 3300005578 Bacteria 1307
275 Ga0068856_100051081 3300005614 Unclassified 4077
276 Ga0068856_100220826 3300005614 Bacteria 1910
277 Ga0070702_100002472 3300005615 Bacteria 7992
278 Ga0070702_100029233 3300005615 Bacteria 2995
279 Ga0070702_100057673 3300005615 Bacteria 2247
280 Ga0070702_100139159 3300005615 Bacteria 1544
281 Ga0070702_100150313 3300005615 Bacteria 1494
282 Ga0068852_100045599 3300005616 Bacteria 3730
283 Ga0068852_100064492 3300005616 Bacteria 3193
284 Ga0068852_100166839 3300005616 Bacteria 2061
285 Ga0068859_100029439 3300005617 Bacteria 5509
286 Ga0068859_100033086 3300005617 Bacteria 5193
287 Ga0068859_100041652 3300005617 Bacteria 4612
288 Ga0068859_100073857 3300005617 Bacteria 3448
289 Ga0068859_100136215 3300005617 Bacteria 2528
290 Ga0068859_100162559 3300005617 Bacteria 2312
291 Ga0068859_100228236 3300005617 Bacteria 1950
292 Ga0068864_100003807 3300005618 Bacteria 12440
293 Ga0068864_100012301 3300005618 Bacteria 7073
294 Ga0068864_100030047 3300005618 Bacteria 4605
295 Ga0068864_100071533 3300005618 Bacteria 3020
296 Ga0068864_100129009 3300005618 Bacteria 2269
297 Ga0068864_100194065 3300005618 Bacteria 1862
298 Ga0068864_100375659 3300005618 Bacteria 1346
299 Ga0068866_10038903 3300005718 Bacteria 2346
300 Ga0068861_100006139 3300005719 Bacteria 8175
301 Ga0068861_100015207 3300005719 Bacteria 5418
302 Ga0068861_100028959 3300005719 Bacteria 4045
303 Ga0068851_10024137 3300005834 Bacteria 2977
304 Ga0068851_10028093 3300005834 Bacteria 2777
305 Ga0068851_10037183 3300005834 Bacteria 2440
306 Ga0068870_10083230 3300005840 Bacteria 1773
307 Ga0068863_100046319 3300005841 Bacteria 4127
308 Ga0068863_100152745 3300005841 Bacteria 2210
309 Ga0068863_100213775 3300005841 Bacteria 1857
310 Ga0068863_100393234 3300005841 Bacteria 1355
311 Ga0068858_100000002 3300005842 Bacteria 351633
312 Ga0068858_100005689 3300005842 Bacteria 12184
313 Ga0068858_100018354 3300005842 Bacteria 6550
314 Ga0068858_100035040 3300005842 Bacteria 4656
315 Ga0068858_100096443 3300005842 Bacteria 2755
316 Ga0068858_100312344 3300005842 Bacteria 1501
317 Ga0068860_100014438 3300005843 Bacteria 7737
318 Ga0068860_100059285 3300005843 Bacteria 3639
319 Ga0068860_100097700 3300005843 Bacteria 2800
320 Ga0068860_100108479 3300005843 Bacteria 2653
321 Ga0068860_100202888 3300005843 Bacteria 1922
322 Ga0068862_100000192 3300005844 Bacteria 67711
323 Ga0068862_100016510 3300005844 Bacteria 6146
324 Ga0068862_100096827 3300005844 Bacteria 2576
325 Ga0068862_100157271 3300005844 Bacteria 2027
326 Ga0068862_100224329 3300005844 Bacteria 1702
327 Ga0081455_10000995 3300005937 Bacteria 35927
328 Ga0081455_10049132 3300005937 Bacteria 3639
329 Ga0081455_10120691 3300005937 Bacteria 2066
330 Ga0081538_10000004 3300005981 Bacteria 194737
331 Ga0081539_10000024 3300005985 Bacteria 354702
332 Ga0081539_10000035 3300005985 Bacteria 302689
333 Ga0081539_10000244 3300005985 Bacteria 127514
334 Ga0081539_10014216 3300005985 Bacteria 5910
335 Ga0081539_10017051 3300005985 Bacteria 5131
336 Ga0081539_10022783 3300005985 Bacteria 4128
337 Ga0081539_10054855 3300005985 Bacteria 2221
338 Ga0081539_10092488 3300005985 Bacteria 1560
339 Ga0081539_10094365 3300005985 Bacteria 1539
340 Ga0070717_10070185 3300006028 Bacteria 2919
341 Ga0075365_10036265 3300006038 Bacteria 3194
342 Ga0075365_10054928 3300006038 Bacteria 2642
343 Ga0075365_10055190 3300006038 Bacteria 2636
344 Ga0075365_10065905 3300006038 Bacteria 2428
345 Ga0075368_10002301 3300006042 Bacteria 6203
346 Ga0075368_10017923 3300006042 Bacteria 2655
347 Ga0075363_100000364 3300006048 Bacteria 13662
348 Ga0075363_100004611 3300006048 Bacteria 6052
349 Ga0075363_100019594 3300006048 Bacteria 3383
350 Ga0075364_10035090 3300006051 Bacteria 3240
351 Ga0075364_10059297 3300006051 Bacteria 2508
352 Ga0075364_10094090 3300006051 Bacteria 1990
353 Ga0075364_10138463 3300006051 Bacteria 1636
354 Ga0075432_10022092 3300006058 Bacteria 2175
355 Ga0075432_10038984 3300006058 Bacteria 1656
356 Ga0070712_100069113 3300006175 Bacteria 2519
357 Ga0075367_10036217 3300006178 Bacteria 2860
358 Ga0075367_10123291 3300006178 Bacteria 1598
359 Ga0075369_10001831 3300006186 Bacteria 7419
360 Ga0075366_10006958 3300006195 Bacteria 6227
361 Ga0097621_100000510 3300006237 Bacteria 27211
362 Ga0097621_100023601 3300006237 Bacteria 4790
363 Ga0097621_100082245 3300006237 Bacteria 2681
364 Ga0097621_100092591 3300006237 Bacteria 2532
365 Ga0097621_100099825 3300006237 Bacteria 2441
366 Ga0097621_100108084 3300006237 Bacteria 2348
367 Ga0097621_100116772 3300006237 Bacteria 2260
368 Ga0097621_100125172 3300006237 Bacteria 2183
369 Ga0097621_100135672 3300006237 Bacteria 2099
370 Ga0075370_10013756 3300006353 Bacteria 4306
371 Ga0075370_10034318 3300006353 Bacteria 2844
372 Ga0075370_10047475 3300006353 Bacteria 2431
373 Ga0068871_100000108 3300006358 Bacteria 50255
374 Ga0068871_100001762 3300006358 Bacteria 14573
375 Ga0068871_100005779 3300006358 Bacteria 8691
376 Ga0068871_100044770 3300006358 Bacteria 3561
377 Ga0068871_100080567 3300006358 Bacteria 2696
378 Ga0068871_100129739 3300006358 Bacteria 2136
379 Ga0068871_100195840 3300006358 Bacteria 1743
380 Ga0075428_100000100 3300006844 Bacteria 72697
381 Ga0075428_100001176 3300006844 Bacteria 28020
382 Ga0075428_100002267 3300006844 Bacteria 20832
383 Ga0075428_100002710 3300006844 Bacteria 19287
384 Ga0075428_100003258 3300006844 Bacteria 17774
385 Ga0075428_100004744 3300006844 Bacteria 15048
386 Ga0075428_100011875 3300006844 Bacteria 9686
387 Ga0075428_100020681 3300006844 Bacteria 7288
388 Ga0075428_100021454 3300006844 Bacteria 7148
389 Ga0075428_100058385 3300006844 Bacteria 4224
390 Ga0075428_100061209 3300006844 Bacteria 4122
391 Ga0075428_100069973 3300006844 Bacteria 3836
392 Ga0075428_100072723 3300006844 Bacteria 3755
393 Ga0075428_100092312 3300006844 Bacteria 3301
394 Ga0075428_100106053 3300006844 Bacteria 3063
395 Ga0075428_100109485 3300006844 Bacteria 3010
396 Ga0075430_100002969 3300006846 Bacteria 14207
397 Ga0075430_100007284 3300006846 Bacteria 9338
398 Ga0075430_100015760 3300006846 Bacteria 6438
399 Ga0075430_100034006 3300006846 Bacteria 4325
400 Ga0075430_100045040 3300006846 Bacteria 3729
401 Ga0075430_100079058 3300006846 Bacteria 2757
402 Ga0075430_100090238 3300006846 Bacteria 2564
403 Ga0075430_100134779 3300006846 Bacteria 2058
404 Ga0075431_100001491 3300006847 Bacteria 21644
405 Ga0075431_100002445 3300006847 Bacteria 17879
406 Ga0075431_100003423 3300006847 Bacteria 15391
407 Ga0075431_100004448 3300006847 Bacteria 13746
408 Ga0075431_100008897 3300006847 Bacteria 10058
409 Ga0075431_100009529 3300006847 Bacteria 9755
410 Ga0075431_100009670 3300006847 Bacteria 9683
411 Ga0075431_100015256 3300006847 Bacteria 7786
412 Ga0075431_100018729 3300006847 Bacteria 7053
413 Ga0075431_100026022 3300006847 Bacteria 5999
414 Ga0075431_100076459 3300006847 Bacteria 3455
415 Ga0075431_100179361 3300006847 Bacteria 2174
416 Ga0075431_100217028 3300006847 Bacteria 1952
417 Ga0075433_10000348 3300006852 Bacteria 28818
418 Ga0075433_10006016 3300006852 Bacteria 9559
419 Ga0075433_10013934 3300006852 Bacteria 6554
420 Ga0075433_10026871 3300006852 Bacteria 4877
421 Ga0075433_10029614 3300006852 Bacteria 4667
422 Ga0075433_10082409 3300006852 Bacteria 2837
423 Ga0075433_10116262 3300006852 Bacteria 2373
424 Ga0075434_100002451 3300006871 Bacteria 16337
425 Ga0075434_100009109 3300006871 Bacteria 9249
426 Ga0075434_100017333 3300006871 Bacteria 6936
427 Ga0075434_100019774 3300006871 Bacteria 6519
428 Ga0075434_100021900 3300006871 Bacteria 6221
429 Ga0075434_100023769 3300006871 Bacteria 5980
430 Ga0075434_100041223 3300006871 Bacteria 4574
431 Ga0075434_100092342 3300006871 Bacteria 3029
432 Ga0075434_100106257 3300006871 Bacteria 2817
433 Ga0075434_100391167 3300006871 Bacteria 1411
434 Ga0075429_100000082 3300006880 Bacteria 49180
435 Ga0075429_100005845 3300006880 Bacteria 10615
436 Ga0075429_100008969 3300006880 Bacteria 8687
437 Ga0075429_100009769 3300006880 Bacteria 8318
438 Ga0075429_100055229 3300006880 Bacteria 3456
439 Ga0075429_100057994 3300006880 Bacteria 3372
440 Ga0075429_100071554 3300006880 Bacteria 3020
441 Ga0075429_100103843 3300006880 Bacteria 2482
442 Ga0075429_100160770 3300006880 Bacteria 1967
443 Ga0075429_100278492 3300006880 Bacteria 1465
444 Ga0075429_100305469 3300006880 Bacteria 1393
445 Ga0068865_100004918 3300006881 Bacteria 8076
446 Ga0068865_100051701 3300006881 Bacteria 2845
447 Ga0068865_100083553 3300006881 Bacteria 2299
448 Ga0068865_100103385 3300006881 Bacteria 2089
449 Ga0068865_100179413 3300006881 Bacteria 1630
450 Ga0068865_100202672 3300006881 Bacteria 1541
451 Ga0075436_100003014 3300006914 Bacteria 11541
452 Ga0075436_100058685 3300006914 Bacteria 2658
453 Ga0097620_100029436 3300006931 Bacteria 5509
454 Ga0097620_100033086 3300006931 Bacteria 5193
455 Ga0097620_100041655 3300006931 Bacteria 4612
456 Ga0097620_100073858 3300006931 Bacteria 3448
457 Ga0097620_100136213 3300006931 Bacteria 2528
458 Ga0097620_100162560 3300006931 Bacteria 2312
459 Ga0097620_100228244 3300006931 Bacteria 1950
460 Ga0075435_100003226 3300007076 Bacteria 11043
461 Ga0075435_100003893 3300007076 Bacteria 10196
462 Ga0075435_100020624 3300007076 Bacteria 5055
463 Ga0075435_100040892 3300007076 Bacteria 3704
464 Ga0075435_100042755 3300007076 Bacteria 3625
465 Ga0075435_100064482 3300007076 Bacteria 2977
466 Ga0075435_100101013 3300007076 Bacteria 2390
467 Ga0099794_10002655 3300007265 Bacteria 6655
468 Ga0099794_10008572 3300007265 Bacteria 4255
469 Ga0105240_10021429 3300009093 Bacteria 8593
470 Ga0105240_10275252 3300009093 Bacteria 1937
471 Ga0105240_10405961 3300009093 Bacteria 1533
472 Ga0111539_10003771 3300009094 Bacteria 19940
473 Ga0111539_10004229 3300009094 Bacteria 18819
474 Ga0111539_10004348 3300009094 Bacteria 18553
475 Ga0111539_10009801 3300009094 Bacteria 12091
476 Ga0111539_10021661 3300009094 Bacteria 7906
477 Ga0111539_10029039 3300009094 Bacteria 6742
478 Ga0111539_10034471 3300009094 Bacteria 6137
479 Ga0111539_10037135 3300009094 Bacteria 5884
480 Ga0111539_10048226 3300009094 Bacteria 5087
481 Ga0111539_10075167 3300009094 Bacteria 3981
482 Ga0111539_10092226 3300009094 Bacteria 3559
483 Ga0111539_10096271 3300009094 Bacteria 3477
484 Ga0111539_10108999 3300009094 Bacteria 3249
485 Ga0111539_10147900 3300009094 Bacteria 2750
486 Ga0111539_10159359 3300009094 Bacteria 2640
487 Ga0111539_10218455 3300009094 Bacteria 2220
488 Ga0111539_10229966 3300009094 Bacteria 2159
489 Ga0111539_10238610 3300009094 Bacteria 2116
490 Ga0111539_10576760 3300009094 Bacteria 1310
491 Ga0105245_10018518 3300009098 Bacteria 6090
492 Ga0105245_10049152 3300009098 Bacteria 3775
493 Ga0105245_10064134 3300009098 Bacteria 3320
494 Ga0105247_10011104 3300009101 Bacteria 5432
495 Ga0105247_10018503 3300009101 Bacteria 4178
496 Ga0114129_10000032 3300009147 Bacteria 111487
497 Ga0114129_10000127 3300009147 Bacteria 77507
498 Ga0114129_10000939 3300009147 Bacteria 38096
499 Ga0114129_10003134 3300009147 Bacteria 23200
500 Ga0114129_10003744 3300009147 Bacteria 21440
501 Ga0114129_10006207 3300009147 Bacteria 16951
502 Ga0114129_10006952 3300009147 Bacteria 16099
503 Ga0114129_10011327 3300009147 Bacteria 12704
504 Ga0114129_10015037 3300009147 Bacteria 11018
505 Ga0114129_10017930 3300009147 Bacteria 10079
506 Ga0114129_10029973 3300009147 Bacteria 7704
507 Ga0114129_10033131 3300009147 Bacteria 7301
508 Ga0114129_10037256 3300009147 Bacteria 6867
509 Ga0114129_10071958 3300009147 Bacteria 4820
510 Ga0114129_10157201 3300009147 Bacteria 3108
511 Ga0114129_10185545 3300009147 Bacteria 2827
512 Ga0114129_10200567 3300009147 Bacteria 2702
513 Ga0114129_10210827 3300009147 Bacteria 2626
514 Ga0114129_10556086 3300009147 Bacteria 1491
515 Ga0105243_10002886 3300009148 Bacteria 14242
516 Ga0105243_10006221 3300009148 Bacteria 9229
517 Ga0105243_10009076 3300009148 Bacteria 7596
518 Ga0105243_10013026 3300009148 Bacteria 6283
519 Ga0105243_10036259 3300009148 Bacteria 3827
520 Ga0105243_10054643 3300009148 Bacteria 3171
521 Ga0105243_10057372 3300009148 Bacteria 3100
522 Ga0105243_10163848 3300009148 Bacteria 1919
523 Ga0105243_10350370 3300009148 Bacteria 1355
524 Ga0105243_10411699 3300009148 Bacteria 1258
525 Ga0105241_10009863 3300009174 Bacteria 7019
526 Ga0105241_10122279 3300009174 Bacteria 2098
527 Ga0105242_10002197 3300009176 Bacteria 15395
528 Ga0105242_10026154 3300009176 Bacteria 4624
529 Ga0105242_10026311 3300009176 Bacteria 4611
530 Ga0105242_10109442 3300009176 Bacteria 2353
531 Ga0105242_10113762 3300009176 Bacteria 2311
532 Ga0105242_10114559 3300009176 Bacteria 2304
533 Ga0105242_10121863 3300009176 Bacteria 2239
534 Ga0105242_10190971 3300009176 Bacteria 1813
535 Ga0105248_10000943 3300009177 Bacteria 32364
536 Ga0105248_10007178 3300009177 Bacteria 12223
537 Ga0105248_10009334 3300009177 Bacteria 10803
538 Ga0105248_10012226 3300009177 Bacteria 9466
539 Ga0105248_10018050 3300009177 Bacteria 7788
540 Ga0105248_10029846 3300009177 Bacteria 6085
541 Ga0105248_10079334 3300009177 Bacteria 3690
542 Ga0105248_10098948 3300009177 Bacteria 3286
543 Ga0105248_10120483 3300009177 Bacteria 2960
544 Ga0105248_10177132 3300009177 Bacteria 2403
545 Ga0105248_10318894 3300009177 Bacteria 1750
546 Ga0105248_10368026 3300009177 Bacteria 1618
547 Ga0105238_10005510 3300009551 Bacteria 12501
548 Ga0105238_10038120 3300009551 Bacteria 4882
549 Ga0105238_10137774 3300009551 Bacteria 2418
550 Ga0105238_10170887 3300009551 Bacteria 2150
551 Ga0105238_10197339 3300009551 Bacteria 1988
552 Ga0105249_10003805 3300009553 Bacteria 13025
553 Ga0105249_10009569 3300009553 Bacteria 8493
554 Ga0105249_10028809 3300009553 Bacteria 5012
555 Ga0105249_10412692 3300009553 Bacteria 1382
556 Ga0105239_10081521 3300010375 Bacteria 3561
557 Ga0105239_10112876 3300010375 Bacteria 3013
558 Ga0105239_10274524 3300010375 Bacteria 1897
559 Ga0105246_10002150 3300011119 Bacteria 11883
560 Ga0105246_10021870 3300011119 Bacteria 4122
561 Ga0105246_10136664 3300011119 Bacteria 1838
562 Ga0105246_10143116 3300011119 Bacteria 1801
563 Ga0105246_10147169 3300011119 Bacteria 1779
564 Ga0157371_10024677 3300013102 Bacteria 4387
565 Ga0157370_10016729 3300013104 Bacteria 7421
566 Ga0157370_10042219 3300013104 Bacteria 4396
567 Ga0157370_10116970 3300013104 Bacteria 2490
568 Ga0157369_10011406 3300013105 Bacteria 10092
569 Ga0157369_10012708 3300013105 Bacteria 9548
570 Ga0157374_10191254 3300013296 Bacteria 2002
571 Ga0157374_10242036 3300013296 Bacteria 1774
572 Ga0157378_10090899 3300013297 Bacteria 2775
573 Ga0157378_10120861 3300013297 Bacteria 2414
574 Ga0157378_10171200 3300013297 Bacteria 2037
575 Ga0157378_10391349 3300013297 Bacteria 1367
576 Ga0163162_10008524 3300013306 Bacteria 9993
577 Ga0163162_10008622 3300013306 Bacteria 9935
578 Ga0163162_10092279 3300013306 Bacteria 3112
579 Ga0163162_10331878 3300013306 Bacteria 1653
580 Ga0157372_10046056 3300013307 Bacteria 4840
581 Ga0157372_10079042 3300013307 Bacteria 3718
582 Ga0157372_10265210 3300013307 Bacteria 1994
583 Ga0157375_10017505 3300013308 Bacteria 6469
584 Ga0157375_10047330 3300013308 Bacteria 4199
585 Ga0157375_10066597 3300013308 Bacteria 3597
586 Ga0157375_10074179 3300013308 Bacteria 3423
587 Ga0157375_10107640 3300013308 Bacteria 2881
588 Ga0157375_10114966 3300013308 Bacteria 2793
589 Ga0157375_10211661 3300013308 Bacteria 2096
590 Ga0163163_10008055 3300014325 Bacteria 9335
591 Ga0163163_10017879 3300014325 Bacteria 6620
592 Ga0163163_10022835 3300014325 Bacteria 5930
593 Ga0163163_10047022 3300014325 Bacteria 4240
594 Ga0163163_10071192 3300014325 Bacteria 3464
595 Ga0163163_10087836 3300014325 Bacteria 3120
596 Ga0163163_10136659 3300014325 Bacteria 2492
597 Ga0163163_10210525 3300014325 Bacteria 1993
598 Ga0163163_10544418 3300014325 Bacteria 1223
599 Ga0157380_10001491 3300014326 Bacteria 15326
600 Ga0157380_10010921 3300014326 Bacteria 6549
601 Ga0157380_10014471 3300014326 Bacteria 5772
602 Ga0157380_10029501 3300014326 Bacteria 4192
603 Ga0157380_10030663 3300014326 Bacteria 4121
604 Ga0157380_10036819 3300014326 Bacteria 3788
605 Ga0157380_10037074 3300014326 Bacteria 3777
606 Ga0157380_10064627 3300014326 Bacteria 2938
607 Ga0157380_10067423 3300014326 Bacteria 2881
608 Ga0157380_10116889 3300014326 Bacteria 2252
609 Ga0157380_10175468 3300014326 Bacteria 1877
610 Ga0157380_10204849 3300014326 Bacteria 1753
611 Ga0157380_10344942 3300014326 Bacteria 1391
612 Ga0157380_10367117 3300014326 Bacteria 1353
613 Ga0157380_10367951 3300014326 Bacteria 1352
614 Ga0182008_10006801 3300014497 Bacteria 6363
615 Ga0157377_10005968 3300014745 Bacteria 5769
616 Ga0157377_10011755 3300014745 Bacteria 4379
617 Ga0157377_10109470 3300014745 Bacteria 1658
618 Ga0157379_10000007 3300014968 Bacteria 142402
619 Ga0157379_10003064 3300014968 Bacteria 14133
620 Ga0157379_10013575 3300014968 Bacteria 7138
621 Ga0157379_10017832 3300014968 Bacteria 6255
622 Ga0157379_10044088 3300014968 Bacteria 3982
623 Ga0157379_10069016 3300014968 Bacteria 3160
624 Ga0157379_10190944 3300014968 Bacteria 1851
625 Ga0157379_10203540 3300014968 Bacteria 1790
626 Ga0157376_10011280 3300014969 Bacteria 6579
627 Ga0157376_10036613 3300014969 Bacteria 3976
628 Ga0157376_10070517 3300014969 Bacteria 2967
629 Ga0157376_10299891 3300014969 Bacteria 1521
630 Ga0182007_10023328 3300015262 Bacteria 2176
631 Ga0163161_10028324 3300017792 Bacteria 3978
632 Ga0163161_10078278 3300017792 Bacteria 2430
633 Ga0206356_10209910 3300020070 Bacteria 4669
634 Ga0206353_10257956 3300020082 Bacteria 1212
635 Ga0206353_10390452 3300020082 Bacteria 14670
636 Ga0206353_11931331 3300020082 Bacteria 4097
637 Ga0213876_10086674 3300021384 Bacteria 1657
638 Ga0209050_1002956 3300025298 Bacteria 13286
639 Ga0209257_1000006 3300025304 Bacteria 1570111
640 Ga0207697_10002059 3300025315 Bacteria 10589
641 Ga0207697_10002496 3300025315 Bacteria 9506
642 Ga0207697_10028256 3300025315 Bacteria 2294
643 Ga0207697_10068738 3300025315 Bacteria 1482
644 Ga0207656_10045227 3300025321 Bacteria 1883
645 Ga0207682_10002902 3300025893 Bacteria 7559
646 Ga0207682_10003368 3300025893 Bacteria 6959
647 Ga0207682_10011854 3300025893 Bacteria 3405
648 Ga0207642_10036849 3300025899 Bacteria 2103
649 Ga0207688_10004310 3300025901 Bacteria 7760
650 Ga0207688_10010791 3300025901 Bacteria 4972
651 Ga0207688_10063280 3300025901 Bacteria 2087
652 Ga0207688_10092310 3300025901 Bacteria 1740
653 Ga0207680_10053614 3300025903 Bacteria 2422
654 Ga0207680_10111437 3300025903 Bacteria 1775
655 Ga0207699_10014716 3300025906 Bacteria 4043
656 Ga0207645_10001211 3300025907 Bacteria 21295
657 Ga0207645_10002990 3300025907 Bacteria 13067
658 Ga0207645_10054617 3300025907 Bacteria 2551
659 Ga0207645_10056145 3300025907 Bacteria 2514
660 Ga0207645_10079852 3300025907 Bacteria 2097
661 Ga0207645_10080516 3300025907 Bacteria 2088
662 Ga0207643_10006077 3300025908 Bacteria 6452
663 Ga0207643_10010032 3300025908 Bacteria 5092
664 Ga0207643_10014099 3300025908 Bacteria 4339
665 Ga0207643_10021872 3300025908 Bacteria 3518
666 Ga0207643_10037355 3300025908 Bacteria 2725
667 Ga0207643_10048157 3300025908 Bacteria 2414
668 Ga0207643_10132954 3300025908 Bacteria 1482
669 Ga0207705_10003753 3300025909 Bacteria 11574
670 Ga0207705_10054656 3300025909 Bacteria 2878
671 Ga0207705_10069859 3300025909 Bacteria 2544
672 Ga0207684_10000491 3300025910 Bacteria 50201
673 Ga0207684_10031743 3300025910 Bacteria 4493
674 Ga0207684_10311778 3300025910 Bacteria 1356
675 Ga0207654_10014370 3300025911 Bacteria 4089
676 Ga0207707_10019997 3300025912 Bacteria 5842
677 Ga0207695_10014226 3300025913 Bacteria 9438
678 Ga0207695_10059773 3300025913 Bacteria 3950
679 Ga0207695_10158762 3300025913 Bacteria 2194
680 Ga0207693_10120583 3300025915 Bacteria 2059
681 Ga0207660_10015632 3300025917 Bacteria 5012
682 Ga0207662_10019025 3300025918 Bacteria 3902
683 Ga0207662_10022979 3300025918 Bacteria 3579
684 Ga0207662_10084746 3300025918 Bacteria 1939
685 Ga0207662_10088745 3300025918 Bacteria 1899
686 Ga0207662_10185391 3300025918 Bacteria 1341
687 Ga0207657_10024642 3300025919 Bacteria 5565
688 Ga0207657_10040322 3300025919 Bacteria 4138
689 Ga0207657_10100137 3300025919 Bacteria 2406
690 Ga0207649_10023474 3300025920 Bacteria 3573
691 Ga0207649_10043227 3300025920 Bacteria 2754
692 Ga0207649_10129224 3300025920 Bacteria 1714
693 Ga0207652_10047440 3300025921 Bacteria 3669
694 Ga0207646_10001586 3300025922 Bacteria 27768
695 Ga0207646_10002404 3300025922 Bacteria 22088
696 Ga0207646_10009215 3300025922 Bacteria 9784
697 Ga0207646_10012777 3300025922 Bacteria 8053
698 Ga0207646_10017164 3300025922 Bacteria 6779
699 Ga0207646_10028693 3300025922 Bacteria 5063
700 Ga0207646_10092641 3300025922 Bacteria 2705
701 Ga0207681_10009853 3300025923 Bacteria 5844
702 Ga0207681_10020691 3300025923 Bacteria 4173
703 Ga0207681_10111301 3300025923 Bacteria 1992
704 Ga0207681_10135371 3300025923 Bacteria 1827
705 Ga0207681_10220191 3300025923 Bacteria 1468
706 Ga0207694_10015342 3300025924 Bacteria 5781
707 Ga0207650_10032986 3300025925 Bacteria 3748
708 Ga0207650_10142047 3300025925 Bacteria 1888
709 Ga0207650_10191455 3300025925 Bacteria 1634
710 Ga0207659_10000209 3300025926 Bacteria 35219
711 Ga0207659_10000854 3300025926 Bacteria 18070
712 Ga0207659_10002047 3300025926 Bacteria 11973
713 Ga0207659_10006129 3300025926 Bacteria 7345
714 Ga0207659_10009478 3300025926 Bacteria 6087
715 Ga0207659_10011484 3300025926 Bacteria 5596
716 Ga0207659_10030752 3300025926 Bacteria 3671
717 Ga0207659_10035003 3300025926 Bacteria 3468
718 Ga0207659_10036189 3300025926 Bacteria 3417
719 Ga0207659_10045322 3300025926 Bacteria 3100
720 Ga0207659_10056908 3300025926 Bacteria 2801
721 Ga0207687_10016974 3300025927 Bacteria 4785
722 Ga0207700_10195584 3300025928 Bacteria 1701
723 Ga0207664_10028758 3300025929 Bacteria 4227
724 Ga0207664_10083724 3300025929 Bacteria 2601
725 Ga0207644_10038219 3300025931 Bacteria 3380
726 Ga0207644_10039388 3300025931 Bacteria 3336
727 Ga0207644_10040682 3300025931 Bacteria 3286
728 Ga0207644_10153803 3300025931 Bacteria 1782
729 Ga0207644_10204901 3300025931 Bacteria 1557
730 Ga0207706_10009358 3300025933 Bacteria 8996
731 Ga0207706_10015076 3300025933 Bacteria 6996
732 Ga0207706_10038166 3300025933 Bacteria 4261
733 Ga0207706_10038926 3300025933 Bacteria 4217
734 Ga0207706_10041924 3300025933 Bacteria 4056
735 Ga0207706_10082819 3300025933 Bacteria 2820
736 Ga0207706_10087790 3300025933 Bacteria 2735
737 Ga0207686_10003421 3300025934 Bacteria 8521
738 Ga0207686_10006274 3300025934 Bacteria 6397
739 Ga0207686_10010825 3300025934 Bacteria 4973
740 Ga0207686_10217860 3300025934 Bacteria 1376
741 Ga0207709_10008062 3300025935 Bacteria 5834
742 Ga0207709_10010140 3300025935 Bacteria 5189
743 Ga0207709_10017542 3300025935 Bacteria 3996
744 Ga0207709_10028476 3300025935 Bacteria 3230
745 Ga0207709_10058745 3300025935 Bacteria 2391
746 Ga0207709_10061172 3300025935 Bacteria 2352
747 Ga0207709_10167256 3300025935 Bacteria 1540
748 Ga0207670_10003370 3300025936 Bacteria 8479
749 Ga0207670_10050656 3300025936 Bacteria 2784
750 Ga0207670_10058770 3300025936 Bacteria 2613
751 Ga0207670_10058784 3300025936 Bacteria 2613
752 Ga0207670_10149525 3300025936 Bacteria 1731
753 Ga0207670_10198646 3300025936 Bacteria 1522
754 Ga0207670_10199551 3300025936 Bacteria 1519
755 Ga0207670_10200801 3300025936 Bacteria 1515
756 Ga0207670_10235702 3300025936 Bacteria 1407
757 Ga0207670_10274841 3300025936 Bacteria 1311
758 Ga0207669_10016067 3300025937 Bacteria 3792
759 Ga0207669_10019064 3300025937 Bacteria 3563
760 Ga0207669_10058122 3300025937 Bacteria 2358
761 Ga0207704_10043620 3300025938 Bacteria 2650
762 Ga0207704_10075104 3300025938 Bacteria 2160
763 Ga0207691_10006867 3300025940 Bacteria 10983
764 Ga0207691_10006894 3300025940 Bacteria 10958
765 Ga0207691_10029696 3300025940 Bacteria 5113
766 Ga0207691_10030061 3300025940 Bacteria 5079
767 Ga0207691_10036136 3300025940 Bacteria 4578
768 Ga0207691_10051484 3300025940 Bacteria 3764
769 Ga0207691_10081206 3300025940 Bacteria 2915
770 Ga0207691_10087850 3300025940 Bacteria 2789
771 Ga0207691_10150241 3300025940 Bacteria 2048
772 Ga0207711_10001278 3300025941 Bacteria 23847
773 Ga0207711_10010515 3300025941 Bacteria 7688
774 Ga0207711_10011686 3300025941 Bacteria 7295
775 Ga0207711_10018748 3300025941 Bacteria 5753
776 Ga0207711_10062275 3300025941 Bacteria 3218
777 Ga0207711_10090877 3300025941 Bacteria 2685
778 Ga0207711_10097778 3300025941 Bacteria 2592
779 Ga0207689_10006638 3300025942 Bacteria 10203
780 Ga0207689_10036444 3300025942 Bacteria 4083
781 Ga0207689_10038079 3300025942 Bacteria 3984
782 Ga0207689_10092527 3300025942 Bacteria 2484
783 Ga0207689_10292362 3300025942 Bacteria 1350
784 Ga0207661_10001430 3300025944 Bacteria 16095
785 Ga0207661_10001693 3300025944 Bacteria 15030
786 Ga0207661_10017151 3300025944 Bacteria 5352
787 Ga0207661_10043583 3300025944 Bacteria 3542
788 Ga0207661_10059670 3300025944 Bacteria 3075
789 Ga0207661_10105298 3300025944 Bacteria 2376
790 Ga0207679_10007694 3300025945 Bacteria 6844
791 Ga0207679_10037475 3300025945 Bacteria 3447
792 Ga0207679_10059730 3300025945 Bacteria 2830
793 Ga0207679_10090800 3300025945 Bacteria 2362
794 Ga0207679_10117062 3300025945 Bacteria 2114
795 Ga0207679_10167973 3300025945 Bacteria 1803
796 Ga0207679_10168597 3300025945 Bacteria 1800
797 Ga0207667_10073659 3300025949 Bacteria 3548
798 Ga0207667_10086606 3300025949 Bacteria 3242
799 Ga0207667_10250735 3300025949 Bacteria 1811
800 Ga0207651_10009269 3300025960 Bacteria 5375
801 Ga0207651_10026264 3300025960 Bacteria 3634
802 Ga0207651_10028137 3300025960 Bacteria 3541
803 Ga0207651_10105102 3300025960 Bacteria 2105
804 Ga0207651_10121253 3300025960 Bacteria 1983
805 Ga0207651_10203723 3300025960 Bacteria 1587
806 Ga0207651_10326444 3300025960 Bacteria 1284
807 Ga0207712_10016816 3300025961 Bacteria 4742
808 Ga0207712_10023448 3300025961 Bacteria 4072
809 Ga0207712_10035472 3300025961 Bacteria 3389
810 Ga0207712_10048939 3300025961 Bacteria 2943
811 Ga0207712_10105025 3300025961 Bacteria 2107
812 Ga0207640_10063796 3300025981 Bacteria 2449
813 Ga0207640_10109378 3300025981 Bacteria 1955
814 Ga0207640_10145833 3300025981 Bacteria 1732
815 Ga0207658_10105918 3300025986 Bacteria 2213
816 Ga0207658_10194161 3300025986 Bacteria 1690
817 Ga0207677_10005324 3300026023 Bacteria 6976
818 Ga0207677_10123707 3300026023 Bacteria 1951
819 Ga0207677_10181823 3300026023 Bacteria 1655
820 Ga0207703_10000001 3300026035 Bacteria 822925
821 Ga0207703_10001811 3300026035 Bacteria 19051
822 Ga0207703_10003450 3300026035 Bacteria 13241
823 Ga0207703_10028221 3300026035 Bacteria 4422
824 Ga0207703_10064866 3300026035 Bacteria 2999
825 Ga0207639_10175722 3300026041 Bacteria 1818
826 Ga0207639_10205469 3300026041 Bacteria 1692
827 Ga0207678_10004486 3300026067 Bacteria 12554
828 Ga0207678_10036465 3300026067 Bacteria 4280
829 Ga0207678_10045317 3300026067 Bacteria 3803
830 Ga0207678_10067075 3300026067 Bacteria 3080
831 Ga0207678_10074382 3300026067 Bacteria 2911
832 Ga0207678_10112554 3300026067 Bacteria 2321
833 Ga0207678_10121680 3300026067 Bacteria 2227
834 Ga0207708_10003212 3300026075 Bacteria 12042
835 Ga0207708_10003477 3300026075 Bacteria 11612
836 Ga0207708_10008663 3300026075 Bacteria 7531
837 Ga0207708_10014140 3300026075 Bacteria 5966
838 Ga0207708_10018446 3300026075 Bacteria 5255
839 Ga0207708_10051556 3300026075 Bacteria 3133
840 Ga0207708_10056058 3300026075 Bacteria 3006
841 Ga0207708_10081767 3300026075 Bacteria 2483
842 Ga0207708_10082413 3300026075 Bacteria 2473
843 Ga0207708_10147771 3300026075 Bacteria 1848
844 Ga0207708_10314022 3300026075 Bacteria 1277
845 Ga0207702_10032147 3300026078 Bacteria 4379
846 Ga0207702_10135040 3300026078 Bacteria 2225
847 Ga0207702_10216984 3300026078 Bacteria 1781
848 Ga0207641_10087888 3300026088 Bacteria 2712
849 Ga0207641_10122856 3300026088 Bacteria 2320
850 Ga0207641_10148860 3300026088 Bacteria 2119
851 Ga0207648_10001129 3300026089 Bacteria 29973
852 Ga0207648_10004649 3300026089 Bacteria 14051
853 Ga0207648_10013721 3300026089 Bacteria 7521
854 Ga0207648_10023072 3300026089 Bacteria 5581
855 Ga0207648_10023618 3300026089 Bacteria 5504
856 Ga0207648_10031547 3300026089 Bacteria 4684
857 Ga0207648_10031931 3300026089 Bacteria 4652
858 Ga0207648_10046921 3300026089 Bacteria 3787
859 Ga0207648_10054768 3300026089 Bacteria 3483
860 Ga0207648_10063665 3300026089 Bacteria 3214
861 Ga0207648_10113510 3300026089 Bacteria 2379
862 Ga0207648_10191481 3300026089 Bacteria 1813
863 Ga0207648_10305520 3300026089 Bacteria 1427
864 Ga0207676_10022681 3300026095 Bacteria 4619
865 Ga0207676_10047034 3300026095 Bacteria 3342
866 Ga0207676_10087204 3300026095 Bacteria 2552
867 Ga0207676_10124781 3300026095 Bacteria 2178
868 Ga0207674_10019100 3300026116 Bacteria 7430
869 Ga0207674_10046794 3300026116 Bacteria 4439
870 Ga0207674_10071773 3300026116 Bacteria 3479
871 Ga0207674_10096765 3300026116 Bacteria 2936
872 Ga0207674_10124853 3300026116 Bacteria 2540
873 Ga0207674_10169714 3300026116 Bacteria 2136
874 Ga0207674_10227804 3300026116 Bacteria 1812
875 Ga0207675_100010366 3300026118 Bacteria 8731
876 Ga0207675_100012983 3300026118 Bacteria 7776
877 Ga0207675_100043996 3300026118 Bacteria 4170
878 Ga0207675_100052039 3300026118 Bacteria 3822
879 Ga0207683_10000190 3300026121 Bacteria 52505
880 Ga0207683_10003923 3300026121 Bacteria 12898
881 Ga0207683_10007767 3300026121 Bacteria 9177
882 Ga0207683_10054688 3300026121 Bacteria 3500
883 Ga0207683_10056469 3300026121 Bacteria 3444
884 Ga0207683_10082387 3300026121 Bacteria 2858
885 Ga0207683_10124695 3300026121 Bacteria 2314
886 Ga0207683_10140584 3300026121 Bacteria 2175
887 Ga0207698_10060892 3300026142 Bacteria 2938
888 Ga0207698_10238718 3300026142 Bacteria 1655
889 Ga0209588_1022596 3300027671 Unclassified 1979
890 Ga0209588_1028619 3300027671 Bacteria 1774
891 Ga0209998_10010271 3300027717 Bacteria 1939
892 Ga0207428_10000393 3300027907 Bacteria 54718
893 Ga0207428_10000574 3300027907 Bacteria 43446
894 Ga0207428_10001100 3300027907 Bacteria 29381
895 Ga0207428_10011660 3300027907 Bacteria 7755
896 Ga0207428_10016192 3300027907 Bacteria 6419
897 Ga0207428_10038835 3300027907 Bacteria 3867
898 Ga0207428_10063561 3300027907 Bacteria 2915
899 Ga0207428_10084280 3300027907 Bacteria 2477
900 Ga0207428_10084727 3300027907 Bacteria 2469
901 Ga0207428_10086614 3300027907 Bacteria 2438
902 Ga0207428_10089007 3300027907 Bacteria 2400
903 Ga0207428_10161341 3300027907 Bacteria 1702
904 Ga0207428_10178367 3300027907 Bacteria 1606
905 Ga0207428_10244222 3300027907 Bacteria 1341
906 Ga0268266_10004015 3300028379 Bacteria 14232
907 Ga0268266_10012762 3300028379 Bacteria 7259
908 Ga0268265_10000185 3300028380 Bacteria 73947
909 Ga0268265_10030738 3300028380 Bacteria 3871
910 Ga0268265_10051363 3300028380 Bacteria 3112
911 Ga0268265_10089961 3300028380 Bacteria 2451
912 Ga0268265_10191468 3300028380 Bacteria 1767
913 Ga0268264_10007749 3300028381 Bacteria 8940
914 Ga0268264_10062017 3300028381 Bacteria 3138
915 Ga0268264_10303755 3300028381 Bacteria 1503
916 Ga0265337_1014920 3300028556 Bacteria 2563
917 Ga0265337_1026590 3300028556 Bacteria 1751
918 Ga0265326_10000821 3300028558 Bacteria 11439
919 Ga0265319_1004075 3300028563 Bacteria 7367
920 Ga0265334_10011902 3300028573 Bacteria 3654
921 Ga0265318_10010683 3300028577 Bacteria 3988
922 Ga0265336_10014135 3300028666 Bacteria 2648
923 Ga0307515_10002908 3300028794 Bacteria 36383
924 Ga0307515_10099224 3300028794 Unclassified 3538
925 Ga0265338_10007839 3300028800 Bacteria 13118
926 Ga0265324_10002985 3300029957 Bacteria 8268
927 Ga0316176_1037086 3300030732 Bacteria 3136
928 Ga0265770_1007359 3300030878 Bacteria 1548
929 Ga0265330_10015743 3300031235 Bacteria 3496
930 Ga0265332_10020389 3300031238 Bacteria 2926
931 Ga0265328_10041085 3300031239 Bacteria 1703
932 Ga0265320_10002308 3300031240 Bacteria 13378
933 Ga0265320_10004075 3300031240 Bacteria 9600
934 Ga0265325_10013604 3300031241 Bacteria 4626
935 Ga0265329_10004508 3300031242 Bacteria 5780
936 Ga0265340_10000470 3300031247 Bacteria 21864
937 Ga0265327_10004586 3300031251 Bacteria 12162
938 Ga0265316_10010209 3300031344 Bacteria 8573
939 Ga0265316_10011723 3300031344 Bacteria 7890
940 Ga0265316_10238937 3300031344 Bacteria 1336
941 Ga0307513_10000007 3300031456 Bacteria 451043
942 Ga0307509_10032339 3300031507 Bacteria 5765
943 Ga0307509_10078800 3300031507 Unclassified 3412
944 Ga0307408_100013432 3300031548 Bacteria 5435
945 Ga0307408_100059644 3300031548 Unclassified 2778
946 Ga0307408_100203948 3300031548 Bacteria 1602
947 Ga0307408_100220969 3300031548 Bacteria 1546
948 Ga0265313_10038254 3300031595 Bacteria 2391
949 Ga0316575_10000826 3300031665 Bacteria 9421
950 Ga0316575_10001083 3300031665 Bacteria 8488
951 Ga0316575_10009431 3300031665 Bacteria 3574
952 Ga0316579_10008036 3300031691 Bacteria 4381
953 Ga0316579_10020391 3300031691 Bacteria 2940
954 Ga0316579_10039001 3300031691 Bacteria 2199
955 Ga0265314_10002620 3300031711 Bacteria 18168
956 Ga0265314_10015520 3300031711 Bacteria 6044
957 Ga0265314_10027079 3300031711 Bacteria 4297
958 Ga0265314_10052424 3300031711 Bacteria 2836
959 Ga0316576_10003639 3300031727 Bacteria 9084
960 Ga0316576_10006146 3300031727 Bacteria 7440
961 Ga0316576_10011842 3300031727 Bacteria 5736
962 Ga0316576_10027074 3300031727 Unclassified 4028
963 Ga0316576_10056092 3300031727 Bacteria 2877
964 Ga0316576_10071907 3300031727 Bacteria 2552
965 Ga0316576_10082011 3300031727 Bacteria 2394
966 Ga0316576_10100244 3300031727 Bacteria 2164
967 Ga0316576_10139728 3300031727 Bacteria 1823
968 Ga0316578_10001433 3300031728 Bacteria 9668
969 Ga0316578_10001971 3300031728 Bacteria 8709
970 Ga0316578_10041392 3300031728 Bacteria 2668
971 Ga0316578_10041628 3300031728 Bacteria 2661
972 Ga0316578_10117930 3300031728 Bacteria 1595
973 Ga0307405_10058926 3300031731 Bacteria 2418
974 Ga0307405_10091025 3300031731 Unclassified 2020
975 Ga0307405_10104994 3300031731 Bacteria 1902
976 Ga0316577_10000080 3300031733 Bacteria 25210
977 Ga0316577_10000089 3300031733 Bacteria 24350
978 Ga0316577_10000636 3300031733 Bacteria 14588
979 Ga0316577_10004746 3300031733 Bacteria 7060
980 Ga0316577_10005239 3300031733 Bacteria 6786
981 Ga0316577_10089796 3300031733 Bacteria 1720
982 Ga0307413_10039012 3300031824 Bacteria 2758
983 Ga0307413_10054017 3300031824 Bacteria 2435
984 Ga0307413_10062645 3300031824 Bacteria 2302
985 Ga0307410_10019576 3300031852 Bacteria 4121
986 Ga0307410_10025569 3300031852 Bacteria 3706
987 Ga0307410_10103711 3300031852 Bacteria 2043
988 Ga0307406_10081494 3300031901 Bacteria 2152
989 Ga0307412_10087758 3300031911 Bacteria 2168
990 Ga0307409_100027899 3300031995 Bacteria 4011
991 Ga0307409_100037964 3300031995 Bacteria 3557
992 Ga0307409_100144540 3300031995 Bacteria 2055
993 Ga0307416_100008589 3300032002 Bacteria 6605
994 Ga0307416_100016633 3300032002 Bacteria 5120
995 Ga0307416_100165180 3300032002 Bacteria 2052
996 Ga0307416_100178783 3300032002 Bacteria 1986
997 Ga0307415_100018876 3300032126 Unclassified 4175
998 Ga0316583_10009047 3300032133 Bacteria 3591
999 Ga0316583_10020931 3300032133 Bacteria 2345
1000 Ga0316583_10021849 3300032133 Bacteria 2293
1001 Ga0316583_10068207 3300032133 Bacteria 1244
1002 Ga0316585_10021473 3300032137 Bacteria 1983
1003 Ga0316585_10053676 3300032137 Unclassified 1296
1004 Ga0316580_10001255 3300032139 Bacteria 6534
1005 Ga0316580_10006543 3300032139 Bacteria 3443
1006 Ga0316593_10008734 3300032168 Bacteria 2836
1007 Ga0373923_0045215 3300035111 Bacteria 1828
1008 Ga0373932_0018875 3300035112 Bacteria 1790
1009 Ga0373945_0059996 3300035116 Bacteria 1418
1010 Ga0373954_0023176 3300035118 Bacteria 2821
1011 Ga0373956_0052479 3300035119 Bacteria 1834
1012 Ga0373943_0015607 3300035170 Bacteria 3453
1013 Ga0373943_0038565 3300035170 Bacteria 2298
1014 Ga0373946_0024979 3300035171 Bacteria 2347
1015 Ga0373955_0033485 3300035172 Bacteria 2707
1016 Ga0373962_0023654 3300035242 Bacteria 1638
1017 Ga0316574_0000151 3300035398 Bacteria 22405
1018 Ga0316574_0001153 3300035398 Bacteria 12184
1019 Ga0316574_0001764 3300035398 Bacteria 10495
1020 Ga0316574_0066657 3300035398 Bacteria 2269
1021 Ga0316574_0080492 3300035398 Bacteria 2067
1022 Ga0373924_0007928 3300035410 Bacteria 3844
1023 Ga0373931_0016904 3300035691 Bacteria 3598
1024 Ga0373931_0035227 3300035691 Bacteria 2601
1025 Ga0373935_0076680 3300035692 Bacteria 2165
1026 Ga0373935_0141213 3300035692 Bacteria 1627
1027 Ga0373927_0022808 3300035695 Bacteria 4100
1028 Ga0373947_0002973 3300035725 Bacteria 10111
1029 Ga0373947_0013397 3300035725 Bacteria 4699
1030 Ga0373937_0008628 3300036401 Bacteria 8854
1031 Ga0373937_0055725 3300036401 Bacteria 3630
1032 Ga0373937_0210739 3300036401 Bacteria 1828
1033 Ga0373937_0243687 3300036401 Bacteria 1694
1034 Ga0316582_0000480 3300036647 Bacteria 14910
1035 Ga0316582_0006227 3300036647 Bacteria 6240
1036 Ga0316582_0015286 3300036647 Bacteria 4384
1037 Ga0316582_0043091 3300036647 Bacteria 2830
1038 Ga0316582_0137838 3300036647 Bacteria 1643
1039 Ga0316582_0154380 3300036647 Bacteria 1553
1040 Ga0316584_0000413 3300036712 Bacteria 22346
1041 Ga0316584_0001506 3300036712 Bacteria 14029
1042 Ga0316584_0010138 3300036712 Bacteria 6576
1043 Ga0316584_0011733 3300036712 Bacteria 6166
1044 Ga0316584_0023624 3300036712 Bacteria 4492
1045 Ga0316584_0046235 3300036712 Bacteria 3250
1046 Ga0316584_0061249 3300036712 Bacteria 2818
1047 Ga0316584_0203567 3300036712 Bacteria 1460
1048 Ga0373925_0021612 3300037068 Bacteria 4690
1049 Ga0373925_0029664 3300037068 Bacteria 4013
1050 Ga0373925_0044438 3300037068 Bacteria 3298
1051 Ga0395900_0147181 3300037418 Bacteria 2408
1052 Ga0395900_0327770 3300037418 Bacteria 1510
1053 Ga0395898_0076611 3300037466 Bacteria 3229
1054 Ga0395905_0035481 3300037471 Bacteria 4683
1055 Ga0436364_0619729 3300037853 Bacteria 11470
1056 Ga0395901_0006804 3300038443 Bacteria 11552
1057 Ga0395901_0023635 3300038443 Bacteria 6301
1058 Ga0395901_0157581 3300038443 Bacteria 2384
1059 Ga0400484_12566 3300038725 Bacteria 11306
1060 Ga0400490_37255 3300038726 Bacteria 31974
1061 Ga0400490_39545 3300038726 Bacteria 12070
1062 Ga0400490_42916 3300038726 Bacteria 2138
1063 Ga0400491_05038 3300038727 Bacteria 2416
1064 Ga0400491_07905 3300038727 Bacteria 7863
1065 Ga0400485_03365 3300038735 Bacteria 8632
1066 Ga0400485_09643 3300038735 Bacteria 2009
1067 Ga0400488_06186 3300038741 Bacteria 2520
1068 Ga0400488_41691 3300038741 Bacteria 5506
1069 Ga0400486_13051 3300038742 Bacteria 12497
1070 Ga0400483_032670 3300039062 Bacteria 4098
1071 Ga0400483_123874 3300039062 Bacteria 1403
1072 Ga0400483_155563 3300039062 Bacteria 6344
1073 Ga0400489_27482 3300039093 Bacteria 35511
1074 Ga0436365_0895231 3300039437 Bacteria 2488
1075 Ga0439439_0000378 3300041406 Bacteria 7310
1076 Ga0439465_0015220 3300041413 Bacteria 2400
1077 Ga0451789_0440849 3300041443 Bacteria 5430
1078 Ga0451791_0426296 3300041451 Bacteria 2831
1079 Ga0451793_0141268 3300041452 Bacteria 1282
1080 Ga0451793_0476113 3300041452 Bacteria 4486
1081 Ga0451800_0714665 3300041459 Bacteria 1503
1082 Ga0451841_0256531 3300041498 Bacteria 1460
1083 Ga0451843_0257713 3300041509 Bacteria 4028
1084 Ga0451853_3751897 3300041512 Bacteria 1692
1085 Ga0439433_0013975 3300041999 Bacteria 1766
1086 Ga0439449_0008770 3300042007 Bacteria 3837
1087 Ga0439449_0010419 3300042007 Bacteria 3510
1088 Ga0439454_004658 3300042011 Bacteria 1595
1089 Ga0439457_010577 3300042014 Bacteria 2118
1090 Ga0450920_001937 3300042122 Bacteria 3483
1091 Ga0450923_004384 3300042125 Bacteria 2216
1092 Ga0450907_002845 3300042146 Bacteria 3194
1093 Ga0439435_0002282 3300042436 Bacteria 3774
1094 Ga0439435_0008994 3300042436 Bacteria 2332
1095 Ga0439435_0038192 3300042436 Bacteria 1334
1096 Ga0439460_0020898 3300042461 Bacteria 1784
1097 Ga0451577_0052810 3300042876 Unclassified 3629
1098 Ga0451577_0085446 3300042876 Bacteria 2815
1099 Ga0451577_0280582 3300042876 Bacteria 1509
1100 Ga0466972_0006816 3300044658 Bacteria 5733
1101 Ga0453683_0065627 3300044673 Bacteria 2269
1102 Ga0453683_0193185 3300044673 Bacteria 1292
1103 Ga0466966_0037157 3300044684 Bacteria 3142
1104 Ga0466963_0064225 3300044694 Bacteria 2459
1105 Ga0466963_0152872 3300044694 Bacteria 1603
1106 Ga0466963_0169693 3300044694 Bacteria 1521
1107 Ga0453684_0000173 3300044712 Bacteria 285446
1108 Ga0453684_0001703 3300044712 Bacteria 59231
1109 Ga0453684_0007129 3300044712 Bacteria 20828
1110 Ga0453684_0015989 3300044712 Bacteria 11792
1111 Ga0453684_0080375 3300044712 Bacteria 4071
1112 Ga0453684_0115462 3300044712 Bacteria 3253
1113 Ga0453684_0166957 3300044712 Bacteria 2598
1114 Ga0453684_0360157 3300044712 Bacteria 1638
1115 Ga0466971_0051355 3300044719 Bacteria 1856
1116 Ga0466968_0025832 3300044735 Bacteria 2407
1117 Ga0466970_0013084 3300044765 Bacteria 4252
1118 Ga0466970_0017062 3300044765 Bacteria 3749
1119 Ga0466957_0039512 3300044842 Bacteria 2847
1120 Ga0466957_0047436 3300044842 Bacteria 2610
1121 Ga0466959_0009315 3300045049 Bacteria 6979
1122 Ga0451576_0008442 3300045051 Bacteria 12094
1123 Ga0451576_0008949 3300045051 Bacteria 11677
1124 Ga0451576_0153042 3300045051 Bacteria 2405
1125 Ga0451576_0165470 3300045051 Bacteria 2308
1126 Ga0451576_0201454 3300045051 Bacteria 2079
1127 Ga0466958_0009420 3300045836 Bacteria 5442
1128 Ga0466958_0064423 3300045836 Bacteria 2235
1129 Ga0466958_0099781 3300045836 Bacteria 1804
1130 Ga0466958_0139498 3300045836 Bacteria 1525
1131 Ga0466967_0005268 3300045976 Bacteria 8920
1132 Ga0466967_0022309 3300045976 Bacteria 5163
1133 Ga0466967_0091982 3300045976 Bacteria 2757
1134 Ga0466967_0133259 3300045976 Bacteria 2309
1135 Ga0466967_0163140 3300045976 Bacteria 2093
1136 Ga0495603_0008241 3300046455 Bacteria 6298
1137 Ga0495603_0013562 3300046455 Bacteria 4931
1138 Ga0495629_0000523 3300046459 Bacteria 32051
1139 Ga0495638_0000003 3300046460 Bacteria 888792
1140 Ga0495653_0017324 3300046463 Bacteria 5860
1141 Ga0495653_0093503 3300046463 Bacteria 2193
1142 Ga0495580_0000346 3300046472 Bacteria 37864
1143 Ga0495580_0073561 3300046472 Bacteria 2386
1144 Ga0495580_0172151 3300046472 Bacteria 1497
1145 Ga0495582_0008009 3300046473 Bacteria 5832
1146 Ga0495582_0098518 3300046473 Bacteria 1636
1147 Ga0495639_0008933 3300046475 Bacteria 4295
1148 Ga0495594_0076126 3300046499 Bacteria 1871
1149 Ga0495594_0201852 3300046499 Bacteria 1133
1150 Ga0495608_0020626 3300046511 Bacteria 4528
1151 Ga0495618_0235901 3300046514 Bacteria 1151
1152 Ga0495628_0003293 3300046516 Bacteria 14451
1153 Ga0495628_0011434 3300046516 Bacteria 7506
1154 Ga0495628_0122326 3300046516 Bacteria 1995
1155 Ga0495630_0009089 3300046517 Bacteria 7142
1156 Ga0495630_0013143 3300046517 Bacteria 6019
1157 Ga0495666_0121750 3300046526 Bacteria 1221
1158 Ga0495665_0108169 3300046531 Bacteria 1459
1159 Ga0495640_0018120 3300046533 Bacteria 5232
1160 Ga0495640_0094151 3300046533 Bacteria 1973
1161 Ga0495586_0168486 3300046535 Bacteria 1237
1162 Ga0495587_0081896 3300046536 Bacteria 1870
1163 Ga0495609_0033729 3300046538 Bacteria 2323
1164 Ga0495621_0000799 3300046539 Bacteria 7962
1165 Ga0495621_0001364 3300046539 Bacteria 6315
1166 Ga0495621_0013561 3300046539 Bacteria 2564
1167 Ga0495645_0000509 3300046543 Bacteria 26861
1168 Ga0495667_0021852 3300046559 Bacteria 4314
1169 Ga0495635_0132119 3300046663 Bacteria 1702
1170 Ga0495659_0022356 3300046664 Bacteria 2139
1171 Ga0495659_0024145 3300046664 Bacteria 2070
1172 Ga0495588_0044414 3300046674 Bacteria 2276
1173 Ga0495647_0030358 3300046681 Bacteria 2005
1174 Ga0495658_0001090 3300046683 Bacteria 14314
1175 Ga0495658_0034283 3300046683 Bacteria 2785
1176 Ga0495658_0048533 3300046683 Bacteria 2394
1177 Ga0495658_0219255 3300046683 Bacteria 1190
1178 Ga0495669_0011838 3300046684 Bacteria 3709
1179 Ga0495669_0108264 3300046684 Bacteria 1296
1180 Ga0495613_0008520 3300046689 Bacteria 7612
1181 Ga0495613_0124506 3300046689 Bacteria 1849
1182 Ga0495613_0227618 3300046689 Bacteria 1307
1183 Ga0495600_0098163 3300046809 Bacteria 1909
1184 Ga0495581_0043855 3300047315 Bacteria 2586
1185 Ga0495674_0021360 3300047319 Bacteria 5988
1186 Ga0495674_0051535 3300047319 Bacteria 3628
1187 Ga0495672_0000242 3300047320 Bacteria 76766
1188 Ga0495672_0004208 3300047320 Bacteria 11921
1189 Ga0495677_0044018 3300047445 Bacteria 1637
1190 Ga0495684_0001676 3300047471 Bacteria 17798
1191 Ga0495602_0136664 3300048088 Bacteria 1946
1192 Ga0496101_0156636 3300048904 Bacteria 1745
1193 Ga0496101_0236363 3300048904 Bacteria 1421
1194 Ga0496102_0043243 3300048905 Bacteria 4084
1195 Ga0496102_0072640 3300048905 Bacteria 3162
1196 Ga0496102_0079705 3300048905 Bacteria 3016
1197 Ga0496102_0093756 3300048905 Bacteria 2781
1198 Ga0496102_0119680 3300048905 Bacteria 2459
1199 Ga0496104_0003311 3300048907 Bacteria 13902
1200 Ga0496104_0010031 3300048907 Bacteria 8455
1201 Ga0496104_0020628 3300048907 Bacteria 6043
1202 Ga0496104_0079682 3300048907 Bacteria 3122
1203 Ga0496104_0243987 3300048907 Bacteria 1709
1204 Ga0496105_0000513 3300048908 Bacteria 25567
1205 Ga0496105_0092061 3300048908 Bacteria 2504
1206 Ga0496105_0096560 3300048908 Bacteria 2441
1207 Ga0496105_0161757 3300048908 Bacteria 1838
1208 Ga0496106_0006809 3300048909 Bacteria 8459
1209 Ga0496106_0029816 3300048909 Bacteria 4067
1210 Ga0496106_0110583 3300048909 Bacteria 2139
1211 Ga0496106_0159907 3300048909 Bacteria 1781
1212 Ga0496107_0003244 3300048910 Bacteria 10823
1213 Ga0496107_0082562 3300048910 Bacteria 2344
1214 Ga0496108_0002685 3300048911 Bacteria 14243
1215 Ga0496108_0005882 3300048911 Bacteria 9943
1216 Ga0496108_0024891 3300048911 Bacteria 4930
1217 Ga0496108_0074259 3300048911 Bacteria 2871
1218 Ga0496108_0168024 3300048911 Bacteria 1897
1219 Ga0496109_0001158 3300048912 Bacteria 21942
1220 Ga0496109_0003151 3300048912 Bacteria 13754
1221 Ga0496109_0030856 3300048912 Bacteria 4805
1222 Ga0496109_0265194 3300048912 Bacteria 1618
1223 Ga0496110_0006677 3300048913 Bacteria 9168
1224 Ga0496110_0013256 3300048913 Bacteria 6807
1225 Ga0496110_0017224 3300048913 Bacteria 6043
1226 Ga0496110_0092227 3300048913 Bacteria 2710
1227 Ga0496111_0006838 3300048914 Bacteria 7439
1228 Ga0496111_0010934 3300048914 Bacteria 6105
1229 Ga0496111_0076714 3300048914 Bacteria 2436
1230 Ga0496111_0219971 3300048914 Bacteria 1411
1231 Ga0496112_0001156 3300048915 Bacteria 19704
1232 Ga0496112_0041108 3300048915 Bacteria 4523
1233 Ga0496112_0088517 3300048915 Bacteria 3064
1234 Ga0496112_0157512 3300048915 Bacteria 2238
1235 Ga0496112_0194101 3300048915 Bacteria 1992
1236 Ga0496112_0436367 3300048915 Bacteria 1248
1237 Ga0496113_0008939 3300048916 Bacteria 6558
1238 Ga0496113_0012915 3300048916 Bacteria 5633
1239 Ga0496113_0021398 3300048916 Bacteria 4562
1240 Ga0496113_0025915 3300048916 Bacteria 4187
1241 Ga0496114_0005398 3300048917 Bacteria 9998
1242 Ga0496114_0014629 3300048917 Bacteria 6303
1243 Ga0496114_0080620 3300048917 Bacteria 2749
1244 Ga0496114_0144195 3300048917 Bacteria 2064
1245 Ga0496114_0174311 3300048917 Bacteria 1876
1246 Ga0496114_0467976 3300048917 Bacteria 1116
1247 Ga0496115_0001888 3300048918 Bacteria 14992
1248 Ga0496115_0053909 3300048918 Bacteria 3229
1249 Ga0496115_0056811 3300048918 Bacteria 3146
1250 Ga0496117_0004173 3300048920 Bacteria 16158
1251 Ga0496118_0000909 3300048921 Bacteria 46249
1252 Ga0496121_0000025 3300048924 Bacteria 453467
1253 Ga0496122_0002058 3300048925 Bacteria 29852
1254 Ga0496122_0111496 3300048925 Bacteria 1794
1255 Ga0496123_0006537 3300048926 Bacteria 11257
1256 Ga0496123_0011752 3300048926 Bacteria 7543
1257 Ga0496123_0121298 3300048926 Bacteria 1470
1258 Ga0496124_0000639 3300048927 Bacteria 57891
1259 Ga0496124_0132995 3300048927 Bacteria 1974
1260 Ga0496124_0162442 3300048927 Bacteria 1739
1261 Ga0496126_0027150 3300048929 Bacteria 5475
1262 Ga0501300_001453 3300049523 Bacteria 3549
1263 Ga0501323_004435 3300049539 Bacteria 1485
1264 Ga0501325_001364 3300049541 Bacteria 1483
1265 Ga0501031_0001166 3300049568 Bacteria 15986
1266 Ga0501031_0016519 3300049568 Bacteria 4794
1267 Ga0501031_0019548 3300049568 Bacteria 4413
1268 Ga0501031_0087488 3300049568 Bacteria 2032
1269 Ga0501032_0002307 3300049569 Bacteria 14975
1270 Ga0501033_0000941 3300049570 Bacteria 26478
1271 Ga0501033_0019917 3300049570 Bacteria 5071
1272 Ga0501033_0063719 3300049570 Bacteria 2713
1273 Ga0501033_0078188 3300049570 Bacteria 2428
1274 Ga0501034_0002121 3300049571 Bacteria 24658
1275 Ga0501034_0008189 3300049571 Bacteria 11084
1276 Ga0501034_0164197 3300049571 Bacteria 2190
1277 Ga0501034_0201836 3300049571 Bacteria 1946
1278 Ga0501036_0000057 3300049572 Bacteria 72542
1279 Ga0501036_0001775 3300049572 Bacteria 16746
1280 Ga0501036_0022956 3300049572 Bacteria 5253
1281 Ga0501036_0051933 3300049572 Bacteria 3472
1282 Ga0501036_0103190 3300049572 Bacteria 2412
1283 Ga0501036_0137854 3300049572 Bacteria 2059
1284 Ga0501037_0001310 3300049573 Bacteria 18313
1285 Ga0501037_0009021 3300049573 Bacteria 7309
1286 Ga0501037_0030509 3300049573 Bacteria 3984
1287 Ga0501038_0000391 3300049574 Bacteria 37957
1288 Ga0501038_0027841 3300049574 Bacteria 5022
1289 Ga0501038_0086524 3300049574 Bacteria 2633
1290 Ga0501038_0134033 3300049574 Bacteria 2031
1291 Ga0501039_0000309 3300049575 Bacteria 34600
1292 Ga0501039_0013387 3300049575 Bacteria 6270
1293 Ga0501039_0021253 3300049575 Bacteria 4980
1294 Ga0501039_0028801 3300049575 Bacteria 4277
1295 Ga0501039_0043221 3300049575 Bacteria 3481
1296 Ga0501039_0114050 3300049575 Bacteria 2114
1297 Ga0501039_0206551 3300049575 Bacteria 1544
1298 Ga0501040_0004086 3300049576 Bacteria 9486
1299 Ga0501040_0009350 3300049576 Bacteria 6386
1300 Ga0501040_0016992 3300049576 Bacteria 4824
1301 Ga0501040_0020914 3300049576 Bacteria 4363
1302 Ga0501040_0021385 3300049576 Bacteria 4320
1303 Ga0501040_0033917 3300049576 Bacteria 3459
1304 Ga0501040_0166529 3300049576 Bacteria 1560
1305 Ga0501040_0176649 3300049576 Bacteria 1513
1306 Ga0501041_0002498 3300049577 Bacteria 10468
1307 Ga0501041_0014933 3300049577 Bacteria 4612
1308 Ga0501041_0018696 3300049577 Bacteria 4127
1309 Ga0501041_0123376 3300049577 Bacteria 1611
1310 Ga0501041_0126730 3300049577 Bacteria 1590
1311 Ga0501042_0002039 3300049578 Bacteria 12242
1312 Ga0501042_0003181 3300049578 Bacteria 10244
1313 Ga0501042_0011677 3300049578 Bacteria 5934
1314 Ga0501042_0050630 3300049578 Bacteria 2962
1315 Ga0501042_0058483 3300049578 Bacteria 2752
1316 Ga0501042_0092036 3300049578 Bacteria 2177
1317 Ga0501042_0099901 3300049578 Bacteria 2086
1318 Ga0501042_0104152 3300049578 Bacteria 2041
1319 Ga0501042_0241435 3300049578 Bacteria 1303
1320 Ga0501043_0000111 3300049579 Bacteria 76773
1321 Ga0501043_0043834 3300049579 Bacteria 3517
1322 Ga0501043_0118797 3300049579 Bacteria 2073
1323 Ga0501046_0000307 3300049580 Bacteria 49550
1324 Ga0501046_0014958 3300049580 Bacteria 6529
1325 Ga0501046_0114077 3300049580 Bacteria 2062
1326 Ga0501046_0125431 3300049580 Bacteria 1951
1327 Ga0501047_0000289 3300049581 Bacteria 57793
1328 Ga0501047_0002400 3300049581 Bacteria 17896
1329 Ga0501048_0000298 3300049582 Bacteria 33825
1330 Ga0501048_0005925 3300049582 Bacteria 9304
1331 Ga0501048_0016854 3300049582 Bacteria 5386
1332 Ga0501048_0022284 3300049582 Bacteria 4635
1333 Ga0501048_0165633 3300049582 Bacteria 1565
1334 Ga0501067_0000065 3300049583 Bacteria 59946
1335 Ga0501067_0013273 3300049583 Bacteria 4562
1336 Ga0501067_0016818 3300049583 Bacteria 4040
1337 Ga0501067_0020205 3300049583 Bacteria 3684
1338 Ga0501067_0036773 3300049583 Bacteria 2718
1339 Ga0501067_0146587 3300049583 Bacteria 1315
1340 Ga0501068_0000099 3300049584 Bacteria 37456
1341 Ga0501068_0039468 3300049584 Bacteria 2831
1342 Ga0501068_0043827 3300049584 Bacteria 2692
1343 Ga0501068_0054740 3300049584 Bacteria 2417
1344 Ga0501068_0068423 3300049584 Bacteria 2164
1345 Ga0501068_0103014 3300049584 Bacteria 1770
1346 Ga0501069_0001404 3300049585 Bacteria 11809
1347 Ga0501069_0006770 3300049585 Bacteria 6001
1348 Ga0501069_0046809 3300049585 Bacteria 2400
1349 Ga0501070_0001132 3300049586 Bacteria 23911
1350 Ga0501070_0016772 3300049586 Bacteria 6148
1351 Ga0501070_0024597 3300049586 Bacteria 5050
1352 Ga0501070_0073617 3300049586 Bacteria 2826
1353 Ga0501070_0146802 3300049586 Bacteria 1947
1354 Ga0501071_0000488 3300049587 Bacteria 20060
1355 Ga0501071_0003854 3300049587 Bacteria 9442
1356 Ga0501071_0005549 3300049587 Bacteria 8126
1357 Ga0501071_0019597 3300049587 Bacteria 4695
1358 Ga0501071_0020005 3300049587 Bacteria 4650
1359 Ga0501071_0025545 3300049587 Bacteria 4139
1360 Ga0501071_0039050 3300049587 Bacteria 3395
1361 Ga0501071_0048161 3300049587 Bacteria 3064
1362 Ga0501071_0075934 3300049587 Bacteria 2453
1363 Ga0501071_0116344 3300049587 Bacteria 1979
1364 Ga0501071_0184437 3300049587 Bacteria 1564
1365 Ga0501072_0004844 3300049588 Bacteria 10248
1366 Ga0501072_0009359 3300049588 Bacteria 7448
1367 Ga0501072_0009420 3300049588 Bacteria 7425
1368 Ga0501072_0013185 3300049588 Bacteria 6329
1369 Ga0501072_0017150 3300049588 Bacteria 5564
1370 Ga0501072_0029963 3300049588 Bacteria 4252
1371 Ga0501072_0031779 3300049588 Bacteria 4133
1372 Ga0501072_0032367 3300049588 Bacteria 4095
1373 Ga0501072_0061470 3300049588 Bacteria 2963
1374 Ga0501072_0071964 3300049588 Bacteria 2732
1375 Ga0501072_0105608 3300049588 Bacteria 2239
1376 Ga0501072_0303699 3300049588 Bacteria 1269
1377 Ga0501073_0007238 3300049589 Bacteria 8263
1378 Ga0501073_0013683 3300049589 Bacteria 5903
1379 Ga0501073_0015002 3300049589 Bacteria 5621
1380 Ga0501073_0126313 3300049589 Bacteria 1773
1381 Ga0501073_0214598 3300049589 Bacteria 1330
1382 Ga0501074_0000074 3300049590 Bacteria 48322
1383 Ga0501074_0019499 3300049590 Bacteria 4925
1384 Ga0501074_0058553 3300049590 Bacteria 2776
1385 Ga0501074_0088881 3300049590 Bacteria 2212
1386 Ga0501074_0106746 3300049590 Bacteria 2005
1387 Ga0501075_0003648 3300049591 Bacteria 10323
1388 Ga0501075_0018685 3300049591 Bacteria 5019
1389 Ga0501075_0025444 3300049591 Bacteria 4348
1390 Ga0501075_0040497 3300049591 Bacteria 3489
1391 Ga0501075_0041989 3300049591 Bacteria 3429
1392 Ga0501075_0073297 3300049591 Bacteria 2589
1393 Ga0501075_0098365 3300049591 Bacteria 2221
1394 Ga0501075_0233080 3300049591 Bacteria 1404
1395 Ga0501076_0002631 3300049592 Bacteria 12381
1396 Ga0501076_0007851 3300049592 Bacteria 7775
1397 Ga0501076_0011199 3300049592 Bacteria 6676
1398 Ga0501076_0011969 3300049592 Bacteria 6481
1399 Ga0501076_0041077 3300049592 Bacteria 3637
1400 Ga0501076_0105052 3300049592 Bacteria 2279
1401 Ga0501076_0200901 3300049592 Bacteria 1628
1402 Ga0501076_0257598 3300049592 Bacteria 1428
1403 Ga0501077_0016934 3300049593 Bacteria 4597
1404 Ga0501077_0062494 3300049593 Bacteria 2363
1405 Ga0501077_0100103 3300049593 Bacteria 1837
1406 Ga0501077_0176385 3300049593 Bacteria 1358
1407 Ga0501221_014438 3300049704 Bacteria 1468
1408 Ga0501079_0005025 3300049741 Bacteria 9816
1409 Ga0501079_0018044 3300049741 Bacteria 5389
1410 Ga0501079_0024592 3300049741 Bacteria 4622
1411 Ga0501079_0047886 3300049741 Bacteria 3299
1412 Ga0501079_0061460 3300049741 Bacteria 2898
1413 Ga0501079_0100333 3300049741 Bacteria 2244
1414 Ga0501079_0106723 3300049741 Bacteria 2173
1415 Ga0501079_0107212 3300049741 Bacteria 2169
1416 Ga0501079_0170704 3300049741 Bacteria 1696
1417 Ga0501080_0000244 3300049742 Bacteria 40757
1418 Ga0501080_0000414 3300049742 Bacteria 32763
1419 Ga0501080_0070329 3300049742 Bacteria 3255
1420 Ga0501080_0096840 3300049742 Bacteria 2740
1421 Ga0501080_0104895 3300049742 Bacteria 2621
1422 Ga0501080_0161284 3300049742 Bacteria 2071
1423 Ga0501081_0000754 3300049743 Bacteria 18935
1424 Ga0501081_0008776 3300049743 Bacteria 6570
1425 Ga0501081_0011798 3300049743 Bacteria 5724
1426 Ga0501081_0090290 3300049743 Bacteria 2153
1427 Ga0501081_0138662 3300049743 Bacteria 1742
1428 Ga0501081_0142686 3300049743 Bacteria 1717
1429 Ga0501081_0195964 3300049743 Bacteria 1464
1430 Ga0501083_0019965 3300049744 Bacteria 4663
1431 Ga0501083_0036872 3300049744 Bacteria 3332
1432 Ga0501083_0192587 3300049744 Bacteria 1331
1433 Ga0501264_000063 3300049761 Bacteria 15044
1434 Ga0501035_0000262 3300049822 Bacteria 62472
1435 Ga0501035_0013824 3300049822 Bacteria 7450
1436 Ga0501035_0108437 3300049822 Bacteria 2435
1437 Ga0501044_0000312 3300049823 Bacteria 61322
1438 Ga0501045_0003035 3300049824 Bacteria 11480
1439 Ga0501045_0003799 3300049824 Bacteria 10386
1440 Ga0501045_0011531 3300049824 Bacteria 6208
1441 Ga0501045_0017723 3300049824 Bacteria 5057
1442 Ga0501045_0025444 3300049824 Bacteria 4254
1443 Ga0501045_0034416 3300049824 Bacteria 3677
1444 Ga0501045_0074245 3300049824 Bacteria 2504
1445 Ga0501045_0082011 3300049824 Bacteria 2378
1446 Ga0501045_0147944 3300049824 Bacteria 1747
1447 nmdc:mga03n38_31977_c1 3300050490 Bacteria 2225
1448 nmdc:mga00v17_102676_c1 3300050491 Bacteria 1806
1449 nmdc:mga00v17_105147_c1 3300050491 Bacteria 1786
1450 nmdc:mga0yw44_12118_c1 3300050492 Bacteria 4482
1451 nmdc:mga0yw44_148377_c1 3300050492 Bacteria 1528
1452 nmdc:mga0yw44_18976_c1 3300050492 Bacteria 3355
1453 nmdc:mga0yw44_52124_c1 3300050492 Bacteria 2480
1454 nmdc:mga0yw44_64894_c1 3300050492 Bacteria 2248
1455 nmdc:mga0k408_24679_c1 3300050493 Bacteria 3400
1456 nmdc:mga0k408_76416_c1 3300050493 Bacteria 1957
1457 nmdc:mga06z11_50726_c1 3300050494 Bacteria 2122
1458 nmdc:mga06z11_98093_c1 3300050494 Bacteria 1603
1459 nmdc:mga07m45_24539_c1 3300050496 Bacteria 3305
1460 nmdc:mga07m45_25794_c1 3300050496 Bacteria 3227
1461 nmdc:mga05p37_10188_c1 3300050507 Bacteria 11159
1462 nmdc:mga05p37_115999_c1 3300050507 Bacteria 3291
1463 nmdc:mga05p37_123154_c1 3300050507 Bacteria 3185
1464 nmdc:mga05p37_12946_c1 3300050507 Bacteria 9978
1465 nmdc:mga05p37_13104_c1 3300050507 Bacteria 9923
1466 nmdc:mga05p37_13976_c1 3300050507 Bacteria 9626
1467 nmdc:mga05p37_147215_c1 3300050507 Bacteria 2882
1468 nmdc:mga05p37_156577_c1 3300050507 Bacteria 2784
1469 nmdc:mga05p37_16959_c1 3300050507 Bacteria 8785
1470 nmdc:mga05p37_275_c1 3300050507 Bacteria 53593
1471 nmdc:mga05p37_3361_c1 3300050507 Bacteria 18671
1472 nmdc:mga05p37_441566_c1 3300050507 Bacteria 1509
1473 nmdc:mga05p37_444686_c1 3300050507 Bacteria 1502
1474 nmdc:mga05p37_45778_c1 3300050507 Bacteria 5380
1475 nmdc:mga05p37_482297_c1 3300050507 Bacteria 1428
1476 nmdc:mga05p37_6361_c1 3300050507 Bacteria 13918
1477 nmdc:mga05p37_63640_c1 3300050507 Bacteria 4539
1478 nmdc:mga05p37_65409_c1 3300050507 Bacteria 4474
1479 nmdc:mga09592_12832_c1 3300050508 Bacteria 6831
1480 nmdc:mga09592_137332_c1 3300050508 Bacteria 2106
1481 nmdc:mga09592_182953_c1 3300050508 Bacteria 1813
1482 nmdc:mga09592_183003_c1 3300050508 Bacteria 1813
1483 nmdc:mga09592_252817_c1 3300050508 Bacteria 1528
1484 nmdc:mga09592_302676_c1 3300050508 Bacteria 1386
1485 nmdc:mga09592_5612_c1 3300050508 Bacteria 10225
1486 nmdc:mga09592_65081_c1 3300050508 Bacteria 3087
1487 nmdc:mga09592_67270_c1 3300050508 Bacteria 3038
1488 nmdc:mga09592_70846_c1 3300050508 Bacteria 2959
1489 nmdc:mga09592_953_c1 3300050508 Bacteria 22761
1490 nmdc:mga09592_96657_c1 3300050508 Bacteria 2527
1491 nmdc:mga0qj67_13711_c1 3300050509 Bacteria 6117
1492 nmdc:mga0qj67_21101_c1 3300050509 Bacteria 4995
1493 nmdc:mga0qj67_24595_c1 3300050509 Bacteria 4644
1494 nmdc:mga0qj67_245972_c1 3300050509 Bacteria 1451
1495 nmdc:mga0qj67_2517_c1 3300050509 Bacteria 13091
1496 nmdc:mga0qj67_2598_c1 3300050509 Bacteria 12929
1497 nmdc:mga0qj67_75052_c1 3300050509 Bacteria 2702
1498 nmdc:mga0qj67_95202_c1 3300050509 Bacteria 2396
1499 nmdc:mga06r32_10914_c1 3300050510 Bacteria 8179
1500 nmdc:mga06r32_113653_c1 3300050510 Bacteria 2665
1501 nmdc:mga06r32_113980_c1 3300050510 Bacteria 2661
1502 nmdc:mga06r32_14263_c1 3300050510 Bacteria 7208
1503 nmdc:mga06r32_14472_c1 3300050510 Bacteria 7159
1504 nmdc:mga06r32_15782_c1 3300050510 Bacteria 6866
1505 nmdc:mga06r32_220850_c1 3300050510 Bacteria 1883
1506 nmdc:mga06r32_4670_c1 3300050510 Bacteria 12295
1507 nmdc:mga06r32_46937_c1 3300050510 Bacteria 4124
1508 nmdc:mga06r32_48535_c1 3300050510 Bacteria 4058
1509 nmdc:mga06r32_52312_c1 3300050510 Bacteria 3911
1510 nmdc:mga06r32_66280_c1 3300050510 Bacteria 3484
1511 nmdc:mga06r32_66410_c1 3300050510 Bacteria 3481
1512 nmdc:mga06r32_6887_c1 3300050510 Bacteria 10217
1513 nmdc:mga06r32_7657_c1 3300050510 Bacteria 9712
1514 nmdc:mga08y16_103170_c1 3300050511 Bacteria 2969
1515 nmdc:mga08y16_11284_c1 3300050511 Bacteria 9388
1516 nmdc:mga08y16_185985_c1 3300050511 Bacteria 2156
1517 nmdc:mga08y16_269854_c1 3300050511 Bacteria 1757
1518 nmdc:mga08y16_2708_c1 3300050511 Bacteria 18180
1519 nmdc:mga08y16_273965_c1 3300050511 Bacteria 1742
1520 nmdc:mga08y16_282487_c1 3300050511 Bacteria 1712
1521 nmdc:mga08y16_28869_c1 3300050511 Bacteria 5848
1522 nmdc:mga08y16_32443_c1 3300050511 Bacteria 5490
1523 nmdc:mga08y16_3393_c1 3300050511 Bacteria 16521
1524 nmdc:mga08y16_46864_c1 3300050511 Bacteria 4525
1525 nmdc:mga08y16_504_c1 3300050511 Bacteria 36040
1526 nmdc:mga08y16_6332_c1 3300050511 Bacteria 12414
1527 nmdc:mga08y16_8405_c1 3300050511 Bacteria 10802
1528 nmdc:mga0n895_10806_c1 3300050512 Bacteria 8100
1529 nmdc:mga0n895_118817_c1 3300050512 Bacteria 2664
1530 nmdc:mga0n895_11991_c1 3300050512 Bacteria 7756
1531 nmdc:mga0n895_130462_c1 3300050512 Bacteria 2538
1532 nmdc:mga0n895_18517_c1 3300050512 Bacteria 6446
1533 nmdc:mga0n895_20427_c1 3300050512 Bacteria 6178
1534 nmdc:mga0n895_2106_c1 3300050512 Bacteria 15347
1535 nmdc:mga0n895_28190_c1 3300050512 Bacteria 5342
1536 nmdc:mga0n895_50397_c1 3300050512 Bacteria 4082
1537 nmdc:mga0n895_5966_c1 3300050512 Bacteria 10256
1538 nmdc:mga0n895_62888_c1 3300050512 Bacteria 3669
1539 nmdc:mga0n895_78707_c1 3300050512 Bacteria 3281
1540 nmdc:mga0n895_829_c1 3300050512 Bacteria 22161
1541 nmdc:mga0rr50_145299_c1 3300050513 Bacteria 1912
1542 nmdc:mga0rr50_151407_c1 3300050513 Bacteria 1875
1543 nmdc:mga0rr50_167056_c1 3300050513 Bacteria 1790
1544 nmdc:mga0rr50_32236_c1 3300050513 Bacteria 3732
1545 nmdc:mga0rr50_354_c1 3300050513 Bacteria 24902
1546 nmdc:mga0rr50_7956_c1 3300050513 Bacteria 6579
1547 nmdc:mga0rr50_80461_c1 3300050513 Bacteria 2512
1548 nmdc:mga08x19_2446_c1 3300050514 Bacteria 11284
1549 nmdc:mga0a205_1093_c1 3300050515 Bacteria 22518
1550 nmdc:mga0a205_140551_c1 3300050515 Bacteria 2315
1551 nmdc:mga0a205_141186_c1 3300050515 Bacteria 2309
1552 nmdc:mga0a205_14504_c1 3300050515 Bacteria 7352
1553 nmdc:mga0a205_146419_c1 3300050515 Bacteria 2262
1554 nmdc:mga0a205_18128_c1 3300050515 Bacteria 6614
1555 nmdc:mga0a205_2072_c1 3300050515 Bacteria 17539
1556 nmdc:mga0a205_3147_c1 3300050515 Bacteria 14638
1557 nmdc:mga0a205_38110_c1 3300050515 Bacteria 4624
1558 nmdc:mga0a205_72728_c1 3300050515 Bacteria 3322
1559 nmdc:mga0a205_74669_c1 3300050515 Bacteria 2099
1560 Ga0495601_0006657 3300053077 Bacteria 6763
1561 Ga0495595_0006010 3300053084 Bacteria 4931
1562 Ga0495619_0003726 3300053085 Bacteria 9825
1563 Ga0495619_0011460 3300053085 Bacteria 5587
1564 Ga0495619_0074185 3300053085 Bacteria 2281
1565 Ga0495619_0081543 3300053085 Bacteria 2178
1566 Ga0495619_0088962 3300053085 Bacteria 2089
1567 Ga0500643_000913 3300053087 Bacteria 18624
1568 Ga0500644_0000106 3300053088 Bacteria 52751
1569 Ga0500641_0002700 3300053096 Bacteria 6267
1570 Ga0500556_0000001 3300053104 Bacteria 1135060
1571 Ga0500568_0000003 3300053139 Bacteria 863587
1572 Ga0500568_0032010 3300053139 Bacteria 2164
1573 Ga0500604_0002802 3300053151 Bacteria 4732
1574 Ga0500616_0000007 3300053153 Bacteria 836875
1575 Ga0500616_0000205 3300053153 Bacteria 96713
1576 Ga0500616_0037765 3300053153 Bacteria 2613
1577 Ga0500622_0000066 3300053156 Bacteria 124842
1578 Ga0500622_0000179 3300053156 Bacteria 68943
1579 Ga0500622_0001539 3300053156 Bacteria 18262
1580 Ga0500645_001172 3300053730 Bacteria 14012
1581 Ga0501084_0001637 3300054114 Bacteria 17781
1582 Ga0501084_0006547 3300054114 Bacteria 9576
1583 Ga0501084_0023342 3300054114 Bacteria 5163
1584 Ga0501084_0023478 3300054114 Bacteria 5145
1585 Ga0501084_0026974 3300054114 Bacteria 4799
1586 Ga0501084_0043651 3300054114 Bacteria 3750
1587 Ga0501084_0053078 3300054114 Bacteria 3390
1588 Ga0501084_0066241 3300054114 Bacteria 3022
1589 Ga0501084_0135199 3300054114 Bacteria 2076
1590 Ga0501084_0167806 3300054114 Bacteria 1853
1591 Ga0501084_0282519 3300054114 Bacteria 1402
1592 Ga0590071_014634 3300059421 Bacteria 1840
1593 Ga0590075_000348 3300059424 Bacteria 12914
1594 Ga0590075_000928 3300059424 Bacteria 7624
1595 Ga0590077_000323 3300059426 Bacteria 13559
1596 Ga0590077_003620 3300059426 Bacteria 3192
1597 Ga0501082_0002453 3300060353 Bacteria 16280
1598 Ga0501082_0007432 3300060353 Bacteria 9454
1599 Ga0501082_0012030 3300060353 Bacteria 7439
1600 Ga0501082_0022921 3300060353 Bacteria 5380
1601 Ga0501082_0038929 3300060353 Bacteria 4101
1602 Ga0501082_0063921 3300060353 Bacteria 3169
1603 Ga0501082_0073646 3300060353 Bacteria 2942
1604 Ga0501082_0107841 3300060353 Bacteria 2410
1605 Ga0466962_0006259 3300061719 Bacteria 5719
1606 Ga0530510_0002726 3300061734 Bacteria 12164
1607 Ga0530510_0017917 3300061734 Bacteria 5021
1608 Ga0530510_0022875 3300061734 Bacteria 4454
1609 Ga0530510_0027284 3300061734 Bacteria 4092
1610 Ga0530510_0029713 3300061734 Bacteria 3923
1611 Ga0530510_0034058 3300061734 Bacteria 3668
1612 Ga0530510_0041103 3300061734 Bacteria 3338
1613 Ga0530510_0078292 3300061734 Bacteria 2403
1614 2644131281 2643221623 Bacteria 5239945
1615 2739310205 2738543024 Bacteria 5603683
1616 2753302454 2751185788 Bacteria 4541048
1617 2844856075 2844852863 Bacteria 3849151
1618 2852646055 2852643534 Bacteria 3013378
1619 2857734016 2857733635 Bacteria 3532004
1620 2895661688 2895660088 Bacteria 3782833
1621 2904432919 2904430863 Bacteria 3486923
1622 2904503372 2904501621 Bacteria 3401437
1623 2908675451 2908674828 Bacteria 3382763
1624 2909074507 2909074476 Bacteria 3436050
1625 2919041481 2919039151 Bacteria 3391018
1626 2919045610 2919042368 Bacteria 3905917
1627 2928107441 2928104781 Bacteria 3877447
1628 2928500436 2928500415 Bacteria 3384541
1629 2984554623 2984551494 Bacteria 3877562
1630 8002290462 8002285264 Bacteria 6717907
1631 8056056240 8056054917 Bacteria 5736694
1632 Ga0501040_0015481
1633 JGI24744J21845_10015159
1634 JGI25406J46586_10001453
1635 JGI25406J46586_10002115
1636 JGI25406J46586_10003867
1637 JGI25406J46586_10020800
1638 rootH1_10003792
1639 rootH1_10015730
1640 rootH1_10130565
1641 rootH2_10029474
1642 rootH2_10077888
1643 rootH2_10246637
1644 rootL2_10072383
1645 rootL2_10147111
1646 rootL2_10218153
1647 rootH1_10000715
1648 rootH1_10017154
1649 rootH1_10038814
1650 rootH1_10052808
1651 rootH1_10072353
1652 rootH1_10074058
1653 rootH1_10271435
1654 rootH1_10309830
1655 JGI25407J50210_10001911
1656 Ga0055531_10000197
1657 Ga0065704_10090251
1658 Ga0065712_10000291
1659 Ga0065712_10004042
1660 Ga0065712_10069922
1661 Ga0065715_10007485
1662 Ga0065715_10088927
1663 Ga0065715_10093813
1664 Ga0065715_10115116
1665 Ga0065707_10002597
1666 Ga0065707_10095335
1667 Ga0065707_10137250
1668 Ga0070658_10004558
1669 Ga0070658_10021319
1670 Ga0070658_10047664
1671 Ga0070658_10063213
1672 Ga0070676_10001001
1673 Ga0070676_10004892
1674 Ga0070683_100014524
1675 Ga0070683_100066029
1676 Ga0070683_100072617
1677 Ga0070683_100080888
1678 Ga0070690_100020399
1679 Ga0070690_100046269
1680 Ga0070690_100082498
1681 Ga0070690_100115957
1682 Ga0070670_100002473
1683 Ga0070670_100037369
1684 Ga0070670_100048794
1685 Ga0070670_100194418
1686 Ga0070677_10004528
1687 Ga0070677_10007902
1688 Ga0070677_10020902
1689 Ga0070677_10038389
1690 Ga0068869_100011797
1691 Ga0068869_100015575
1692 Ga0068869_100051024
1693 Ga0068869_100189935
1694 Ga0070666_10017347
1695 Ga0070666_10038037
1696 Ga0070666_10039300
1697 Ga0070666_10124172
1698 Ga0070666_10185287
1699 Ga0070680_100001439
1700 Ga0070680_100121292
1701 Ga0070682_100012961
1702 Ga0070682_100192315
1703 Ga0068868_100004371
1704 Ga0068868_100028174
1705 Ga0068868_100107984
1706 Ga0068868_100147442
1707 Ga0070660_100015905
1708 Ga0070660_100049144
1709 Ga0070660_100086389
1710 Ga0070689_100014123
1711 Ga0070689_100040242
1712 Ga0070689_100085455
1713 Ga0070689_100099802
1714 Ga0070689_100202478
1715 Ga0070689_100273604
1716 Ga0070691_10000641
1717 Ga0070691_10024585
1718 Ga0070687_100012056
1719 Ga0070661_100003449
1720 Ga0070661_100075997
1721 Ga0070661_100106273
1722 Ga0070692_10019617
1723 Ga0070668_100028688
1724 Ga0070668_100051252
1725 Ga0070668_100054752
1726 Ga0070668_100255113
1727 Ga0070669_100019309
1728 Ga0070669_100024441
1729 Ga0070669_100027704
1730 Ga0070669_100055599
1731 Ga0070669_100113862
1732 Ga0070669_100125363
1733 Ga0070675_100000253
1734 Ga0070675_100000801
1735 Ga0070675_100010643
1736 Ga0070675_100012438
1737 Ga0070675_100016586
1738 Ga0070675_100024137
1739 Ga0070675_100033328
1740 Ga0070675_100036573
1741 Ga0070675_100047989
1742 Ga0070675_100051450
1743 Ga0070675_100118766
1744 Ga0070675_100127945
1745 Ga0070675_100154473
1746 Ga0070675_100159515
1747 Ga0070675_100216181
1748 Ga0070675_100306837
1749 Ga0070671_100010783
1750 Ga0070671_100012745
1751 Ga0070671_100081478
1752 Ga0070671_100126264
1753 Ga0070671_100133600
1754 Ga0070671_100251314
1755 Ga0070674_100008245
1756 Ga0070674_100011162
1757 Ga0070674_100021567
1758 Ga0070674_100025985
1759 Ga0070674_100106384
1760 Ga0070673_100003415
1761 Ga0070673_100010744
1762 Ga0070673_100011536
1763 Ga0070673_100031373
1764 Ga0070673_100039829
1765 Ga0070673_100046128
1766 Ga0070673_100141248
1767 Ga0070673_100161682
1768 Ga0070673_100370344
1769 Ga0070688_100001161
1770 Ga0070688_100003997
1771 Ga0070688_100011267
1772 Ga0070688_100032333
1773 Ga0070688_100110805
1774 Ga0070688_100134579
1775 Ga0070659_100012472
1776 Ga0070659_100196671
1777 Ga0070659_100197851
1778 Ga0070667_100022929
1779 Ga0070667_100106195
1780 Ga0070667_100110257
1781 Ga0070667_100270192
1782 Ga0070709_10005949
1783 Ga0070714_100004846
1784 Ga0070714_100008730
1785 Ga0070714_100037767
1786 Ga0070713_100039343
1787 Ga0070701_10003780
1788 Ga0070701_10006652
1789 Ga0070701_10018766
1790 Ga0070701_10074729
1791 Ga0070701_10143987
1792 Ga0070705_100006809
1793 Ga0070705_100009951
1794 Ga0070700_100067464
1795 Ga0070694_100000107
1796 Ga0070694_100010050
1797 Ga0070694_100095545
1798 Ga0070708_100009182
1799 Ga0070708_100023470
1800 Ga0070708_100025793
1801 Ga0070708_100033340
1802 Ga0070708_100036455
1803 Ga0070708_100045037
1804 Ga0070708_100085577
1805 Ga0070708_100147932
1806 Ga0070663_100093338
1807 Ga0070663_100130434
1808 Ga0070678_100002431
1809 Ga0070678_100007740
1810 Ga0070678_100014125
1811 Ga0070678_100079193
1812 Ga0070678_100290583
1813 Ga0070662_100027802
1814 Ga0070662_100104796
1815 Ga0070662_100105552
1816 Ga0070662_100119446
1817 Ga0070662_100185094
1818 Ga0070681_10097714
1819 Ga0070681_10104952
1820 Ga0070681_10115744
1821 Ga0070681_10204787
1822 Ga0070681_10369968
1823 Ga0068867_100002815
1824 Ga0068867_100003246
1825 Ga0068867_100136856
1826 Ga0070685_10004772
1827 Ga0070685_10046696
1828 Ga0070685_10058265
1829 Ga0070706_100060461
1830 Ga0070706_100115262
1831 Ga0070706_100273176
1832 Ga0070707_100001749
1833 Ga0070707_100005817
1834 Ga0070707_100073832
1835 Ga0070707_100247852
1836 Ga0070698_100007001
1837 Ga0070698_100060247
1838 Ga0070698_100124924
1839 Ga0070699_100010678
1840 Ga0070699_100017590
1841 Ga0070699_100042598
1842 Ga0070699_100064384
1843 Ga0070699_100077001
1844 Ga0070679_100024192
1845 Ga0070679_100062464
1846 Ga0070679_100210201
1847 Ga0070684_100000213
1848 Ga0070684_100023808
1849 Ga0070684_100052441
1850 Ga0070684_100086426
1851 Ga0070684_100139022
1852 Ga0070684_100169766
1853 Ga0070684_100171779
1854 Ga0070684_100173029
1855 Ga0070697_100036753
1856 Ga0070697_100045110
1857 Ga0070697_100058647
1858 Ga0070697_100152772
1859 Ga0070697_100171230
1860 Ga0068853_100011384
1861 Ga0068853_100089669
1862 Ga0068853_100209435
1863 Ga0070672_100006459
1864 Ga0070672_100016774
1865 Ga0070672_100021164
1866 Ga0070672_100027841
1867 Ga0070672_100079330
1868 Ga0070672_100088071
1869 Ga0070672_100110689
1870 Ga0070672_100129850
1871 Ga0070686_100002473
1872 Ga0070686_100023123
1873 Ga0070686_100046276
1874 Ga0070695_100001868
1875 Ga0070695_100066492
1876 Ga0070696_100022563
1877 Ga0070696_100025334
1878 Ga0070693_100032240
1879 Ga0070693_100036425
1880 Ga0070693_100124278
1881 Ga0070665_100002991
1882 Ga0070665_100021844
1883 Ga0070665_100044289
1884 Ga0070665_100176423
1885 Ga0070704_100008238
1886 Ga0070704_100033130
1887 Ga0068855_100009123
1888 Ga0068855_100108732
1889 Ga0068855_100119594
1890 Ga0068855_100133775
1891 Ga0068855_100168419
1892 Ga0068855_100379915
1893 Ga0070664_100000586
1894 Ga0070664_100003485
1895 Ga0070664_100017864
1896 Ga0070664_100042073
1897 Ga0070664_100130673
1898 Ga0070664_100163765
1899 Ga0070664_100287132
1900 Ga0068857_100085189
1901 Ga0068857_100132500
1902 Ga0068854_100030643
1903 Ga0068854_100059050
1904 Ga0068854_100113415
1905 Ga0068854_100296381
1906 Ga0068856_100051081
1907 Ga0068856_100220826
1908 Ga0070702_100002472
1909 Ga0070702_100029233
1910 Ga0070702_100057673
1911 Ga0070702_100139159
1912 Ga0070702_100150313
1913 Ga0068852_100045599
1914 Ga0068852_100064492
1915 Ga0068852_100166839
1916 Ga0068859_100029439
1917 Ga0068859_100033086
1918 Ga0068859_100041652
1919 Ga0068859_100073857
1920 Ga0068859_100136215
1921 Ga0068859_100162559
1922 Ga0068859_100228236
1923 Ga0068864_100003807
1924 Ga0068864_100012301
1925 Ga0068864_100030047
1926 Ga0068864_100071533
1927 Ga0068864_100129009
1928 Ga0068864_100194065
1929 Ga0068864_100375659
1930 Ga0068866_10038903
1931 Ga0068861_100006139
1932 Ga0068861_100015207
1933 Ga0068861_100028959
1934 Ga0068851_10024137
1935 Ga0068851_10028093
1936 Ga0068851_10037183
1937 Ga0068870_10083230
1938 Ga0068863_100046319
1939 Ga0068863_100152745
1940 Ga0068863_100213775
1941 Ga0068863_100393234
1942 Ga0068858_100000002
1943 Ga0068858_100005689
1944 Ga0068858_100018354
1945 Ga0068858_100035040
1946 Ga0068858_100096443
1947 Ga0068858_100312344
1948 Ga0068860_100014438
1949 Ga0068860_100059285
1950 Ga0068860_100097700
1951 Ga0068860_100108479
1952 Ga0068860_100202888
1953 Ga0068862_100000192
1954 Ga0068862_100016510
1955 Ga0068862_100096827
1956 Ga0068862_100157271
1957 Ga0068862_100224329
1958 Ga0081455_10000995
1959 Ga0081455_10049132
1960 Ga0081455_10120691
1961 Ga0081538_10000004
1962 Ga0081539_10000024
1963 Ga0081539_10000035
1964 Ga0081539_10000244
1965 Ga0081539_10014216
1966 Ga0081539_10017051
1967 Ga0081539_10022783
1968 Ga0081539_10054855
1969 Ga0081539_10092488
1970 Ga0081539_10094365
1971 Ga0070717_10070185
1972 Ga0075365_10036265
1973 Ga0075365_10054928
1974 Ga0075365_10055190
1975 Ga0075365_10065905
1976 Ga0075368_10002301
1977 Ga0075368_10017923
1978 Ga0075363_100000364
1979 Ga0075363_100004611
1980 Ga0075363_100019594
1981 Ga0075364_10035090
1982 Ga0075364_10059297
1983 Ga0075364_10094090
1984 Ga0075364_10138463
1985 Ga0075432_10022092
1986 Ga0075432_10038984
1987 Ga0070712_100069113
1988 Ga0075367_10036217
1989 Ga0075367_10123291
1990 Ga0075369_10001831
1991 Ga0075366_10006958
1992 Ga0097621_100000510
1993 Ga0097621_100023601
1994 Ga0097621_100082245
1995 Ga0097621_100092591
1996 Ga0097621_100099825
1997 Ga0097621_100108084
1998 Ga0097621_100116772
1999 Ga0097621_100125172
2000 Ga0097621_100135672
2001 Ga0075370_10013756
2002 Ga0075370_10034318
2003 Ga0075370_10047475
2004 Ga0068871_100000108
2005 Ga0068871_100001762
2006 Ga0068871_100005779
2007 Ga0068871_100044770
2008 Ga0068871_100080567
2009 Ga0068871_100129739
2010 Ga0068871_100195840
2011 Ga0075428_100000100
2012 Ga0075428_100001176
2013 Ga0075428_100002267
2014 Ga0075428_100002710
2015 Ga0075428_100003258
2016 Ga0075428_100004744
2017 Ga0075428_100011875
2018 Ga0075428_100020681
2019 Ga0075428_100021454
2020 Ga0075428_100058385
2021 Ga0075428_100061209
2022 Ga0075428_100069973
2023 Ga0075428_100072723
2024 Ga0075428_100092312
2025 Ga0075428_100106053
2026 Ga0075428_100109485
2027 Ga0075430_100002969
2028 Ga0075430_100007284
2029 Ga0075430_100015760
2030 Ga0075430_100034006
2031 Ga0075430_100045040
2032 Ga0075430_100079058
2033 Ga0075430_100090238
2034 Ga0075430_100134779
2035 Ga0075431_100001491
2036 Ga0075431_100002445
2037 Ga0075431_100003423
2038 Ga0075431_100004448
2039 Ga0075431_100008897
2040 Ga0075431_100009529
2041 Ga0075431_100009670
2042 Ga0075431_100015256
2043 Ga0075431_100018729
2044 Ga0075431_100026022
2045 Ga0075431_100076459
2046 Ga0075431_100179361
2047 Ga0075431_100217028
2048 Ga0075433_10000348
2049 Ga0075433_10006016
2050 Ga0075433_10013934
2051 Ga0075433_10026871
2052 Ga0075433_10029614
2053 Ga0075433_10082409
2054 Ga0075433_10116262
2055 Ga0075434_100002451
2056 Ga0075434_100009109
2057 Ga0075434_100017333
2058 Ga0075434_100019774
2059 Ga0075434_100021900
2060 Ga0075434_100023769
2061 Ga0075434_100041223
2062 Ga0075434_100092342
2063 Ga0075434_100106257
2064 Ga0075434_100391167
2065 Ga0075429_100000082
2066 Ga0075429_100005845
2067 Ga0075429_100008969
2068 Ga0075429_100009769
2069 Ga0075429_100055229
2070 Ga0075429_100057994
2071 Ga0075429_100071554
2072 Ga0075429_100103843
2073 Ga0075429_100160770
2074 Ga0075429_100278492
2075 Ga0075429_100305469
2076 Ga0068865_100004918
2077 Ga0068865_100051701
2078 Ga0068865_100083553
2079 Ga0068865_100103385
2080 Ga0068865_100179413
2081 Ga0068865_100202672
2082 Ga0075436_100003014
2083 Ga0075436_100058685
2084 Ga0097620_100029436
2085 Ga0097620_100033086
2086 Ga0097620_100041655
2087 Ga0097620_100073858
2088 Ga0097620_100136213
2089 Ga0097620_100162560
2090 Ga0097620_100228244
2091 Ga0075435_100003226
2092 Ga0075435_100003893
2093 Ga0075435_100020624
2094 Ga0075435_100040892
2095 Ga0075435_100042755
2096 Ga0075435_100064482
2097 Ga0075435_100101013
2098 Ga0099794_10002655
2099 Ga0099794_10008572
2100 Ga0105240_10021429
2101 Ga0105240_10275252
2102 Ga0105240_10405961
2103 Ga0111539_10003771
2104 Ga0111539_10004229
2105 Ga0111539_10004348
2106 Ga0111539_10009801
2107 Ga0111539_10021661
2108 Ga0111539_10029039
2109 Ga0111539_10034471
2110 Ga0111539_10037135
2111 Ga0111539_10048226
2112 Ga0111539_10075167
2113 Ga0111539_10092226
2114 Ga0111539_10096271
2115 Ga0111539_10108999
2116 Ga0111539_10147900
2117 Ga0111539_10159359
2118 Ga0111539_10218455
2119 Ga0111539_10229966
2120 Ga0111539_10238610
2121 Ga0111539_10576760
2122 Ga0105245_10018518
2123 Ga0105245_10049152
2124 Ga0105245_10064134
2125 Ga0105247_10011104
2126 Ga0105247_10018503
2127 Ga0114129_10000032
2128 Ga0114129_10000127
2129 Ga0114129_10000939
2130 Ga0114129_10003134
2131 Ga0114129_10003744
2132 Ga0114129_10006207
2133 Ga0114129_10006952
2134 Ga0114129_10011327
2135 Ga0114129_10015037
2136 Ga0114129_10017930
2137 Ga0114129_10029973
2138 Ga0114129_10033131
2139 Ga0114129_10037256
2140 Ga0114129_10071958
2141 Ga0114129_10157201
2142 Ga0114129_10185545
2143 Ga0114129_10200567
2144 Ga0114129_10210827
2145 Ga0114129_10556086
2146 Ga0105243_10002886
2147 Ga0105243_10006221
2148 Ga0105243_10009076
2149 Ga0105243_10013026
2150 Ga0105243_10036259
2151 Ga0105243_10054643
2152 Ga0105243_10057372
2153 Ga0105243_10163848
2154 Ga0105243_10350370
2155 Ga0105243_10411699
2156 Ga0105241_10009863
2157 Ga0105241_10122279
2158 Ga0105242_10002197
2159 Ga0105242_10026154
2160 Ga0105242_10026311
2161 Ga0105242_10109442
2162 Ga0105242_10113762
2163 Ga0105242_10114559
2164 Ga0105242_10121863
2165 Ga0105242_10190971
2166 Ga0105248_10000943
2167 Ga0105248_10007178
2168 Ga0105248_10009334
2169 Ga0105248_10012226
2170 Ga0105248_10018050
2171 Ga0105248_10029846
2172 Ga0105248_10079334
2173 Ga0105248_10098948
2174 Ga0105248_10120483
2175 Ga0105248_10177132
2176 Ga0105248_10318894
2177 Ga0105248_10368026
2178 Ga0105238_10005510
2179 Ga0105238_10038120
2180 Ga0105238_10137774
2181 Ga0105238_10170887
2182 Ga0105238_10197339
2183 Ga0105249_10003805
2184 Ga0105249_10009569
2185 Ga0105249_10028809
2186 Ga0105249_10412692
2187 Ga0105239_10081521
2188 Ga0105239_10112876
2189 Ga0105239_10274524
2190 Ga0105246_10002150
2191 Ga0105246_10021870
2192 Ga0105246_10136664
2193 Ga0105246_10143116
2194 Ga0105246_10147169
2195 Ga0157371_10024677
2196 Ga0157370_10016729
2197 Ga0157370_10042219
2198 Ga0157370_10116970
2199 Ga0157369_10011406
2200 Ga0157369_10012708
2201 Ga0157374_10191254
2202 Ga0157374_10242036
2203 Ga0157378_10090899
2204 Ga0157378_10120861
2205 Ga0157378_10171200
2206 Ga0157378_10391349
2207 Ga0163162_10008524
2208 Ga0163162_10008622
2209 Ga0163162_10092279
2210 Ga0163162_10331878
2211 Ga0157372_10046056
2212 Ga0157372_10079042
2213 Ga0157372_10265210
2214 Ga0157375_10017505
2215 Ga0157375_10047330
2216 Ga0157375_10066597
2217 Ga0157375_10074179
2218 Ga0157375_10107640
2219 Ga0157375_10114966
2220 Ga0157375_10211661
2221 Ga0163163_10008055
2222 Ga0163163_10017879
2223 Ga0163163_10022835
2224 Ga0163163_10047022
2225 Ga0163163_10071192
2226 Ga0163163_10087836
2227 Ga0163163_10136659
2228 Ga0163163_10210525
2229 Ga0163163_10544418
2230 Ga0157380_10001491
2231 Ga0157380_10010921
2232 Ga0157380_10014471
2233 Ga0157380_10029501
2234 Ga0157380_10030663
2235 Ga0157380_10036819
2236 Ga0157380_10037074
2237 Ga0157380_10064627
2238 Ga0157380_10067423
2239 Ga0157380_10116889
2240 Ga0157380_10175468
2241 Ga0157380_10204849
2242 Ga0157380_10344942
2243 Ga0157380_10367117
2244 Ga0157380_10367951
2245 Ga0182008_10006801
2246 Ga0157377_10005968
2247 Ga0157377_10011755
2248 Ga0157377_10109470
2249 Ga0157379_10000007
2250 Ga0157379_10003064
2251 Ga0157379_10013575
2252 Ga0157379_10017832
2253 Ga0157379_10044088
2254 Ga0157379_10069016
2255 Ga0157379_10190944
2256 Ga0157379_10203540
2257 Ga0157376_10011280
2258 Ga0157376_10036613
2259 Ga0157376_10070517
2260 Ga0157376_10299891
2261 Ga0182007_10023328
2262 Ga0163161_10028324
2263 Ga0163161_10078278
2264 Ga0206356_10209910
2265 Ga0206353_10257956
2266 Ga0206353_10390452
2267 Ga0206353_11931331
2268 Ga0213876_10086674
2269 Ga0209050_1002956
2270 Ga0209257_1000006
2271 Ga0207697_10002059
2272 Ga0207697_10002496
2273 Ga0207697_10028256
2274 Ga0207697_10068738
2275 Ga0207656_10045227
2276 Ga0207682_10002902
2277 Ga0207682_10003368
2278 Ga0207682_10011854
2279 Ga0207642_10036849
2280 Ga0207688_10004310
2281 Ga0207688_10010791
2282 Ga0207688_10063280
2283 Ga0207688_10092310
2284 Ga0207680_10053614
2285 Ga0207680_10111437
2286 Ga0207699_10014716
2287 Ga0207645_10001211
2288 Ga0207645_10002990
2289 Ga0207645_10054617
2290 Ga0207645_10056145
2291 Ga0207645_10079852
2292 Ga0207645_10080516
2293 Ga0207643_10006077
2294 Ga0207643_10010032
2295 Ga0207643_10014099
2296 Ga0207643_10021872
2297 Ga0207643_10037355
2298 Ga0207643_10048157
2299 Ga0207643_10132954
2300 Ga0207705_10003753
2301 Ga0207705_10054656
2302 Ga0207705_10069859
2303 Ga0207684_10000491
2304 Ga0207684_10031743
2305 Ga0207684_10311778
2306 Ga0207654_10014370
2307 Ga0207707_10019997
2308 Ga0207695_10014226
2309 Ga0207695_10059773
2310 Ga0207695_10158762
2311 Ga0207693_10120583
2312 Ga0207660_10015632
2313 Ga0207662_10019025
2314 Ga0207662_10022979
2315 Ga0207662_10084746
2316 Ga0207662_10088745
2317 Ga0207662_10185391
2318 Ga0207657_10024642
2319 Ga0207657_10040322
2320 Ga0207657_10100137
2321 Ga0207649_10023474
2322 Ga0207649_10043227
2323 Ga0207649_10129224
2324 Ga0207652_10047440
2325 Ga0207646_10001586
2326 Ga0207646_10002404
2327 Ga0207646_10009215
2328 Ga0207646_10012777
2329 Ga0207646_10017164
2330 Ga0207646_10028693
2331 Ga0207646_10092641
2332 Ga0207681_10009853
2333 Ga0207681_10020691
2334 Ga0207681_10111301
2335 Ga0207681_10135371
2336 Ga0207681_10220191
2337 Ga0207694_10015342
2338 Ga0207650_10032986
2339 Ga0207650_10142047
2340 Ga0207650_10191455
2341 Ga0207659_10000209
2342 Ga0207659_10000854
2343 Ga0207659_10002047
2344 Ga0207659_10006129
2345 Ga0207659_10009478
2346 Ga0207659_10011484
2347 Ga0207659_10030752
2348 Ga0207659_10035003
2349 Ga0207659_10036189
2350 Ga0207659_10045322
2351 Ga0207659_10056908
2352 Ga0207687_10016974
2353 Ga0207700_10195584
2354 Ga0207664_10028758
2355 Ga0207664_10083724
2356 Ga0207644_10038219
2357 Ga0207644_10039388
2358 Ga0207644_10040682
2359 Ga0207644_10153803
2360 Ga0207644_10204901
2361 Ga0207706_10009358
2362 Ga0207706_10015076
2363 Ga0207706_10038166
2364 Ga0207706_10038926
2365 Ga0207706_10041924
2366 Ga0207706_10082819
2367 Ga0207706_10087790
2368 Ga0207686_10003421
2369 Ga0207686_10006274
2370 Ga0207686_10010825
2371 Ga0207686_10217860
2372 Ga0207709_10008062
2373 Ga0207709_10010140
2374 Ga0207709_10017542
2375 Ga0207709_10028476
2376 Ga0207709_10058745
2377 Ga0207709_10061172
2378 Ga0207709_10167256
2379 Ga0207670_10003370
2380 Ga0207670_10050656
2381 Ga0207670_10058770
2382 Ga0207670_10058784
2383 Ga0207670_10149525
2384 Ga0207670_10198646
2385 Ga0207670_10199551
2386 Ga0207670_10200801
2387 Ga0207670_10235702
2388 Ga0207670_10274841
2389 Ga0207669_10016067
2390 Ga0207669_10019064
2391 Ga0207669_10058122
2392 Ga0207704_10043620
2393 Ga0207704_10075104
2394 Ga0207691_10006867
2395 Ga0207691_10006894
2396 Ga0207691_10029696
2397 Ga0207691_10030061
2398 Ga0207691_10036136
2399 Ga0207691_10051484
2400 Ga0207691_10081206
2401 Ga0207691_10087850
2402 Ga0207691_10150241
2403 Ga0207711_10001278
2404 Ga0207711_10010515
2405 Ga0207711_10011686
2406 Ga0207711_10018748
2407 Ga0207711_10062275
2408 Ga0207711_10090877
2409 Ga0207711_10097778
2410 Ga0207689_10006638
2411 Ga0207689_10036444
2412 Ga0207689_10038079
2413 Ga0207689_10092527
2414 Ga0207689_10292362
2415 Ga0207661_10001430
2416 Ga0207661_10001693
2417 Ga0207661_10017151
2418 Ga0207661_10043583
2419 Ga0207661_10059670
2420 Ga0207661_10105298
2421 Ga0207679_10007694
2422 Ga0207679_10037475
2423 Ga0207679_10059730
2424 Ga0207679_10090800
2425 Ga0207679_10117062
2426 Ga0207679_10167973
2427 Ga0207679_10168597
2428 Ga0207667_10073659
2429 Ga0207667_10086606
2430 Ga0207667_10250735
2431 Ga0207651_10009269
2432 Ga0207651_10026264
2433 Ga0207651_10028137
2434 Ga0207651_10105102
2435 Ga0207651_10121253
2436 Ga0207651_10203723
2437 Ga0207651_10326444
2438 Ga0207712_10016816
2439 Ga0207712_10023448
2440 Ga0207712_10035472
2441 Ga0207712_10048939
2442 Ga0207712_10105025
2443 Ga0207640_10063796
2444 Ga0207640_10109378
2445 Ga0207640_10145833
2446 Ga0207658_10105918
2447 Ga0207658_10194161
2448 Ga0207677_10005324
2449 Ga0207677_10123707
2450 Ga0207677_10181823
2451 Ga0207703_10000001
2452 Ga0207703_10001811
2453 Ga0207703_10003450
2454 Ga0207703_10028221
2455 Ga0207703_10064866
2456 Ga0207639_10175722
2457 Ga0207639_10205469
2458 Ga0207678_10004486
2459 Ga0207678_10036465
2460 Ga0207678_10045317
2461 Ga0207678_10067075
2462 Ga0207678_10074382
2463 Ga0207678_10112554
2464 Ga0207678_10121680
2465 Ga0207708_10003212
2466 Ga0207708_10003477
2467 Ga0207708_10008663
2468 Ga0207708_10014140
2469 Ga0207708_10018446
2470 Ga0207708_10051556
2471 Ga0207708_10056058
2472 Ga0207708_10081767
2473 Ga0207708_10082413
2474 Ga0207708_10147771
2475 Ga0207708_10314022
2476 Ga0207702_10032147
2477 Ga0207702_10135040
2478 Ga0207702_10216984
2479 Ga0207641_10087888
2480 Ga0207641_10122856
2481 Ga0207641_10148860
2482 Ga0207648_10001129
2483 Ga0207648_10004649
2484 Ga0207648_10013721
2485 Ga0207648_10023072
2486 Ga0207648_10023618
2487 Ga0207648_10031547
2488 Ga0207648_10031931
2489 Ga0207648_10046921
2490 Ga0207648_10054768
2491 Ga0207648_10063665
2492 Ga0207648_10113510
2493 Ga0207648_10191481
2494 Ga0207648_10305520
2495 Ga0207676_10022681
2496 Ga0207676_10047034
2497 Ga0207676_10087204
2498 Ga0207676_10124781
2499 Ga0207674_10019100
2500 Ga0207674_10046794
2501 Ga0207674_10071773
2502 Ga0207674_10096765
2503 Ga0207674_10124853
2504 Ga0207674_10169714
2505 Ga0207674_10227804
2506 Ga0207675_100010366
2507 Ga0207675_100012983
2508 Ga0207675_100043996
2509 Ga0207675_100052039
2510 Ga0207683_10000190
2511 Ga0207683_10003923
2512 Ga0207683_10007767
2513 Ga0207683_10054688
2514 Ga0207683_10056469
2515 Ga0207683_10082387
2516 Ga0207683_10124695
2517 Ga0207683_10140584
2518 Ga0207698_10060892
2519 Ga0207698_10238718
2520 Ga0209588_1022596
2521 Ga0209588_1028619
2522 Ga0209998_10010271
2523 Ga0207428_10000393
2524 Ga0207428_10000574
2525 Ga0207428_10001100
2526 Ga0207428_10011660
2527 Ga0207428_10016192
2528 Ga0207428_10038835
2529 Ga0207428_10063561
2530 Ga0207428_10084280
2531 Ga0207428_10084727
2532 Ga0207428_10086614
2533 Ga0207428_10089007
2534 Ga0207428_10161341
2535 Ga0207428_10178367
2536 Ga0207428_10244222
2537 Ga0268266_10004015
2538 Ga0268266_10012762
2539 Ga0268265_10000185
2540 Ga0268265_10030738
2541 Ga0268265_10051363
2542 Ga0268265_10089961
2543 Ga0268265_10191468
2544 Ga0268264_10007749
2545 Ga0268264_10062017
2546 Ga0268264_10303755
2547 Ga0265337_1014920
2548 Ga0265337_1026590
2549 Ga0265326_10000821
2550 Ga0265319_1004075
2551 Ga0265334_10011902
2552 Ga0265318_10010683
2553 Ga0265336_10014135
2554 Ga0307515_10002908
2555 Ga0307515_10099224
2556 Ga0265338_10007839
2557 Ga0265324_10002985
2558 Ga0316176_1037086
2559 Ga0265770_1007359
2560 Ga0265330_10015743
2561 Ga0265332_10020389
2562 Ga0265328_10041085
2563 Ga0265320_10002308
2564 Ga0265320_10004075
2565 Ga0265325_10013604
2566 Ga0265329_10004508
2567 Ga0265340_10000470
2568 Ga0265327_10004586
2569 Ga0265316_10010209
2570 Ga0265316_10011723
2571 Ga0265316_10238937
2572 Ga0307513_10000007
2573 Ga0307509_10032339
2574 Ga0307509_10078800
2575 Ga0307408_100013432
2576 Ga0307408_100059644
2577 Ga0307408_100203948
2578 Ga0307408_100220969
2579 Ga0265313_10038254
2580 Ga0316575_10000826
2581 Ga0316575_10001083
2582 Ga0316575_10009431
2583 Ga0316579_10008036
2584 Ga0316579_10020391
2585 Ga0316579_10039001
2586 Ga0265314_10002620
2587 Ga0265314_10015520
2588 Ga0265314_10027079
2589 Ga0265314_10052424
2590 Ga0316576_10003639
2591 Ga0316576_10006146
2592 Ga0316576_10011842
2593 Ga0316576_10027074
2594 Ga0316576_10056092
2595 Ga0316576_10071907
2596 Ga0316576_10082011
2597 Ga0316576_10100244
2598 Ga0316576_10139728
2599 Ga0316578_10001433
2600 Ga0316578_10001971
2601 Ga0316578_10041392
2602 Ga0316578_10041628
2603 Ga0316578_10117930
2604 Ga0307405_10058926
2605 Ga0307405_10091025
2606 Ga0307405_10104994
2607 Ga0316577_10000080
2608 Ga0316577_10000089
2609 Ga0316577_10000636
2610 Ga0316577_10004746
2611 Ga0316577_10005239
2612 Ga0316577_10089796
2613 Ga0307413_10039012
2614 Ga0307413_10054017
2615 Ga0307413_10062645
2616 Ga0307410_10019576
2617 Ga0307410_10025569
2618 Ga0307410_10103711
2619 Ga0307406_10081494
2620 Ga0307412_10087758
2621 Ga0307409_100027899
2622 Ga0307409_100037964
2623 Ga0307409_100144540
2624 Ga0307416_100008589
2625 Ga0307416_100016633
2626 Ga0307416_100165180
2627 Ga0307416_100178783
2628 Ga0307415_100018876
2629 Ga0316583_10009047
2630 Ga0316583_10020931
2631 Ga0316583_10021849
2632 Ga0316583_10068207
2633 Ga0316585_10021473
2634 Ga0316585_10053676
2635 Ga0316580_10001255
2636 Ga0316580_10006543
2637 Ga0316593_10008734
2638 Ga0373923_0045215
2639 Ga0373932_0018875
2640 Ga0373945_0059996
2641 Ga0373954_0023176
2642 Ga0373956_0052479
2643 Ga0373943_0015607
2644 Ga0373943_0038565
2645 Ga0373946_0024979
2646 Ga0373955_0033485
2647 Ga0373962_0023654
2648 Ga0316574_0000151
2649 Ga0316574_0001153
2650 Ga0316574_0001764
2651 Ga0316574_0066657
2652 Ga0316574_0080492
2653 Ga0373924_0007928
2654 Ga0373931_0016904
2655 Ga0373931_0035227
2656 Ga0373935_0076680
2657 Ga0373935_0141213
2658 Ga0373927_0022808
2659 Ga0373947_0002973
2660 Ga0373947_0013397
2661 Ga0373937_0008628
2662 Ga0373937_0055725
2663 Ga0373937_0210739
2664 Ga0373937_0243687
2665 Ga0316582_0000480
2666 Ga0316582_0006227
2667 Ga0316582_0015286
2668 Ga0316582_0043091
2669 Ga0316582_0137838
2670 Ga0316582_0154380
2671 Ga0316584_0000413
2672 Ga0316584_0001506
2673 Ga0316584_0010138
2674 Ga0316584_0011733
2675 Ga0316584_0023624
2676 Ga0316584_0046235
2677 Ga0316584_0061249
2678 Ga0316584_0203567
2679 Ga0373925_0021612
2680 Ga0373925_0029664
2681 Ga0373925_0044438
2682 Ga0395900_0147181
2683 Ga0395900_0327770
2684 Ga0395898_0076611
2685 Ga0395905_0035481
2686 Ga0436364_0619729
2687 Ga0395901_0006804
2688 Ga0395901_0023635
2689 Ga0395901_0157581
2690 Ga0400484_12566
2691 Ga0400490_37255
2692 Ga0400490_39545
2693 Ga0400490_42916
2694 Ga0400491_05038
2695 Ga0400491_07905
2696 Ga0400485_03365
2697 Ga0400485_09643
2698 Ga0400488_06186
2699 Ga0400488_41691
2700 Ga0400486_13051
2701 Ga0400483_032670
2702 Ga0400483_123874
2703 Ga0400483_155563
2704 Ga0400489_27482
2705 Ga0436365_0895231
2706 Ga0439439_0000378
2707 Ga0439465_0015220
2708 Ga0451789_0440849
2709 Ga0451791_0426296
2710 Ga0451793_0141268
2711 Ga0451793_0476113
2712 Ga0451800_0714665
2713 Ga0451841_0256531
2714 Ga0451843_0257713
2715 Ga0451853_3751897
2716 Ga0439433_0013975
2717 Ga0439449_0008770
2718 Ga0439449_0010419
2719 Ga0439454_004658
2720 Ga0439457_010577
2721 Ga0450920_001937
2722 Ga0450923_004384
2723 Ga0450907_002845
2724 Ga0439435_0002282
2725 Ga0439435_0008994
2726 Ga0439435_0038192
2727 Ga0439460_0020898
2728 Ga0451577_0052810
2729 Ga0451577_0085446
2730 Ga0451577_0280582
2731 Ga0466972_0006816
2732 Ga0453683_0065627
2733 Ga0453683_0193185
2734 Ga0466966_0037157
2735 Ga0466963_0064225
2736 Ga0466963_0152872
2737 Ga0466963_0169693
2738 Ga0453684_0000173
2739 Ga0453684_0001703
2740 Ga0453684_0007129
2741 Ga0453684_0015989
2742 Ga0453684_0080375
2743 Ga0453684_0115462
2744 Ga0453684_0166957
2745 Ga0453684_0360157
2746 Ga0466971_0051355
2747 Ga0466968_0025832
2748 Ga0466970_0013084
2749 Ga0466970_0017062
2750 Ga0466957_0039512
2751 Ga0466957_0047436
2752 Ga0466959_0009315
2753 Ga0451576_0008442
2754 Ga0451576_0008949
2755 Ga0451576_0153042
2756 Ga0451576_0165470
2757 Ga0451576_0201454
2758 Ga0466958_0009420
2759 Ga0466958_0064423
2760 Ga0466958_0099781
2761 Ga0466958_0139498
2762 Ga0466967_0005268
2763 Ga0466967_0022309
2764 Ga0466967_0091982
2765 Ga0466967_0133259
2766 Ga0466967_0163140
2767 Ga0495603_0008241
2768 Ga0495603_0013562
2769 Ga0495629_0000523
2770 Ga0495638_0000003
2771 Ga0495653_0017324
2772 Ga0495653_0093503
2773 Ga0495580_0000346
2774 Ga0495580_0073561
2775 Ga0495580_0172151
2776 Ga0495582_0008009
2777 Ga0495582_0098518
2778 Ga0495639_0008933
2779 Ga0495594_0076126
2780 Ga0495594_0201852
2781 Ga0495608_0020626
2782 Ga0495618_0235901
2783 Ga0495628_0003293
2784 Ga0495628_0011434
2785 Ga0495628_0122326
2786 Ga0495630_0009089
2787 Ga0495630_0013143
2788 Ga0495666_0121750
2789 Ga0495665_0108169
2790 Ga0495640_0018120
2791 Ga0495640_0094151
2792 Ga0495586_0168486
2793 Ga0495587_0081896
2794 Ga0495609_0033729
2795 Ga0495621_0000799
2796 Ga0495621_0001364
2797 Ga0495621_0013561
2798 Ga0495645_0000509
2799 Ga0495667_0021852
2800 Ga0495635_0132119
2801 Ga0495659_0022356
2802 Ga0495659_0024145
2803 Ga0495588_0044414
2804 Ga0495647_0030358
2805 Ga0495658_0001090
2806 Ga0495658_0034283
2807 Ga0495658_0048533
2808 Ga0495658_0219255
2809 Ga0495669_0011838
2810 Ga0495669_0108264
2811 Ga0495613_0008520
2812 Ga0495613_0124506
2813 Ga0495613_0227618
2814 Ga0495600_0098163
2815 Ga0495581_0043855
2816 Ga0495674_0021360
2817 Ga0495674_0051535
2818 Ga0495672_0000242
2819 Ga0495672_0004208
2820 Ga0495677_0044018
2821 Ga0495684_0001676
2822 Ga0495602_0136664
2823 Ga0496101_0156636
2824 Ga0496101_0236363
2825 Ga0496102_0043243
2826 Ga0496102_0072640
2827 Ga0496102_0079705
2828 Ga0496102_0093756
2829 Ga0496102_0119680
2830 Ga0496104_0003311
2831 Ga0496104_0010031
2832 Ga0496104_0020628
2833 Ga0496104_0079682
2834 Ga0496104_0243987
2835 Ga0496105_0000513
2836 Ga0496105_0092061
2837 Ga0496105_0096560
2838 Ga0496105_0161757
2839 Ga0496106_0006809
2840 Ga0496106_0029816
2841 Ga0496106_0110583
2842 Ga0496106_0159907
2843 Ga0496107_0003244
2844 Ga0496107_0082562
2845 Ga0496108_0002685
2846 Ga0496108_0005882
2847 Ga0496108_0024891
2848 Ga0496108_0074259
2849 Ga0496108_0168024
2850 Ga0496109_0001158
2851 Ga0496109_0003151
2852 Ga0496109_0030856
2853 Ga0496109_0265194
2854 Ga0496110_0006677
2855 Ga0496110_0013256
2856 Ga0496110_0017224
2857 Ga0496110_0092227
2858 Ga0496111_0006838
2859 Ga0496111_0010934
2860 Ga0496111_0076714
2861 Ga0496111_0219971
2862 Ga0496112_0001156
2863 Ga0496112_0041108
2864 Ga0496112_0088517
2865 Ga0496112_0157512
2866 Ga0496112_0194101
2867 Ga0496112_0436367
2868 Ga0496113_0008939
2869 Ga0496113_0012915
2870 Ga0496113_0021398
2871 Ga0496113_0025915
2872 Ga0496114_0005398
2873 Ga0496114_0014629
2874 Ga0496114_0080620
2875 Ga0496114_0144195
2876 Ga0496114_0174311
2877 Ga0496114_0467976
2878 Ga0496115_0001888
2879 Ga0496115_0053909
2880 Ga0496115_0056811
2881 Ga0496117_0004173
2882 Ga0496118_0000909
2883 Ga0496121_0000025
2884 Ga0496122_0002058
2885 Ga0496122_0111496
2886 Ga0496123_0006537
2887 Ga0496123_0011752
2888 Ga0496123_0121298
2889 Ga0496124_0000639
2890 Ga0496124_0132995
2891 Ga0496124_0162442
2892 Ga0496126_0027150
2893 Ga0501300_001453
2894 Ga0501323_004435
2895 Ga0501325_001364
2896 Ga0501031_0001166
2897 Ga0501031_0016519
2898 Ga0501031_0019548
2899 Ga0501031_0087488
2900 Ga0501032_0002307
2901 Ga0501033_0000941
2902 Ga0501033_0019917
2903 Ga0501033_0063719
2904 Ga0501033_0078188
2905 Ga0501034_0002121
2906 Ga0501034_0008189
2907 Ga0501034_0164197
2908 Ga0501034_0201836
2909 Ga0501036_0000057
2910 Ga0501036_0001775
2911 Ga0501036_0022956
2912 Ga0501036_0051933
2913 Ga0501036_0103190
2914 Ga0501036_0137854
2915 Ga0501037_0001310
2916 Ga0501037_0009021
2917 Ga0501037_0030509
2918 Ga0501038_0000391
2919 Ga0501038_0027841
2920 Ga0501038_0086524
2921 Ga0501038_0134033
2922 Ga0501039_0000309
2923 Ga0501039_0013387
2924 Ga0501039_0021253
2925 Ga0501039_0028801
2926 Ga0501039_0043221
2927 Ga0501039_0114050
2928 Ga0501039_0206551
2929 Ga0501040_0004086
2930 Ga0501040_0009350
2931 Ga0501040_0016992
2932 Ga0501040_0020914
2933 Ga0501040_0021385
2934 Ga0501040_0033917
2935 Ga0501040_0166529
2936 Ga0501040_0176649
2937 Ga0501041_0002498
2938 Ga0501041_0014933
2939 Ga0501041_0018696
2940 Ga0501041_0123376
2941 Ga0501041_0126730
2942 Ga0501042_0002039
2943 Ga0501042_0003181
2944 Ga0501042_0011677
2945 Ga0501042_0050630
2946 Ga0501042_0058483
2947 Ga0501042_0092036
2948 Ga0501042_0099901
2949 Ga0501042_0104152
2950 Ga0501042_0241435
2951 Ga0501043_0000111
2952 Ga0501043_0043834
2953 Ga0501043_0118797
2954 Ga0501046_0000307
2955 Ga0501046_0014958
2956 Ga0501046_0114077
2957 Ga0501046_0125431
2958 Ga0501047_0000289
2959 Ga0501047_0002400
2960 Ga0501048_0000298
2961 Ga0501048_0005925
2962 Ga0501048_0016854
2963 Ga0501048_0022284
2964 Ga0501048_0165633
2965 Ga0501067_0000065
2966 Ga0501067_0013273
2967 Ga0501067_0016818
2968 Ga0501067_0020205
2969 Ga0501067_0036773
2970 Ga0501067_0146587
2971 Ga0501068_0000099
2972 Ga0501068_0039468
2973 Ga0501068_0043827
2974 Ga0501068_0054740
2975 Ga0501068_0068423
2976 Ga0501068_0103014
2977 Ga0501069_0001404
2978 Ga0501069_0006770
2979 Ga0501069_0046809
2980 Ga0501070_0001132
2981 Ga0501070_0016772
2982 Ga0501070_0024597
2983 Ga0501070_0073617
2984 Ga0501070_0146802
2985 Ga0501071_0000488
2986 Ga0501071_0003854
2987 Ga0501071_0005549
2988 Ga0501071_0019597
2989 Ga0501071_0020005
2990 Ga0501071_0025545
2991 Ga0501071_0039050
2992 Ga0501071_0048161
2993 Ga0501071_0075934
2994 Ga0501071_0116344
2995 Ga0501071_0184437
2996 Ga0501072_0004844
2997 Ga0501072_0009359
2998 Ga0501072_0009420
2999 Ga0501072_0013185
3000 Ga0501072_0017150
3001 Ga0501072_0029963
3002 Ga0501072_0031779
3003 Ga0501072_0032367
3004 Ga0501072_0061470
3005 Ga0501072_0071964
3006 Ga0501072_0105608
3007 Ga0501072_0303699
3008 Ga0501073_0007238
3009 Ga0501073_0013683
3010 Ga0501073_0015002
3011 Ga0501073_0126313
3012 Ga0501073_0214598
3013 Ga0501074_0000074
3014 Ga0501074_0019499
3015 Ga0501074_0058553
3016 Ga0501074_0088881
3017 Ga0501074_0106746
3018 Ga0501075_0003648
3019 Ga0501075_0018685
3020 Ga0501075_0025444
3021 Ga0501075_0040497
3022 Ga0501075_0041989
3023 Ga0501075_0073297
3024 Ga0501075_0098365
3025 Ga0501075_0233080
3026 Ga0501076_0002631
3027 Ga0501076_0007851
3028 Ga0501076_0011199
3029 Ga0501076_0011969
3030 Ga0501076_0041077
3031 Ga0501076_0105052
3032 Ga0501076_0200901
3033 Ga0501076_0257598
3034 Ga0501077_0016934
3035 Ga0501077_0062494
3036 Ga0501077_0100103
3037 Ga0501077_0176385
3038 Ga0501221_014438
3039 Ga0501079_0005025
3040 Ga0501079_0018044
3041 Ga0501079_0024592
3042 Ga0501079_0047886
3043 Ga0501079_0061460
3044 Ga0501079_0100333
3045 Ga0501079_0106723
3046 Ga0501079_0107212
3047 Ga0501079_0170704
3048 Ga0501080_0000244
3049 Ga0501080_0000414
3050 Ga0501080_0070329
3051 Ga0501080_0096840
3052 Ga0501080_0104895
3053 Ga0501080_0161284
3054 Ga0501081_0000754
3055 Ga0501081_0008776
3056 Ga0501081_0011798
3057 Ga0501081_0090290
3058 Ga0501081_0138662
3059 Ga0501081_0142686
3060 Ga0501081_0195964
3061 Ga0501083_0019965
3062 Ga0501083_0036872
3063 Ga0501083_0192587
3064 Ga0501264_000063
3065 Ga0501035_0000262
3066 Ga0501035_0013824
3067 Ga0501035_0108437
3068 Ga0501044_0000312
3069 Ga0501045_0003035
3070 Ga0501045_0003799
3071 Ga0501045_0011531
3072 Ga0501045_0017723
3073 Ga0501045_0025444
3074 Ga0501045_0034416
3075 Ga0501045_0074245
3076 Ga0501045_0082011
3077 Ga0501045_0147944
3078 nmdc:mga03n38_31977_c1
3079 nmdc:mga00v17_102676_c1
3080 nmdc:mga00v17_105147_c1
3081 nmdc:mga0yw44_12118_c1
3082 nmdc:mga0yw44_148377_c1
3083 nmdc:mga0yw44_18976_c1
3084 nmdc:mga0yw44_52124_c1
3085 nmdc:mga0yw44_64894_c1
3086 nmdc:mga0k408_24679_c1
3087 nmdc:mga0k408_76416_c1
3088 nmdc:mga06z11_50726_c1
3089 nmdc:mga06z11_98093_c1
3090 nmdc:mga07m45_24539_c1
3091 nmdc:mga07m45_25794_c1
3092 nmdc:mga05p37_10188_c1
3093 nmdc:mga05p37_115999_c1
3094 nmdc:mga05p37_123154_c1
3095 nmdc:mga05p37_12946_c1
3096 nmdc:mga05p37_13104_c1
3097 nmdc:mga05p37_13976_c1
3098 nmdc:mga05p37_147215_c1
3099 nmdc:mga05p37_156577_c1
3100 nmdc:mga05p37_16959_c1
3101 nmdc:mga05p37_275_c1
3102 nmdc:mga05p37_3361_c1
3103 nmdc:mga05p37_441566_c1
3104 nmdc:mga05p37_444686_c1
3105 nmdc:mga05p37_45778_c1
3106 nmdc:mga05p37_482297_c1
3107 nmdc:mga05p37_6361_c1
3108 nmdc:mga05p37_63640_c1
3109 nmdc:mga05p37_65409_c1
3110 nmdc:mga09592_12832_c1
3111 nmdc:mga09592_137332_c1
3112 nmdc:mga09592_182953_c1
3113 nmdc:mga09592_183003_c1
3114 nmdc:mga09592_252817_c1
3115 nmdc:mga09592_302676_c1
3116 nmdc:mga09592_5612_c1
3117 nmdc:mga09592_65081_c1
3118 nmdc:mga09592_67270_c1
3119 nmdc:mga09592_70846_c1
3120 nmdc:mga09592_953_c1
3121 nmdc:mga09592_96657_c1
3122 nmdc:mga0qj67_13711_c1
3123 nmdc:mga0qj67_21101_c1
3124 nmdc:mga0qj67_24595_c1
3125 nmdc:mga0qj67_245972_c1
3126 nmdc:mga0qj67_2517_c1
3127 nmdc:mga0qj67_2598_c1
3128 nmdc:mga0qj67_75052_c1
3129 nmdc:mga0qj67_95202_c1
3130 nmdc:mga06r32_10914_c1
3131 nmdc:mga06r32_113653_c1
3132 nmdc:mga06r32_113980_c1
3133 nmdc:mga06r32_14263_c1
3134 nmdc:mga06r32_14472_c1
3135 nmdc:mga06r32_15782_c1
3136 nmdc:mga06r32_220850_c1
3137 nmdc:mga06r32_4670_c1
3138 nmdc:mga06r32_46937_c1
3139 nmdc:mga06r32_48535_c1
3140 nmdc:mga06r32_52312_c1
3141 nmdc:mga06r32_66280_c1
3142 nmdc:mga06r32_66410_c1
3143 nmdc:mga06r32_6887_c1
3144 nmdc:mga06r32_7657_c1
3145 nmdc:mga08y16_103170_c1
3146 nmdc:mga08y16_11284_c1
3147 nmdc:mga08y16_185985_c1
3148 nmdc:mga08y16_269854_c1
3149 nmdc:mga08y16_2708_c1
3150 nmdc:mga08y16_273965_c1
3151 nmdc:mga08y16_282487_c1
3152 nmdc:mga08y16_28869_c1
3153 nmdc:mga08y16_32443_c1
3154 nmdc:mga08y16_3393_c1
3155 nmdc:mga08y16_46864_c1
3156 nmdc:mga08y16_504_c1
3157 nmdc:mga08y16_6332_c1
3158 nmdc:mga08y16_8405_c1
3159 nmdc:mga0n895_10806_c1
3160 nmdc:mga0n895_118817_c1
3161 nmdc:mga0n895_11991_c1
3162 nmdc:mga0n895_130462_c1
3163 nmdc:mga0n895_18517_c1
3164 nmdc:mga0n895_20427_c1
3165 nmdc:mga0n895_2106_c1
3166 nmdc:mga0n895_28190_c1
3167 nmdc:mga0n895_50397_c1
3168 nmdc:mga0n895_5966_c1
3169 nmdc:mga0n895_62888_c1
3170 nmdc:mga0n895_78707_c1
3171 nmdc:mga0n895_829_c1
3172 nmdc:mga0rr50_145299_c1
3173 nmdc:mga0rr50_151407_c1
3174 nmdc:mga0rr50_167056_c1
3175 nmdc:mga0rr50_32236_c1
3176 nmdc:mga0rr50_354_c1
3177 nmdc:mga0rr50_7956_c1
3178 nmdc:mga0rr50_80461_c1
3179 nmdc:mga08x19_2446_c1
3180 nmdc:mga0a205_1093_c1
3181 nmdc:mga0a205_140551_c1
3182 nmdc:mga0a205_141186_c1
3183 nmdc:mga0a205_14504_c1
3184 nmdc:mga0a205_146419_c1
3185 nmdc:mga0a205_18128_c1
3186 nmdc:mga0a205_2072_c1
3187 nmdc:mga0a205_3147_c1
3188 nmdc:mga0a205_38110_c1
3189 nmdc:mga0a205_72728_c1
3190 nmdc:mga0a205_74669_c1
3191 Ga0495601_0006657
3192 Ga0495595_0006010
3193 Ga0495619_0003726
3194 Ga0495619_0011460
3195 Ga0495619_0074185
3196 Ga0495619_0081543
3197 Ga0495619_0088962
3198 Ga0500643_000913
3199 Ga0500644_0000106
3200 Ga0500641_0002700
3201 Ga0500556_0000001
3202 Ga0500568_0000003
3203 Ga0500568_0032010
3204 Ga0500604_0002802
3205 Ga0500616_0000007
3206 Ga0500616_0000205
3207 Ga0500616_0037765
3208 Ga0500622_0000066
3209 Ga0500622_0000179
3210 Ga0500622_0001539
3211 Ga0500645_001172
3212 Ga0501084_0001637
3213 Ga0501084_0006547
3214 Ga0501084_0023342
3215 Ga0501084_0023478
3216 Ga0501084_0026974
3217 Ga0501084_0043651
3218 Ga0501084_0053078
3219 Ga0501084_0066241
3220 Ga0501084_0135199
3221 Ga0501084_0167806
3222 Ga0501084_0282519
3223 Ga0590071_014634
3224 Ga0590075_000348
3225 Ga0590075_000928
3226 Ga0590077_000323
3227 Ga0590077_003620
3228 Ga0501082_0002453
3229 Ga0501082_0007432
3230 Ga0501082_0012030
3231 Ga0501082_0022921
3232 Ga0501082_0038929
3233 Ga0501082_0063921
3234 Ga0501082_0073646
3235 Ga0501082_0107841
3236 Ga0466962_0006259
3237 Ga0530510_0002726
3238 Ga0530510_0017917
3239 Ga0530510_0022875
3240 Ga0530510_0027284
3241 Ga0530510_0029713
3242 Ga0530510_0034058
3243 Ga0530510_0041103
3244 Ga0530510_0078292
3245 2644131281
3246 2739310205
3247 2753302454
3248 2844856075
3249 2852646055
3250 2857734016
3251 2895661688
3252 2904432919
3253 2904503372
3254 2908675451
3255 2909074507
3256 2919041481
3257 2919045610
3258 2928107441
3259 2928500436
3260 2984554623
3261 8002290462
3262 8056056240

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07478

Dala_Dala_lig_C

D-ala D-ala ligase C-terminus

203

408

0.98

PF01820

Dala_Dala_lig_N

D-ala D-ala ligase N-terminus

43

186

0.86

PF02786

CPSase_L_D2

Carbamoyl-phosphate synthase L chain, ATP binding domain

219

379

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r5f-assembly1.cif.gz_A-2 crystal structure of d-alanine-d-alnine ligase from xanthomonas oryzae pv. oryzae with atp 0.9306 3 386
4me6-assembly1.cif.gz_A-2 crystal structure of d-alanine-d-alanine ligase a from xanthomonas oryzae pathovar oryzae with adp 0.9302 2 386
3rfc-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9282 2 385
3r5f-assembly1.cif.gz_A-2 crystal structure of d-alanine-d-alnine ligase from xanthomonas oryzae pv. oryzae with atp 0.9279 3 386
4me6-assembly1.cif.gz_A-2 crystal structure of d-alanine-d-alanine ligase a from xanthomonas oryzae pathovar oryzae with adp 0.9276 2 386
ID Description Score Start End Superfamily
3q1kB02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9541 146 384 3.30.470.20
5bpfD02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9505 146 371 3.30.470.20
3q1kB02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9477 146 384 3.30.470.20
1ehiB02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9429 244 382 3.30.470.20
5bpfD02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9377 146 371 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A535FBX8-F1-model_v4 D-alanine--D-alanine ligase 0.9939 131 384 GO:0005524
GO:0005829
GO:0008360
GO:0008716
GO:0009252
GO:0046872
GO:0071555
AF-A0A7X6VCQ7-F1-model_v4 ATP-grasp domain-containing protein 0.991 216 380 GO:0005524
GO:0005829
GO:0008360
GO:0008716
GO:0009252
GO:0046872
AF-A0A357CRR7-F1-model_v4 D-alanine--D-alanine ligase A 0.9895 117 378 GO:0005524
GO:0005829
GO:0008360
GO:0008716
GO:0009252
GO:0046872
GO:0071555
AF-A0A7W0ZQ39-F1-model_v4 ATP-grasp domain-containing protein 0.9865 216 380 GO:0005524
GO:0005829
GO:0008360
GO:0008716
GO:0009252
GO:0046872
AF-A0A535FBX8-F1-model_v4 D-alanine--D-alanine ligase 0.9862 131 384 GO:0005524
GO:0005829
GO:0008360
GO:0008716
GO:0009252
GO:0046872
GO:0071555

Map