F495144
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1633 | 702 | 1455 | 182 |
Family's Representative Sequence
| Representative Sequence | 3300046524|Ga0495648_0001270|Ga0495648_0001270_1928_2587 |
| Length | 219 |
| Sequence | MLPYSLVEADMPFSLFPKSRLPLKSPPANRFADRLEMKMHARADTAAQIAPSWPEDIFTILQRFDVRQVPYVPDAGHSQLIERVLAAPSMRAVPLTTEEEGVALLAGAWAGGQRGVLLMQSSGVGNCVNMLSLTQVLRFPFLTLVTMRGEWGEFNPWQVPMGSSTAGVFELSGIKVLRASHAAEVREVVEAAAGQAYNACTPTAVLLSQRLIGAKVFTK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 9 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 10 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 11 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 12 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 13 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 14 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 15 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 16 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 17 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 18 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 19 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 20 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 21 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 22 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 23 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 24 | 2791355199 | |||
| 25 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 26 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 27 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 28 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 29 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 30 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 31 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 32 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 33 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 34 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 35 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 36 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 37 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 38 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 39 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 40 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 41 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 42 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 43 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 44 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 45 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 46 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 47 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 48 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 49 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 50 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 51 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 52 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 53 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 54 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 55 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 56 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 57 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 58 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 59 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 60 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 61 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 62 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 63 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 64 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 65 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 66 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 67 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 68 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 69 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 70 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 71 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 72 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 73 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 74 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 75 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 76 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 77 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 78 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 79 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 80 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 81 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 82 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 83 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 84 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 85 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 86 | 2922368715 | |||
| 87 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 88 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 89 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 90 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 91 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 92 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 93 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 94 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 95 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 96 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 97 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 98 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 99 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 100 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 101 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 102 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 103 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 104 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 105 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 106 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 107 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 108 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 109 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 110 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 111 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 112 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 113 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 114 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 115 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 116 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 117 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 118 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 119 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 120 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 121 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 122 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 123 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 124 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 125 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 126 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 127 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 128 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 129 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 130 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 131 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 132 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 133 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 134 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 135 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 136 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 137 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 138 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 139 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 140 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 141 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 142 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 143 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 144 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 145 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 146 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 147 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 148 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 149 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 150 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 151 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 152 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 153 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 154 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 155 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 156 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 157 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 160 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 161 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 163 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 164 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 165 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 166 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 168 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 169 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 170 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 172 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 177 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 180 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 181 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 183 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 184 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 185 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 186 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 187 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 188 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 189 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 193 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 194 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 195 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 196 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 197 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 198 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 199 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 200 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 202 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 203 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 207 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 208 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 210 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 211 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 212 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 214 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 215 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 216 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 217 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 218 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 219 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 220 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 221 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 222 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 223 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 224 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 225 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 226 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 227 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 228 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 229 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 230 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 231 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 232 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 233 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 234 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 235 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 236 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 237 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 238 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 239 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 240 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 241 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 243 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 244 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 245 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 246 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 247 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 248 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 250 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 251 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 252 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 253 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 254 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 256 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 257 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 259 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 260 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 261 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 262 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 263 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 264 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 265 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 266 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 267 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 268 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 269 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 270 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 271 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 272 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 273 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 274 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 275 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 276 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 277 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 278 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 279 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 280 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 281 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 282 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 283 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 284 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 285 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 286 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 287 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 288 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 289 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 290 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 291 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 292 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 293 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 294 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 295 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 296 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 297 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 298 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 299 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 300 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 301 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 302 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 303 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 304 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 305 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 306 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 307 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 372 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 373 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 374 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 375 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 379 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 383 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 384 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 385 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 386 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 387 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 389 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 390 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 391 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 392 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 393 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 394 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 395 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 396 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 397 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 398 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 399 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 400 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 401 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 402 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 403 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 404 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 405 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 406 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 407 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 408 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 409 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 410 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 411 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 412 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 413 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 414 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 415 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 416 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 417 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 418 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 419 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 420 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 421 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 422 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 423 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 424 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 425 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 426 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 427 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 428 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 429 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 430 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 431 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 432 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 433 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 434 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 435 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 436 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 437 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 438 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 439 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 440 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 441 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 442 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 443 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 444 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 445 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 446 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 447 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 448 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 449 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 450 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 451 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 452 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 453 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 454 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 455 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 456 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 457 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 458 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 459 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 460 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 461 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 462 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 463 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 464 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 465 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 466 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 550 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 551 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 552 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 553 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 554 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 555 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 556 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 557 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 558 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 559 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 560 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 561 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 562 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 563 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 564 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 565 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 566 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 567 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 568 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 569 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 570 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 571 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 572 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 573 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 574 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 575 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 576 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 577 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 578 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 579 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 580 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 581 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 582 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 583 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 584 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 585 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 586 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 587 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 588 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 589 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 590 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 591 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 592 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 593 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 594 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 595 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 596 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 597 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 598 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 599 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 600 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 601 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 602 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 603 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 604 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 605 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 606 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 607 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 608 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 609 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 610 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 611 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 612 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 613 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 614 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 615 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 616 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 617 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 620 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 624 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 625 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 626 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 627 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 628 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 629 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 630 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 631 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 632 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 633 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 634 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 635 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 636 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 637 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 638 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 639 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 640 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 641 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 642 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 643 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 644 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 645 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 646 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 647 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 648 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 649 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 650 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 651 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 652 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 653 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 654 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 655 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 656 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 657 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 658 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 659 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 660 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 661 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 662 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 663 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 664 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 665 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 666 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 667 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 668 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 669 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 670 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 671 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 672 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 673 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 674 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 675 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 676 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 677 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 678 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 679 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 680 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 681 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 682 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 683 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 684 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 685 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 686 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 687 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 688 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 689 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 690 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 691 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 692 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 693 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 694 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 695 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 696 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 697 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 698 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 699 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 700 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 701 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 702 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.96 |
| Metatranscriptomes | 0.25 |
| Isolates | 10.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.37 |
| Nodule | 8.51 |
| Rhizoplane | 7.1 |
| Rhizosphere | 66.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1002246 | 3300000549 | Bacteria | 2722 |
| 2 | JGI24749J21850_1027053 | 3300002076 | Bacteria | 818 |
| 3 | JGI25406J46586_10000050 | 3300003203 | Bacteria | 54388 |
| 4 | JGI25165J46597_1011970 | 3300003214 | Bacteria | 1225 |
| 5 | JGI25153J46596_10000712 | 3300003215 | Bacteria | 20316 |
| 6 | JGI25153J46596_10000760 | 3300003215 | Bacteria | 19717 |
| 7 | JGI25153J46596_10011001 | 3300003215 | Bacteria | 4035 |
| 8 | JGI25153J46596_10045521 | 3300003215 | Bacteria | 1308 |
| 9 | rootH2_10004786 | 3300003320 | Bacteria | 1431 |
| 10 | rootL2_10112590 | 3300003322 | Bacteria | 1798 |
| 11 | JGI25160J50197_1002322 | 3300003354 | Bacteria | 8903 |
| 12 | JGI25160J50197_1015410 | 3300003354 | Bacteria | 2509 |
| 13 | JGI25161J50226_1011621 | 3300003374 | Bacteria | 1096 |
| 14 | Ga0055526_1040592 | 3300003771 | Bacteria | 1171 |
| 15 | Ga0055543_1003132 | 3300004625 | Bacteria | 5059 |
| 16 | Ga0065165_1001109 | 3300005262 | Bacteria | 31984 |
| 17 | Ga0065165_1006875 | 3300005262 | Bacteria | 5784 |
| 18 | Ga0065165_1011066 | 3300005262 | Bacteria | 3815 |
| 19 | Ga0065165_1044439 | 3300005262 | Bacteria | 1299 |
| 20 | Ga0065712_10031307 | 3300005290 | Bacteria | 1312 |
| 21 | Ga0070658_10001665 | 3300005327 | Bacteria | 18741 |
| 22 | Ga0070658_10109626 | 3300005327 | Bacteria | 2286 |
| 23 | Ga0070658_10316039 | 3300005327 | Bacteria | 1333 |
| 24 | Ga0070676_10631456 | 3300005328 | Bacteria | 775 |
| 25 | Ga0070683_100066277 | 3300005329 | Bacteria | 3363 |
| 26 | Ga0070683_100445869 | 3300005329 | Bacteria | 1235 |
| 27 | Ga0070690_100072362 | 3300005330 | Bacteria | 2241 |
| 28 | Ga0070690_100141045 | 3300005330 | Bacteria | 1636 |
| 29 | Ga0070690_100326214 | 3300005330 | Bacteria | 1108 |
| 30 | Ga0070670_100578528 | 3300005331 | Bacteria | 1003 |
| 31 | Ga0068869_100268730 | 3300005334 | Bacteria | 1367 |
| 32 | Ga0068869_100504439 | 3300005334 | Bacteria | 1011 |
| 33 | Ga0068869_100554129 | 3300005334 | Bacteria | 966 |
| 34 | Ga0070680_100000866 | 3300005336 | Bacteria | 21501 |
| 35 | Ga0070680_100004957 | 3300005336 | Bacteria | 10025 |
| 36 | Ga0070680_100069793 | 3300005336 | Bacteria | 2886 |
| 37 | Ga0070680_100199398 | 3300005336 | Bacteria | 1687 |
| 38 | Ga0070680_100308713 | 3300005336 | Bacteria | 1342 |
| 39 | Ga0070680_100328176 | 3300005336 | Bacteria | 1299 |
| 40 | Ga0070680_100567013 | 3300005336 | Bacteria | 974 |
| 41 | Ga0070682_100130277 | 3300005337 | Bacteria | 1701 |
| 42 | Ga0070682_100268758 | 3300005337 | Bacteria | 1238 |
| 43 | Ga0068868_100005376 | 3300005338 | Bacteria | 8999 |
| 44 | Ga0068868_100089912 | 3300005338 | Bacteria | 2472 |
| 45 | Ga0068868_100431979 | 3300005338 | Bacteria | 1142 |
| 46 | Ga0068868_100501825 | 3300005338 | Bacteria | 1063 |
| 47 | Ga0068868_100653356 | 3300005338 | Bacteria | 937 |
| 48 | Ga0070660_100229205 | 3300005339 | Bacteria | 1511 |
| 49 | Ga0070689_100087421 | 3300005340 | Bacteria | 2452 |
| 50 | Ga0070689_100139020 | 3300005340 | Bacteria | 1952 |
| 51 | Ga0070689_100287320 | 3300005340 | Bacteria | 1366 |
| 52 | Ga0070691_10431570 | 3300005341 | Bacteria | 749 |
| 53 | Ga0070687_100264188 | 3300005343 | Bacteria | 1076 |
| 54 | Ga0070661_100232425 | 3300005344 | Bacteria | 1417 |
| 55 | Ga0070661_100283551 | 3300005344 | Bacteria | 1285 |
| 56 | Ga0070661_101033278 | 3300005344 | Bacteria | 683 |
| 57 | Ga0070692_10033354 | 3300005345 | Bacteria | 2594 |
| 58 | Ga0070692_10365314 | 3300005345 | Bacteria | 901 |
| 59 | Ga0070692_10625378 | 3300005345 | Bacteria | 716 |
| 60 | Ga0070668_100006807 | 3300005347 | Bacteria | 8475 |
| 61 | Ga0070668_100030774 | 3300005347 | Bacteria | 4083 |
| 62 | Ga0070668_100081083 | 3300005347 | Bacteria | 2543 |
| 63 | Ga0070668_100111293 | 3300005347 | Bacteria | 2179 |
| 64 | Ga0070668_100388922 | 3300005347 | Bacteria | 1188 |
| 65 | Ga0070668_100427775 | 3300005347 | Bacteria | 1134 |
| 66 | Ga0070668_100776849 | 3300005347 | Bacteria | 849 |
| 67 | Ga0070671_100031101 | 3300005355 | Bacteria | 4408 |
| 68 | Ga0070671_100127068 | 3300005355 | Bacteria | 2147 |
| 69 | Ga0070671_100176438 | 3300005355 | Bacteria | 1808 |
| 70 | Ga0070671_100290738 | 3300005355 | Bacteria | 1391 |
| 71 | Ga0070674_100076912 | 3300005356 | Bacteria | 2374 |
| 72 | Ga0070674_100095630 | 3300005356 | Bacteria | 2154 |
| 73 | Ga0070674_100244368 | 3300005356 | Bacteria | 1407 |
| 74 | Ga0070674_100431106 | 3300005356 | Bacteria | 1084 |
| 75 | Ga0070674_100449243 | 3300005356 | Bacteria | 1063 |
| 76 | Ga0070674_100808845 | 3300005356 | Bacteria | 810 |
| 77 | Ga0070673_100080898 | 3300005364 | Bacteria | 2633 |
| 78 | Ga0070673_100282428 | 3300005364 | Bacteria | 1456 |
| 79 | Ga0070688_100005226 | 3300005365 | Bacteria | 6818 |
| 80 | Ga0070688_100702752 | 3300005365 | Bacteria | 783 |
| 81 | Ga0070659_100130397 | 3300005366 | Bacteria | 2042 |
| 82 | Ga0070659_100172269 | 3300005366 | Bacteria | 1773 |
| 83 | Ga0070659_100294566 | 3300005366 | Bacteria | 1352 |
| 84 | Ga0070659_100328689 | 3300005366 | Bacteria | 1279 |
| 85 | Ga0070667_100195022 | 3300005367 | Bacteria | 1795 |
| 86 | Ga0070703_10027971 | 3300005406 | Bacteria | 1683 |
| 87 | Ga0070709_10001579 | 3300005434 | Bacteria | 12291 |
| 88 | Ga0070709_10005406 | 3300005434 | Bacteria | 6920 |
| 89 | Ga0070709_10051939 | 3300005434 | Bacteria | 2574 |
| 90 | Ga0070709_10380775 | 3300005434 | Bacteria | 1049 |
| 91 | Ga0070714_100038450 | 3300005435 | Bacteria | 4022 |
| 92 | Ga0070714_100703754 | 3300005435 | Bacteria | 975 |
| 93 | Ga0070713_100005218 | 3300005436 | Bacteria | 8852 |
| 94 | Ga0070713_100080887 | 3300005436 | Bacteria | 2771 |
| 95 | Ga0070713_100169747 | 3300005436 | Bacteria | 1954 |
| 96 | Ga0070713_100216580 | 3300005436 | Bacteria | 1736 |
| 97 | Ga0070710_10000506 | 3300005437 | Bacteria | 18315 |
| 98 | Ga0070710_10000563 | 3300005437 | Bacteria | 17589 |
| 99 | Ga0070710_10004747 | 3300005437 | Bacteria | 6427 |
| 100 | Ga0070710_10386386 | 3300005437 | Bacteria | 935 |
| 101 | Ga0070710_10395793 | 3300005437 | Bacteria | 925 |
| 102 | Ga0070701_10042104 | 3300005438 | Bacteria | 2329 |
| 103 | Ga0070711_100003355 | 3300005439 | Bacteria | 9321 |
| 104 | Ga0070711_100308013 | 3300005439 | Bacteria | 1262 |
| 105 | Ga0070711_100438016 | 3300005439 | Bacteria | 1068 |
| 106 | Ga0070711_100614857 | 3300005439 | Bacteria | 908 |
| 107 | Ga0070700_100112513 | 3300005441 | Bacteria | 1812 |
| 108 | Ga0070694_100093529 | 3300005444 | Bacteria | 2113 |
| 109 | Ga0070694_101007392 | 3300005444 | Bacteria | 692 |
| 110 | Ga0070708_100480141 | 3300005445 | Bacteria | 1173 |
| 111 | Ga0070663_100003233 | 3300005455 | Bacteria | 9369 |
| 112 | Ga0070663_100025815 | 3300005455 | Bacteria | 3971 |
| 113 | Ga0070663_100063225 | 3300005455 | Bacteria | 2672 |
| 114 | Ga0070663_100078923 | 3300005455 | Bacteria | 2414 |
| 115 | Ga0070663_100116261 | 3300005455 | Bacteria | 2016 |
| 116 | Ga0070663_100258091 | 3300005455 | Bacteria | 1382 |
| 117 | Ga0070663_100302105 | 3300005455 | Bacteria | 1281 |
| 118 | Ga0070663_100596437 | 3300005455 | Bacteria | 928 |
| 119 | Ga0070678_100057791 | 3300005456 | Bacteria | 2844 |
| 120 | Ga0070678_100072118 | 3300005456 | Bacteria | 2588 |
| 121 | Ga0070678_100102787 | 3300005456 | Bacteria | 2218 |
| 122 | Ga0070678_100335420 | 3300005456 | Bacteria | 1295 |
| 123 | Ga0070662_100148860 | 3300005457 | Bacteria | 1820 |
| 124 | Ga0070662_100691147 | 3300005457 | Bacteria | 862 |
| 125 | Ga0070681_10002083 | 3300005458 | Bacteria | 18160 |
| 126 | Ga0070681_10019352 | 3300005458 | Bacteria | 6813 |
| 127 | Ga0070681_10341851 | 3300005458 | Bacteria | 1406 |
| 128 | Ga0070681_10416251 | 3300005458 | Bacteria | 1256 |
| 129 | Ga0070681_10441971 | 3300005458 | Bacteria | 1212 |
| 130 | Ga0070681_10637190 | 3300005458 | Bacteria | 981 |
| 131 | Ga0068867_100138427 | 3300005459 | Bacteria | 1900 |
| 132 | Ga0068867_100151066 | 3300005459 | Bacteria | 1824 |
| 133 | Ga0070685_10145522 | 3300005466 | Bacteria | 1497 |
| 134 | Ga0070685_10323863 | 3300005466 | Bacteria | 1045 |
| 135 | Ga0070706_100203771 | 3300005467 | Bacteria | 1848 |
| 136 | Ga0070698_100199514 | 3300005471 | Bacteria | 1937 |
| 137 | Ga0070698_100279900 | 3300005471 | Bacteria | 1600 |
| 138 | Ga0070679_100008178 | 3300005530 | Bacteria | 9832 |
| 139 | Ga0070679_100188624 | 3300005530 | Bacteria | 2031 |
| 140 | Ga0070679_100193903 | 3300005530 | Bacteria | 1999 |
| 141 | Ga0070679_100249921 | 3300005530 | Bacteria | 1730 |
| 142 | Ga0070679_100645756 | 3300005530 | Bacteria | 1001 |
| 143 | Ga0070684_100000952 | 3300005535 | Bacteria | 20624 |
| 144 | Ga0070684_100165447 | 3300005535 | Bacteria | 2007 |
| 145 | Ga0070684_100617640 | 3300005535 | Bacteria | 1008 |
| 146 | Ga0068853_100011686 | 3300005539 | Bacteria | 7136 |
| 147 | Ga0068853_100014119 | 3300005539 | Bacteria | 6538 |
| 148 | Ga0068853_100029205 | 3300005539 | Bacteria | 4646 |
| 149 | Ga0068853_100269422 | 3300005539 | Bacteria | 1567 |
| 150 | Ga0068853_100290345 | 3300005539 | Bacteria | 1509 |
| 151 | Ga0068853_100335693 | 3300005539 | Bacteria | 1403 |
| 152 | Ga0068853_100439890 | 3300005539 | Bacteria | 1225 |
| 153 | Ga0068853_101509363 | 3300005539 | Bacteria | 651 |
| 154 | Ga0070672_100250216 | 3300005543 | Bacteria | 1492 |
| 155 | Ga0070686_100210095 | 3300005544 | Bacteria | 1400 |
| 156 | Ga0070686_100339187 | 3300005544 | Bacteria | 1126 |
| 157 | Ga0070686_100764649 | 3300005544 | Bacteria | 776 |
| 158 | Ga0070695_100135671 | 3300005545 | Bacteria | 1701 |
| 159 | Ga0070695_100603883 | 3300005545 | Bacteria | 862 |
| 160 | Ga0070696_100347513 | 3300005546 | Bacteria | 1148 |
| 161 | Ga0070693_100045525 | 3300005547 | Bacteria | 2487 |
| 162 | Ga0070693_100201142 | 3300005547 | Bacteria | 1294 |
| 163 | Ga0070693_100308268 | 3300005547 | Bacteria | 1069 |
| 164 | Ga0070665_100023863 | 3300005548 | Bacteria | 6162 |
| 165 | Ga0070665_100026898 | 3300005548 | Bacteria | 5794 |
| 166 | Ga0070665_100054505 | 3300005548 | Bacteria | 4010 |
| 167 | Ga0070665_100098124 | 3300005548 | Bacteria | 2934 |
| 168 | Ga0070665_100265908 | 3300005548 | Bacteria | 1716 |
| 169 | Ga0070665_100616170 | 3300005548 | Bacteria | 1098 |
| 170 | Ga0070665_100822710 | 3300005548 | Bacteria | 942 |
| 171 | Ga0070665_101791805 | 3300005548 | Bacteria | 620 |
| 172 | Ga0070704_100073604 | 3300005549 | Bacteria | 2489 |
| 173 | Ga0070704_100374564 | 3300005549 | Bacteria | 1208 |
| 174 | Ga0068855_100006305 | 3300005563 | Bacteria | 14456 |
| 175 | Ga0068855_100105995 | 3300005563 | Bacteria | 3231 |
| 176 | Ga0068855_100256501 | 3300005563 | Bacteria | 1949 |
| 177 | Ga0068855_100383382 | 3300005563 | Bacteria | 1543 |
| 178 | Ga0070664_100424419 | 3300005564 | Bacteria | 1218 |
| 179 | Ga0068857_100012744 | 3300005577 | Bacteria | 7328 |
| 180 | Ga0068857_100015946 | 3300005577 | Bacteria | 6580 |
| 181 | Ga0068857_100293366 | 3300005577 | Bacteria | 1498 |
| 182 | Ga0068857_100312135 | 3300005577 | Bacteria | 1451 |
| 183 | Ga0068857_100792648 | 3300005577 | Bacteria | 904 |
| 184 | Ga0068854_100333428 | 3300005578 | Bacteria | 1237 |
| 185 | Ga0068854_100568824 | 3300005578 | Bacteria | 964 |
| 186 | Ga0068854_100604291 | 3300005578 | Bacteria | 937 |
| 187 | Ga0068856_100395192 | 3300005614 | Bacteria | 1402 |
| 188 | Ga0070702_100049264 | 3300005615 | Bacteria | 2401 |
| 189 | Ga0070702_100387532 | 3300005615 | Bacteria | 996 |
| 190 | Ga0068852_100028208 | 3300005616 | Bacteria | 4589 |
| 191 | Ga0068852_100116084 | 3300005616 | Bacteria | 2442 |
| 192 | Ga0068852_100192794 | 3300005616 | Bacteria | 1924 |
| 193 | Ga0068852_100330711 | 3300005616 | Bacteria | 1482 |
| 194 | Ga0068852_100466182 | 3300005616 | Bacteria | 1253 |
| 195 | Ga0068859_100183564 | 3300005617 | Bacteria | 2175 |
| 196 | Ga0068859_101214005 | 3300005617 | Bacteria | 830 |
| 197 | Ga0068864_100489555 | 3300005618 | Bacteria | 1182 |
| 198 | Ga0068866_10111089 | 3300005718 | Bacteria | 1529 |
| 199 | Ga0068866_10136917 | 3300005718 | Bacteria | 1401 |
| 200 | Ga0068866_10472117 | 3300005718 | Bacteria | 825 |
| 201 | Ga0068861_100016572 | 3300005719 | Bacteria | 5217 |
| 202 | Ga0068861_100516402 | 3300005719 | Bacteria | 1083 |
| 203 | Ga0068861_100633016 | 3300005719 | Bacteria | 986 |
| 204 | Ga0068861_101179001 | 3300005719 | Bacteria | 740 |
| 205 | Ga0068851_10043794 | 3300005834 | Bacteria | 2257 |
| 206 | Ga0068870_10130231 | 3300005840 | Bacteria | 1460 |
| 207 | Ga0068870_10133269 | 3300005840 | Bacteria | 1446 |
| 208 | Ga0068863_100048337 | 3300005841 | Bacteria | 4034 |
| 209 | Ga0068863_100116799 | 3300005841 | Bacteria | 2542 |
| 210 | Ga0068863_100204103 | 3300005841 | Bacteria | 1902 |
| 211 | Ga0068863_100468556 | 3300005841 | Bacteria | 1238 |
| 212 | Ga0068863_100588667 | 3300005841 | Bacteria | 1100 |
| 213 | Ga0068858_100093050 | 3300005842 | Bacteria | 2806 |
| 214 | Ga0068858_100114861 | 3300005842 | Bacteria | 2515 |
| 215 | Ga0068858_100278781 | 3300005842 | Bacteria | 1592 |
| 216 | Ga0068860_100101194 | 3300005843 | Bacteria | 2749 |
| 217 | Ga0068860_100130655 | 3300005843 | Bacteria | 2409 |
| 218 | Ga0068860_100135352 | 3300005843 | Bacteria | 2366 |
| 219 | Ga0068860_100135633 | 3300005843 | Bacteria | 2363 |
| 220 | Ga0068860_100371466 | 3300005843 | Bacteria | 1410 |
| 221 | Ga0068860_100781147 | 3300005843 | Bacteria | 968 |
| 222 | Ga0068862_100019484 | 3300005844 | Bacteria | 5663 |
| 223 | Ga0068862_100182231 | 3300005844 | Bacteria | 1886 |
| 224 | Ga0068862_100297271 | 3300005844 | Bacteria | 1484 |
| 225 | Ga0068862_100325651 | 3300005844 | Bacteria | 1419 |
| 226 | Ga0068862_100446376 | 3300005844 | Bacteria | 1218 |
| 227 | Ga0068862_100918391 | 3300005844 | Bacteria | 861 |
| 228 | Ga0081455_10006420 | 3300005937 | Bacteria | 12604 |
| 229 | Ga0081455_10133148 | 3300005937 | Bacteria | 1941 |
| 230 | Ga0081538_10067578 | 3300005981 | Bacteria | 1994 |
| 231 | Ga0081540_1002397 | 3300005983 | Bacteria | 15288 |
| 232 | Ga0081540_1007919 | 3300005983 | Bacteria | 7499 |
| 233 | Ga0081540_1008426 | 3300005983 | Bacteria | 7207 |
| 234 | Ga0081540_1016807 | 3300005983 | Bacteria | 4560 |
| 235 | Ga0081540_1024502 | 3300005983 | Bacteria | 3501 |
| 236 | Ga0081540_1046363 | 3300005983 | Bacteria | 2195 |
| 237 | Ga0081540_1048618 | 3300005983 | Bacteria | 2123 |
| 238 | Ga0081540_1056532 | 3300005983 | Bacteria | 1904 |
| 239 | Ga0081539_10000072 | 3300005985 | Bacteria | 232726 |
| 240 | Ga0081539_10000325 | 3300005985 | Bacteria | 106431 |
| 241 | Ga0081539_10037287 | 3300005985 | Bacteria | 2897 |
| 242 | Ga0081539_10051150 | 3300005985 | Bacteria | 2331 |
| 243 | Ga0070717_10015855 | 3300006028 | Bacteria | 5828 |
| 244 | Ga0070717_10046100 | 3300006028 | Bacteria | 3566 |
| 245 | Ga0070717_10584610 | 3300006028 | Bacteria | 1013 |
| 246 | Ga0075365_10004379 | 3300006038 | Bacteria | 7469 |
| 247 | Ga0075365_10021811 | 3300006038 | Bacteria | 4001 |
| 248 | Ga0075365_10114872 | 3300006038 | Bacteria | 1852 |
| 249 | Ga0075365_10169476 | 3300006038 | Bacteria | 1523 |
| 250 | Ga0075365_10366068 | 3300006038 | Bacteria | 1016 |
| 251 | Ga0075368_10005726 | 3300006042 | Bacteria | 4297 |
| 252 | Ga0075363_100013638 | 3300006048 | Bacteria | 3947 |
| 253 | Ga0075363_100329241 | 3300006048 | Bacteria | 890 |
| 254 | Ga0075364_10071315 | 3300006051 | Bacteria | 2288 |
| 255 | Ga0075364_10158221 | 3300006051 | Bacteria | 1528 |
| 256 | Ga0075364_10201872 | 3300006051 | Bacteria | 1348 |
| 257 | Ga0075432_10057870 | 3300006058 | Bacteria | 1376 |
| 258 | Ga0075432_10132197 | 3300006058 | Bacteria | 946 |
| 259 | Ga0070715_10000376 | 3300006163 | Bacteria | 11157 |
| 260 | Ga0070715_10055764 | 3300006163 | Bacteria | 1717 |
| 261 | Ga0070715_10219311 | 3300006163 | Bacteria | 977 |
| 262 | Ga0070715_10273242 | 3300006163 | Bacteria | 893 |
| 263 | Ga0070716_100054448 | 3300006173 | Bacteria | 2285 |
| 264 | Ga0070712_100009777 | 3300006175 | Bacteria | 6044 |
| 265 | Ga0070712_100014924 | 3300006175 | Bacteria | 4994 |
| 266 | Ga0070712_100023662 | 3300006175 | Bacteria | 4061 |
| 267 | Ga0070712_100034677 | 3300006175 | Bacteria | 3421 |
| 268 | Ga0070712_100177856 | 3300006175 | Bacteria | 1656 |
| 269 | Ga0070712_100471136 | 3300006175 | Bacteria | 1049 |
| 270 | Ga0075362_10362738 | 3300006177 | Bacteria | 727 |
| 271 | Ga0075367_10029919 | 3300006178 | Bacteria | 3118 |
| 272 | Ga0075367_10085132 | 3300006178 | Bacteria | 1918 |
| 273 | Ga0075367_10148194 | 3300006178 | Bacteria | 1455 |
| 274 | Ga0075367_10161715 | 3300006178 | Bacteria | 1392 |
| 275 | Ga0075367_10414353 | 3300006178 | Bacteria | 853 |
| 276 | Ga0075367_10467190 | 3300006178 | Bacteria | 800 |
| 277 | Ga0075369_10085068 | 3300006186 | Bacteria | 1406 |
| 278 | Ga0075369_10128892 | 3300006186 | Bacteria | 1148 |
| 279 | Ga0075369_10262882 | 3300006186 | Bacteria | 802 |
| 280 | Ga0075366_10028925 | 3300006195 | Bacteria | 3253 |
| 281 | Ga0097621_100196925 | 3300006237 | Bacteria | 1747 |
| 282 | Ga0097621_100270350 | 3300006237 | Bacteria | 1493 |
| 283 | Ga0075370_10005879 | 3300006353 | Bacteria | 6133 |
| 284 | Ga0075370_10023578 | 3300006353 | Bacteria | 3390 |
| 285 | Ga0075370_10087885 | 3300006353 | Bacteria | 1791 |
| 286 | Ga0068871_100146132 | 3300006358 | Bacteria | 2013 |
| 287 | Ga0068871_100308242 | 3300006358 | Bacteria | 1391 |
| 288 | Ga0068871_100713106 | 3300006358 | Bacteria | 920 |
| 289 | Ga0068871_100840373 | 3300006358 | Bacteria | 848 |
| 290 | Ga0075428_100577288 | 3300006844 | Bacteria | 1201 |
| 291 | Ga0075430_100265099 | 3300006846 | Bacteria | 1422 |
| 292 | Ga0075434_100070588 | 3300006871 | Bacteria | 3484 |
| 293 | Ga0075434_100250728 | 3300006871 | Bacteria | 1789 |
| 294 | Ga0068865_100221282 | 3300006881 | Bacteria | 1480 |
| 295 | Ga0068865_100402284 | 3300006881 | Bacteria | 1122 |
| 296 | Ga0068865_100447258 | 3300006881 | Bacteria | 1067 |
| 297 | Ga0097620_100183559 | 3300006931 | Bacteria | 2175 |
| 298 | Ga0097620_101119457 | 3300006931 | Bacteria | 866 |
| 299 | Ga0097620_101213996 | 3300006931 | Bacteria | 830 |
| 300 | Ga0099825_1029470 | 3300006941 | Bacteria | 2543 |
| 301 | Ga0099823_1043212 | 3300006944 | Bacteria | 3119 |
| 302 | Ga0099795_10012566 | 3300007788 | Bacteria | 2572 |
| 303 | Ga0099795_10036743 | 3300007788 | Bacteria | 1720 |
| 304 | Ga0099795_10046864 | 3300007788 | Bacteria | 1559 |
| 305 | Ga0099795_10054815 | 3300007788 | Bacteria | 1463 |
| 306 | Ga0099795_10283990 | 3300007788 | Bacteria | 723 |
| 307 | Ga0105251_10081614 | 3300009011 | Bacteria | 1494 |
| 308 | Ga0105240_10006650 | 3300009093 | Bacteria | 16964 |
| 309 | Ga0105240_10028150 | 3300009093 | Bacteria | 7346 |
| 310 | Ga0105240_10077860 | 3300009093 | Bacteria | 4084 |
| 311 | Ga0105240_10120653 | 3300009093 | Bacteria | 3157 |
| 312 | Ga0105240_10370125 | 3300009093 | Bacteria | 1620 |
| 313 | Ga0105240_10454079 | 3300009093 | Bacteria | 1433 |
| 314 | Ga0105240_10818069 | 3300009093 | Bacteria | 1008 |
| 315 | Ga0111539_10003570 | 3300009094 | Bacteria | 20500 |
| 316 | Ga0111539_10086432 | 3300009094 | Bacteria | 3685 |
| 317 | Ga0111539_10148109 | 3300009094 | Bacteria | 2748 |
| 318 | Ga0111539_10169347 | 3300009094 | Bacteria | 2552 |
| 319 | Ga0111539_11184709 | 3300009094 | Bacteria | 887 |
| 320 | Ga0105245_10193843 | 3300009098 | Bacteria | 1948 |
| 321 | Ga0105245_10283167 | 3300009098 | Bacteria | 1621 |
| 322 | Ga0105245_11453011 | 3300009098 | Bacteria | 736 |
| 323 | Ga0105247_10107479 | 3300009101 | Bacteria | 1792 |
| 324 | Ga0105247_10257739 | 3300009101 | Bacteria | 1195 |
| 325 | Ga0105247_10261783 | 3300009101 | Bacteria | 1186 |
| 326 | Ga0114129_10125747 | 3300009147 | Bacteria | 3525 |
| 327 | Ga0114129_10829090 | 3300009147 | Bacteria | 1177 |
| 328 | Ga0114129_11008986 | 3300009147 | Bacteria | 1048 |
| 329 | Ga0105243_10228334 | 3300009148 | Bacteria | 1650 |
| 330 | Ga0105241_10003241 | 3300009174 | Bacteria | 12101 |
| 331 | Ga0105241_10085165 | 3300009174 | Bacteria | 2483 |
| 332 | Ga0105241_10133503 | 3300009174 | Bacteria | 2012 |
| 333 | Ga0105241_10144748 | 3300009174 | Bacteria | 1938 |
| 334 | Ga0105241_10255384 | 3300009174 | Bacteria | 1488 |
| 335 | Ga0105242_10116929 | 3300009176 | Bacteria | 2282 |
| 336 | Ga0105242_10171258 | 3300009176 | Bacteria | 1908 |
| 337 | Ga0105242_10742190 | 3300009176 | Bacteria | 965 |
| 338 | Ga0105242_11167832 | 3300009176 | Bacteria | 787 |
| 339 | Ga0105248_10706575 | 3300009177 | Bacteria | 1137 |
| 340 | Ga0105237_10008430 | 3300009545 | Bacteria | 11156 |
| 341 | Ga0105237_10013203 | 3300009545 | Bacteria | 8665 |
| 342 | Ga0105237_10024067 | 3300009545 | Bacteria | 6231 |
| 343 | Ga0105237_10051706 | 3300009545 | Bacteria | 4127 |
| 344 | Ga0105237_10123415 | 3300009545 | Bacteria | 2584 |
| 345 | Ga0105237_10169407 | 3300009545 | Bacteria | 2183 |
| 346 | Ga0105237_10214632 | 3300009545 | Bacteria | 1924 |
| 347 | Ga0105237_10485619 | 3300009545 | Bacteria | 1241 |
| 348 | Ga0105238_10034351 | 3300009551 | Bacteria | 5160 |
| 349 | Ga0105238_10045750 | 3300009551 | Bacteria | 4421 |
| 350 | Ga0105238_10074082 | 3300009551 | Bacteria | 3398 |
| 351 | Ga0105238_10196785 | 3300009551 | Bacteria | 1991 |
| 352 | Ga0105238_10576969 | 3300009551 | Bacteria | 1131 |
| 353 | Ga0105238_10591728 | 3300009551 | Bacteria | 1117 |
| 354 | Ga0105238_11051907 | 3300009551 | Bacteria | 836 |
| 355 | Ga0105238_11245153 | 3300009551 | Bacteria | 769 |
| 356 | Ga0105249_10743319 | 3300009553 | Bacteria | 1043 |
| 357 | Ga0105249_10848567 | 3300009553 | Bacteria | 979 |
| 358 | Ga0105249_11127669 | 3300009553 | Bacteria | 855 |
| 359 | Ga0099796_10135143 | 3300010159 | Bacteria | 959 |
| 360 | Ga0105239_10019512 | 3300010375 | Bacteria | 7484 |
| 361 | Ga0105239_10643323 | 3300010375 | Bacteria | 1211 |
| 362 | Ga0105246_10050204 | 3300011119 | Bacteria | 2861 |
| 363 | Ga0105246_10279153 | 3300011119 | Bacteria | 1339 |
| 364 | Ga0157322_1008142 | 3300012490 | Bacteria | 794 |
| 365 | Ga0157371_10022069 | 3300013102 | Bacteria | 4669 |
| 366 | Ga0157371_10150504 | 3300013102 | Bacteria | 1659 |
| 367 | Ga0157370_10003007 | 3300013104 | Bacteria | 20010 |
| 368 | Ga0157370_10827658 | 3300013104 | Bacteria | 842 |
| 369 | Ga0157369_10038951 | 3300013105 | Bacteria | 5196 |
| 370 | Ga0157369_10047487 | 3300013105 | Bacteria | 4661 |
| 371 | Ga0157369_10213289 | 3300013105 | Bacteria | 2023 |
| 372 | Ga0157369_10310892 | 3300013105 | Bacteria | 1639 |
| 373 | Ga0157374_10085901 | 3300013296 | Bacteria | 2993 |
| 374 | Ga0157374_10183720 | 3300013296 | Bacteria | 2044 |
| 375 | Ga0157374_10506467 | 3300013296 | Bacteria | 1212 |
| 376 | Ga0157378_10061196 | 3300013297 | Bacteria | 3359 |
| 377 | Ga0157378_10071194 | 3300013297 | Bacteria | 3122 |
| 378 | Ga0157378_10321782 | 3300013297 | Bacteria | 1503 |
| 379 | Ga0157378_10680078 | 3300013297 | Bacteria | 1047 |
| 380 | Ga0163162_10115670 | 3300013306 | Bacteria | 2782 |
| 381 | Ga0163162_10206262 | 3300013306 | Bacteria | 2095 |
| 382 | Ga0163162_10232236 | 3300013306 | Bacteria | 1975 |
| 383 | Ga0163162_10402266 | 3300013306 | Bacteria | 1502 |
| 384 | Ga0163162_11205287 | 3300013306 | Bacteria | 859 |
| 385 | Ga0163162_11337391 | 3300013306 | Bacteria | 814 |
| 386 | Ga0163162_11369024 | 3300013306 | Bacteria | 805 |
| 387 | Ga0157372_10089134 | 3300013307 | Bacteria | 3504 |
| 388 | Ga0157372_10445403 | 3300013307 | Bacteria | 1509 |
| 389 | Ga0157372_10924417 | 3300013307 | Bacteria | 1012 |
| 390 | Ga0157372_10994178 | 3300013307 | Bacteria | 972 |
| 391 | Ga0157375_10065900 | 3300013308 | Bacteria | 3612 |
| 392 | Ga0157375_10072080 | 3300013308 | Bacteria | 3470 |
| 393 | Ga0157375_10723219 | 3300013308 | Bacteria | 1148 |
| 394 | Ga0157375_11029651 | 3300013308 | Bacteria | 962 |
| 395 | Ga0157375_12168896 | 3300013308 | Bacteria | 662 |
| 396 | Ga0163163_10003485 | 3300014325 | Bacteria | 13361 |
| 397 | Ga0163163_10047093 | 3300014325 | Bacteria | 4237 |
| 398 | Ga0163163_10049822 | 3300014325 | Bacteria | 4122 |
| 399 | Ga0163163_10184430 | 3300014325 | Bacteria | 2134 |
| 400 | Ga0163163_10293108 | 3300014325 | Bacteria | 1679 |
| 401 | Ga0163163_10436443 | 3300014325 | Bacteria | 1369 |
| 402 | Ga0163163_10563742 | 3300014325 | Bacteria | 1202 |
| 403 | Ga0163163_10997973 | 3300014325 | Bacteria | 900 |
| 404 | Ga0163163_11453197 | 3300014325 | Bacteria | 747 |
| 405 | Ga0157380_10268990 | 3300014326 | Bacteria | 1552 |
| 406 | Ga0157380_10272723 | 3300014326 | Bacteria | 1543 |
| 407 | Ga0182008_10279964 | 3300014497 | Bacteria | 868 |
| 408 | Ga0157377_10005796 | 3300014745 | Bacteria | 5834 |
| 409 | Ga0157377_10065182 | 3300014745 | Bacteria | 2092 |
| 410 | Ga0157379_10038813 | 3300014968 | Bacteria | 4248 |
| 411 | Ga0157379_10812939 | 3300014968 | Bacteria | 883 |
| 412 | Ga0157376_10308492 | 3300014969 | Bacteria | 1501 |
| 413 | Ga0157376_10454988 | 3300014969 | Bacteria | 1249 |
| 414 | Ga0157376_10566733 | 3300014969 | Bacteria | 1126 |
| 415 | Ga0157376_10581333 | 3300014969 | Bacteria | 1112 |
| 416 | Ga0182007_10039960 | 3300015262 | Bacteria | 1567 |
| 417 | Ga0163161_10612284 | 3300017792 | Bacteria | 899 |
| 418 | Ga0163161_10621799 | 3300017792 | Bacteria | 892 |
| 419 | Ga0206356_10863949 | 3300020070 | Bacteria | 1257 |
| 420 | Ga0206356_11765100 | 3300020070 | Bacteria | 1287 |
| 421 | Ga0206353_11063056 | 3300020082 | Bacteria | 861 |
| 422 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 423 | Ga0214542_1000037 | 3300021321 | Bacteria | 159256 |
| 424 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 425 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 426 | Ga0213874_10098188 | 3300021377 | Bacteria | 970 |
| 427 | Ga0213876_10002729 | 3300021384 | Bacteria | 10288 |
| 428 | Ga0213876_10051418 | 3300021384 | Bacteria | 2178 |
| 429 | Ga0213876_10108796 | 3300021384 | Bacteria | 1471 |
| 430 | Ga0209563_117798 | 3300025230 | Bacteria | 845 |
| 431 | Ga0209026_1022664 | 3300025250 | Bacteria | 961 |
| 432 | Ga0209677_105144 | 3300025253 | Bacteria | 3511 |
| 433 | Ga0209148_1000347 | 3300025254 | Bacteria | 60370 |
| 434 | Ga0209233_1011115 | 3300025261 | Bacteria | 2662 |
| 435 | Ga0209455_1002091 | 3300025272 | Bacteria | 7979 |
| 436 | Ga0209455_1013519 | 3300025272 | Bacteria | 1890 |
| 437 | Ga0209673_1034422 | 3300025273 | Bacteria | 1530 |
| 438 | Ga0209564_1004821 | 3300025295 | Bacteria | 8032 |
| 439 | Ga0209564_1008038 | 3300025295 | Bacteria | 5287 |
| 440 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 441 | Ga0209758_1000133 | 3300025297 | Bacteria | 182442 |
| 442 | Ga0209758_1000845 | 3300025297 | Bacteria | 42737 |
| 443 | Ga0209758_1001269 | 3300025297 | Bacteria | 31260 |
| 444 | Ga0209758_1006848 | 3300025297 | Bacteria | 7976 |
| 445 | Ga0209758_1021253 | 3300025297 | Bacteria | 3032 |
| 446 | Ga0209050_1076411 | 3300025298 | Bacteria | 727 |
| 447 | Ga0209256_1003911 | 3300025299 | Bacteria | 9844 |
| 448 | Ga0207426_1000270 | 3300025302 | Bacteria | 108404 |
| 449 | Ga0207426_1000292 | 3300025302 | Bacteria | 99342 |
| 450 | Ga0207426_1003805 | 3300025302 | Bacteria | 7825 |
| 451 | Ga0207426_1014306 | 3300025302 | Bacteria | 2909 |
| 452 | Ga0209051_1038395 | 3300025303 | Bacteria | 1743 |
| 453 | Ga0209257_1001242 | 3300025304 | Bacteria | 31529 |
| 454 | Ga0209257_1036953 | 3300025304 | Bacteria | 1494 |
| 455 | Ga0207697_10024723 | 3300025315 | Bacteria | 2458 |
| 456 | Ga0207656_10022373 | 3300025321 | Bacteria | 2536 |
| 457 | Ga0207653_10043025 | 3300025885 | Bacteria | 1486 |
| 458 | Ga0207682_10023362 | 3300025893 | Bacteria | 2442 |
| 459 | Ga0207692_10002141 | 3300025898 | Bacteria | 7544 |
| 460 | Ga0207692_10002191 | 3300025898 | Bacteria | 7469 |
| 461 | Ga0207692_10008931 | 3300025898 | Bacteria | 4167 |
| 462 | Ga0207692_10029494 | 3300025898 | Bacteria | 2608 |
| 463 | Ga0207692_10274388 | 3300025898 | Bacteria | 1018 |
| 464 | Ga0207692_10277865 | 3300025898 | Bacteria | 1012 |
| 465 | Ga0207642_10087351 | 3300025899 | Bacteria | 1531 |
| 466 | Ga0207710_10448879 | 3300025900 | Bacteria | 666 |
| 467 | Ga0207688_10010703 | 3300025901 | Bacteria | 4991 |
| 468 | Ga0207688_10258200 | 3300025901 | Bacteria | 1057 |
| 469 | Ga0207680_10062786 | 3300025903 | Bacteria | 2271 |
| 470 | Ga0207680_10179682 | 3300025903 | Bacteria | 1430 |
| 471 | Ga0207680_10416025 | 3300025903 | Bacteria | 951 |
| 472 | Ga0207647_10028027 | 3300025904 | Bacteria | 3665 |
| 473 | Ga0207647_10041473 | 3300025904 | Bacteria | 2893 |
| 474 | Ga0207685_10001380 | 3300025905 | Bacteria | 5033 |
| 475 | Ga0207685_10060767 | 3300025905 | Bacteria | 1495 |
| 476 | Ga0207685_10269519 | 3300025905 | Bacteria | 831 |
| 477 | Ga0207699_10000503 | 3300025906 | Bacteria | 19503 |
| 478 | Ga0207699_10010550 | 3300025906 | Bacteria | 4642 |
| 479 | Ga0207699_10016050 | 3300025906 | Bacteria | 3907 |
| 480 | Ga0207699_10062794 | 3300025906 | Bacteria | 2241 |
| 481 | Ga0207699_10154430 | 3300025906 | Bacteria | 1522 |
| 482 | Ga0207699_10288892 | 3300025906 | Bacteria | 1142 |
| 483 | Ga0207645_10003034 | 3300025907 | Bacteria | 12931 |
| 484 | Ga0207645_10156206 | 3300025907 | Bacteria | 1490 |
| 485 | Ga0207643_10083232 | 3300025908 | Bacteria | 1856 |
| 486 | Ga0207643_10123359 | 3300025908 | Bacteria | 1536 |
| 487 | Ga0207643_10196076 | 3300025908 | Bacteria | 1228 |
| 488 | Ga0207705_10052000 | 3300025909 | Bacteria | 2949 |
| 489 | Ga0207705_10107676 | 3300025909 | Bacteria | 2056 |
| 490 | Ga0207705_10275071 | 3300025909 | Bacteria | 1288 |
| 491 | Ga0207705_10282447 | 3300025909 | Bacteria | 1271 |
| 492 | Ga0207705_10902887 | 3300025909 | Bacteria | 684 |
| 493 | Ga0207705_11043729 | 3300025909 | Bacteria | 631 |
| 494 | Ga0207684_10347308 | 3300025910 | Bacteria | 1277 |
| 495 | Ga0207654_10026617 | 3300025911 | Bacteria | 3134 |
| 496 | Ga0207654_10132535 | 3300025911 | Bacteria | 1579 |
| 497 | Ga0207707_10000717 | 3300025912 | Bacteria | 32801 |
| 498 | Ga0207707_10001896 | 3300025912 | Bacteria | 19043 |
| 499 | Ga0207707_10002335 | 3300025912 | Bacteria | 17083 |
| 500 | Ga0207707_10409620 | 3300025912 | Bacteria | 1163 |
| 501 | Ga0207707_10428673 | 3300025912 | Bacteria | 1133 |
| 502 | Ga0207707_10692011 | 3300025912 | Bacteria | 856 |
| 503 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 504 | Ga0207695_10025550 | 3300025913 | Bacteria | 6609 |
| 505 | Ga0207695_10092793 | 3300025913 | Bacteria | 3029 |
| 506 | Ga0207695_10265824 | 3300025913 | Bacteria | 1612 |
| 507 | Ga0207695_10339889 | 3300025913 | Bacteria | 1389 |
| 508 | Ga0207671_10033634 | 3300025914 | Bacteria | 3812 |
| 509 | Ga0207671_10035720 | 3300025914 | Bacteria | 3686 |
| 510 | Ga0207671_10156310 | 3300025914 | Bacteria | 1764 |
| 511 | Ga0207671_10646605 | 3300025914 | Bacteria | 842 |
| 512 | Ga0207693_10000085 | 3300025915 | Bacteria | 83879 |
| 513 | Ga0207693_10010478 | 3300025915 | Bacteria | 7524 |
| 514 | Ga0207693_10014747 | 3300025915 | Bacteria | 6278 |
| 515 | Ga0207693_10078815 | 3300025915 | Bacteria | 2578 |
| 516 | Ga0207693_10080001 | 3300025915 | Bacteria | 2558 |
| 517 | Ga0207663_10000145 | 3300025916 | Bacteria | 32751 |
| 518 | Ga0207663_10001800 | 3300025916 | Bacteria | 10116 |
| 519 | Ga0207663_10260645 | 3300025916 | Bacteria | 1280 |
| 520 | Ga0207663_10459253 | 3300025916 | Bacteria | 983 |
| 521 | Ga0207660_10001403 | 3300025917 | Bacteria | 16191 |
| 522 | Ga0207660_10012962 | 3300025917 | Bacteria | 5462 |
| 523 | Ga0207660_10149915 | 3300025917 | Bacteria | 1791 |
| 524 | Ga0207660_10434921 | 3300025917 | Bacteria | 1060 |
| 525 | Ga0207660_10722753 | 3300025917 | Bacteria | 812 |
| 526 | Ga0207660_11010655 | 3300025917 | Bacteria | 678 |
| 527 | Ga0207662_10132358 | 3300025918 | Bacteria | 1574 |
| 528 | Ga0207662_10477335 | 3300025918 | Bacteria | 856 |
| 529 | Ga0207657_10006888 | 3300025919 | Bacteria | 11727 |
| 530 | Ga0207657_10011138 | 3300025919 | Bacteria | 8938 |
| 531 | Ga0207657_10052926 | 3300025919 | Bacteria | 3520 |
| 532 | Ga0207657_10434435 | 3300025919 | Bacteria | 1031 |
| 533 | Ga0207649_10151677 | 3300025920 | Bacteria | 1597 |
| 534 | Ga0207652_10004802 | 3300025921 | Bacteria | 10944 |
| 535 | Ga0207652_10022959 | 3300025921 | Bacteria | 5167 |
| 536 | Ga0207681_10081029 | 3300025923 | Bacteria | 2291 |
| 537 | Ga0207681_10309715 | 3300025923 | Bacteria | 1252 |
| 538 | Ga0207681_10406526 | 3300025923 | Bacteria | 1100 |
| 539 | Ga0207694_10084993 | 3300025924 | Bacteria | 2489 |
| 540 | Ga0207694_10179888 | 3300025924 | Bacteria | 1714 |
| 541 | Ga0207694_10558617 | 3300025924 | Bacteria | 961 |
| 542 | Ga0207694_10668697 | 3300025924 | Bacteria | 875 |
| 543 | Ga0207659_10332058 | 3300025926 | Bacteria | 1257 |
| 544 | Ga0207659_10345954 | 3300025926 | Bacteria | 1232 |
| 545 | Ga0207687_10006611 | 3300025927 | Bacteria | 7649 |
| 546 | Ga0207687_10295986 | 3300025927 | Bacteria | 1302 |
| 547 | Ga0207687_10706428 | 3300025927 | Bacteria | 856 |
| 548 | Ga0207700_10056742 | 3300025928 | Bacteria | 2949 |
| 549 | Ga0207700_10198422 | 3300025928 | Bacteria | 1690 |
| 550 | Ga0207700_10342822 | 3300025928 | Bacteria | 1299 |
| 551 | Ga0207664_10028269 | 3300025929 | Bacteria | 4260 |
| 552 | Ga0207664_10238554 | 3300025929 | Bacteria | 1583 |
| 553 | Ga0207664_10350136 | 3300025929 | Bacteria | 1307 |
| 554 | Ga0207664_10455251 | 3300025929 | Bacteria | 1142 |
| 555 | Ga0207644_10077187 | 3300025931 | Bacteria | 2452 |
| 556 | Ga0207644_10404706 | 3300025931 | Bacteria | 1116 |
| 557 | Ga0207644_10419244 | 3300025931 | Bacteria | 1096 |
| 558 | Ga0207644_10427416 | 3300025931 | Bacteria | 1086 |
| 559 | Ga0207644_11149500 | 3300025931 | Bacteria | 652 |
| 560 | Ga0207690_10065349 | 3300025932 | Bacteria | 2487 |
| 561 | Ga0207690_10180731 | 3300025932 | Bacteria | 1588 |
| 562 | Ga0207690_10377023 | 3300025932 | Bacteria | 1127 |
| 563 | Ga0207690_10471764 | 3300025932 | Bacteria | 1012 |
| 564 | Ga0207706_10054196 | 3300025933 | Bacteria | 3539 |
| 565 | Ga0207706_10090077 | 3300025933 | Bacteria | 2697 |
| 566 | Ga0207706_10350447 | 3300025933 | Bacteria | 1284 |
| 567 | Ga0207686_10080217 | 3300025934 | Bacteria | 2127 |
| 568 | Ga0207686_10210725 | 3300025934 | Bacteria | 1397 |
| 569 | Ga0207709_10076899 | 3300025935 | Bacteria | 2138 |
| 570 | Ga0207709_10194207 | 3300025935 | Bacteria | 1445 |
| 571 | Ga0207709_10297134 | 3300025935 | Bacteria | 1199 |
| 572 | Ga0207670_10070252 | 3300025936 | Bacteria | 2418 |
| 573 | Ga0207669_10011373 | 3300025937 | Bacteria | 4328 |
| 574 | Ga0207669_10052811 | 3300025937 | Bacteria | 2444 |
| 575 | Ga0207669_10127068 | 3300025937 | Bacteria | 1744 |
| 576 | Ga0207669_10193128 | 3300025937 | Bacteria | 1470 |
| 577 | Ga0207669_10280468 | 3300025937 | Bacteria | 1256 |
| 578 | Ga0207704_10170929 | 3300025938 | Bacteria | 1559 |
| 579 | Ga0207665_10000229 | 3300025939 | Bacteria | 38095 |
| 580 | Ga0207665_10009781 | 3300025939 | Bacteria | 6297 |
| 581 | Ga0207665_10032829 | 3300025939 | Bacteria | 3437 |
| 582 | Ga0207665_10768961 | 3300025939 | Bacteria | 760 |
| 583 | Ga0207691_10097500 | 3300025940 | Bacteria | 2628 |
| 584 | Ga0207691_10385801 | 3300025940 | Bacteria | 1196 |
| 585 | Ga0207691_10593938 | 3300025940 | Bacteria | 937 |
| 586 | Ga0207711_10047118 | 3300025941 | Bacteria | 3685 |
| 587 | Ga0207711_10207208 | 3300025941 | Bacteria | 1790 |
| 588 | Ga0207711_10388754 | 3300025941 | Bacteria | 1295 |
| 589 | Ga0207689_10003758 | 3300025942 | Bacteria | 13827 |
| 590 | Ga0207689_10135366 | 3300025942 | Bacteria | 2028 |
| 591 | Ga0207661_10000917 | 3300025944 | Bacteria | 19380 |
| 592 | Ga0207661_10238900 | 3300025944 | Bacteria | 1611 |
| 593 | Ga0207661_10370450 | 3300025944 | Bacteria | 1295 |
| 594 | Ga0207667_10007040 | 3300025949 | Bacteria | 13589 |
| 595 | Ga0207667_10271633 | 3300025949 | Bacteria | 1733 |
| 596 | Ga0207667_10623081 | 3300025949 | Bacteria | 1086 |
| 597 | Ga0207712_10122062 | 3300025961 | Bacteria | 1973 |
| 598 | Ga0207712_11166605 | 3300025961 | Bacteria | 687 |
| 599 | Ga0207668_10018550 | 3300025972 | Bacteria | 4382 |
| 600 | Ga0207668_10088097 | 3300025972 | Bacteria | 2272 |
| 601 | Ga0207668_10116175 | 3300025972 | Bacteria | 2017 |
| 602 | Ga0207668_10122050 | 3300025972 | Bacteria | 1974 |
| 603 | Ga0207668_10784211 | 3300025972 | Bacteria | 843 |
| 604 | Ga0207640_10412368 | 3300025981 | Bacteria | 1103 |
| 605 | Ga0207658_10611463 | 3300025986 | Bacteria | 980 |
| 606 | Ga0207658_10991182 | 3300025986 | Bacteria | 766 |
| 607 | Ga0207677_10241250 | 3300026023 | Bacteria | 1462 |
| 608 | Ga0207677_10416807 | 3300026023 | Bacteria | 1143 |
| 609 | Ga0207677_10430357 | 3300026023 | Bacteria | 1126 |
| 610 | Ga0207677_10459412 | 3300026023 | Bacteria | 1093 |
| 611 | Ga0207677_10529499 | 3300026023 | Bacteria | 1023 |
| 612 | Ga0207703_10088708 | 3300026035 | Bacteria | 2596 |
| 613 | Ga0207703_10094264 | 3300026035 | Bacteria | 2523 |
| 614 | Ga0207703_10098345 | 3300026035 | Bacteria | 2474 |
| 615 | Ga0207703_10878834 | 3300026035 | Bacteria | 858 |
| 616 | Ga0207639_10006860 | 3300026041 | Bacteria | 7756 |
| 617 | Ga0207639_10028169 | 3300026041 | Bacteria | 4100 |
| 618 | Ga0207639_10038009 | 3300026041 | Bacteria | 3578 |
| 619 | Ga0207639_10068349 | 3300026041 | Bacteria | 2768 |
| 620 | Ga0207639_10127978 | 3300026041 | Bacteria | 2098 |
| 621 | Ga0207639_10212637 | 3300026041 | Bacteria | 1666 |
| 622 | Ga0207678_10002626 | 3300026067 | Bacteria | 16370 |
| 623 | Ga0207678_10014595 | 3300026067 | Bacteria | 6913 |
| 624 | Ga0207678_10021631 | 3300026067 | Bacteria | 5640 |
| 625 | Ga0207678_10033947 | 3300026067 | Bacteria | 4444 |
| 626 | Ga0207678_10048700 | 3300026067 | Bacteria | 3663 |
| 627 | Ga0207678_10083398 | 3300026067 | Bacteria | 2734 |
| 628 | Ga0207678_10089802 | 3300026067 | Bacteria | 2626 |
| 629 | Ga0207678_10254767 | 3300026067 | Bacteria | 1504 |
| 630 | Ga0207678_10322153 | 3300026067 | Bacteria | 1330 |
| 631 | Ga0207678_10481404 | 3300026067 | Bacteria | 1081 |
| 632 | Ga0207678_10751893 | 3300026067 | Bacteria | 859 |
| 633 | Ga0207708_10002913 | 3300026075 | Bacteria | 12608 |
| 634 | Ga0207708_10050661 | 3300026075 | Bacteria | 3161 |
| 635 | Ga0207702_10259853 | 3300026078 | Bacteria | 1634 |
| 636 | Ga0207702_10333030 | 3300026078 | Bacteria | 1448 |
| 637 | Ga0207702_10997614 | 3300026078 | Bacteria | 831 |
| 638 | Ga0207641_10294140 | 3300026088 | Bacteria | 1532 |
| 639 | Ga0207641_10452139 | 3300026088 | Bacteria | 1241 |
| 640 | Ga0207641_11318166 | 3300026088 | Bacteria | 722 |
| 641 | Ga0207648_10111364 | 3300026089 | Bacteria | 2403 |
| 642 | Ga0207648_10126456 | 3300026089 | Bacteria | 2249 |
| 643 | Ga0207648_10491142 | 3300026089 | Bacteria | 1122 |
| 644 | Ga0207676_10672794 | 3300026095 | Bacteria | 1000 |
| 645 | Ga0207674_10011178 | 3300026116 | Bacteria | 10096 |
| 646 | Ga0207674_10022614 | 3300026116 | Bacteria | 6747 |
| 647 | Ga0207674_10097487 | 3300026116 | Bacteria | 2924 |
| 648 | Ga0207674_10146631 | 3300026116 | Bacteria | 2318 |
| 649 | Ga0207674_10360954 | 3300026116 | Bacteria | 1404 |
| 650 | Ga0207674_10803679 | 3300026116 | Bacteria | 908 |
| 651 | Ga0207675_100074027 | 3300026118 | Bacteria | 3187 |
| 652 | Ga0207675_100154152 | 3300026118 | Bacteria | 2188 |
| 653 | Ga0207675_100854869 | 3300026118 | Bacteria | 925 |
| 654 | Ga0207683_10018187 | 3300026121 | Bacteria | 5995 |
| 655 | Ga0207683_10082170 | 3300026121 | Bacteria | 2861 |
| 656 | Ga0207683_10408897 | 3300026121 | Bacteria | 1249 |
| 657 | Ga0207698_10033138 | 3300026142 | Bacteria | 3750 |
| 658 | Ga0207698_10078782 | 3300026142 | Bacteria | 2647 |
| 659 | Ga0207698_10261855 | 3300026142 | Bacteria | 1589 |
| 660 | Ga0207698_10385805 | 3300026142 | Bacteria | 1334 |
| 661 | Ga0209389_1000001 | 3300027296 | Bacteria | 463799 |
| 662 | Ga0209389_1000014 | 3300027296 | Bacteria | 188621 |
| 663 | Ga0209589_1000020 | 3300027357 | Bacteria | 188617 |
| 664 | Ga0209489_100060 | 3300027361 | Bacteria | 147091 |
| 665 | Ga0209489_101114 | 3300027361 | Bacteria | 54578 |
| 666 | Ga0209700_100007 | 3300027363 | Bacteria | 454608 |
| 667 | Ga0209179_1004949 | 3300027512 | Bacteria | 2050 |
| 668 | Ga0209588_1000816 | 3300027671 | Bacteria | 7919 |
| 669 | Ga0209588_1060552 | 3300027671 | Bacteria | 1224 |
| 670 | Ga0209974_10021441 | 3300027876 | Bacteria | 2139 |
| 671 | Ga0207428_10212990 | 3300027907 | Bacteria | 1451 |
| 672 | Ga0207428_10390444 | 3300027907 | Bacteria | 1020 |
| 673 | Ga0268266_10003290 | 3300028379 | Bacteria | 16240 |
| 674 | Ga0268266_10013881 | 3300028379 | Bacteria | 6935 |
| 675 | Ga0268266_10022599 | 3300028379 | Bacteria | 5356 |
| 676 | Ga0268266_10092360 | 3300028379 | Bacteria | 2655 |
| 677 | Ga0268266_10108842 | 3300028379 | Bacteria | 2453 |
| 678 | Ga0268266_10231194 | 3300028379 | Bacteria | 1703 |
| 679 | Ga0268266_10512514 | 3300028379 | Bacteria | 1146 |
| 680 | Ga0268266_10891614 | 3300028379 | Bacteria | 860 |
| 681 | Ga0268266_11412720 | 3300028379 | Bacteria | 671 |
| 682 | Ga0268265_10009993 | 3300028380 | Bacteria | 6406 |
| 683 | Ga0268265_10021737 | 3300028380 | Bacteria | 4498 |
| 684 | Ga0268265_10177517 | 3300028380 | Bacteria | 1827 |
| 685 | Ga0268265_10216282 | 3300028380 | Bacteria | 1673 |
| 686 | Ga0268265_10454145 | 3300028380 | Bacteria | 1197 |
| 687 | Ga0268264_10244025 | 3300028381 | Bacteria | 1665 |
| 688 | Ga0268264_10732308 | 3300028381 | Bacteria | 984 |
| 689 | Ga0265318_10011813 | 3300028577 | Bacteria | 3741 |
| 690 | Ga0307517_10083264 | 3300028786 | Bacteria | 2706 |
| 691 | Ga0265338_10381945 | 3300028800 | Bacteria | 1007 |
| 692 | Ga0307511_10045798 | 3300030521 | Bacteria | 3609 |
| 693 | Ga0307512_10294970 | 3300030522 | Bacteria | 761 |
| 694 | Ga0265762_1022956 | 3300030760 | Bacteria | 1155 |
| 695 | Ga0265330_10012565 | 3300031235 | Bacteria | 3959 |
| 696 | Ga0265330_10030658 | 3300031235 | Bacteria | 2413 |
| 697 | Ga0265332_10001601 | 3300031238 | Bacteria | 12401 |
| 698 | Ga0265328_10002807 | 3300031239 | Bacteria | 7796 |
| 699 | Ga0265328_10089696 | 3300031239 | Bacteria | 1136 |
| 700 | Ga0265320_10018545 | 3300031240 | Bacteria | 3828 |
| 701 | Ga0265325_10032679 | 3300031241 | Bacteria | 2776 |
| 702 | Ga0265329_10039885 | 3300031242 | Bacteria | 1507 |
| 703 | Ga0265340_10044848 | 3300031247 | Bacteria | 2162 |
| 704 | Ga0265340_10356768 | 3300031247 | Unclassified | 646 |
| 705 | Ga0265339_10013941 | 3300031249 | Bacteria | 4861 |
| 706 | Ga0265331_10002014 | 3300031250 | Bacteria | 14136 |
| 707 | Ga0265331_10055981 | 3300031250 | Bacteria | 1874 |
| 708 | Ga0265331_10082448 | 3300031250 | Bacteria | 1492 |
| 709 | Ga0265331_10084420 | 3300031250 | Bacteria | 1472 |
| 710 | Ga0265331_10178250 | 3300031250 | Bacteria | 960 |
| 711 | Ga0265316_10055188 | 3300031344 | Bacteria | 3109 |
| 712 | Ga0265316_10285113 | 3300031344 | Bacteria | 1206 |
| 713 | Ga0265316_10442876 | 3300031344 | Bacteria | 932 |
| 714 | Ga0307513_10611209 | 3300031456 | Bacteria | 799 |
| 715 | Ga0307509_10093399 | 3300031507 | Bacteria | 3070 |
| 716 | Ga0307509_10205904 | 3300031507 | Bacteria | 1798 |
| 717 | Ga0307509_10503716 | 3300031507 | Bacteria | 895 |
| 718 | Ga0265313_10021124 | 3300031595 | Bacteria | 3568 |
| 719 | Ga0307508_10000032 | 3300031616 | Bacteria | 163293 |
| 720 | Ga0307508_10065217 | 3300031616 | Bacteria | 3209 |
| 721 | Ga0307508_10105723 | 3300031616 | Bacteria | 2412 |
| 722 | Ga0307508_10209810 | 3300031616 | Bacteria | 1548 |
| 723 | Ga0307508_10220463 | 3300031616 | Bacteria | 1496 |
| 724 | Ga0307508_10237559 | 3300031616 | Bacteria | 1420 |
| 725 | Ga0265314_10000720 | 3300031711 | Bacteria | 40041 |
| 726 | Ga0265314_10002758 | 3300031711 | Bacteria | 17547 |
| 727 | Ga0265314_10067654 | 3300031711 | Bacteria | 2404 |
| 728 | Ga0265342_10007374 | 3300031712 | Bacteria | 8063 |
| 729 | Ga0265342_10008230 | 3300031712 | Bacteria | 7507 |
| 730 | Ga0265342_10196665 | 3300031712 | Bacteria | 1098 |
| 731 | Ga0307516_10010277 | 3300031730 | Bacteria | 10309 |
| 732 | Ga0307516_10078471 | 3300031730 | Bacteria | 3148 |
| 733 | Ga0307516_10108391 | 3300031730 | Bacteria | 2584 |
| 734 | Ga0307405_10076072 | 3300031731 | Bacteria | 2177 |
| 735 | Ga0326468_10009406 | 3300031889 | Bacteria | 968 |
| 736 | Ga0307406_10072182 | 3300031901 | Bacteria | 2265 |
| 737 | Ga0307406_10721601 | 3300031901 | Bacteria | 834 |
| 738 | Ga0307407_10273882 | 3300031903 | Bacteria | 1166 |
| 739 | Ga0307407_10750032 | 3300031903 | Bacteria | 739 |
| 740 | Ga0307412_10850901 | 3300031911 | Bacteria | 796 |
| 741 | Ga0307416_100288558 | 3300032002 | Bacteria | 1623 |
| 742 | Ga0307411_10228270 | 3300032005 | Bacteria | 1449 |
| 743 | Ga0307415_100175699 | 3300032126 | Bacteria | 1675 |
| 744 | Ga0307415_100296861 | 3300032126 | Bacteria | 1337 |
| 745 | Ga0307507_10030697 | 3300033179 | Bacteria | 5659 |
| 746 | Ga0307507_10253679 | 3300033179 | Bacteria | 1133 |
| 747 | Ga0307510_10016937 | 3300033180 | Bacteria | 8597 |
| 748 | Ga0307510_10063397 | 3300033180 | Bacteria | 3765 |
| 749 | Ga0307510_10168454 | 3300033180 | Bacteria | 1774 |
| 750 | Ga0307510_10210133 | 3300033180 | Bacteria | 1469 |
| 751 | Ga0373958_0037397 | 3300034819 | Bacteria | 979 |
| 752 | Ga0373926_0132831 | 3300035083 | Bacteria | 943 |
| 753 | Ga0373934_0001744 | 3300035086 | Bacteria | 7994 |
| 754 | Ga0373944_0084789 | 3300035089 | Bacteria | 1052 |
| 755 | Ga0373923_0001465 | 3300035111 | Bacteria | 6780 |
| 756 | Ga0373936_0011859 | 3300035113 | Bacteria | 3307 |
| 757 | Ga0373936_0017834 | 3300035113 | Bacteria | 2736 |
| 758 | Ga0373941_0080388 | 3300035115 | Bacteria | 1100 |
| 759 | Ga0373945_0198174 | 3300035116 | Bacteria | 833 |
| 760 | Ga0373953_0081149 | 3300035117 | Bacteria | 1348 |
| 761 | Ga0373953_0312793 | 3300035117 | Bacteria | 686 |
| 762 | Ga0373954_0002051 | 3300035118 | Bacteria | 8373 |
| 763 | Ga0373954_0009270 | 3300035118 | Bacteria | 4330 |
| 764 | Ga0373954_0032382 | 3300035118 | Bacteria | 2416 |
| 765 | Ga0373954_0280203 | 3300035118 | Bacteria | 822 |
| 766 | Ga0373956_0006790 | 3300035119 | Bacteria | 4589 |
| 767 | Ga0373956_0009916 | 3300035119 | Bacteria | 3884 |
| 768 | Ga0373956_0028341 | 3300035119 | Bacteria | 2436 |
| 769 | Ga0373957_0094309 | 3300035120 | Bacteria | 1192 |
| 770 | Ga0373943_0003121 | 3300035170 | Bacteria | 7531 |
| 771 | Ga0373943_0255731 | 3300035170 | Bacteria | 985 |
| 772 | Ga0373943_0458474 | 3300035170 | Bacteria | 741 |
| 773 | Ga0373946_0054567 | 3300035171 | Bacteria | 1682 |
| 774 | Ga0373955_0000836 | 3300035172 | Bacteria | 13190 |
| 775 | Ga0373955_0175082 | 3300035172 | Bacteria | 1271 |
| 776 | Ga0373924_0009259 | 3300035410 | Bacteria | 3607 |
| 777 | Ga0373924_0095604 | 3300035410 | Bacteria | 1274 |
| 778 | Ga0373931_0006167 | 3300035691 | Bacteria | 5589 |
| 779 | Ga0373935_0007485 | 3300035692 | Bacteria | 6537 |
| 780 | Ga0373935_0041267 | 3300035692 | Bacteria | 2898 |
| 781 | Ga0373935_0223613 | 3300035692 | Bacteria | 1308 |
| 782 | Ga0373927_0000783 | 3300035695 | Bacteria | 24265 |
| 783 | Ga0373927_0003201 | 3300035695 | Bacteria | 11796 |
| 784 | Ga0373927_0014802 | 3300035695 | Bacteria | 5158 |
| 785 | Ga0373927_0109933 | 3300035695 | Bacteria | 1795 |
| 786 | Ga0373927_0125122 | 3300035695 | Bacteria | 1678 |
| 787 | Ga0373927_0295969 | 3300035695 | Bacteria | 1065 |
| 788 | Ga0373933_0000745 | 3300035724 | Bacteria | 19876 |
| 789 | Ga0373933_0020123 | 3300035724 | Bacteria | 3780 |
| 790 | Ga0373933_0051852 | 3300035724 | Bacteria | 2453 |
| 791 | Ga0373947_0001285 | 3300035725 | Bacteria | 15466 |
| 792 | Ga0373947_0002225 | 3300035725 | Bacteria | 11745 |
| 793 | Ga0373947_0005796 | 3300035725 | Bacteria | 7204 |
| 794 | Ga0373947_0606714 | 3300035725 | Bacteria | 746 |
| 795 | Ga0373937_0010610 | 3300036401 | Bacteria | 8049 |
| 796 | Ga0373937_0011733 | 3300036401 | Bacteria | 7685 |
| 797 | Ga0373937_0017404 | 3300036401 | Bacteria | 6402 |
| 798 | Ga0373937_0055982 | 3300036401 | Bacteria | 3621 |
| 799 | Ga0373937_0065077 | 3300036401 | Bacteria | 3355 |
| 800 | Ga0373937_0291115 | 3300036401 | Bacteria | 1543 |
| 801 | Ga0373937_0357148 | 3300036401 | Bacteria | 1384 |
| 802 | Ga0373925_0009084 | 3300037068 | Bacteria | 7235 |
| 803 | Ga0373925_0159804 | 3300037068 | Bacteria | 1774 |
| 804 | Ga0373925_0205571 | 3300037068 | Bacteria | 1567 |
| 805 | Ga0373925_0483802 | 3300037068 | Bacteria | 1015 |
| 806 | Ga0373925_0571115 | 3300037068 | Bacteria | 931 |
| 807 | Ga0395899_0052019 | 3300037312 | Bacteria | 3038 |
| 808 | Ga0395899_0155113 | 3300037312 | Bacteria | 1621 |
| 809 | Ga0395899_0658370 | 3300037312 | Bacteria | 661 |
| 810 | Ga0395900_0001070 | 3300037418 | Bacteria | 34841 |
| 811 | Ga0395900_0130661 | 3300037418 | Bacteria | 2574 |
| 812 | Ga0395898_0001820 | 3300037466 | Bacteria | 27513 |
| 813 | Ga0395898_0008100 | 3300037466 | Bacteria | 11126 |
| 814 | Ga0395898_0492649 | 3300037466 | Bacteria | 1166 |
| 815 | Ga0395898_1210145 | 3300037466 | Bacteria | 686 |
| 816 | Ga0395905_0009285 | 3300037471 | Bacteria | 9620 |
| 817 | Ga0395905_0274201 | 3300037471 | Bacteria | 1573 |
| 818 | Ga0395905_0910527 | 3300037471 | Bacteria | 782 |
| 819 | Ga0436364_0253351 | 3300037853 | Bacteria | 51722 |
| 820 | Ga0436364_1482475 | 3300037853 | Bacteria | 1330 |
| 821 | Ga0395901_0036584 | 3300038443 | Bacteria | 5075 |
| 822 | Ga0395901_0230580 | 3300038443 | Bacteria | 1933 |
| 823 | Ga0395901_0233509 | 3300038443 | Bacteria | 1920 |
| 824 | Ga0395901_0465594 | 3300038443 | Bacteria | 1291 |
| 825 | Ga0436365_0551209 | 3300039437 | Bacteria | 2930 |
| 826 | Ga0436365_0766659 | 3300039437 | Bacteria | 1020 |
| 827 | Ga0436365_1026973 | 3300039437 | Bacteria | 738 |
| 828 | Ga0436365_1295580 | 3300039437 | Bacteria | 811 |
| 829 | Ga0436365_1550533 | 3300039437 | Bacteria | 2263 |
| 830 | Ga0436365_1886582 | 3300039437 | Bacteria | 1088 |
| 831 | Ga0436361_0733364 | 3300039447 | Bacteria | 1096 |
| 832 | Ga0436361_0850535 | 3300039447 | Bacteria | 3280 |
| 833 | Ga0436361_0940506 | 3300039447 | Bacteria | 712 |
| 834 | Ga0436363_0315242 | 3300039450 | Bacteria | 980 |
| 835 | Ga0436363_0448550 | 3300039450 | Bacteria | 800 |
| 836 | Ga0436363_0726009 | 3300039450 | Bacteria | 1097 |
| 837 | Ga0436363_1691007 | 3300039450 | Bacteria | 7615 |
| 838 | Ga0436362_0392249 | 3300039453 | Bacteria | 1408 |
| 839 | Ga0436362_0532768 | 3300039453 | Bacteria | 4386 |
| 840 | Ga0451791_0201774 | 3300041451 | Bacteria | 1784 |
| 841 | Ga0451791_0642730 | 3300041451 | Bacteria | 830 |
| 842 | Ga0451797_1478868 | 3300041453 | Bacteria | 686 |
| 843 | Ga0451800_0883918 | 3300041459 | Bacteria | 1225 |
| 844 | Ga0451841_0432165 | 3300041498 | Bacteria | 1367 |
| 845 | Ga0451851_0421653 | 3300041507 | Bacteria | 1229 |
| 846 | Ga0439448_0090233 | 3300042005 | Bacteria | 1035 |
| 847 | Ga0439432_184098 | 3300042006 | Bacteria | 608 |
| 848 | Ga0466969_0241984 | 3300044656 | Bacteria | 819 |
| 849 | Ga0466969_0265654 | 3300044656 | Bacteria | 777 |
| 850 | Ga0466972_0000134 | 3300044658 | Bacteria | 61802 |
| 851 | Ga0466972_0014382 | 3300044658 | Bacteria | 3964 |
| 852 | Ga0466972_0026556 | 3300044658 | Bacteria | 2870 |
| 853 | Ga0466972_0085058 | 3300044658 | Bacteria | 1504 |
| 854 | Ga0466966_0037736 | 3300044684 | Bacteria | 3114 |
| 855 | Ga0466963_0018695 | 3300044694 | Bacteria | 4337 |
| 856 | Ga0466963_0025638 | 3300044694 | Bacteria | 3763 |
| 857 | Ga0466963_0417413 | 3300044694 | Bacteria | 946 |
| 858 | Ga0466964_0256271 | 3300044706 | Bacteria | 865 |
| 859 | Ga0466964_0423259 | 3300044706 | Bacteria | 701 |
| 860 | Ga0466968_0006796 | 3300044735 | Bacteria | 4327 |
| 861 | Ga0466968_0152970 | 3300044735 | Bacteria | 1061 |
| 862 | Ga0466968_0221446 | 3300044735 | Bacteria | 891 |
| 863 | Ga0466970_0028528 | 3300044765 | Bacteria | 2934 |
| 864 | Ga0466957_0229960 | 3300044842 | Bacteria | 1227 |
| 865 | Ga0466960_0039333 | 3300044901 | Bacteria | 2230 |
| 866 | Ga0466960_0100716 | 3300044901 | Bacteria | 1487 |
| 867 | Ga0466959_0560060 | 3300045049 | Bacteria | 770 |
| 868 | Ga0466967_0129640 | 3300045976 | Bacteria | 2340 |
| 869 | Ga0466967_0156615 | 3300045976 | Bacteria | 2134 |
| 870 | Ga0466967_0865800 | 3300045976 | Bacteria | 898 |
| 871 | Ga0466967_1193165 | 3300045976 | Bacteria | 758 |
| 872 | Ga0466967_1834124 | 3300045976 | Bacteria | 603 |
| 873 | Ga0495617_026298 | 3300046452 | Bacteria | 1959 |
| 874 | Ga0495592_0011800 | 3300046454 | Bacteria | 6619 |
| 875 | Ga0495592_0024131 | 3300046454 | Bacteria | 4624 |
| 876 | Ga0495592_0667153 | 3300046454 | Bacteria | 628 |
| 877 | Ga0495603_0001681 | 3300046455 | Bacteria | 13000 |
| 878 | Ga0495603_0002554 | 3300046455 | Bacteria | 10727 |
| 879 | Ga0495603_0076353 | 3300046455 | Bacteria | 1966 |
| 880 | Ga0495629_0000077 | 3300046459 | Bacteria | 85931 |
| 881 | Ga0495629_0000165 | 3300046459 | Bacteria | 58366 |
| 882 | Ga0495629_0001874 | 3300046459 | Bacteria | 16415 |
| 883 | Ga0495629_0072547 | 3300046459 | Bacteria | 2403 |
| 884 | Ga0495638_0003381 | 3300046460 | Bacteria | 12578 |
| 885 | Ga0495638_0242061 | 3300046460 | Bacteria | 998 |
| 886 | Ga0495638_0405853 | 3300046460 | Bacteria | 706 |
| 887 | Ga0495641_0000929 | 3300046461 | Bacteria | 24998 |
| 888 | Ga0495651_0000998 | 3300046462 | Bacteria | 21934 |
| 889 | Ga0495651_0007709 | 3300046462 | Bacteria | 8235 |
| 890 | Ga0495651_0014165 | 3300046462 | Bacteria | 6163 |
| 891 | Ga0495651_0117801 | 3300046462 | Bacteria | 1954 |
| 892 | Ga0495653_0002848 | 3300046463 | Bacteria | 13821 |
| 893 | Ga0495653_0039737 | 3300046463 | Bacteria | 3684 |
| 894 | Ga0495580_0000913 | 3300046472 | Bacteria | 25774 |
| 895 | Ga0495580_0012709 | 3300046472 | Bacteria | 6453 |
| 896 | Ga0495582_0000016 | 3300046473 | Bacteria | 100714 |
| 897 | Ga0495582_0228655 | 3300046473 | Bacteria | 1065 |
| 898 | Ga0495605_0096527 | 3300046474 | Bacteria | 1363 |
| 899 | Ga0495605_0111427 | 3300046474 | Bacteria | 1248 |
| 900 | Ga0495639_0000014 | 3300046475 | Bacteria | 82866 |
| 901 | Ga0495639_0253721 | 3300046475 | Bacteria | 870 |
| 902 | Ga0495662_0000086 | 3300046476 | Bacteria | 33465 |
| 903 | Ga0495664_0009821 | 3300046477 | Bacteria | 5365 |
| 904 | Ga0495664_0031350 | 3300046477 | Bacteria | 3116 |
| 905 | Ga0495664_0091995 | 3300046477 | Bacteria | 1824 |
| 906 | Ga0495664_0096681 | 3300046477 | Bacteria | 1778 |
| 907 | Ga0495664_0109702 | 3300046477 | Bacteria | 1665 |
| 908 | Ga0495664_0168297 | 3300046477 | Bacteria | 1330 |
| 909 | Ga0495584_0080757 | 3300046491 | Bacteria | 1636 |
| 910 | Ga0495584_0089683 | 3300046491 | Bacteria | 1550 |
| 911 | Ga0495584_0097665 | 3300046491 | Bacteria | 1484 |
| 912 | Ga0495584_0131219 | 3300046491 | Bacteria | 1271 |
| 913 | Ga0495584_0231768 | 3300046491 | Bacteria | 939 |
| 914 | Ga0495584_0310212 | 3300046491 | Bacteria | 801 |
| 915 | Ga0495585_0012248 | 3300046492 | Bacteria | 5052 |
| 916 | Ga0495585_0026425 | 3300046492 | Bacteria | 3315 |
| 917 | Ga0495585_0180233 | 3300046492 | Bacteria | 1086 |
| 918 | Ga0495585_0218648 | 3300046492 | Bacteria | 962 |
| 919 | Ga0495594_0000420 | 3300046499 | Bacteria | 21403 |
| 920 | Ga0495594_0251690 | 3300046499 | Bacteria | 1006 |
| 921 | Ga0495594_0294615 | 3300046499 | Bacteria | 924 |
| 922 | Ga0495596_0261390 | 3300046500 | Bacteria | 672 |
| 923 | Ga0495583_0020320 | 3300046506 | Bacteria | 3444 |
| 924 | Ga0495583_0110898 | 3300046506 | Bacteria | 1163 |
| 925 | Ga0495606_0016617 | 3300046507 | Bacteria | 5601 |
| 926 | Ga0495606_0094225 | 3300046507 | Bacteria | 1835 |
| 927 | Ga0495608_0004861 | 3300046511 | Bacteria | 9605 |
| 928 | Ga0495608_0036601 | 3300046511 | Bacteria | 3304 |
| 929 | Ga0495608_0085211 | 3300046511 | Bacteria | 2048 |
| 930 | Ga0495610_0034048 | 3300046512 | Bacteria | 2627 |
| 931 | Ga0495616_0036445 | 3300046513 | Bacteria | 2538 |
| 932 | Ga0495616_0145796 | 3300046513 | Bacteria | 1074 |
| 933 | Ga0495618_0080743 | 3300046514 | Bacteria | 2075 |
| 934 | Ga0495618_0084275 | 3300046514 | Bacteria | 2031 |
| 935 | Ga0495628_0014816 | 3300046516 | Bacteria | 6522 |
| 936 | Ga0495628_0027632 | 3300046516 | Bacteria | 4614 |
| 937 | Ga0495628_0042840 | 3300046516 | Bacteria | 3608 |
| 938 | Ga0495628_0055901 | 3300046516 | Bacteria | 3108 |
| 939 | Ga0495628_0328876 | 3300046516 | Bacteria | 1127 |
| 940 | Ga0495630_0003176 | 3300046517 | Bacteria | 11417 |
| 941 | Ga0495630_0139089 | 3300046517 | Bacteria | 1846 |
| 942 | Ga0495630_0961129 | 3300046517 | Bacteria | 650 |
| 943 | Ga0495631_0215358 | 3300046518 | Bacteria | 820 |
| 944 | Ga0495632_0092028 | 3300046519 | Bacteria | 1437 |
| 945 | Ga0495632_0150184 | 3300046519 | Bacteria | 1077 |
| 946 | Ga0495644_0056272 | 3300046523 | Bacteria | 1478 |
| 947 | Ga0495644_0059596 | 3300046523 | Bacteria | 1435 |
| 948 | Ga0495644_0105582 | 3300046523 | Bacteria | 1067 |
| 949 | Ga0495648_0001270 | 3300046524 | Bacteria | 25160 |
| 950 | Ga0495648_0040464 | 3300046524 | Bacteria | 2955 |
| 951 | Ga0495666_0197235 | 3300046526 | Bacteria | 926 |
| 952 | Ga0495642_0019111 | 3300046528 | Bacteria | 2684 |
| 953 | Ga0495642_0115543 | 3300046528 | Bacteria | 1150 |
| 954 | Ga0495642_0149036 | 3300046528 | Bacteria | 1012 |
| 955 | Ga0495652_0025241 | 3300046529 | Bacteria | 5260 |
| 956 | Ga0495652_0035210 | 3300046529 | Bacteria | 4358 |
| 957 | Ga0495652_0035670 | 3300046529 | Bacteria | 4327 |
| 958 | Ga0495652_0080110 | 3300046529 | Bacteria | 2698 |
| 959 | Ga0495652_0085510 | 3300046529 | Bacteria | 2591 |
| 960 | Ga0495652_0295280 | 3300046529 | Bacteria | 1180 |
| 961 | Ga0495665_0000665 | 3300046531 | Bacteria | 17688 |
| 962 | Ga0495665_0050977 | 3300046531 | Bacteria | 2193 |
| 963 | Ga0495640_0002399 | 3300046533 | Bacteria | 15028 |
| 964 | Ga0495640_0002839 | 3300046533 | Bacteria | 13934 |
| 965 | Ga0495640_0045369 | 3300046533 | Bacteria | 3050 |
| 966 | Ga0495640_0097751 | 3300046533 | Bacteria | 1930 |
| 967 | Ga0495586_0016426 | 3300046535 | Bacteria | 3937 |
| 968 | Ga0495587_0008879 | 3300046536 | Bacteria | 6450 |
| 969 | Ga0495587_0015099 | 3300046536 | Bacteria | 4826 |
| 970 | Ga0495609_0047871 | 3300046538 | Bacteria | 1912 |
| 971 | Ga0495609_0115113 | 3300046538 | Bacteria | 1159 |
| 972 | Ga0495621_0217536 | 3300046539 | Bacteria | 772 |
| 973 | Ga0495597_0136927 | 3300046542 | Bacteria | 1012 |
| 974 | Ga0495645_0039169 | 3300046543 | Bacteria | 3457 |
| 975 | Ga0495645_0135638 | 3300046543 | Bacteria | 1722 |
| 976 | Ga0495645_0291672 | 3300046543 | Bacteria | 1069 |
| 977 | Ga0495622_0002786 | 3300046557 | Bacteria | 8343 |
| 978 | Ga0495622_0016747 | 3300046557 | Bacteria | 3414 |
| 979 | Ga0495622_0023742 | 3300046557 | Bacteria | 2860 |
| 980 | Ga0495622_0050150 | 3300046557 | Bacteria | 1937 |
| 981 | Ga0495622_0138108 | 3300046557 | Bacteria | 1107 |
| 982 | Ga0495633_0053573 | 3300046558 | Bacteria | 1899 |
| 983 | Ga0495633_0066574 | 3300046558 | Bacteria | 1682 |
| 984 | Ga0495667_0009076 | 3300046559 | Bacteria | 6755 |
| 985 | Ga0495667_0011830 | 3300046559 | Bacteria | 5911 |
| 986 | Ga0495667_0039008 | 3300046559 | Bacteria | 3161 |
| 987 | Ga0495667_0042791 | 3300046559 | Bacteria | 3003 |
| 988 | Ga0495667_0270286 | 3300046559 | Bacteria | 1080 |
| 989 | Ga0495656_0035397 | 3300046615 | Bacteria | 2051 |
| 990 | Ga0495656_0041525 | 3300046615 | Bacteria | 1922 |
| 991 | Ga0495656_0088098 | 3300046615 | Bacteria | 1414 |
| 992 | Ga0495656_0225095 | 3300046615 | Bacteria | 939 |
| 993 | Ga0495668_0057213 | 3300046616 | Bacteria | 2152 |
| 994 | Ga0495668_0194231 | 3300046616 | Bacteria | 1111 |
| 995 | Ga0495668_0360414 | 3300046616 | Bacteria | 798 |
| 996 | Ga0495668_0366617 | 3300046616 | Bacteria | 791 |
| 997 | Ga0495634_0000859 | 3300046642 | Bacteria | 29254 |
| 998 | Ga0495634_0025034 | 3300046642 | Bacteria | 4183 |
| 999 | Ga0495634_0042688 | 3300046642 | Bacteria | 3075 |
| 1000 | Ga0495611_0073357 | 3300046648 | Bacteria | 1567 |
| 1001 | Ga0495611_0140338 | 3300046648 | Bacteria | 1128 |
| 1002 | Ga0495625_0039960 | 3300046660 | Bacteria | 3424 |
| 1003 | Ga0495625_0226343 | 3300046660 | Bacteria | 1223 |
| 1004 | Ga0495625_0276165 | 3300046660 | Bacteria | 1082 |
| 1005 | Ga0495625_0388317 | 3300046660 | Bacteria | 874 |
| 1006 | Ga0495635_0000160 | 3300046663 | Bacteria | 41557 |
| 1007 | Ga0495635_0012918 | 3300046663 | Bacteria | 5847 |
| 1008 | Ga0495635_0045294 | 3300046663 | Bacteria | 3035 |
| 1009 | Ga0495635_0134480 | 3300046663 | Bacteria | 1685 |
| 1010 | Ga0495635_0450937 | 3300046663 | Bacteria | 850 |
| 1011 | Ga0495588_0003175 | 3300046674 | Bacteria | 7112 |
| 1012 | Ga0495588_0018312 | 3300046674 | Bacteria | 3413 |
| 1013 | Ga0495588_0089354 | 3300046674 | Bacteria | 1613 |
| 1014 | Ga0495657_0000879 | 3300046675 | Bacteria | 26530 |
| 1015 | Ga0495657_0005900 | 3300046675 | Bacteria | 9625 |
| 1016 | Ga0495657_0045190 | 3300046675 | Bacteria | 2990 |
| 1017 | Ga0495657_0061256 | 3300046675 | Bacteria | 2489 |
| 1018 | Ga0495657_0135604 | 3300046675 | Bacteria | 1538 |
| 1019 | Ga0495599_0006440 | 3300046678 | Bacteria | 7083 |
| 1020 | Ga0495599_0023759 | 3300046678 | Bacteria | 3832 |
| 1021 | Ga0495599_0036498 | 3300046678 | Bacteria | 3087 |
| 1022 | Ga0495599_0091650 | 3300046678 | Bacteria | 1896 |
| 1023 | Ga0495623_0022851 | 3300046679 | Bacteria | 4037 |
| 1024 | Ga0495623_0022863 | 3300046679 | Bacteria | 4036 |
| 1025 | Ga0495623_0415218 | 3300046679 | Bacteria | 722 |
| 1026 | Ga0495646_0011620 | 3300046680 | Bacteria | 5595 |
| 1027 | Ga0495646_0036240 | 3300046680 | Bacteria | 3056 |
| 1028 | Ga0495647_0004777 | 3300046681 | Bacteria | 4421 |
| 1029 | Ga0495658_0002129 | 3300046683 | Bacteria | 10021 |
| 1030 | Ga0495658_0467759 | 3300046683 | Bacteria | 806 |
| 1031 | Ga0495669_0004453 | 3300046684 | Bacteria | 5784 |
| 1032 | Ga0495669_0019284 | 3300046684 | Bacteria | 2942 |
| 1033 | Ga0495669_0166786 | 3300046684 | Bacteria | 1047 |
| 1034 | Ga0495613_0080984 | 3300046689 | Bacteria | 2359 |
| 1035 | Ga0495613_0163535 | 3300046689 | Bacteria | 1582 |
| 1036 | Ga0495624_0000138 | 3300046690 | Bacteria | 52220 |
| 1037 | Ga0495624_0060002 | 3300046690 | Bacteria | 2385 |
| 1038 | Ga0495624_0367711 | 3300046690 | Bacteria | 865 |
| 1039 | Ga0495670_0011657 | 3300046691 | Bacteria | 4326 |
| 1040 | Ga0495670_0095461 | 3300046691 | Bacteria | 1525 |
| 1041 | Ga0495670_0339782 | 3300046691 | Bacteria | 807 |
| 1042 | Ga0495649_0062500 | 3300046694 | Bacteria | 2001 |
| 1043 | Ga0495649_0074141 | 3300046694 | Bacteria | 1823 |
| 1044 | Ga0495649_0110748 | 3300046694 | Bacteria | 1456 |
| 1045 | Ga0495649_0187292 | 3300046694 | Bacteria | 1078 |
| 1046 | Ga0495589_0013236 | 3300046794 | Bacteria | 4257 |
| 1047 | Ga0495589_0099354 | 3300046794 | Bacteria | 1409 |
| 1048 | Ga0495600_0003305 | 3300046809 | Bacteria | 9460 |
| 1049 | Ga0495600_0019159 | 3300046809 | Bacteria | 4366 |
| 1050 | Ga0495600_0049648 | 3300046809 | Bacteria | 2737 |
| 1051 | Ga0495600_0064139 | 3300046809 | Bacteria | 2401 |
| 1052 | Ga0495600_0215981 | 3300046809 | Bacteria | 1228 |
| 1053 | Ga0495660_0097091 | 3300046810 | Bacteria | 1522 |
| 1054 | Ga0495660_0153516 | 3300046810 | Bacteria | 1135 |
| 1055 | Ga0495581_0000001 | 3300047315 | Bacteria | 104278 |
| 1056 | Ga0495581_0165241 | 3300047315 | Bacteria | 1294 |
| 1057 | Ga0495581_0174967 | 3300047315 | Bacteria | 1255 |
| 1058 | Ga0495604_0049825 | 3300047317 | Bacteria | 3252 |
| 1059 | Ga0495604_0055766 | 3300047317 | Bacteria | 3044 |
| 1060 | Ga0495604_0060760 | 3300047317 | Bacteria | 2892 |
| 1061 | Ga0495604_0488465 | 3300047317 | Bacteria | 800 |
| 1062 | Ga0495636_0014658 | 3300047318 | Bacteria | 3119 |
| 1063 | Ga0495636_0376219 | 3300047318 | Bacteria | 673 |
| 1064 | Ga0495674_0005256 | 3300047319 | Bacteria | 12420 |
| 1065 | Ga0495674_0008899 | 3300047319 | Bacteria | 9548 |
| 1066 | Ga0495674_0167618 | 3300047319 | Bacteria | 1834 |
| 1067 | Ga0495674_0457991 | 3300047319 | Bacteria | 1024 |
| 1068 | Ga0495672_0004418 | 3300047320 | Bacteria | 11527 |
| 1069 | Ga0495672_0029991 | 3300047320 | Bacteria | 3418 |
| 1070 | Ga0495672_0059938 | 3300047320 | Bacteria | 2200 |
| 1071 | Ga0495676_0040714 | 3300047321 | Bacteria | 3832 |
| 1072 | Ga0495676_0157359 | 3300047321 | Bacteria | 1611 |
| 1073 | Ga0495680_0003079 | 3300047322 | Bacteria | 16606 |
| 1074 | Ga0495680_0022685 | 3300047322 | Bacteria | 5229 |
| 1075 | Ga0495680_0044778 | 3300047322 | Bacteria | 3497 |
| 1076 | Ga0495680_0150989 | 3300047322 | Bacteria | 1694 |
| 1077 | Ga0495683_0031335 | 3300047323 | Bacteria | 2710 |
| 1078 | Ga0495683_0036510 | 3300047323 | Bacteria | 2493 |
| 1079 | Ga0495683_0049939 | 3300047323 | Bacteria | 2094 |
| 1080 | Ga0495683_0203155 | 3300047323 | Bacteria | 892 |
| 1081 | Ga0495687_041885 | 3300047443 | Bacteria | 2005 |
| 1082 | Ga0495687_185412 | 3300047443 | Bacteria | 675 |
| 1083 | Ga0495675_0046597 | 3300047444 | Bacteria | 2759 |
| 1084 | Ga0495685_121617 | 3300047447 | Bacteria | 857 |
| 1085 | Ga0495673_0023976 | 3300047469 | Bacteria | 2957 |
| 1086 | Ga0495673_0062926 | 3300047469 | Bacteria | 1583 |
| 1087 | Ga0495673_0065060 | 3300047469 | Bacteria | 1549 |
| 1088 | Ga0495673_0068791 | 3300047469 | Bacteria | 1495 |
| 1089 | Ga0495684_0036692 | 3300047471 | Bacteria | 3757 |
| 1090 | Ga0495684_0044470 | 3300047471 | Bacteria | 3400 |
| 1091 | Ga0495684_0072494 | 3300047471 | Bacteria | 2617 |
| 1092 | Ga0495686_0076336 | 3300047472 | Bacteria | 2053 |
| 1093 | Ga0495686_0080518 | 3300047472 | Bacteria | 1990 |
| 1094 | Ga0495686_0183940 | 3300047472 | Bacteria | 1209 |
| 1095 | Ga0495686_0319020 | 3300047472 | Bacteria | 852 |
| 1096 | Ga0495593_0000006 | 3300047673 | Bacteria | 90370 |
| 1097 | Ga0495593_0022703 | 3300047673 | Bacteria | 3491 |
| 1098 | Ga0495593_0286107 | 3300047673 | Bacteria | 824 |
| 1099 | Ga0495602_0011303 | 3300048088 | Bacteria | 9231 |
| 1100 | Ga0495602_0017651 | 3300048088 | Bacteria | 7149 |
| 1101 | Ga0495602_0038574 | 3300048088 | Bacteria | 4414 |
| 1102 | Ga0495602_0196436 | 3300048088 | Bacteria | 1542 |
| 1103 | Ga0495602_0346360 | 3300048088 | Bacteria | 1073 |
| 1104 | Ga0495602_0384061 | 3300048088 | Bacteria | 1005 |
| 1105 | Ga0495614_0057226 | 3300048089 | Bacteria | 1674 |
| 1106 | Ga0495614_0200275 | 3300048089 | Bacteria | 903 |
| 1107 | Ga0495626_0171203 | 3300048091 | Bacteria | 905 |
| 1108 | Ga0496100_0006943 | 3300048903 | Bacteria | 6207 |
| 1109 | Ga0496100_0084030 | 3300048903 | Bacteria | 2157 |
| 1110 | Ga0496100_0115201 | 3300048903 | Bacteria | 1874 |
| 1111 | Ga0496100_0247974 | 3300048903 | Bacteria | 1316 |
| 1112 | Ga0496101_0059075 | 3300048904 | Bacteria | 2779 |
| 1113 | Ga0496101_0072025 | 3300048904 | Bacteria | 2536 |
| 1114 | Ga0496101_0085099 | 3300048904 | Bacteria | 2342 |
| 1115 | Ga0496101_0128661 | 3300048904 | Bacteria | 1921 |
| 1116 | Ga0496101_0158441 | 3300048904 | Bacteria | 1735 |
| 1117 | Ga0496101_0182757 | 3300048904 | Bacteria | 1615 |
| 1118 | Ga0496101_0209036 | 3300048904 | Bacteria | 1511 |
| 1119 | Ga0496101_0403148 | 3300048904 | Bacteria | 1077 |
| 1120 | Ga0496101_0457260 | 3300048904 | Bacteria | 1007 |
| 1121 | Ga0496101_0543616 | 3300048904 | Bacteria | 918 |
| 1122 | Ga0496101_1068847 | 3300048904 | Bacteria | 634 |
| 1123 | Ga0496102_0067901 | 3300048905 | Bacteria | 3271 |
| 1124 | Ga0496102_0071311 | 3300048905 | Bacteria | 3190 |
| 1125 | Ga0496102_0129692 | 3300048905 | Bacteria | 2359 |
| 1126 | Ga0496102_0157522 | 3300048905 | Bacteria | 2135 |
| 1127 | Ga0496102_0281194 | 3300048905 | Bacteria | 1568 |
| 1128 | Ga0496102_0863936 | 3300048905 | Bacteria | 827 |
| 1129 | Ga0496103_0155585 | 3300048906 | Bacteria | 1465 |
| 1130 | Ga0496103_0218081 | 3300048906 | Bacteria | 1227 |
| 1131 | Ga0496104_0009233 | 3300048907 | Bacteria | 8768 |
| 1132 | Ga0496104_0009595 | 3300048907 | Bacteria | 8616 |
| 1133 | Ga0496104_0022577 | 3300048907 | Bacteria | 5779 |
| 1134 | Ga0496104_0026681 | 3300048907 | Bacteria | 5337 |
| 1135 | Ga0496104_0030806 | 3300048907 | Bacteria | 4987 |
| 1136 | Ga0496104_0109706 | 3300048907 | Bacteria | 2645 |
| 1137 | Ga0496104_0369287 | 3300048907 | Bacteria | 1347 |
| 1138 | Ga0496104_0472106 | 3300048907 | Bacteria | 1166 |
| 1139 | Ga0496105_0002418 | 3300048908 | Bacteria | 13525 |
| 1140 | Ga0496105_0003634 | 3300048908 | Bacteria | 11464 |
| 1141 | Ga0496105_0005245 | 3300048908 | Bacteria | 9819 |
| 1142 | Ga0496105_0032335 | 3300048908 | Bacteria | 4292 |
| 1143 | Ga0496105_0036221 | 3300048908 | Bacteria | 4064 |
| 1144 | Ga0496105_0048740 | 3300048908 | Bacteria | 3496 |
| 1145 | Ga0496105_0056871 | 3300048908 | Bacteria | 3229 |
| 1146 | Ga0496105_0311075 | 3300048908 | Bacteria | 1264 |
| 1147 | Ga0496105_0471474 | 3300048908 | Bacteria | 989 |
| 1148 | Ga0496105_0520715 | 3300048908 | Bacteria | 931 |
| 1149 | Ga0496106_0102797 | 3300048909 | Bacteria | 2217 |
| 1150 | Ga0496106_0286438 | 3300048909 | Bacteria | 1320 |
| 1151 | Ga0496107_0364903 | 3300048910 | Bacteria | 1074 |
| 1152 | Ga0496107_0602276 | 3300048910 | Bacteria | 812 |
| 1153 | Ga0496108_0011505 | 3300048911 | Bacteria | 7191 |
| 1154 | Ga0496108_0029736 | 3300048911 | Bacteria | 4527 |
| 1155 | Ga0496108_0030463 | 3300048911 | Bacteria | 4472 |
| 1156 | Ga0496108_0091996 | 3300048911 | Bacteria | 2579 |
| 1157 | Ga0496108_0106987 | 3300048911 | Bacteria | 2388 |
| 1158 | Ga0496108_0111129 | 3300048911 | Bacteria | 2344 |
| 1159 | Ga0496108_0463158 | 3300048911 | Bacteria | 1107 |
| 1160 | Ga0496109_0031295 | 3300048912 | Bacteria | 4774 |
| 1161 | Ga0496109_0066655 | 3300048912 | Bacteria | 3297 |
| 1162 | Ga0496109_0088762 | 3300048912 | Bacteria | 2858 |
| 1163 | Ga0496109_0142003 | 3300048912 | Bacteria | 2245 |
| 1164 | Ga0496109_0201139 | 3300048912 | Bacteria | 1873 |
| 1165 | Ga0496109_0270310 | 3300048912 | Bacteria | 1601 |
| 1166 | Ga0496109_0296681 | 3300048912 | Bacteria | 1524 |
| 1167 | Ga0496109_1167299 | 3300048912 | Bacteria | 707 |
| 1168 | Ga0496110_0024962 | 3300048913 | Bacteria | 5101 |
| 1169 | Ga0496110_0059210 | 3300048913 | Bacteria | 3375 |
| 1170 | Ga0496110_0126508 | 3300048913 | Bacteria | 2306 |
| 1171 | Ga0496110_0129862 | 3300048913 | Bacteria | 2274 |
| 1172 | Ga0496110_0129876 | 3300048913 | Bacteria | 2274 |
| 1173 | Ga0496110_0682134 | 3300048913 | Bacteria | 928 |
| 1174 | Ga0496111_0005520 | 3300048914 | Bacteria | 8122 |
| 1175 | Ga0496111_0091349 | 3300048914 | Bacteria | 2231 |
| 1176 | Ga0496111_0104147 | 3300048914 | Bacteria | 2087 |
| 1177 | Ga0496111_0131764 | 3300048914 | Bacteria | 1850 |
| 1178 | Ga0496111_0615582 | 3300048914 | Bacteria | 794 |
| 1179 | Ga0496112_0000044 | 3300048915 | Bacteria | 86865 |
| 1180 | Ga0496112_0002088 | 3300048915 | Bacteria | 15846 |
| 1181 | Ga0496112_0018929 | 3300048915 | Bacteria | 6489 |
| 1182 | Ga0496112_0020643 | 3300048915 | Bacteria | 6247 |
| 1183 | Ga0496112_0021176 | 3300048915 | Bacteria | 6179 |
| 1184 | Ga0496112_0042168 | 3300048915 | Bacteria | 4464 |
| 1185 | Ga0496112_0060244 | 3300048915 | Bacteria | 3740 |
| 1186 | Ga0496112_0061659 | 3300048915 | Bacteria | 3698 |
| 1187 | Ga0496112_0071713 | 3300048915 | Bacteria | 3423 |
| 1188 | Ga0496112_0076624 | 3300048915 | Bacteria | 3307 |
| 1189 | Ga0496112_0165914 | 3300048915 | Bacteria | 2174 |
| 1190 | Ga0496112_0183402 | 3300048915 | Bacteria | 2057 |
| 1191 | Ga0496113_0009278 | 3300048916 | Bacteria | 6453 |
| 1192 | Ga0496113_0011400 | 3300048916 | Bacteria | 5927 |
| 1193 | Ga0496113_0073010 | 3300048916 | Bacteria | 2613 |
| 1194 | Ga0496113_0083713 | 3300048916 | Bacteria | 2448 |
| 1195 | Ga0496113_0108366 | 3300048916 | Bacteria | 2159 |
| 1196 | Ga0496113_0548392 | 3300048916 | Bacteria | 927 |
| 1197 | Ga0496114_0023840 | 3300048917 | Bacteria | 4993 |
| 1198 | Ga0496114_0050479 | 3300048917 | Bacteria | 3463 |
| 1199 | Ga0496114_0109489 | 3300048917 | Bacteria | 2365 |
| 1200 | Ga0496114_0219590 | 3300048917 | Bacteria | 1668 |
| 1201 | Ga0496114_0337485 | 3300048917 | Bacteria | 1332 |
| 1202 | Ga0496114_0387592 | 3300048917 | Bacteria | 1237 |
| 1203 | Ga0496114_0449791 | 3300048917 | Bacteria | 1141 |
| 1204 | Ga0496115_0020404 | 3300048918 | Bacteria | 5113 |
| 1205 | Ga0496115_0025923 | 3300048918 | Bacteria | 4569 |
| 1206 | Ga0496115_0029725 | 3300048918 | Bacteria | 4294 |
| 1207 | Ga0496115_0033607 | 3300048918 | Bacteria | 4050 |
| 1208 | Ga0496115_0035946 | 3300048918 | Bacteria | 3921 |
| 1209 | Ga0496115_0060891 | 3300048918 | Bacteria | 3042 |
| 1210 | Ga0496115_0078942 | 3300048918 | Bacteria | 2679 |
| 1211 | Ga0496115_0143179 | 3300048918 | Bacteria | 1972 |
| 1212 | Ga0496115_0216934 | 3300048918 | Bacteria | 1579 |
| 1213 | Ga0496115_0251683 | 3300048918 | Bacteria | 1454 |
| 1214 | Ga0496115_0429543 | 3300048918 | Bacteria | 1069 |
| 1215 | Ga0496115_0453673 | 3300048918 | Bacteria | 1035 |
| 1216 | Ga0496115_0545822 | 3300048918 | Bacteria | 927 |
| 1217 | Ga0496115_0761527 | 3300048918 | Bacteria | 756 |
| 1218 | Ga0496115_0813661 | 3300048918 | Bacteria | 726 |
| 1219 | Ga0496115_0841450 | 3300048918 | Bacteria | 711 |
| 1220 | Ga0496116_0076390 | 3300048919 | Bacteria | 2098 |
| 1221 | Ga0496116_0178122 | 3300048919 | Bacteria | 1142 |
| 1222 | Ga0496116_0331715 | 3300048919 | Bacteria | 706 |
| 1223 | Ga0496117_0149557 | 3300048920 | Bacteria | 1384 |
| 1224 | Ga0496118_0069862 | 3300048921 | Bacteria | 2540 |
| 1225 | Ga0496118_0198646 | 3300048921 | Bacteria | 1191 |
| 1226 | Ga0496119_0037130 | 3300048922 | Bacteria | 3169 |
| 1227 | Ga0496119_0044456 | 3300048922 | Bacteria | 2796 |
| 1228 | Ga0496119_0135227 | 3300048922 | Bacteria | 1338 |
| 1229 | Ga0496119_0136853 | 3300048922 | Bacteria | 1327 |
| 1230 | Ga0496119_0194322 | 3300048922 | Bacteria | 1055 |
| 1231 | Ga0496120_0014100 | 3300048923 | Bacteria | 5339 |
| 1232 | Ga0496120_0135828 | 3300048923 | Bacteria | 1254 |
| 1233 | Ga0496121_0001183 | 3300048924 | Bacteria | 45653 |
| 1234 | Ga0496121_0033032 | 3300048924 | Bacteria | 4691 |
| 1235 | Ga0496121_0037558 | 3300048924 | Bacteria | 4300 |
| 1236 | Ga0496121_0045446 | 3300048924 | Bacteria | 3773 |
| 1237 | Ga0496121_0051131 | 3300048924 | Bacteria | 3483 |
| 1238 | Ga0496121_0062533 | 3300048924 | Bacteria | 3048 |
| 1239 | Ga0496121_0197133 | 3300048924 | Bacteria | 1438 |
| 1240 | Ga0496121_0217800 | 3300048924 | Bacteria | 1347 |
| 1241 | Ga0496121_0530931 | 3300048924 | Bacteria | 740 |
| 1242 | Ga0496122_0024003 | 3300048925 | Bacteria | 5352 |
| 1243 | Ga0496122_0115896 | 3300048925 | Bacteria | 1744 |
| 1244 | Ga0496123_0070330 | 3300048926 | Bacteria | 2191 |
| 1245 | Ga0496124_0100316 | 3300048927 | Bacteria | 2347 |
| 1246 | Ga0496124_0170991 | 3300048927 | Bacteria | 1683 |
| 1247 | Ga0496124_0292170 | 3300048927 | Bacteria | 1182 |
| 1248 | Ga0496125_0050293 | 3300048928 | Bacteria | 3452 |
| 1249 | Ga0496125_0254968 | 3300048928 | Bacteria | 1104 |
| 1250 | Ga0496125_0446737 | 3300048928 | Bacteria | 742 |
| 1251 | Ga0496126_0007021 | 3300048929 | Bacteria | 12429 |
| 1252 | Ga0496126_0011784 | 3300048929 | Bacteria | 9001 |
| 1253 | Ga0496126_0013214 | 3300048929 | Bacteria | 8419 |
| 1254 | Ga0496126_0015857 | 3300048929 | Bacteria | 7567 |
| 1255 | Ga0496126_0037507 | 3300048929 | Bacteria | 4522 |
| 1256 | Ga0496126_0068932 | 3300048929 | Bacteria | 3156 |
| 1257 | Ga0496126_0099061 | 3300048929 | Bacteria | 2553 |
| 1258 | Ga0496126_0099222 | 3300048929 | Bacteria | 2551 |
| 1259 | Ga0496126_0220769 | 3300048929 | Bacteria | 1592 |
| 1260 | Ga0496126_0286798 | 3300048929 | Bacteria | 1362 |
| 1261 | Ga0496126_0331694 | 3300048929 | Bacteria | 1248 |
| 1262 | Ga0496126_0407950 | 3300048929 | Bacteria | 1101 |
| 1263 | Ga0496126_0506979 | 3300048929 | Bacteria | 963 |
| 1264 | Ga0496126_0621102 | 3300048929 | Bacteria | 849 |
| 1265 | Ga0501031_0003098 | 3300049568 | Bacteria | 10649 |
| 1266 | Ga0501031_0032790 | 3300049568 | Bacteria | 3387 |
| 1267 | Ga0501031_0112423 | 3300049568 | Bacteria | 1778 |
| 1268 | Ga0501032_0000198 | 3300049569 | Bacteria | 50120 |
| 1269 | Ga0501032_0054807 | 3300049569 | Bacteria | 2683 |
| 1270 | Ga0501033_0000091 | 3300049570 | Bacteria | 85666 |
| 1271 | Ga0501033_0076980 | 3300049570 | Bacteria | 2448 |
| 1272 | Ga0501033_0354966 | 3300049570 | Bacteria | 1026 |
| 1273 | Ga0501033_0572433 | 3300049570 | Bacteria | 777 |
| 1274 | Ga0501034_0000039 | 3300049571 | Bacteria | 237357 |
| 1275 | Ga0501034_0253035 | 3300049571 | Bacteria | 1706 |
| 1276 | Ga0501034_0339341 | 3300049571 | Bacteria | 1433 |
| 1277 | Ga0501034_0440586 | 3300049571 | Bacteria | 1221 |
| 1278 | Ga0501034_0472743 | 3300049571 | Bacteria | 1169 |
| 1279 | Ga0501034_0506556 | 3300049571 | Bacteria | 1120 |
| 1280 | Ga0501036_0000347 | 3300049572 | Bacteria | 32588 |
| 1281 | Ga0501037_0000025 | 3300049573 | Bacteria | 143276 |
| 1282 | Ga0501037_0461997 | 3300049573 | Bacteria | 865 |
| 1283 | Ga0501038_0002497 | 3300049574 | Bacteria | 17114 |
| 1284 | Ga0501038_0029365 | 3300049574 | Bacteria | 4874 |
| 1285 | Ga0501038_0531730 | 3300049574 | Bacteria | 896 |
| 1286 | Ga0501039_0004443 | 3300049575 | Bacteria | 10584 |
| 1287 | Ga0501041_0263495 | 3300049577 | Bacteria | 1084 |
| 1288 | Ga0501041_0472345 | 3300049577 | Bacteria | 797 |
| 1289 | Ga0501043_0000233 | 3300049579 | Bacteria | 50329 |
| 1290 | Ga0501046_0000995 | 3300049580 | Bacteria | 27709 |
| 1291 | Ga0501046_0241526 | 3300049580 | Bacteria | 1332 |
| 1292 | Ga0501046_0281836 | 3300049580 | Bacteria | 1217 |
| 1293 | Ga0501047_0004251 | 3300049581 | Bacteria | 13481 |
| 1294 | Ga0501047_0098158 | 3300049581 | Bacteria | 2808 |
| 1295 | Ga0501047_0119159 | 3300049581 | Bacteria | 2521 |
| 1296 | Ga0501047_0156948 | 3300049581 | Bacteria | 2149 |
| 1297 | Ga0501047_0351056 | 3300049581 | Bacteria | 1312 |
| 1298 | Ga0501048_0000218 | 3300049582 | Bacteria | 37734 |
| 1299 | Ga0501048_0014866 | 3300049582 | Bacteria | 5755 |
| 1300 | Ga0501048_0420367 | 3300049582 | Bacteria | 956 |
| 1301 | Ga0501067_0004456 | 3300049583 | Bacteria | 7723 |
| 1302 | Ga0501068_0000785 | 3300049584 | Bacteria | 16408 |
| 1303 | Ga0501068_0459997 | 3300049584 | Bacteria | 824 |
| 1304 | Ga0501069_0000827 | 3300049585 | Bacteria | 14627 |
| 1305 | Ga0501070_0049607 | 3300049586 | Bacteria | 3485 |
| 1306 | Ga0501070_0156786 | 3300049586 | Bacteria | 1877 |
| 1307 | Ga0501070_0255997 | 3300049586 | Bacteria | 1431 |
| 1308 | Ga0501070_0299202 | 3300049586 | Bacteria | 1311 |
| 1309 | Ga0501071_0159587 | 3300049587 | Bacteria | 1685 |
| 1310 | Ga0501071_0452596 | 3300049587 | Bacteria | 983 |
| 1311 | Ga0501072_0007128 | 3300049588 | Bacteria | 8484 |
| 1312 | Ga0501072_0252575 | 3300049588 | Bacteria | 1404 |
| 1313 | Ga0501072_0489709 | 3300049588 | Bacteria | 973 |
| 1314 | Ga0501073_0000118 | 3300049589 | Bacteria | 50886 |
| 1315 | Ga0501074_0000273 | 3300049590 | Bacteria | 29590 |
| 1316 | Ga0501074_0041653 | 3300049590 | Bacteria | 3325 |
| 1317 | Ga0501076_0540342 | 3300049592 | Bacteria | 961 |
| 1318 | Ga0501079_0000590 | 3300049741 | Bacteria | 24020 |
| 1319 | Ga0501079_0115213 | 3300049741 | Bacteria | 2089 |
| 1320 | Ga0501079_0238472 | 3300049741 | Bacteria | 1421 |
| 1321 | Ga0501080_0000124 | 3300049742 | Bacteria | 54519 |
| 1322 | Ga0501080_0545977 | 3300049742 | Bacteria | 1032 |
| 1323 | Ga0501081_0242685 | 3300049743 | Bacteria | 1314 |
| 1324 | Ga0501081_0339329 | 3300049743 | Bacteria | 1106 |
| 1325 | Ga0501083_0000184 | 3300049744 | Bacteria | 40201 |
| 1326 | Ga0501083_0512726 | 3300049744 | Bacteria | 781 |
| 1327 | Ga0501035_0000052 | 3300049822 | Bacteria | 143038 |
| 1328 | Ga0501035_0107271 | 3300049822 | Bacteria | 2448 |
| 1329 | Ga0501035_0329775 | 3300049822 | Bacteria | 1281 |
| 1330 | Ga0501035_0507972 | 3300049822 | Bacteria | 991 |
| 1331 | Ga0501035_0638617 | 3300049822 | Bacteria | 864 |
| 1332 | Ga0501044_0001974 | 3300049823 | Bacteria | 23731 |
| 1333 | Ga0501044_0176467 | 3300049823 | Bacteria | 2105 |
| 1334 | Ga0501044_0199519 | 3300049823 | Bacteria | 1959 |
| 1335 | Ga0501044_0357662 | 3300049823 | Bacteria | 1378 |
| 1336 | Ga0501044_0375631 | 3300049823 | Bacteria | 1337 |
| 1337 | Ga0501044_0882526 | 3300049823 | Bacteria | 770 |
| 1338 | Ga0501045_0276165 | 3300049824 | Bacteria | 1251 |
| 1339 | Ga0501045_0588073 | 3300049824 | Bacteria | 825 |
| 1340 | nmdc:mga00v17_32928_c1 | 3300050491 | Bacteria | 3067 |
| 1341 | nmdc:mga0yw44_138752_c1 | 3300050492 | Bacteria | 1579 |
| 1342 | nmdc:mga0yw44_242569_c1 | 3300050492 | Bacteria | 1198 |
| 1343 | nmdc:mga0yw44_266_c1 | 3300050492 | Bacteria | 16414 |
| 1344 | nmdc:mga0yw44_45512_c1 | 3300050492 | Bacteria | 2631 |
| 1345 | nmdc:mga0k408_28756_c1 | 3300050493 | Bacteria | 3161 |
| 1346 | nmdc:mga0k408_70684_c1 | 3300050493 | Bacteria | 2037 |
| 1347 | nmdc:mga06z11_101576_c1 | 3300050494 | Bacteria | 1579 |
| 1348 | nmdc:mga06z11_370749_c1 | 3300050494 | Bacteria | 859 |
| 1349 | nmdc:mga06z11_48738_c1 | 3300050494 | Bacteria | 2158 |
| 1350 | nmdc:mga04h51_12410_c1 | 3300050495 | Bacteria | 2391 |
| 1351 | nmdc:mga07m45_332203_c1 | 3300050496 | Bacteria | 883 |
| 1352 | nmdc:mga07m45_7786_c1 | 3300050496 | Bacteria | 5483 |
| 1353 | nmdc:mga07m45_92436_c1 | 3300050496 | Bacteria | 1734 |
| 1354 | nmdc:mga05p37_142001_c1 | 3300050507 | Bacteria | 2941 |
| 1355 | nmdc:mga05p37_52588_c1 | 3300050507 | Bacteria | 5007 |
| 1356 | nmdc:mga05p37_652791_c1 | 3300050507 | Bacteria | 1178 |
| 1357 | nmdc:mga09592_238222_c1 | 3300050508 | Bacteria | 1576 |
| 1358 | nmdc:mga09592_573415_c1 | 3300050508 | Bacteria | 968 |
| 1359 | nmdc:mga09592_7795_c1 | 3300050508 | Bacteria | 8702 |
| 1360 | nmdc:mga0qj67_362895_c1 | 3300050509 | Bacteria | 1170 |
| 1361 | nmdc:mga0qj67_639523_c1 | 3300050509 | Bacteria | 849 |
| 1362 | nmdc:mga08y16_121155_c1 | 3300050511 | Bacteria | 2722 |
| 1363 | nmdc:mga08y16_15302_c1 | 3300050511 | Bacteria | 8071 |
| 1364 | nmdc:mga08y16_177278_c1 | 3300050511 | Bacteria | 2213 |
| 1365 | nmdc:mga08y16_381937_c1 | 3300050511 | Bacteria | 1444 |
| 1366 | nmdc:mga0n895_58310_c1 | 3300050512 | Bacteria | 3806 |
| 1367 | nmdc:mga0n895_94897_c1 | 3300050512 | Bacteria | 2987 |
| 1368 | nmdc:mga0sz30_114179_c1 | 3300050516 | Bacteria | 1185 |
| 1369 | Ga0495601_0166918 | 3300053077 | Bacteria | 1438 |
| 1370 | Ga0495601_0302551 | 3300053077 | Bacteria | 1042 |
| 1371 | Ga0495612_0009808 | 3300053078 | Bacteria | 3879 |
| 1372 | Ga0500635_0005505 | 3300053080 | Bacteria | 3327 |
| 1373 | Ga0500635_0102030 | 3300053080 | Bacteria | 1056 |
| 1374 | Ga0495655_0054323 | 3300053083 | Bacteria | 1071 |
| 1375 | Ga0495595_0002792 | 3300053084 | Bacteria | 6866 |
| 1376 | Ga0495619_0001159 | 3300053085 | Bacteria | 17308 |
| 1377 | Ga0495619_0388233 | 3300053085 | Bacteria | 965 |
| 1378 | Ga0495619_0454592 | 3300053085 | Bacteria | 883 |
| 1379 | Ga0500578_0180763 | 3300053086 | Bacteria | 1300 |
| 1380 | Ga0500643_000069 | 3300053087 | Bacteria | 116366 |
| 1381 | Ga0500646_0072983 | 3300053090 | Bacteria | 1033 |
| 1382 | Ga0500646_0110759 | 3300053090 | Bacteria | 873 |
| 1383 | Ga0500647_0070316 | 3300053091 | Bacteria | 1683 |
| 1384 | Ga0500583_0049077 | 3300053092 | Bacteria | 1951 |
| 1385 | Ga0500583_0163471 | 3300053092 | Bacteria | 1109 |
| 1386 | Ga0500651_0132251 | 3300053093 | Bacteria | 1508 |
| 1387 | Ga0500651_0227351 | 3300053093 | Bacteria | 1092 |
| 1388 | Ga0500566_0000112 | 3300053094 | Bacteria | 41687 |
| 1389 | Ga0500566_0002752 | 3300053094 | Bacteria | 10478 |
| 1390 | Ga0500566_0125526 | 3300053094 | Bacteria | 1379 |
| 1391 | Ga0500566_0372327 | 3300053094 | Bacteria | 648 |
| 1392 | Ga0500640_011906 | 3300053095 | Bacteria | 3558 |
| 1393 | Ga0500640_029224 | 3300053095 | Bacteria | 2409 |
| 1394 | Ga0500641_0017803 | 3300053096 | Bacteria | 2664 |
| 1395 | Ga0500641_0120070 | 3300053096 | Bacteria | 1133 |
| 1396 | Ga0500641_0164625 | 3300053096 | Bacteria | 956 |
| 1397 | Ga0500641_0236238 | 3300053096 | Bacteria | 771 |
| 1398 | Ga0500650_0095005 | 3300053098 | Bacteria | 1396 |
| 1399 | Ga0500650_0268134 | 3300053098 | Bacteria | 762 |
| 1400 | Ga0500554_003067 | 3300053102 | Bacteria | 3370 |
| 1401 | Ga0500556_0068287 | 3300053104 | Bacteria | 1323 |
| 1402 | Ga0500557_000003 | 3300053105 | Bacteria | 228429 |
| 1403 | Ga0500562_001366 | 3300053108 | Bacteria | 6024 |
| 1404 | Ga0500569_150283 | 3300053109 | Bacteria | 785 |
| 1405 | Ga0500569_161765 | 3300053109 | Bacteria | 758 |
| 1406 | Ga0500572_001913 | 3300053111 | Bacteria | 5226 |
| 1407 | Ga0500592_015608 | 3300053116 | Bacteria | 1220 |
| 1408 | Ga0500595_002897 | 3300053119 | Bacteria | 8221 |
| 1409 | Ga0500595_004648 | 3300053119 | Bacteria | 6117 |
| 1410 | Ga0500595_028812 | 3300053119 | Bacteria | 1890 |
| 1411 | Ga0500595_029794 | 3300053119 | Bacteria | 1847 |
| 1412 | Ga0500595_034082 | 3300053119 | Bacteria | 1686 |
| 1413 | Ga0500595_037812 | 3300053119 | Bacteria | 1572 |
| 1414 | Ga0500642_0050838 | 3300053130 | Bacteria | 1829 |
| 1415 | Ga0500642_0151065 | 3300053130 | Bacteria | 1090 |
| 1416 | Ga0500658_0016766 | 3300053134 | Bacteria | 2731 |
| 1417 | Ga0500658_0412285 | 3300053134 | Bacteria | 618 |
| 1418 | Ga0500559_0007921 | 3300053136 | Bacteria | 4685 |
| 1419 | Ga0500559_0083047 | 3300053136 | Bacteria | 1458 |
| 1420 | Ga0500568_0012571 | 3300053139 | Bacteria | 3886 |
| 1421 | Ga0500568_0022119 | 3300053139 | Bacteria | 2727 |
| 1422 | Ga0500577_0122624 | 3300053142 | Bacteria | 1083 |
| 1423 | Ga0500588_0051173 | 3300053146 | Bacteria | 1288 |
| 1424 | Ga0500590_085681 | 3300053148 | Bacteria | 1539 |
| 1425 | Ga0500590_104628 | 3300053148 | Bacteria | 1353 |
| 1426 | Ga0500590_154222 | 3300053148 | Bacteria | 1032 |
| 1427 | Ga0500603_000314 | 3300053150 | Bacteria | 12721 |
| 1428 | Ga0500603_000747 | 3300053150 | Bacteria | 7921 |
| 1429 | Ga0500604_0053025 | 3300053151 | Bacteria | 1257 |
| 1430 | Ga0500622_0046733 | 3300053156 | Bacteria | 2237 |
| 1431 | Ga0500622_0145377 | 3300053156 | Bacteria | 1126 |
| 1432 | Ga0500627_0038837 | 3300053158 | Bacteria | 2037 |
| 1433 | Ga0500627_0170721 | 3300053158 | Bacteria | 980 |
| 1434 | Ga0500630_001943 | 3300053159 | Bacteria | 9925 |
| 1435 | Ga0500633_0066613 | 3300053160 | Bacteria | 1278 |
| 1436 | Ga0500638_006964 | 3300053162 | Bacteria | 4685 |
| 1437 | Ga0500638_044881 | 3300053162 | Bacteria | 2145 |
| 1438 | Ga0500639_000357 | 3300053163 | Bacteria | 22540 |
| 1439 | Ga0500636_0000286 | 3300053177 | Bacteria | 27858 |
| 1440 | Ga0500636_0098736 | 3300053177 | Bacteria | 1663 |
| 1441 | Ga0500636_0249611 | 3300053177 | Bacteria | 905 |
| 1442 | Ga0500637_0182883 | 3300053178 | Bacteria | 1200 |
| 1443 | Ga0500649_180359 | 3300053722 | Bacteria | 714 |
| 1444 | Ga0500570_071677 | 3300053724 | Bacteria | 1613 |
| 1445 | Ga0500611_053734 | 3300053727 | Bacteria | 932 |
| 1446 | Ga0500625_005539 | 3300053729 | Bacteria | 5289 |
| 1447 | Ga0500625_154897 | 3300053729 | Bacteria | 854 |
| 1448 | Ga0500645_051386 | 3300053730 | Bacteria | 1202 |
| 1449 | Ga0500552_001281 | 3300053733 | Bacteria | 2387 |
| 1450 | Ga0500596_001208 | 3300053735 | Bacteria | 5218 |
| 1451 | Ga0500601_000736 | 3300053737 | Bacteria | 4272 |
| 1452 | Ga0501084_0002419 | 3300054114 | Bacteria | 15019 |
| 1453 | Ga0501084_0057287 | 3300054114 | Bacteria | 3261 |
| 1454 | Ga0501084_0371387 | 3300054114 | Bacteria | 1209 |
| 1455 | Ga0501082_0000457 | 3300060353 | Bacteria | 36134 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009147 | Ga0114129_10125747 | Ga0114129_101257475 | 169 |
| 2 | 3300009551 | Ga0105238_10576969 | Ga0105238_105769691 | 169 |
| 3 | 3300048915 | Ga0496112_0021176 | Ga0496112_0021176_2108_2752 | 169 |
| 4 | 3300050507 | nmdc:mga05p37_52588_c1 | nmdc:mga05p37_52588_c1_3802_4314 | 169 |
| 5 | iso_pu_bacteria | 2839993093 | 2839998417 | 172 |
| 6 | iso_pu_bacteria | 2871451962 | 2871455688 | 172 |
| 7 | 3300005985 | Ga0081539_10000072 | Ga0081539_1000007244 | 173 |
| 8 | 3300035170 | Ga0373943_0458474 | Ga0373943_0458474_50_601 | 173 |
| 9 | 3300035692 | Ga0373935_0041267 | Ga0373935_0041267_2057_2608 | 173 |
| 10 | 3300035695 | Ga0373927_0014802 | Ga0373927_0014802_2109_2660 | 173 |
| 11 | 3300037068 | Ga0373925_0159804 | Ga0373925_0159804_26_577 | 173 |
| 12 | 3300037853 | Ga0436364_0253351 | Ga0436364_0253351_23937_24488 | 173 |
| 13 | 3300026121 | Ga0207683_10408897 | Ga0207683_104088971 | 174 |
| 14 | 3300035118 | Ga0373954_0009270 | Ga0373954_0009270_394_918 | 174 |
| 15 | 3300035119 | Ga0373956_0009916 | Ga0373956_0009916_1738_2262 | 174 |
| 16 | 3300035724 | Ga0373933_0020123 | Ga0373933_0020123_62_586 | 174 |
| 17 | 3300036401 | Ga0373937_0010610 | Ga0373937_0010610_3925_4449 | 174 |
| 18 | 3300046454 | Ga0495592_0011800 | Ga0495592_0011800_45_569 | 174 |
| 19 | 3300046477 | Ga0495664_0009821 | Ga0495664_0009821_4412_4936 | 174 |
| 20 | 3300046533 | Ga0495640_0002839 | Ga0495640_0002839_7990_8514 | 174 |
| 21 | 3300046535 | Ga0495586_0016426 | Ga0495586_0016426_419_943 | 174 |
| 22 | 3300046678 | Ga0495599_0023759 | Ga0495599_0023759_45_569 | 174 |
| 23 | 3300046679 | Ga0495623_0022851 | Ga0495623_0022851_3446_3970 | 174 |
| 24 | 3300047471 | Ga0495684_0044470 | Ga0495684_0044470_1275_1799 | 174 |
| 25 | 3300048088 | Ga0495602_0017651 | Ga0495602_0017651_33_557 | 174 |
| 26 | 3300005338 | Ga0068868_100431979 | Ga0068868_1004319792 | 175 |
| 27 | 3300005719 | Ga0068861_100633016 | Ga0068861_1006330162 | 175 |
| 28 | 3300006237 | Ga0097621_100270350 | Ga0097621_1002703503 | 175 |
| 29 | 3300006846 | Ga0075430_100265099 | Ga0075430_1002650992 | 175 |
| 30 | 3300006881 | Ga0068865_100221282 | Ga0068865_1002212822 | 175 |
| 31 | 3300009098 | Ga0105245_11453011 | Ga0105245_114530112 | 175 |
| 32 | 3300009177 | Ga0105248_10706575 | Ga0105248_107065752 | 175 |
| 33 | 3300009551 | Ga0105238_10034351 | Ga0105238_100343513 | 175 |
| 34 | 3300013297 | Ga0157378_10071194 | Ga0157378_100711943 | 175 |
| 35 | 3300025927 | Ga0207687_10706428 | Ga0207687_107064282 | 175 |
| 36 | 3300025938 | Ga0207704_10170929 | Ga0207704_101709292 | 175 |
| 37 | 3300026023 | Ga0207677_10529499 | Ga0207677_105294992 | 175 |
| 38 | 3300031238 | Ga0265332_10001601 | Ga0265332_100016014 | 175 |
| 39 | 3300031901 | Ga0307406_10072182 | Ga0307406_100721821 | 175 |
| 40 | 3300032002 | Ga0307416_100288558 | Ga0307416_1002885581 | 175 |
| 41 | 3300032126 | Ga0307415_100296861 | Ga0307415_1002968612 | 175 |
| 42 | 3300002076 | JGI24749J21850_1027053 | JGI24749J21850_10270531 | 176 |
| 43 | 3300005290 | Ga0065712_10031307 | Ga0065712_100313071 | 176 |
| 44 | 3300005327 | Ga0070658_10001665 | Ga0070658_100016654 | 176 |
| 45 | 3300005328 | Ga0070676_10631456 | Ga0070676_106314561 | 176 |
| 46 | 3300005329 | Ga0070683_100445869 | Ga0070683_1004458692 | 176 |
| 47 | 3300005330 | Ga0070690_100072362 | Ga0070690_1000723623 | 176 |
| 48 | 3300005334 | Ga0068869_100268730 | Ga0068869_1002687301 | 176 |
| 49 | 3300005336 | Ga0070680_100000866 | Ga0070680_1000008669 | 176 |
| 50 | 3300005338 | Ga0068868_100089912 | Ga0068868_1000899122 | 176 |
| 51 | 3300005340 | Ga0070689_100087421 | Ga0070689_1000874212 | 176 |
| 52 | 3300005345 | Ga0070692_10033354 | Ga0070692_100333543 | 176 |
| 53 | 3300005347 | Ga0070668_100111293 | Ga0070668_1001112932 | 176 |
| 54 | 3300005355 | Ga0070671_100176438 | Ga0070671_1001764382 | 176 |
| 55 | 3300005356 | Ga0070674_100076912 | Ga0070674_1000769122 | 176 |
| 56 | 3300005364 | Ga0070673_100282428 | Ga0070673_1002824282 | 176 |
| 57 | 3300005365 | Ga0070688_100005226 | Ga0070688_1000052266 | 176 |
| 58 | 3300005366 | Ga0070659_100328689 | Ga0070659_1003286892 | 176 |
| 59 | 3300005367 | Ga0070667_100195022 | Ga0070667_1001950221 | 176 |
| 60 | 3300005438 | Ga0070701_10042104 | Ga0070701_100421042 | 176 |
| 61 | 3300005456 | Ga0070678_100335420 | Ga0070678_1003354201 | 176 |
| 62 | 3300005457 | Ga0070662_100691147 | Ga0070662_1006911472 | 176 |
| 63 | 3300005458 | Ga0070681_10002083 | Ga0070681_1000208313 | 176 |
| 64 | 3300005459 | Ga0068867_100151066 | Ga0068867_1001510662 | 176 |
| 65 | 3300005466 | Ga0070685_10323863 | Ga0070685_103238631 | 176 |
| 66 | 3300005467 | Ga0070706_100203771 | Ga0070706_1002037711 | 176 |
| 67 | 3300005530 | Ga0070679_100008178 | Ga0070679_1000081786 | 176 |
| 68 | 3300005539 | Ga0068853_100439890 | Ga0068853_1004398902 | 176 |
| 69 | 3300005539 | Ga0068853_101509363 | Ga0068853_1015093631 | 176 |
| 70 | 3300005543 | Ga0070672_100250216 | Ga0070672_1002502162 | 176 |
| 71 | 3300005544 | Ga0070686_100210095 | Ga0070686_1002100951 | 176 |
| 72 | 3300005548 | Ga0070665_100616170 | Ga0070665_1006161702 | 176 |
| 73 | 3300005549 | Ga0070704_100374564 | Ga0070704_1003745642 | 176 |
| 74 | 3300005563 | Ga0068855_100006305 | Ga0068855_1000063056 | 176 |
| 75 | 3300005577 | Ga0068857_100312135 | Ga0068857_1003121352 | 176 |
| 76 | 3300005614 | Ga0068856_100395192 | Ga0068856_1003951922 | 176 |
| 77 | 3300005615 | Ga0070702_100049264 | Ga0070702_1000492642 | 176 |
| 78 | 3300005718 | Ga0068866_10111089 | Ga0068866_101110891 | 176 |
| 79 | 3300005719 | Ga0068861_100016572 | Ga0068861_1000165722 | 176 |
| 80 | 3300005719 | Ga0068861_101179001 | Ga0068861_1011790012 | 176 |
| 81 | 3300005840 | Ga0068870_10130231 | Ga0068870_101302311 | 176 |
| 82 | 3300005841 | Ga0068863_100588667 | Ga0068863_1005886672 | 176 |
| 83 | 3300005844 | Ga0068862_100446376 | Ga0068862_1004463762 | 176 |
| 84 | 3300006237 | Ga0097621_100196925 | Ga0097621_1001969252 | 176 |
| 85 | 3300006358 | Ga0068871_100146132 | Ga0068871_1001461322 | 176 |
| 86 | 3300006881 | Ga0068865_100447258 | Ga0068865_1004472582 | 176 |
| 87 | 3300009093 | Ga0105240_10006650 | Ga0105240_1000665016 | 176 |
| 88 | 3300009093 | Ga0105240_10454079 | Ga0105240_104540792 | 176 |
| 89 | 3300009094 | Ga0111539_10003570 | Ga0111539_1000357016 | 176 |
| 90 | 3300009094 | Ga0111539_10086432 | Ga0111539_100864323 | 176 |
| 91 | 3300009094 | Ga0111539_10148109 | Ga0111539_101481093 | 176 |
| 92 | 3300009098 | Ga0105245_10193843 | Ga0105245_101938433 | 176 |
| 93 | 3300009147 | Ga0114129_10829090 | Ga0114129_108290902 | 176 |
| 94 | 3300009148 | Ga0105243_10228334 | Ga0105243_102283343 | 176 |
| 95 | 3300009176 | Ga0105242_10116929 | Ga0105242_101169292 | 176 |
| 96 | 3300009545 | Ga0105237_10051706 | Ga0105237_100517062 | 176 |
| 97 | 3300009545 | Ga0105237_10485619 | Ga0105237_104856192 | 176 |
| 98 | 3300009553 | Ga0105249_10743319 | Ga0105249_107433192 | 176 |
| 99 | 3300013102 | Ga0157371_10022069 | Ga0157371_100220694 | 176 |
| 100 | 3300013104 | Ga0157370_10003007 | Ga0157370_1000300714 | 176 |
| 101 | 3300013105 | Ga0157369_10310892 | Ga0157369_103108922 | 176 |
| 102 | 3300013296 | Ga0157374_10183720 | Ga0157374_101837202 | 176 |
| 103 | 3300013297 | Ga0157378_10061196 | Ga0157378_100611964 | 176 |
| 104 | 3300013297 | Ga0157378_10321782 | Ga0157378_103217822 | 176 |
| 105 | 3300013306 | Ga0163162_11205287 | Ga0163162_112052871 | 176 |
| 106 | 3300013306 | Ga0163162_11369024 | Ga0163162_113690242 | 176 |
| 107 | 3300013308 | Ga0157375_10723219 | Ga0157375_107232192 | 176 |
| 108 | 3300014326 | Ga0157380_10268990 | Ga0157380_102689902 | 176 |
| 109 | 3300014745 | Ga0157377_10065182 | Ga0157377_100651821 | 176 |
| 110 | 3300014969 | Ga0157376_10581333 | Ga0157376_105813332 | 176 |
| 111 | 3300020070 | Ga0206356_11765100 | Ga0206356_117651002 | 176 |
| 112 | 3300025315 | Ga0207697_10024723 | Ga0207697_100247232 | 176 |
| 113 | 3300025893 | Ga0207682_10023362 | Ga0207682_100233623 | 176 |
| 114 | 3300025899 | Ga0207642_10087351 | Ga0207642_100873513 | 176 |
| 115 | 3300025901 | Ga0207688_10010703 | Ga0207688_100107035 | 176 |
| 116 | 3300025903 | Ga0207680_10062786 | Ga0207680_100627862 | 176 |
| 117 | 3300025907 | Ga0207645_10003034 | Ga0207645_100030343 | 176 |
| 118 | 3300025908 | Ga0207643_10083232 | Ga0207643_100832322 | 176 |
| 119 | 3300025908 | Ga0207643_10123359 | Ga0207643_101233591 | 176 |
| 120 | 3300025909 | Ga0207705_10052000 | Ga0207705_100520003 | 176 |
| 121 | 3300025909 | Ga0207705_11043729 | Ga0207705_110437291 | 176 |
| 122 | 3300025912 | Ga0207707_10002335 | Ga0207707_100023358 | 176 |
| 123 | 3300025913 | Ga0207695_10025550 | Ga0207695_100255503 | 176 |
| 124 | 3300025913 | Ga0207695_10339889 | Ga0207695_103398892 | 176 |
| 125 | 3300025917 | Ga0207660_10001403 | Ga0207660_100014034 | 176 |
| 126 | 3300025921 | Ga0207652_10004802 | Ga0207652_100048026 | 176 |
| 127 | 3300025923 | Ga0207681_10406526 | Ga0207681_104065261 | 176 |
| 128 | 3300025926 | Ga0207659_10332058 | Ga0207659_103320582 | 176 |
| 129 | 3300025931 | Ga0207644_10077187 | Ga0207644_100771872 | 176 |
| 130 | 3300025932 | Ga0207690_10471764 | Ga0207690_104717642 | 176 |
| 131 | 3300025935 | Ga0207709_10194207 | Ga0207709_101942072 | 176 |
| 132 | 3300025937 | Ga0207669_10193128 | Ga0207669_101931282 | 176 |
| 133 | 3300025940 | Ga0207691_10097500 | Ga0207691_100975003 | 176 |
| 134 | 3300025941 | Ga0207711_10207208 | Ga0207711_102072082 | 176 |
| 135 | 3300025942 | Ga0207689_10135366 | Ga0207689_101353662 | 176 |
| 136 | 3300025944 | Ga0207661_10370450 | Ga0207661_103704502 | 176 |
| 137 | 3300025949 | Ga0207667_10007040 | Ga0207667_100070403 | 176 |
| 138 | 3300025961 | Ga0207712_10122062 | Ga0207712_101220622 | 176 |
| 139 | 3300025972 | Ga0207668_10116175 | Ga0207668_101161752 | 176 |
| 140 | 3300025986 | Ga0207658_10991182 | Ga0207658_109911822 | 176 |
| 141 | 3300026023 | Ga0207677_10430357 | Ga0207677_104303572 | 176 |
| 142 | 3300026041 | Ga0207639_10127978 | Ga0207639_101279782 | 176 |
| 143 | 3300026067 | Ga0207678_10083398 | Ga0207678_100833982 | 176 |
| 144 | 3300026075 | Ga0207708_10002913 | Ga0207708_1000291311 | 176 |
| 145 | 3300026078 | Ga0207702_10333030 | Ga0207702_103330302 | 176 |
| 146 | 3300026088 | Ga0207641_10452139 | Ga0207641_104521392 | 176 |
| 147 | 3300026088 | Ga0207641_11318166 | Ga0207641_113181662 | 176 |
| 148 | 3300026089 | Ga0207648_10111364 | Ga0207648_101113642 | 176 |
| 149 | 3300026095 | Ga0207676_10672794 | Ga0207676_106727942 | 176 |
| 150 | 3300026116 | Ga0207674_10097487 | Ga0207674_100974873 | 176 |
| 151 | 3300026118 | Ga0207675_100154152 | Ga0207675_1001541522 | 176 |
| 152 | 3300026121 | Ga0207683_10018187 | Ga0207683_100181872 | 176 |
| 153 | 3300026142 | Ga0207698_10078782 | Ga0207698_100787822 | 176 |
| 154 | 3300027876 | Ga0209974_10021441 | Ga0209974_100214413 | 176 |
| 155 | 3300027907 | Ga0207428_10390444 | Ga0207428_103904442 | 176 |
| 156 | 3300028379 | Ga0268266_10092360 | Ga0268266_100923603 | 176 |
| 157 | 3300028379 | Ga0268266_10891614 | Ga0268266_108916142 | 176 |
| 158 | 3300028380 | Ga0268265_10216282 | Ga0268265_102162823 | 176 |
| 159 | 3300028381 | Ga0268264_10244025 | Ga0268264_102440252 | 176 |
| 160 | 3300028577 | Ga0265318_10011813 | Ga0265318_100118132 | 176 |
| 161 | 3300031235 | Ga0265330_10030658 | Ga0265330_100306582 | 176 |
| 162 | 3300031239 | Ga0265328_10002807 | Ga0265328_100028074 | 176 |
| 163 | 3300031240 | Ga0265320_10018545 | Ga0265320_100185454 | 176 |
| 164 | 3300031242 | Ga0265329_10039885 | Ga0265329_100398853 | 176 |
| 165 | 3300031247 | Ga0265340_10356768 | Ga0265340_103567681 | 176 |
| 166 | 3300031250 | Ga0265331_10002014 | Ga0265331_1000201410 | 176 |
| 167 | 3300031344 | Ga0265316_10285113 | Ga0265316_102851131 | 176 |
| 168 | 3300031344 | Ga0265316_10442876 | Ga0265316_104428762 | 176 |
| 169 | 3300031711 | Ga0265314_10000720 | Ga0265314_1000072025 | 176 |
| 170 | 3300031712 | Ga0265342_10007374 | Ga0265342_100073745 | 176 |
| 171 | 3300036401 | Ga0373937_0065077 | Ga0373937_0065077_2205_2735 | 176 |
| 172 | 3300038443 | Ga0395901_0465594 | Ga0395901_0465594_153_698 | 176 |
| 173 | 3300046454 | Ga0495592_0667153 | Ga0495592_0667153_84_614 | 176 |
| 174 | 3300046460 | Ga0495638_0405853 | Ga0495638_0405853_134_664 | 176 |
| 175 | 3300046528 | Ga0495642_0115543 | Ga0495642_0115543_596_1126 | 176 |
| 176 | 3300046559 | Ga0495667_0270286 | Ga0495667_0270286_219_749 | 176 |
| 177 | 3300046675 | Ga0495657_0135604 | Ga0495657_0135604_299_829 | 176 |
| 178 | 3300047317 | Ga0495604_0488465 | Ga0495604_0488465_163_693 | 176 |
| 179 | 3300047320 | Ga0495672_0059938 | Ga0495672_0059938_1068_1625 | 176 |
| 180 | 3300047322 | Ga0495680_0150989 | Ga0495680_0150989_399_929 | 176 |
| 181 | 3300047472 | Ga0495686_0319020 | Ga0495686_0319020_174_704 | 176 |
| 182 | 3300048907 | Ga0496104_0030806 | Ga0496104_0030806_1649_2182 | 176 |
| 183 | 3300048908 | Ga0496105_0003634 | Ga0496105_0003634_858_1391 | 176 |
| 184 | 3300048911 | Ga0496108_0111129 | Ga0496108_0111129_1257_1787 | 176 |
| 185 | 3300048915 | Ga0496112_0061659 | Ga0496112_0061659_2065_2598 | 176 |
| 186 | 3300048916 | Ga0496113_0073010 | Ga0496113_0073010_1759_2292 | 176 |
| 187 | 3300048917 | Ga0496114_0387592 | Ga0496114_0387592_414_947 | 176 |
| 188 | 3300048918 | Ga0496115_0020404 | Ga0496115_0020404_2416_3033 | 176 |
| 189 | 3300048918 | Ga0496115_0078942 | Ga0496115_0078942_954_1487 | 176 |
| 190 | 3300048918 | Ga0496115_0841450 | Ga0496115_0841450_31_576 | 176 |
| 191 | 3300048919 | Ga0496116_0331715 | Ga0496116_0331715_81_611 | 176 |
| 192 | 3300048920 | Ga0496117_0149557 | Ga0496117_0149557_624_1154 | 176 |
| 193 | 3300048922 | Ga0496119_0135227 | Ga0496119_0135227_185_721 | 176 |
| 194 | 3300048922 | Ga0496119_0136853 | Ga0496119_0136853_485_1015 | 176 |
| 195 | 3300048927 | Ga0496124_0170991 | Ga0496124_0170991_926_1462 | 176 |
| 196 | 3300048928 | Ga0496125_0446737 | Ga0496125_0446737_194_724 | 176 |
| 197 | 3300048929 | Ga0496126_0407950 | Ga0496126_0407950_131_661 | 176 |
| 198 | 3300049571 | Ga0501034_0339341 | Ga0501034_0339341_320_850 | 176 |
| 199 | 3300049577 | Ga0501041_0263495 | Ga0501041_0263495_39_599 | 176 |
| 200 | 3300049582 | Ga0501048_0420367 | Ga0501048_0420367_358_918 | 176 |
| 201 | 3300049587 | Ga0501071_0452596 | Ga0501071_0452596_252_812 | 176 |
| 202 | 3300049588 | Ga0501072_0489709 | Ga0501072_0489709_15_575 | 176 |
| 203 | 3300049592 | Ga0501076_0540342 | Ga0501076_0540342_161_721 | 176 |
| 204 | 3300049743 | Ga0501081_0242685 | Ga0501081_0242685_55_615 | 176 |
| 205 | 3300049824 | Ga0501045_0588073 | Ga0501045_0588073_153_713 | 176 |
| 206 | 3300050507 | nmdc:mga05p37_652791_c1 | nmdc:mga05p37_652791_c1_180_710 | 176 |
| 207 | 3300050508 | nmdc:mga09592_238222_c1 | nmdc:mga09592_238222_c1_543_1073 | 176 |
| 208 | 3300050508 | nmdc:mga09592_7795_c1 | nmdc:mga09592_7795_c1_4008_4538 | 176 |
| 209 | 3300050511 | nmdc:mga08y16_121155_c1 | nmdc:mga08y16_121155_c1_1028_1558 | 176 |
| 210 | 3300050511 | nmdc:mga08y16_15302_c1 | nmdc:mga08y16_15302_c1_945_1475 | 176 |
| 211 | 3300050511 | nmdc:mga08y16_177278_c1 | nmdc:mga08y16_177278_c1_1069_1599 | 176 |
| 212 | 3300053085 | Ga0495619_0388233 | Ga0495619_0388233_423_953 | 176 |
| 213 | 3300053086 | Ga0500578_0180763 | Ga0500578_0180763_178_708 | 176 |
| 214 | 3300053090 | Ga0500646_0110759 | Ga0500646_0110759_12_542 | 176 |
| 215 | 3300053092 | Ga0500583_0163471 | Ga0500583_0163471_59_589 | 176 |
| 216 | 3300053093 | Ga0500651_0132251 | Ga0500651_0132251_805_1335 | 176 |
| 217 | 3300053093 | Ga0500651_0227351 | Ga0500651_0227351_330_860 | 176 |
| 218 | 3300053096 | Ga0500641_0236238 | Ga0500641_0236238_58_588 | 176 |
| 219 | 3300053098 | Ga0500650_0095005 | Ga0500650_0095005_377_907 | 176 |
| 220 | 3300053116 | Ga0500592_015608 | Ga0500592_015608_527_1057 | 176 |
| 221 | 3300053119 | Ga0500595_004648 | Ga0500595_004648_3736_4266 | 176 |
| 222 | 3300053119 | Ga0500595_028812 | Ga0500595_028812_132_662 | 176 |
| 223 | 3300053130 | Ga0500642_0151065 | Ga0500642_0151065_414_944 | 176 |
| 224 | 3300053139 | Ga0500568_0022119 | Ga0500568_0022119_2043_2573 | 176 |
| 225 | 3300053156 | Ga0500622_0145377 | Ga0500622_0145377_335_865 | 176 |
| 226 | 3300053158 | Ga0500627_0038837 | Ga0500627_0038837_1108_1638 | 176 |
| 227 | 3300054114 | Ga0501084_0371387 | Ga0501084_0371387_126_686 | 176 |
| 228 | iso_pu_bacteria | 2507262055 | 2507507568 | 176 |
| 229 | iso_pu_bacteria | 2511231028 | 2511394864 | 176 |
| 230 | iso_pu_bacteria | 2513237092 | 2513621769 | 176 |
| 231 | iso_pu_bacteria | 2513237095 | 2513647609 | 176 |
| 232 | iso_pu_bacteria | 2513237102 | 2513701410 | 176 |
| 233 | iso_pu_bacteria | 2513237139 | 2513878736 | 176 |
| 234 | iso_pu_bacteria | 2513237161 | 2514009336 | 176 |
| 235 | iso_pu_bacteria | 2517093001 | 2517104253 | 176 |
| 236 | iso_pu_bacteria | 2617270735 | 2617346891 | 176 |
| 237 | iso_pu_bacteria | 2617270741 | 2617372822 | 176 |
| 238 | iso_pu_bacteria | 2791355196 | 2793060969 | 176 |
| 239 | iso_pu_bacteria | 2802429603 | 2805921385 | 176 |
| 240 | iso_pu_bacteria | 2816332527 | 2818236645 | 176 |
| 241 | iso_pu_bacteria | 2824617872 | 2824620513 | 176 |
| 242 | iso_pu_bacteria | 2824626560 | 2824628439 | 176 |
| 243 | iso_pu_bacteria | 2824635225 | 2824637139 | 176 |
| 244 | iso_pu_bacteria | 2824644064 | 2824650231 | 176 |
| 245 | iso_pu_bacteria | 2824661429 | 2824669918 | 176 |
| 246 | iso_pu_bacteria | 2824671348 | 2824673677 | 176 |
| 247 | iso_pu_bacteria | 2824679649 | 2824685159 | 176 |
| 248 | iso_pu_bacteria | 2824687955 | 2824690644 | 176 |
| 249 | iso_pu_bacteria | 2824696289 | 2824700845 | 176 |
| 250 | iso_pu_bacteria | 2824704595 | 2824709919 | 176 |
| 251 | iso_pu_bacteria | 2824714736 | 2824720064 | 176 |
| 252 | iso_pu_bacteria | 2824723954 | 2824730426 | 176 |
| 253 | iso_pu_bacteria | 2824732956 | 2824738160 | 176 |
| 254 | iso_pu_bacteria | 2824746037 | 2824748770 | 176 |
| 255 | iso_pu_bacteria | 2824753945 | 2824756076 | 176 |
| 256 | iso_pu_bacteria | 2824763712 | 2824767614 | 176 |
| 257 | iso_pu_bacteria | 2824773399 | 2824775032 | 176 |
| 258 | iso_pu_bacteria | 2838122688 | 2838129313 | 176 |
| 259 | iso_pu_bacteria | 2841941048 | 2841948030 | 176 |
| 260 | iso_pu_bacteria | 2841949485 | 2841953572 | 176 |
| 261 | iso_pu_bacteria | 2841957949 | 2841962830 | 176 |
| 262 | iso_pu_bacteria | 2841966195 | 2841973023 | 176 |
| 263 | iso_pu_bacteria | 2841974524 | 2841978300 | 176 |
| 264 | iso_pu_bacteria | 2841983080 | 2841990519 | 176 |
| 265 | iso_pu_bacteria | 2847930680 | 2847937415 | 176 |
| 266 | iso_pu_bacteria | 2847939898 | 2847947839 | 176 |
| 267 | iso_pu_bacteria | 2849076700 | 2849078303 | 176 |
| 268 | iso_pu_bacteria | 2857509624 | 2857512683 | 176 |
| 269 | iso_pu_bacteria | 2874620515 | 2874628171 | 176 |
| 270 | iso_pu_bacteria | 2879083081 | 2879086716 | 176 |
| 271 | iso_pu_bacteria | 2879099564 | 2879107805 | 176 |
| 272 | iso_pu_bacteria | 2881364244 | 2881371369 | 176 |
| 273 | iso_pu_bacteria | 2881665667 | 2881666676 | 176 |
| 274 | iso_pu_bacteria | 2885366525 | 2885370059 | 176 |
| 275 | iso_pu_bacteria | 2888378607 | 2888385546 | 176 |
| 276 | iso_pu_bacteria | 2888388044 | 2888392689 | 176 |
| 277 | iso_pu_bacteria | 2904666416 | 2904674211 | 176 |
| 278 | iso_pu_bacteria | 2904711408 | 2904711879 | 176 |
| 279 | iso_pu_bacteria | 2906626472 | 2906627690 | 176 |
| 280 | iso_pu_bacteria | 2908775508 | 2908781267 | 176 |
| 281 | iso_pu_bacteria | 2922368715 | 2922372309 | 176 |
| 282 | iso_pu_bacteria | 2922393267 | 2922396984 | 176 |
| 283 | iso_pu_bacteria | 2929615660 | 2929621119 | 176 |
| 284 | iso_pu_bacteria | 2929624759 | 2929626050 | 176 |
| 285 | iso_pu_bacteria | 2932784394 | 2932785076 | 176 |
| 286 | iso_pu_bacteria | 2932794094 | 2932795058 | 176 |
| 287 | iso_pu_bacteria | 2932801729 | 2932805586 | 176 |
| 288 | iso_pu_bacteria | 2932809354 | 2932810104 | 176 |
| 289 | iso_pu_bacteria | 2932818245 | 2932821678 | 176 |
| 290 | iso_pu_bacteria | 2932828146 | 2932828912 | 176 |
| 291 | iso_pu_bacteria | 2933577622 | 2933583011 | 176 |
| 292 | iso_pu_bacteria | 2935616580 | 2935619668 | 176 |
| 293 | iso_pu_bacteria | 2935638405 | 2935638648 | 176 |
| 294 | iso_pu_bacteria | 2935675223 | 2935676457 | 176 |
| 295 | iso_pu_bacteria | 2935684952 | 2935691027 | 176 |
| 296 | iso_pu_bacteria | 2935694250 | 2935694539 | 176 |
| 297 | iso_pu_bacteria | 2935703347 | 2935703654 | 176 |
| 298 | iso_pu_bacteria | 2935713505 | 2935718408 | 176 |
| 299 | iso_pu_bacteria | 2935722832 | 2935727612 | 176 |
| 300 | iso_pu_bacteria | 2935732158 | 2935736315 | 176 |
| 301 | iso_pu_bacteria | 2935741537 | 2935745695 | 176 |
| 302 | iso_pu_bacteria | 2935750917 | 2935756076 | 176 |
| 303 | iso_pu_bacteria | 2935760218 | 2935760664 | 176 |
| 304 | iso_pu_bacteria | 2935801545 | 2935801792 | 176 |
| 305 | iso_pu_bacteria | 2935810662 | 2935814793 | 176 |
| 306 | iso_pu_bacteria | 2935827899 | 2935828142 | 176 |
| 307 | iso_pu_bacteria | 2935837841 | 2935842347 | 176 |
| 308 | iso_pu_bacteria | 2935855204 | 2935858017 | 176 |
| 309 | iso_pu_bacteria | 2935864058 | 2935867921 | 176 |
| 310 | iso_pu_bacteria | 2935873716 | 2935874055 | 176 |
| 311 | iso_pu_bacteria | 2935959822 | 2935962811 | 176 |
| 312 | iso_pu_bacteria | 2935992306 | 2935993020 | 176 |
| 313 | iso_pu_bacteria | 2936002035 | 2936002932 | 176 |
| 314 | iso_pu_bacteria | 2936037263 | 2936040564 | 176 |
| 315 | iso_pu_bacteria | 2940556831 | 2940561949 | 176 |
| 316 | iso_pu_bacteria | 2941531003 | 2941531304 | 176 |
| 317 | iso_pu_bacteria | 2941538514 | 2941542396 | 176 |
| 318 | iso_pu_bacteria | 3005483717 | 3005485496 | 176 |
| 319 | iso_pu_bacteria | 3005506211 | 3005508345 | 176 |
| 320 | iso_pu_bacteria | 3005587118 | 3005588155 | 176 |
| 321 | iso_pu_bacteria | 3005594810 | 3005600408 | 176 |
| 322 | iso_pu_bacteria | 3005710791 | 3005715900 | 176 |
| 323 | iso_pu_bacteria | 3005718088 | 3005723257 | 176 |
| 324 | iso_pu_bacteria | 8016511872 | 8016520550 | 176 |
| 325 | iso_pu_bacteria | 8016583857 | 8016594459 | 176 |
| 326 | iso_pu_bacteria | 8017057580 | 8017065025 | 176 |
| 327 | iso_pu_bacteria | 8019576017 | 8019584405 | 176 |
| 328 | iso_pu_bacteria | 8019586578 | 8019592178 | 176 |
| 329 | iso_pu_bacteria | 8019597564 | 8019599103 | 176 |
| 330 | iso_pu_bacteria | 8019608314 | 8019609254 | 176 |
| 331 | iso_pu_bacteria | 8019648815 | 8019649462 | 176 |
| 332 | iso_pu_bacteria | 8055742211 | 8055745018 | 176 |
| 333 | 3300005337 | Ga0070682_100268758 | Ga0070682_1002687582 | 177 |
| 334 | 3300005340 | Ga0070689_100287320 | Ga0070689_1002873202 | 177 |
| 335 | 3300005344 | Ga0070661_100232425 | Ga0070661_1002324252 | 177 |
| 336 | 3300005347 | Ga0070668_100030774 | Ga0070668_1000307744 | 177 |
| 337 | 3300005356 | Ga0070674_100808845 | Ga0070674_1008088451 | 177 |
| 338 | 3300005365 | Ga0070688_100702752 | Ga0070688_1007027521 | 177 |
| 339 | 3300005535 | Ga0070684_100617640 | Ga0070684_1006176402 | 177 |
| 340 | 3300005539 | Ga0068853_100014119 | Ga0068853_1000141194 | 177 |
| 341 | 3300005547 | Ga0070693_100308268 | Ga0070693_1003082682 | 177 |
| 342 | 3300005841 | Ga0068863_100204103 | Ga0068863_1002041031 | 177 |
| 343 | 3300005843 | Ga0068860_100101194 | Ga0068860_1001011943 | 177 |
| 344 | 3300005844 | Ga0068862_100182231 | Ga0068862_1001822312 | 177 |
| 345 | 3300006931 | Ga0097620_101119457 | Ga0097620_1011194572 | 177 |
| 346 | 3300009551 | Ga0105238_10074082 | Ga0105238_100740823 | 177 |
| 347 | 3300014325 | Ga0163163_10003485 | Ga0163163_1000348511 | 177 |
| 348 | 3300014325 | Ga0163163_10563742 | Ga0163163_105637422 | 177 |
| 349 | 3300025900 | Ga0207710_10448879 | Ga0207710_104488791 | 177 |
| 350 | 3300025909 | Ga0207705_10902887 | Ga0207705_109028872 | 177 |
| 351 | 3300025920 | Ga0207649_10151677 | Ga0207649_101516771 | 177 |
| 352 | 3300026041 | Ga0207639_10038009 | Ga0207639_100380094 | 177 |
| 353 | 3300028380 | Ga0268265_10009993 | Ga0268265_100099936 | 177 |
| 354 | 3300031456 | Ga0307513_10611209 | Ga0307513_106112092 | 177 |
| 355 | 3300035725 | Ga0373947_0606714 | Ga0373947_0606714_148_708 | 177 |
| 356 | 3300039437 | Ga0436365_1295580 | Ga0436365_1295580_118_678 | 177 |
| 357 | 3300046492 | Ga0495585_0026425 | Ga0495585_0026425_1806_2369 | 177 |
| 358 | 3300046523 | Ga0495644_0059596 | Ga0495644_0059596_161_724 | 177 |
| 359 | 3300046539 | Ga0495621_0217536 | Ga0495621_0217536_73_636 | 177 |
| 360 | 3300046558 | Ga0495633_0053573 | Ga0495633_0053573_1120_1683 | 177 |
| 361 | 3300046648 | Ga0495611_0073357 | Ga0495611_0073357_281_844 | 177 |
| 362 | 3300046691 | Ga0495670_0011657 | Ga0495670_0011657_2497_3060 | 177 |
| 363 | 3300047318 | Ga0495636_0014658 | Ga0495636_0014658_2046_2609 | 177 |
| 364 | 3300048907 | Ga0496104_0009233 | Ga0496104_0009233_6758_7318 | 177 |
| 365 | 3300048908 | Ga0496105_0002418 | Ga0496105_0002418_6436_6996 | 177 |
| 366 | 3300048911 | Ga0496108_0011505 | Ga0496108_0011505_4513_5073 | 177 |
| 367 | 3300048912 | Ga0496109_0270310 | Ga0496109_0270310_888_1448 | 177 |
| 368 | 3300048912 | Ga0496109_0296681 | Ga0496109_0296681_619_1179 | 177 |
| 369 | 3300048913 | Ga0496110_0024962 | Ga0496110_0024962_3184_3744 | 177 |
| 370 | 3300048914 | Ga0496111_0005520 | Ga0496111_0005520_2859_3419 | 177 |
| 371 | 3300048915 | Ga0496112_0002088 | Ga0496112_0002088_9952_10512 | 177 |
| 372 | 3300048916 | Ga0496113_0011400 | Ga0496113_0011400_23_583 | 177 |
| 373 | 3300048918 | Ga0496115_0060891 | Ga0496115_0060891_1737_2297 | 177 |
| 374 | 3300048927 | Ga0496124_0100316 | Ga0496124_0100316_442_1005 | 177 |
| 375 | 3300048929 | Ga0496126_0506979 | Ga0496126_0506979_16_579 | 177 |
| 376 | 3300049570 | Ga0501033_0572433 | Ga0501033_0572433_64_597 | 177 |
| 377 | 3300049571 | Ga0501034_0472743 | Ga0501034_0472743_311_844 | 177 |
| 378 | 3300049571 | Ga0501034_0506556 | Ga0501034_0506556_518_1054 | 177 |
| 379 | 3300049573 | Ga0501037_0461997 | Ga0501037_0461997_196_744 | 177 |
| 380 | 3300049580 | Ga0501046_0241526 | Ga0501046_0241526_135_668 | 177 |
| 381 | 3300049581 | Ga0501047_0098158 | Ga0501047_0098158_555_1088 | 177 |
| 382 | 3300049823 | Ga0501044_0375631 | Ga0501044_0375631_279_812 | 177 |
| 383 | iso_pu_bacteria | 2508501128 | 2509152967 | 177 |
| 384 | iso_pu_bacteria | 2513237098 | 2513674859 | 177 |
| 385 | iso_pu_bacteria | 2524023210 | 2524468239 | 177 |
| 386 | iso_pu_bacteria | 2844315083 | 2844320122 | 177 |
| 387 | iso_pu_bacteria | 2885383462 | 2885386077 | 177 |
| 388 | iso_pu_bacteria | 2903727486 | 2903730204 | 177 |
| 389 | iso_pu_bacteria | 2903768456 | 2903775274 | 177 |
| 390 | iso_pu_bacteria | 2906602504 | 2906609947 | 177 |
| 391 | iso_pu_bacteria | 8056681323 | 8056684813 | 177 |
| 392 | iso_pu_bacteria | 8056967851 | 8056974972 | 177 |
| 393 | 3300005330 | Ga0070690_100326214 | Ga0070690_1003262141 | 178 |
| 394 | 3300005334 | Ga0068869_100504439 | Ga0068869_1005044392 | 178 |
| 395 | 3300005338 | Ga0068868_100005376 | Ga0068868_1000053766 | 178 |
| 396 | 3300005338 | Ga0068868_100653356 | Ga0068868_1006533561 | 178 |
| 397 | 3300005341 | Ga0070691_10431570 | Ga0070691_104315701 | 178 |
| 398 | 3300005343 | Ga0070687_100264188 | Ga0070687_1002641882 | 178 |
| 399 | 3300005345 | Ga0070692_10365314 | Ga0070692_103653142 | 178 |
| 400 | 3300005345 | Ga0070692_10625378 | Ga0070692_106253781 | 178 |
| 401 | 3300005347 | Ga0070668_100006807 | Ga0070668_10000680710 | 178 |
| 402 | 3300005347 | Ga0070668_100388922 | Ga0070668_1003889222 | 178 |
| 403 | 3300005347 | Ga0070668_100427775 | Ga0070668_1004277751 | 178 |
| 404 | 3300005347 | Ga0070668_100776849 | Ga0070668_1007768491 | 178 |
| 405 | 3300005355 | Ga0070671_100031101 | Ga0070671_1000311013 | 178 |
| 406 | 3300005355 | Ga0070671_100127068 | Ga0070671_1001270682 | 178 |
| 407 | 3300005356 | Ga0070674_100449243 | Ga0070674_1004492431 | 178 |
| 408 | 3300005364 | Ga0070673_100080898 | Ga0070673_1000808983 | 178 |
| 409 | 3300005366 | Ga0070659_100294566 | Ga0070659_1002945662 | 178 |
| 410 | 3300005406 | Ga0070703_10027971 | Ga0070703_100279712 | 178 |
| 411 | 3300005441 | Ga0070700_100112513 | Ga0070700_1001125132 | 178 |
| 412 | 3300005444 | Ga0070694_100093529 | Ga0070694_1000935292 | 178 |
| 413 | 3300005444 | Ga0070694_101007392 | Ga0070694_1010073921 | 178 |
| 414 | 3300005445 | Ga0070708_100480141 | Ga0070708_1004801411 | 178 |
| 415 | 3300005455 | Ga0070663_100003233 | Ga0070663_1000032335 | 178 |
| 416 | 3300005455 | Ga0070663_100025815 | Ga0070663_1000258152 | 178 |
| 417 | 3300005455 | Ga0070663_100063225 | Ga0070663_1000632252 | 178 |
| 418 | 3300005455 | Ga0070663_100258091 | Ga0070663_1002580912 | 178 |
| 419 | 3300005455 | Ga0070663_100302105 | Ga0070663_1003021052 | 178 |
| 420 | 3300005456 | Ga0070678_100057791 | Ga0070678_1000577913 | 178 |
| 421 | 3300005456 | Ga0070678_100072118 | Ga0070678_1000721184 | 178 |
| 422 | 3300005456 | Ga0070678_100102787 | Ga0070678_1001027872 | 178 |
| 423 | 3300005459 | Ga0068867_100138427 | Ga0068867_1001384272 | 178 |
| 424 | 3300005466 | Ga0070685_10145522 | Ga0070685_101455222 | 178 |
| 425 | 3300005471 | Ga0070698_100279900 | Ga0070698_1002799002 | 178 |
| 426 | 3300005539 | Ga0068853_100029205 | Ga0068853_1000292055 | 178 |
| 427 | 3300005539 | Ga0068853_100290345 | Ga0068853_1002903453 | 178 |
| 428 | 3300005544 | Ga0070686_100339187 | Ga0070686_1003391871 | 178 |
| 429 | 3300005544 | Ga0070686_100764649 | Ga0070686_1007646492 | 178 |
| 430 | 3300005545 | Ga0070695_100135671 | Ga0070695_1001356713 | 178 |
| 431 | 3300005545 | Ga0070695_100603883 | Ga0070695_1006038831 | 178 |
| 432 | 3300005546 | Ga0070696_100347513 | Ga0070696_1003475132 | 178 |
| 433 | 3300005547 | Ga0070693_100045525 | Ga0070693_1000455252 | 178 |
| 434 | 3300005548 | Ga0070665_100023863 | Ga0070665_1000238633 | 178 |
| 435 | 3300005548 | Ga0070665_100026898 | Ga0070665_1000268983 | 178 |
| 436 | 3300005548 | Ga0070665_100054505 | Ga0070665_1000545054 | 178 |
| 437 | 3300005548 | Ga0070665_100265908 | Ga0070665_1002659082 | 178 |
| 438 | 3300005549 | Ga0070704_100073604 | Ga0070704_1000736042 | 178 |
| 439 | 3300005577 | Ga0068857_100015946 | Ga0068857_1000159462 | 178 |
| 440 | 3300005578 | Ga0068854_100568824 | Ga0068854_1005688242 | 178 |
| 441 | 3300005615 | Ga0070702_100387532 | Ga0070702_1003875321 | 178 |
| 442 | 3300005616 | Ga0068852_100116084 | Ga0068852_1001160842 | 178 |
| 443 | 3300005617 | Ga0068859_100183564 | Ga0068859_1001835643 | 178 |
| 444 | 3300005617 | Ga0068859_101214005 | Ga0068859_1012140051 | 178 |
| 445 | 3300005618 | Ga0068864_100489555 | Ga0068864_1004895551 | 178 |
| 446 | 3300005718 | Ga0068866_10136917 | Ga0068866_101369172 | 178 |
| 447 | 3300005718 | Ga0068866_10472117 | Ga0068866_104721172 | 178 |
| 448 | 3300005719 | Ga0068861_100516402 | Ga0068861_1005164022 | 178 |
| 449 | 3300005840 | Ga0068870_10133269 | Ga0068870_101332692 | 178 |
| 450 | 3300005841 | Ga0068863_100048337 | Ga0068863_1000483375 | 178 |
| 451 | 3300005841 | Ga0068863_100116799 | Ga0068863_1001167992 | 178 |
| 452 | 3300005842 | Ga0068858_100093050 | Ga0068858_1000930503 | 178 |
| 453 | 3300005842 | Ga0068858_100114861 | Ga0068858_1001148612 | 178 |
| 454 | 3300005843 | Ga0068860_100130655 | Ga0068860_1001306552 | 178 |
| 455 | 3300005843 | Ga0068860_100135633 | Ga0068860_1001356332 | 178 |
| 456 | 3300005843 | Ga0068860_100371466 | Ga0068860_1003714662 | 178 |
| 457 | 3300005844 | Ga0068862_100019484 | Ga0068862_1000194845 | 178 |
| 458 | 3300005844 | Ga0068862_100297271 | Ga0068862_1002972712 | 178 |
| 459 | 3300005844 | Ga0068862_100325651 | Ga0068862_1003256511 | 178 |
| 460 | 3300005844 | Ga0068862_100918391 | Ga0068862_1009183911 | 178 |
| 461 | 3300005983 | Ga0081540_1002397 | Ga0081540_100239716 | 178 |
| 462 | 3300005983 | Ga0081540_1007919 | Ga0081540_10079194 | 178 |
| 463 | 3300005983 | Ga0081540_1024502 | Ga0081540_10245022 | 178 |
| 464 | 3300005983 | Ga0081540_1048618 | Ga0081540_10486182 | 178 |
| 465 | 3300005985 | Ga0081539_10051150 | Ga0081539_100511503 | 178 |
| 466 | 3300006038 | Ga0075365_10169476 | Ga0075365_101694762 | 178 |
| 467 | 3300006038 | Ga0075365_10366068 | Ga0075365_103660681 | 178 |
| 468 | 3300006048 | Ga0075363_100013638 | Ga0075363_1000136384 | 178 |
| 469 | 3300006051 | Ga0075364_10071315 | Ga0075364_100713152 | 178 |
| 470 | 3300006058 | Ga0075432_10057870 | Ga0075432_100578702 | 178 |
| 471 | 3300006178 | Ga0075367_10029919 | Ga0075367_100299193 | 178 |
| 472 | 3300006178 | Ga0075367_10161715 | Ga0075367_101617152 | 178 |
| 473 | 3300006186 | Ga0075369_10085068 | Ga0075369_100850682 | 178 |
| 474 | 3300006353 | Ga0075370_10023578 | Ga0075370_100235783 | 178 |
| 475 | 3300006353 | Ga0075370_10087885 | Ga0075370_100878852 | 178 |
| 476 | 3300006358 | Ga0068871_100308242 | Ga0068871_1003082422 | 178 |
| 477 | 3300006844 | Ga0075428_100577288 | Ga0075428_1005772882 | 178 |
| 478 | 3300006881 | Ga0068865_100402284 | Ga0068865_1004022842 | 178 |
| 479 | 3300006931 | Ga0097620_100183559 | Ga0097620_1001835593 | 178 |
| 480 | 3300006931 | Ga0097620_101213996 | Ga0097620_1012139961 | 178 |
| 481 | 3300009094 | Ga0111539_10169347 | Ga0111539_101693471 | 178 |
| 482 | 3300009094 | Ga0111539_11184709 | Ga0111539_111847091 | 178 |
| 483 | 3300009101 | Ga0105247_10107479 | Ga0105247_101074792 | 178 |
| 484 | 3300009174 | Ga0105241_10003241 | Ga0105241_100032415 | 178 |
| 485 | 3300009174 | Ga0105241_10085165 | Ga0105241_100851652 | 178 |
| 486 | 3300009176 | Ga0105242_10171258 | Ga0105242_101712582 | 178 |
| 487 | 3300009545 | Ga0105237_10024067 | Ga0105237_100240673 | 178 |
| 488 | 3300009551 | Ga0105238_11051907 | Ga0105238_110519071 | 178 |
| 489 | 3300011119 | Ga0105246_10279153 | Ga0105246_102791533 | 178 |
| 490 | 3300013306 | Ga0163162_10115670 | Ga0163162_101156704 | 178 |
| 491 | 3300013306 | Ga0163162_10402266 | Ga0163162_104022662 | 178 |
| 492 | 3300013308 | Ga0157375_10065900 | Ga0157375_100659004 | 178 |
| 493 | 3300013308 | Ga0157375_10072080 | Ga0157375_100720801 | 178 |
| 494 | 3300013308 | Ga0157375_11029651 | Ga0157375_110296512 | 178 |
| 495 | 3300014325 | Ga0163163_10049822 | Ga0163163_100498224 | 178 |
| 496 | 3300014325 | Ga0163163_10293108 | Ga0163163_102931082 | 178 |
| 497 | 3300014325 | Ga0163163_10436443 | Ga0163163_104364432 | 178 |
| 498 | 3300014325 | Ga0163163_10997973 | Ga0163163_109979732 | 178 |
| 499 | 3300014325 | Ga0163163_11453197 | Ga0163163_114531971 | 178 |
| 500 | 3300014745 | Ga0157377_10005796 | Ga0157377_100057963 | 178 |
| 501 | 3300014968 | Ga0157379_10812939 | Ga0157379_108129391 | 178 |
| 502 | 3300017792 | Ga0163161_10621799 | Ga0163161_106217991 | 178 |
| 503 | 3300025297 | Ga0209758_1021253 | Ga0209758_10212532 | 178 |
| 504 | 3300025885 | Ga0207653_10043025 | Ga0207653_100430252 | 178 |
| 505 | 3300025903 | Ga0207680_10179682 | Ga0207680_101796821 | 178 |
| 506 | 3300025904 | Ga0207647_10041473 | Ga0207647_100414732 | 178 |
| 507 | 3300025907 | Ga0207645_10156206 | Ga0207645_101562062 | 178 |
| 508 | 3300025908 | Ga0207643_10196076 | Ga0207643_101960761 | 178 |
| 509 | 3300025911 | Ga0207654_10026617 | Ga0207654_100266171 | 178 |
| 510 | 3300025917 | Ga0207660_10722753 | Ga0207660_107227531 | 178 |
| 511 | 3300025918 | Ga0207662_10132358 | Ga0207662_101323582 | 178 |
| 512 | 3300025918 | Ga0207662_10477335 | Ga0207662_104773352 | 178 |
| 513 | 3300025919 | Ga0207657_10052926 | Ga0207657_100529263 | 178 |
| 514 | 3300025923 | Ga0207681_10309715 | Ga0207681_103097152 | 178 |
| 515 | 3300025924 | Ga0207694_10668697 | Ga0207694_106686971 | 178 |
| 516 | 3300025926 | Ga0207659_10345954 | Ga0207659_103459542 | 178 |
| 517 | 3300025927 | Ga0207687_10006611 | Ga0207687_100066116 | 178 |
| 518 | 3300025927 | Ga0207687_10295986 | Ga0207687_102959862 | 178 |
| 519 | 3300025931 | Ga0207644_11149500 | Ga0207644_111495001 | 178 |
| 520 | 3300025932 | Ga0207690_10065349 | Ga0207690_100653492 | 178 |
| 521 | 3300025933 | Ga0207706_10054196 | Ga0207706_100541963 | 178 |
| 522 | 3300025934 | Ga0207686_10080217 | Ga0207686_100802171 | 178 |
| 523 | 3300025937 | Ga0207669_10011373 | Ga0207669_100113733 | 178 |
| 524 | 3300025937 | Ga0207669_10280468 | Ga0207669_102804681 | 178 |
| 525 | 3300025940 | Ga0207691_10385801 | Ga0207691_103858012 | 178 |
| 526 | 3300025941 | Ga0207711_10047118 | Ga0207711_100471184 | 178 |
| 527 | 3300025942 | Ga0207689_10003758 | Ga0207689_1000375810 | 178 |
| 528 | 3300025961 | Ga0207712_11166605 | Ga0207712_111666051 | 178 |
| 529 | 3300025972 | Ga0207668_10088097 | Ga0207668_100880971 | 178 |
| 530 | 3300025972 | Ga0207668_10122050 | Ga0207668_101220503 | 178 |
| 531 | 3300025981 | Ga0207640_10412368 | Ga0207640_104123682 | 178 |
| 532 | 3300025986 | Ga0207658_10611463 | Ga0207658_106114632 | 178 |
| 533 | 3300026023 | Ga0207677_10241250 | Ga0207677_102412502 | 178 |
| 534 | 3300026023 | Ga0207677_10459412 | Ga0207677_104594122 | 178 |
| 535 | 3300026035 | Ga0207703_10088708 | Ga0207703_100887082 | 178 |
| 536 | 3300026035 | Ga0207703_10094264 | Ga0207703_100942642 | 178 |
| 537 | 3300026035 | Ga0207703_10878834 | Ga0207703_108788341 | 178 |
| 538 | 3300026041 | Ga0207639_10068349 | Ga0207639_100683494 | 178 |
| 539 | 3300026067 | Ga0207678_10002626 | Ga0207678_1000262612 | 178 |
| 540 | 3300026067 | Ga0207678_10014595 | Ga0207678_100145954 | 178 |
| 541 | 3300026067 | Ga0207678_10048700 | Ga0207678_100487002 | 178 |
| 542 | 3300026067 | Ga0207678_10089802 | Ga0207678_100898023 | 178 |
| 543 | 3300026067 | Ga0207678_10322153 | Ga0207678_103221532 | 178 |
| 544 | 3300026075 | Ga0207708_10050661 | Ga0207708_100506613 | 178 |
| 545 | 3300026089 | Ga0207648_10126456 | Ga0207648_101264564 | 178 |
| 546 | 3300026089 | Ga0207648_10491142 | Ga0207648_104911421 | 178 |
| 547 | 3300026116 | Ga0207674_10022614 | Ga0207674_100226145 | 178 |
| 548 | 3300026116 | Ga0207674_10803679 | Ga0207674_108036792 | 178 |
| 549 | 3300026118 | Ga0207675_100074027 | Ga0207675_1000740273 | 178 |
| 550 | 3300026121 | Ga0207683_10082170 | Ga0207683_100821703 | 178 |
| 551 | 3300027907 | Ga0207428_10212990 | Ga0207428_102129901 | 178 |
| 552 | 3300028379 | Ga0268266_10003290 | Ga0268266_100032907 | 178 |
| 553 | 3300028379 | Ga0268266_10013881 | Ga0268266_100138813 | 178 |
| 554 | 3300028379 | Ga0268266_10022599 | Ga0268266_100225995 | 178 |
| 555 | 3300028379 | Ga0268266_10512514 | Ga0268266_105125142 | 178 |
| 556 | 3300028379 | Ga0268266_11412720 | Ga0268266_114127201 | 178 |
| 557 | 3300028380 | Ga0268265_10021737 | Ga0268265_100217375 | 178 |
| 558 | 3300028380 | Ga0268265_10454145 | Ga0268265_104541452 | 178 |
| 559 | 3300028381 | Ga0268264_10732308 | Ga0268264_107323082 | 178 |
| 560 | 3300028786 | Ga0307517_10083264 | Ga0307517_100832644 | 178 |
| 561 | 3300030522 | Ga0307512_10294970 | Ga0307512_102949702 | 178 |
| 562 | 3300031507 | Ga0307509_10205904 | Ga0307509_102059042 | 178 |
| 563 | 3300031616 | Ga0307508_10000032 | Ga0307508_1000003236 | 178 |
| 564 | 3300031616 | Ga0307508_10209810 | Ga0307508_102098102 | 178 |
| 565 | 3300031730 | Ga0307516_10078471 | Ga0307516_100784715 | 178 |
| 566 | 3300031730 | Ga0307516_10108391 | Ga0307516_101083911 | 178 |
| 567 | 3300031889 | Ga0326468_10009406 | Ga0326468_100094062 | 178 |
| 568 | 3300031901 | Ga0307406_10721601 | Ga0307406_107216012 | 178 |
| 569 | 3300031903 | Ga0307407_10273882 | Ga0307407_102738822 | 178 |
| 570 | 3300031903 | Ga0307407_10750032 | Ga0307407_107500321 | 178 |
| 571 | 3300031911 | Ga0307412_10850901 | Ga0307412_108509012 | 178 |
| 572 | 3300032005 | Ga0307411_10228270 | Ga0307411_102282702 | 178 |
| 573 | 3300033179 | Ga0307507_10253679 | Ga0307507_102536791 | 178 |
| 574 | 3300033180 | Ga0307510_10016937 | Ga0307510_100169374 | 178 |
| 575 | 3300035115 | Ga0373941_0080388 | Ga0373941_0080388_439_1005 | 178 |
| 576 | 3300037068 | Ga0373925_0205571 | Ga0373925_0205571_338_904 | 178 |
| 577 | 3300041451 | Ga0451791_0201774 | Ga0451791_0201774_1038_1604 | 178 |
| 578 | 3300041451 | Ga0451791_0642730 | Ga0451791_0642730_149_715 | 178 |
| 579 | 3300042006 | Ga0439432_184098 | Ga0439432_184098_13_579 | 178 |
| 580 | 3300046452 | Ga0495617_026298 | Ga0495617_026298_611_1177 | 178 |
| 581 | 3300046455 | Ga0495603_0076353 | Ga0495603_0076353_25_591 | 178 |
| 582 | 3300046459 | Ga0495629_0072547 | Ga0495629_0072547_784_1350 | 178 |
| 583 | 3300046474 | Ga0495605_0111427 | Ga0495605_0111427_413_979 | 178 |
| 584 | 3300046475 | Ga0495639_0253721 | Ga0495639_0253721_68_634 | 178 |
| 585 | 3300046491 | Ga0495584_0080757 | Ga0495584_0080757_1053_1619 | 178 |
| 586 | 3300046491 | Ga0495584_0089683 | Ga0495584_0089683_544_1110 | 178 |
| 587 | 3300046492 | Ga0495585_0012248 | Ga0495585_0012248_3439_4005 | 178 |
| 588 | 3300046492 | Ga0495585_0180233 | Ga0495585_0180233_334_900 | 178 |
| 589 | 3300046499 | Ga0495594_0294615 | Ga0495594_0294615_296_862 | 178 |
| 590 | 3300046506 | Ga0495583_0110898 | Ga0495583_0110898_42_608 | 178 |
| 591 | 3300046507 | Ga0495606_0094225 | Ga0495606_0094225_168_734 | 178 |
| 592 | 3300046513 | Ga0495616_0036445 | Ga0495616_0036445_1556_2122 | 178 |
| 593 | 3300046518 | Ga0495631_0215358 | Ga0495631_0215358_183_749 | 178 |
| 594 | 3300046519 | Ga0495632_0150184 | Ga0495632_0150184_62_628 | 178 |
| 595 | 3300046523 | Ga0495644_0105582 | Ga0495644_0105582_215_781 | 178 |
| 596 | 3300046538 | Ga0495609_0047871 | Ga0495609_0047871_570_1136 | 178 |
| 597 | 3300046557 | Ga0495622_0138108 | Ga0495622_0138108_466_1032 | 178 |
| 598 | 3300046558 | Ga0495633_0066574 | Ga0495633_0066574_1004_1570 | 178 |
| 599 | 3300046615 | Ga0495656_0035397 | Ga0495656_0035397_521_1087 | 178 |
| 600 | 3300046615 | Ga0495656_0041525 | Ga0495656_0041525_1278_1844 | 178 |
| 601 | 3300046615 | Ga0495656_0088098 | Ga0495656_0088098_496_1062 | 178 |
| 602 | 3300046615 | Ga0495656_0225095 | Ga0495656_0225095_42_608 | 178 |
| 603 | 3300046616 | Ga0495668_0194231 | Ga0495668_0194231_528_1094 | 178 |
| 604 | 3300046616 | Ga0495668_0360414 | Ga0495668_0360414_183_749 | 178 |
| 605 | 3300046660 | Ga0495625_0039960 | Ga0495625_0039960_33_599 | 178 |
| 606 | 3300046660 | Ga0495625_0226343 | Ga0495625_0226343_618_1184 | 178 |
| 607 | 3300046660 | Ga0495625_0276165 | Ga0495625_0276165_104_670 | 178 |
| 608 | 3300046684 | Ga0495669_0004453 | Ga0495669_0004453_110_676 | 178 |
| 609 | 3300046684 | Ga0495669_0019284 | Ga0495669_0019284_229_795 | 178 |
| 610 | 3300046690 | Ga0495624_0367711 | Ga0495624_0367711_38_604 | 178 |
| 611 | 3300046691 | Ga0495670_0095461 | Ga0495670_0095461_633_1199 | 178 |
| 612 | 3300046691 | Ga0495670_0339782 | Ga0495670_0339782_183_749 | 178 |
| 613 | 3300046694 | Ga0495649_0187292 | Ga0495649_0187292_184_750 | 178 |
| 614 | 3300046794 | Ga0495589_0013236 | Ga0495589_0013236_1259_1825 | 178 |
| 615 | 3300046810 | Ga0495660_0153516 | Ga0495660_0153516_369_935 | 178 |
| 616 | 3300047315 | Ga0495581_0165241 | Ga0495581_0165241_236_802 | 178 |
| 617 | 3300047318 | Ga0495636_0376219 | Ga0495636_0376219_77_643 | 178 |
| 618 | 3300047323 | Ga0495683_0049939 | Ga0495683_0049939_1498_2064 | 178 |
| 619 | 3300047447 | Ga0495685_121617 | Ga0495685_121617_83_649 | 178 |
| 620 | 3300047469 | Ga0495673_0062926 | Ga0495673_0062926_391_957 | 178 |
| 621 | 3300048088 | Ga0495602_0384061 | Ga0495602_0384061_209_775 | 178 |
| 622 | 3300048903 | Ga0496100_0115201 | Ga0496100_0115201_325_891 | 178 |
| 623 | 3300048904 | Ga0496101_0403148 | Ga0496101_0403148_455_1021 | 178 |
| 624 | 3300048904 | Ga0496101_0457260 | Ga0496101_0457260_150_716 | 178 |
| 625 | 3300048904 | Ga0496101_1068847 | Ga0496101_1068847_17_583 | 178 |
| 626 | 3300048905 | Ga0496102_0071311 | Ga0496102_0071311_740_1306 | 178 |
| 627 | 3300048905 | Ga0496102_0157522 | Ga0496102_0157522_742_1308 | 178 |
| 628 | 3300048906 | Ga0496103_0218081 | Ga0496103_0218081_391_957 | 178 |
| 629 | 3300048907 | Ga0496104_0109706 | Ga0496104_0109706_1616_2182 | 178 |
| 630 | 3300048907 | Ga0496104_0472106 | Ga0496104_0472106_425_991 | 178 |
| 631 | 3300048910 | Ga0496107_0602276 | Ga0496107_0602276_236_802 | 178 |
| 632 | 3300048911 | Ga0496108_0106987 | Ga0496108_0106987_841_1407 | 178 |
| 633 | 3300048912 | Ga0496109_0031295 | Ga0496109_0031295_3103_3669 | 178 |
| 634 | 3300048913 | Ga0496110_0059210 | Ga0496110_0059210_1183_1749 | 178 |
| 635 | 3300048913 | Ga0496110_0129862 | Ga0496110_0129862_1042_1608 | 178 |
| 636 | 3300048914 | Ga0496111_0104147 | Ga0496111_0104147_891_1457 | 178 |
| 637 | 3300048916 | Ga0496113_0083713 | Ga0496113_0083713_1593_2159 | 178 |
| 638 | 3300048918 | Ga0496115_0143179 | Ga0496115_0143179_1196_1762 | 178 |
| 639 | 3300048924 | Ga0496121_0045446 | Ga0496121_0045446_357_923 | 178 |
| 640 | 3300048927 | Ga0496124_0292170 | Ga0496124_0292170_512_1078 | 178 |
| 641 | 3300048928 | Ga0496125_0254968 | Ga0496125_0254968_393_959 | 178 |
| 642 | 3300048929 | Ga0496126_0015857 | Ga0496126_0015857_6937_7503 | 178 |
| 643 | 3300048929 | Ga0496126_0220769 | Ga0496126_0220769_820_1386 | 178 |
| 644 | 3300049577 | Ga0501041_0472345 | Ga0501041_0472345_85_651 | 178 |
| 645 | 3300049584 | Ga0501068_0459997 | Ga0501068_0459997_97_663 | 178 |
| 646 | 3300050491 | nmdc:mga00v17_32928_c1 | nmdc:mga00v17_32928_c1_1458_2024 | 178 |
| 647 | 3300050492 | nmdc:mga0yw44_242569_c1 | nmdc:mga0yw44_242569_c1_423_989 | 178 |
| 648 | 3300050493 | nmdc:mga0k408_70684_c1 | nmdc:mga0k408_70684_c1_796_1362 | 178 |
| 649 | 3300050494 | nmdc:mga06z11_101576_c1 | nmdc:mga06z11_101576_c1_354_920 | 178 |
| 650 | 3300050494 | nmdc:mga06z11_370749_c1 | nmdc:mga06z11_370749_c1_38_604 | 178 |
| 651 | 3300050494 | nmdc:mga06z11_48738_c1 | nmdc:mga06z11_48738_c1_590_1156 | 178 |
| 652 | 3300050496 | nmdc:mga07m45_7786_c1 | nmdc:mga07m45_7786_c1_3031_3597 | 178 |
| 653 | 3300050496 | nmdc:mga07m45_92436_c1 | nmdc:mga07m45_92436_c1_1062_1628 | 178 |
| 654 | 3300050507 | nmdc:mga05p37_142001_c1 | nmdc:mga05p37_142001_c1_905_1471 | 178 |
| 655 | 3300050509 | nmdc:mga0qj67_362895_c1 | nmdc:mga0qj67_362895_c1_592_1158 | 178 |
| 656 | 3300050511 | nmdc:mga08y16_381937_c1 | nmdc:mga08y16_381937_c1_291_857 | 178 |
| 657 | 3300050512 | nmdc:mga0n895_94897_c1 | nmdc:mga0n895_94897_c1_141_707 | 178 |
| 658 | 3300053090 | Ga0500646_0072983 | Ga0500646_0072983_112_678 | 178 |
| 659 | 3300053096 | Ga0500641_0017803 | Ga0500641_0017803_1224_1790 | 178 |
| 660 | 3300053096 | Ga0500641_0120070 | Ga0500641_0120070_52_618 | 178 |
| 661 | 3300053109 | Ga0500569_161765 | Ga0500569_161765_17_583 | 178 |
| 662 | 3300053119 | Ga0500595_034082 | Ga0500595_034082_835_1401 | 178 |
| 663 | 3300053134 | Ga0500658_0016766 | Ga0500658_0016766_565_1131 | 178 |
| 664 | 3300053146 | Ga0500588_0051173 | Ga0500588_0051173_17_583 | 178 |
| 665 | 3300053160 | Ga0500633_0066613 | Ga0500633_0066613_53_619 | 178 |
| 666 | 3300053162 | Ga0500638_044881 | Ga0500638_044881_1503_2069 | 178 |
| 667 | 3300053727 | Ga0500611_053734 | Ga0500611_053734_177_743 | 178 |
| 668 | iso_pu_bacteria | 2508501042 | 2508692773 | 178 |
| 669 | iso_pu_bacteria | 2513237101 | 2513694801 | 178 |
| 670 | iso_pu_bacteria | 2721755755 | 2723842169 | 178 |
| 671 | iso_pu_bacteria | 2791355199 | 2793078074 | 178 |
| 672 | iso_pu_bacteria | 2874604998 | 2874610245 | 178 |
| 673 | iso_pu_bacteria | 2876808645 | 2876809277 | 178 |
| 674 | iso_pu_bacteria | 2879110137 | 2879112517 | 178 |
| 675 | iso_pu_bacteria | 2889033259 | 2889036260 | 178 |
| 676 | iso_pu_bacteria | 2922361189 | 2922366846 | 178 |
| 677 | iso_pu_bacteria | 2922386360 | 2922389255 | 178 |
| 678 | iso_pu_bacteria | 2935819856 | 2935823085 | 178 |
| 679 | iso_pu_bacteria | 2935847175 | 2935848667 | 178 |
| 680 | iso_pu_bacteria | 8006964411 | 8006966440 | 178 |
| 681 | iso_pu_bacteria | 8006984368 | 8006990594 | 178 |
| 682 | iso_pu_bacteria | 8006994254 | 8006997102 | 178 |
| 683 | iso_pu_bacteria | 8056673599 | 8056678308 | 178 |
| 684 | 3300003214 | JGI25165J46597_1011970 | JGI25165J46597_10119702 | 179 |
| 685 | 3300003374 | JGI25161J50226_1011621 | JGI25161J50226_10116212 | 179 |
| 686 | 3300004625 | Ga0055543_1003132 | Ga0055543_10031323 | 179 |
| 687 | 3300005262 | Ga0065165_1001109 | Ga0065165_100110919 | 179 |
| 688 | 3300005985 | Ga0081539_10037287 | Ga0081539_100372872 | 179 |
| 689 | 3300025261 | Ga0209233_1011115 | Ga0209233_10111153 | 179 |
| 690 | 3300025928 | Ga0207700_10342822 | Ga0207700_103428222 | 179 |
| 691 | 3300031711 | Ga0265314_10002758 | Ga0265314_100027589 | 179 |
| 692 | 3300039437 | Ga0436365_1886582 | Ga0436365_1886582_410_949 | 179 |
| 693 | 3300049587 | Ga0501071_0159587 | Ga0501071_0159587_766_1347 | 179 |
| 694 | 3300049588 | Ga0501072_0252575 | Ga0501072_0252575_40_621 | 179 |
| 695 | 3300049743 | Ga0501081_0339329 | Ga0501081_0339329_165_746 | 179 |
| 696 | 3300049744 | Ga0501083_0512726 | Ga0501083_0512726_129_710 | 179 |
| 697 | 3300003215 | JGI25153J46596_10000712 | JGI25153J46596_100007122 | 180 |
| 698 | 3300003215 | JGI25153J46596_10000760 | JGI25153J46596_1000076018 | 180 |
| 699 | 3300003215 | JGI25153J46596_10011001 | JGI25153J46596_100110012 | 180 |
| 700 | 3300003215 | JGI25153J46596_10045521 | JGI25153J46596_100455212 | 180 |
| 701 | 3300003322 | rootL2_10112590 | rootL2_101125902 | 180 |
| 702 | 3300003354 | JGI25160J50197_1002322 | JGI25160J50197_10023224 | 180 |
| 703 | 3300003354 | JGI25160J50197_1015410 | JGI25160J50197_10154104 | 180 |
| 704 | 3300005262 | Ga0065165_1044439 | Ga0065165_10444392 | 180 |
| 705 | 3300005331 | Ga0070670_100578528 | Ga0070670_1005785282 | 180 |
| 706 | 3300005336 | Ga0070680_100069793 | Ga0070680_1000697934 | 180 |
| 707 | 3300005344 | Ga0070661_101033278 | Ga0070661_1010332781 | 180 |
| 708 | 3300005347 | Ga0070668_100081083 | Ga0070668_1000810832 | 180 |
| 709 | 3300005356 | Ga0070674_100095630 | Ga0070674_1000956302 | 180 |
| 710 | 3300005356 | Ga0070674_100431106 | Ga0070674_1004311062 | 180 |
| 711 | 3300005366 | Ga0070659_100130397 | Ga0070659_1001303972 | 180 |
| 712 | 3300005437 | Ga0070710_10386386 | Ga0070710_103863861 | 180 |
| 713 | 3300005439 | Ga0070711_100308013 | Ga0070711_1003080132 | 180 |
| 714 | 3300005439 | Ga0070711_100614857 | Ga0070711_1006148572 | 180 |
| 715 | 3300005455 | Ga0070663_100596437 | Ga0070663_1005964372 | 180 |
| 716 | 3300005457 | Ga0070662_100148860 | Ga0070662_1001488602 | 180 |
| 717 | 3300005539 | Ga0068853_100335693 | Ga0068853_1003356932 | 180 |
| 718 | 3300005548 | Ga0070665_100098124 | Ga0070665_1000981244 | 180 |
| 719 | 3300005548 | Ga0070665_101791805 | Ga0070665_1017918051 | 180 |
| 720 | 3300005577 | Ga0068857_100792648 | Ga0068857_1007926481 | 180 |
| 721 | 3300005578 | Ga0068854_100333428 | Ga0068854_1003334282 | 180 |
| 722 | 3300005616 | Ga0068852_100028208 | Ga0068852_1000282083 | 180 |
| 723 | 3300005841 | Ga0068863_100468556 | Ga0068863_1004685562 | 180 |
| 724 | 3300005842 | Ga0068858_100278781 | Ga0068858_1002787812 | 180 |
| 725 | 3300005843 | Ga0068860_100135352 | Ga0068860_1001353522 | 180 |
| 726 | 3300005937 | Ga0081455_10133148 | Ga0081455_101331482 | 180 |
| 727 | 3300005981 | Ga0081538_10067578 | Ga0081538_100675782 | 180 |
| 728 | 3300005983 | Ga0081540_1008426 | Ga0081540_10084263 | 180 |
| 729 | 3300006038 | Ga0075365_10021811 | Ga0075365_100218113 | 180 |
| 730 | 3300006042 | Ga0075368_10005726 | Ga0075368_100057262 | 180 |
| 731 | 3300006051 | Ga0075364_10158221 | Ga0075364_101582212 | 180 |
| 732 | 3300006175 | Ga0070712_100034677 | Ga0070712_1000346772 | 180 |
| 733 | 3300006177 | Ga0075362_10362738 | Ga0075362_103627382 | 180 |
| 734 | 3300006178 | Ga0075367_10085132 | Ga0075367_100851322 | 180 |
| 735 | 3300006178 | Ga0075367_10148194 | Ga0075367_101481941 | 180 |
| 736 | 3300006178 | Ga0075367_10414353 | Ga0075367_104143532 | 180 |
| 737 | 3300006186 | Ga0075369_10262882 | Ga0075369_102628821 | 180 |
| 738 | 3300006353 | Ga0075370_10005879 | Ga0075370_100058793 | 180 |
| 739 | 3300006358 | Ga0068871_100840373 | Ga0068871_1008403731 | 180 |
| 740 | 3300006871 | Ga0075434_100070588 | Ga0075434_1000705884 | 180 |
| 741 | 3300006941 | Ga0099825_1029470 | Ga0099825_10294704 | 180 |
| 742 | 3300006944 | Ga0099823_1043212 | Ga0099823_10432123 | 180 |
| 743 | 3300009011 | Ga0105251_10081614 | Ga0105251_100816142 | 180 |
| 744 | 3300009093 | Ga0105240_10028150 | Ga0105240_100281504 | 180 |
| 745 | 3300009101 | Ga0105247_10257739 | Ga0105247_102577392 | 180 |
| 746 | 3300009101 | Ga0105247_10261783 | Ga0105247_102617831 | 180 |
| 747 | 3300009174 | Ga0105241_10133503 | Ga0105241_101335031 | 180 |
| 748 | 3300009174 | Ga0105241_10144748 | Ga0105241_101447482 | 180 |
| 749 | 3300009174 | Ga0105241_10255384 | Ga0105241_102553842 | 180 |
| 750 | 3300009176 | Ga0105242_10742190 | Ga0105242_107421902 | 180 |
| 751 | 3300009545 | Ga0105237_10008430 | Ga0105237_100084308 | 180 |
| 752 | 3300009545 | Ga0105237_10123415 | Ga0105237_101234152 | 180 |
| 753 | 3300009553 | Ga0105249_10848567 | Ga0105249_108485672 | 180 |
| 754 | 3300010375 | Ga0105239_10643323 | Ga0105239_106433232 | 180 |
| 755 | 3300011119 | Ga0105246_10050204 | Ga0105246_100502043 | 180 |
| 756 | 3300012490 | Ga0157322_1008142 | Ga0157322_10081422 | 180 |
| 757 | 3300013296 | Ga0157374_10506467 | Ga0157374_105064672 | 180 |
| 758 | 3300013306 | Ga0163162_10206262 | Ga0163162_102062622 | 180 |
| 759 | 3300013307 | Ga0157372_10924417 | Ga0157372_109244172 | 180 |
| 760 | 3300013308 | Ga0157375_12168896 | Ga0157375_121688961 | 180 |
| 761 | 3300014969 | Ga0157376_10454988 | Ga0157376_104549882 | 180 |
| 762 | 3300015262 | Ga0182007_10039960 | Ga0182007_100399602 | 180 |
| 763 | 3300017792 | Ga0163161_10612284 | Ga0163161_106122842 | 180 |
| 764 | 3300021320 | Ga0214544_1000001 | Ga0214544_1000001668 | 180 |
| 765 | 3300021321 | Ga0214542_1000037 | Ga0214542_100003753 | 180 |
| 766 | 3300021324 | Ga0214545_1000003 | Ga0214545_100000392 | 180 |
| 767 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002673 | 180 |
| 768 | 3300025230 | Ga0209563_117798 | Ga0209563_1177981 | 180 |
| 769 | 3300025253 | Ga0209677_105144 | Ga0209677_1051444 | 180 |
| 770 | 3300025254 | Ga0209148_1000347 | Ga0209148_100034753 | 180 |
| 771 | 3300025272 | Ga0209455_1002091 | Ga0209455_10020912 | 180 |
| 772 | 3300025272 | Ga0209455_1013519 | Ga0209455_10135192 | 180 |
| 773 | 3300025273 | Ga0209673_1034422 | Ga0209673_10344222 | 180 |
| 774 | 3300025295 | Ga0209564_1004821 | Ga0209564_10048216 | 180 |
| 775 | 3300025297 | Ga0209758_1000133 | Ga0209758_1000133150 | 180 |
| 776 | 3300025297 | Ga0209758_1000845 | Ga0209758_100084518 | 180 |
| 777 | 3300025297 | Ga0209758_1001269 | Ga0209758_100126923 | 180 |
| 778 | 3300025297 | Ga0209758_1006848 | Ga0209758_10068485 | 180 |
| 779 | 3300025302 | Ga0207426_1000270 | Ga0207426_100027064 | 180 |
| 780 | 3300025302 | Ga0207426_1003805 | Ga0207426_10038056 | 180 |
| 781 | 3300025302 | Ga0207426_1014306 | Ga0207426_10143064 | 180 |
| 782 | 3300025304 | Ga0209257_1036953 | Ga0209257_10369532 | 180 |
| 783 | 3300025898 | Ga0207692_10277865 | Ga0207692_102778651 | 180 |
| 784 | 3300025901 | Ga0207688_10258200 | Ga0207688_102582002 | 180 |
| 785 | 3300025904 | Ga0207647_10028027 | Ga0207647_100280272 | 180 |
| 786 | 3300025911 | Ga0207654_10132535 | Ga0207654_101325352 | 180 |
| 787 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008897 | 180 |
| 788 | 3300025914 | Ga0207671_10033634 | Ga0207671_100336342 | 180 |
| 789 | 3300025915 | Ga0207693_10080001 | Ga0207693_100800013 | 180 |
| 790 | 3300025916 | Ga0207663_10459253 | Ga0207663_104592532 | 180 |
| 791 | 3300025919 | Ga0207657_10011138 | Ga0207657_100111385 | 180 |
| 792 | 3300025919 | Ga0207657_10434435 | Ga0207657_104344352 | 180 |
| 793 | 3300025923 | Ga0207681_10081029 | Ga0207681_100810293 | 180 |
| 794 | 3300025931 | Ga0207644_10419244 | Ga0207644_104192442 | 180 |
| 795 | 3300025932 | Ga0207690_10377023 | Ga0207690_103770232 | 180 |
| 796 | 3300025933 | Ga0207706_10090077 | Ga0207706_100900772 | 180 |
| 797 | 3300025933 | Ga0207706_10350447 | Ga0207706_103504472 | 180 |
| 798 | 3300025934 | Ga0207686_10210725 | Ga0207686_102107252 | 180 |
| 799 | 3300025935 | Ga0207709_10076899 | Ga0207709_100768992 | 180 |
| 800 | 3300025937 | Ga0207669_10127068 | Ga0207669_101270682 | 180 |
| 801 | 3300025940 | Ga0207691_10593938 | Ga0207691_105939382 | 180 |
| 802 | 3300025941 | Ga0207711_10388754 | Ga0207711_103887542 | 180 |
| 803 | 3300025972 | Ga0207668_10018550 | Ga0207668_100185503 | 180 |
| 804 | 3300025972 | Ga0207668_10784211 | Ga0207668_107842112 | 180 |
| 805 | 3300026035 | Ga0207703_10098345 | Ga0207703_100983452 | 180 |
| 806 | 3300026041 | Ga0207639_10212637 | Ga0207639_102126372 | 180 |
| 807 | 3300026067 | Ga0207678_10481404 | Ga0207678_104814041 | 180 |
| 808 | 3300026067 | Ga0207678_10751893 | Ga0207678_107518932 | 180 |
| 809 | 3300026116 | Ga0207674_10146631 | Ga0207674_101466314 | 180 |
| 810 | 3300026142 | Ga0207698_10033138 | Ga0207698_100331383 | 180 |
| 811 | 3300027296 | Ga0209389_1000001 | Ga0209389_100000139 | 180 |
| 812 | 3300027296 | Ga0209389_1000014 | Ga0209389_100001486 | 180 |
| 813 | 3300027357 | Ga0209589_1000020 | Ga0209589_100002086 | 180 |
| 814 | 3300027361 | Ga0209489_100060 | Ga0209489_10006045 | 180 |
| 815 | 3300027361 | Ga0209489_101114 | Ga0209489_10111421 | 180 |
| 816 | 3300027363 | Ga0209700_100007 | Ga0209700_100007365 | 180 |
| 817 | 3300028379 | Ga0268266_10231194 | Ga0268266_102311942 | 180 |
| 818 | 3300028380 | Ga0268265_10177517 | Ga0268265_101775172 | 180 |
| 819 | 3300031616 | Ga0307508_10105723 | Ga0307508_101057233 | 180 |
| 820 | 3300033180 | Ga0307510_10063397 | Ga0307510_100633972 | 180 |
| 821 | 3300033180 | Ga0307510_10210133 | Ga0307510_102101332 | 180 |
| 822 | 3300035086 | Ga0373934_0001744 | Ga0373934_0001744_2648_3196 | 180 |
| 823 | 3300035118 | Ga0373954_0002051 | Ga0373954_0002051_6595_7143 | 180 |
| 824 | 3300035119 | Ga0373956_0006790 | Ga0373956_0006790_3288_3836 | 180 |
| 825 | 3300035120 | Ga0373957_0094309 | Ga0373957_0094309_390_938 | 180 |
| 826 | 3300035172 | Ga0373955_0000836 | Ga0373955_0000836_8348_8896 | 180 |
| 827 | 3300035410 | Ga0373924_0009259 | Ga0373924_0009259_432_980 | 180 |
| 828 | 3300035724 | Ga0373933_0051852 | Ga0373933_0051852_805_1353 | 180 |
| 829 | 3300036401 | Ga0373937_0011733 | Ga0373937_0011733_5225_5773 | 180 |
| 830 | 3300037466 | Ga0395898_0492649 | Ga0395898_0492649_82_624 | 180 |
| 831 | 3300037471 | Ga0395905_0009285 | Ga0395905_0009285_4564_5106 | 180 |
| 832 | 3300037471 | Ga0395905_0274201 | Ga0395905_0274201_669_1223 | 180 |
| 833 | 3300037853 | Ga0436364_1482475 | Ga0436364_1482475_18_560 | 180 |
| 834 | 3300039437 | Ga0436365_1550533 | Ga0436365_1550533_1710_2252 | 180 |
| 835 | 3300044656 | Ga0466969_0241984 | Ga0466969_0241984_32_574 | 180 |
| 836 | 3300044658 | Ga0466972_0000134 | Ga0466972_0000134_58952_59494 | 180 |
| 837 | 3300044658 | Ga0466972_0014382 | Ga0466972_0014382_1313_1855 | 180 |
| 838 | 3300044658 | Ga0466972_0026556 | Ga0466972_0026556_1707_2249 | 180 |
| 839 | 3300044658 | Ga0466972_0085058 | Ga0466972_0085058_917_1459 | 180 |
| 840 | 3300044735 | Ga0466968_0006796 | Ga0466968_0006796_1218_1760 | 180 |
| 841 | 3300044735 | Ga0466968_0221446 | Ga0466968_0221446_326_868 | 180 |
| 842 | 3300044901 | Ga0466960_0039333 | Ga0466960_0039333_397_939 | 180 |
| 843 | 3300044901 | Ga0466960_0100716 | Ga0466960_0100716_171_713 | 180 |
| 844 | 3300045976 | Ga0466967_0865800 | Ga0466967_0865800_75_617 | 180 |
| 845 | 3300046454 | Ga0495592_0024131 | Ga0495592_0024131_3739_4281 | 180 |
| 846 | 3300046459 | Ga0495629_0000077 | Ga0495629_0000077_74716_75264 | 180 |
| 847 | 3300046459 | Ga0495629_0001874 | Ga0495629_0001874_14096_14638 | 180 |
| 848 | 3300046460 | Ga0495638_0003381 | Ga0495638_0003381_3903_4445 | 180 |
| 849 | 3300046462 | Ga0495651_0000998 | Ga0495651_0000998_20096_20638 | 180 |
| 850 | 3300046462 | Ga0495651_0007709 | Ga0495651_0007709_2476_3018 | 180 |
| 851 | 3300046462 | Ga0495651_0014165 | Ga0495651_0014165_4443_4991 | 180 |
| 852 | 3300046463 | Ga0495653_0002848 | Ga0495653_0002848_2559_3107 | 180 |
| 853 | 3300046463 | Ga0495653_0039737 | Ga0495653_0039737_2750_3292 | 180 |
| 854 | 3300046477 | Ga0495664_0031350 | Ga0495664_0031350_2244_2786 | 180 |
| 855 | 3300046477 | Ga0495664_0091995 | Ga0495664_0091995_327_869 | 180 |
| 856 | 3300046491 | Ga0495584_0097665 | Ga0495584_0097665_873_1415 | 180 |
| 857 | 3300046491 | Ga0495584_0231768 | Ga0495584_0231768_252_794 | 180 |
| 858 | 3300046491 | Ga0495584_0310212 | Ga0495584_0310212_46_588 | 180 |
| 859 | 3300046492 | Ga0495585_0218648 | Ga0495585_0218648_155_697 | 180 |
| 860 | 3300046499 | Ga0495594_0251690 | Ga0495594_0251690_384_926 | 180 |
| 861 | 3300046500 | Ga0495596_0261390 | Ga0495596_0261390_94_636 | 180 |
| 862 | 3300046507 | Ga0495606_0016617 | Ga0495606_0016617_2377_2919 | 180 |
| 863 | 3300046511 | Ga0495608_0004861 | Ga0495608_0004861_3880_4428 | 180 |
| 864 | 3300046511 | Ga0495608_0036601 | Ga0495608_0036601_1205_1747 | 180 |
| 865 | 3300046512 | Ga0495610_0034048 | Ga0495610_0034048_1240_1782 | 180 |
| 866 | 3300046513 | Ga0495616_0145796 | Ga0495616_0145796_149_691 | 180 |
| 867 | 3300046516 | Ga0495628_0014816 | Ga0495628_0014816_1170_1718 | 180 |
| 868 | 3300046516 | Ga0495628_0027632 | Ga0495628_0027632_1363_1905 | 180 |
| 869 | 3300046516 | Ga0495628_0328876 | Ga0495628_0328876_75_617 | 180 |
| 870 | 3300046519 | Ga0495632_0092028 | Ga0495632_0092028_258_800 | 180 |
| 871 | 3300046524 | Ga0495648_0040464 | Ga0495648_0040464_1712_2254 | 180 |
| 872 | 3300046528 | Ga0495642_0149036 | Ga0495642_0149036_39_581 | 180 |
| 873 | 3300046529 | Ga0495652_0035210 | Ga0495652_0035210_1203_1745 | 180 |
| 874 | 3300046529 | Ga0495652_0035670 | Ga0495652_0035670_2549_3097 | 180 |
| 875 | 3300046529 | Ga0495652_0085510 | Ga0495652_0085510_1817_2359 | 180 |
| 876 | 3300046529 | Ga0495652_0295280 | Ga0495652_0295280_56_598 | 180 |
| 877 | 3300046533 | Ga0495640_0097751 | Ga0495640_0097751_1358_1906 | 180 |
| 878 | 3300046536 | Ga0495587_0008879 | Ga0495587_0008879_4915_5457 | 180 |
| 879 | 3300046536 | Ga0495587_0015099 | Ga0495587_0015099_3582_4130 | 180 |
| 880 | 3300046538 | Ga0495609_0115113 | Ga0495609_0115113_554_1096 | 180 |
| 881 | 3300046542 | Ga0495597_0136927 | Ga0495597_0136927_279_821 | 180 |
| 882 | 3300046543 | Ga0495645_0291672 | Ga0495645_0291672_444_992 | 180 |
| 883 | 3300046557 | Ga0495622_0023742 | Ga0495622_0023742_2008_2550 | 180 |
| 884 | 3300046559 | Ga0495667_0009076 | Ga0495667_0009076_1041_1589 | 180 |
| 885 | 3300046559 | Ga0495667_0042791 | Ga0495667_0042791_1851_2393 | 180 |
| 886 | 3300046616 | Ga0495668_0057213 | Ga0495668_0057213_1526_2068 | 180 |
| 887 | 3300046616 | Ga0495668_0366617 | Ga0495668_0366617_171_716 | 180 |
| 888 | 3300046642 | Ga0495634_0025034 | Ga0495634_0025034_3314_3856 | 180 |
| 889 | 3300046660 | Ga0495625_0388317 | Ga0495625_0388317_17_559 | 180 |
| 890 | 3300046663 | Ga0495635_0000160 | Ga0495635_0000160_7735_8283 | 180 |
| 891 | 3300046663 | Ga0495635_0045294 | Ga0495635_0045294_723_1265 | 180 |
| 892 | 3300046663 | Ga0495635_0450937 | Ga0495635_0450937_195_737 | 180 |
| 893 | 3300046674 | Ga0495588_0018312 | Ga0495588_0018312_1633_2175 | 180 |
| 894 | 3300046675 | Ga0495657_0000879 | Ga0495657_0000879_21193_21741 | 180 |
| 895 | 3300046675 | Ga0495657_0005900 | Ga0495657_0005900_7753_8295 | 180 |
| 896 | 3300046675 | Ga0495657_0045190 | Ga0495657_0045190_952_1494 | 180 |
| 897 | 3300046678 | Ga0495599_0006440 | Ga0495599_0006440_5177_5725 | 180 |
| 898 | 3300046678 | Ga0495599_0036498 | Ga0495599_0036498_1030_1572 | 180 |
| 899 | 3300046679 | Ga0495623_0022863 | Ga0495623_0022863_2388_2936 | 180 |
| 900 | 3300046680 | Ga0495646_0011620 | Ga0495646_0011620_1149_1691 | 180 |
| 901 | 3300046683 | Ga0495658_0467759 | Ga0495658_0467759_220_762 | 180 |
| 902 | 3300046684 | Ga0495669_0166786 | Ga0495669_0166786_415_957 | 180 |
| 903 | 3300046690 | Ga0495624_0060002 | Ga0495624_0060002_1788_2330 | 180 |
| 904 | 3300046694 | Ga0495649_0062500 | Ga0495649_0062500_60_602 | 180 |
| 905 | 3300046694 | Ga0495649_0074141 | Ga0495649_0074141_908_1450 | 180 |
| 906 | 3300046694 | Ga0495649_0110748 | Ga0495649_0110748_850_1392 | 180 |
| 907 | 3300046809 | Ga0495600_0003305 | Ga0495600_0003305_7872_8420 | 180 |
| 908 | 3300046809 | Ga0495600_0019159 | Ga0495600_0019159_1898_2440 | 180 |
| 909 | 3300046809 | Ga0495600_0064139 | Ga0495600_0064139_729_1271 | 180 |
| 910 | 3300046810 | Ga0495660_0097091 | Ga0495660_0097091_108_650 | 180 |
| 911 | 3300047317 | Ga0495604_0055766 | Ga0495604_0055766_2337_2879 | 180 |
| 912 | 3300047317 | Ga0495604_0060760 | Ga0495604_0060760_754_1302 | 180 |
| 913 | 3300047322 | Ga0495680_0003079 | Ga0495680_0003079_14512_15054 | 180 |
| 914 | 3300047322 | Ga0495680_0022685 | Ga0495680_0022685_239_787 | 180 |
| 915 | 3300047323 | Ga0495683_0031335 | Ga0495683_0031335_1569_2111 | 180 |
| 916 | 3300047323 | Ga0495683_0203155 | Ga0495683_0203155_106_648 | 180 |
| 917 | 3300047443 | Ga0495687_185412 | Ga0495687_185412_10_552 | 180 |
| 918 | 3300047469 | Ga0495673_0065060 | Ga0495673_0065060_589_1131 | 180 |
| 919 | 3300047471 | Ga0495684_0036692 | Ga0495684_0036692_397_945 | 180 |
| 920 | 3300047471 | Ga0495684_0072494 | Ga0495684_0072494_73_615 | 180 |
| 921 | 3300047472 | Ga0495686_0076336 | Ga0495686_0076336_769_1311 | 180 |
| 922 | 3300047472 | Ga0495686_0080518 | Ga0495686_0080518_26_568 | 180 |
| 923 | 3300047472 | Ga0495686_0183940 | Ga0495686_0183940_78_620 | 180 |
| 924 | 3300047673 | Ga0495593_0022703 | Ga0495593_0022703_2838_3386 | 180 |
| 925 | 3300047673 | Ga0495593_0286107 | Ga0495593_0286107_236_778 | 180 |
| 926 | 3300048088 | Ga0495602_0011303 | Ga0495602_0011303_558_1100 | 180 |
| 927 | 3300048088 | Ga0495602_0038574 | Ga0495602_0038574_754_1302 | 180 |
| 928 | 3300048088 | Ga0495602_0346360 | Ga0495602_0346360_315_857 | 180 |
| 929 | 3300048089 | Ga0495614_0200275 | Ga0495614_0200275_81_623 | 180 |
| 930 | 3300048903 | Ga0496100_0084030 | Ga0496100_0084030_32_574 | 180 |
| 931 | 3300048904 | Ga0496101_0059075 | Ga0496101_0059075_2002_2544 | 180 |
| 932 | 3300048904 | Ga0496101_0072025 | Ga0496101_0072025_648_1190 | 180 |
| 933 | 3300048904 | Ga0496101_0158441 | Ga0496101_0158441_343_885 | 180 |
| 934 | 3300048904 | Ga0496101_0182757 | Ga0496101_0182757_952_1497 | 180 |
| 935 | 3300048904 | Ga0496101_0543616 | Ga0496101_0543616_16_558 | 180 |
| 936 | 3300048905 | Ga0496102_0281194 | Ga0496102_0281194_817_1359 | 180 |
| 937 | 3300048907 | Ga0496104_0009595 | Ga0496104_0009595_1609_2151 | 180 |
| 938 | 3300048907 | Ga0496104_0026681 | Ga0496104_0026681_3912_4457 | 180 |
| 939 | 3300048907 | Ga0496104_0369287 | Ga0496104_0369287_452_994 | 180 |
| 940 | 3300048908 | Ga0496105_0005245 | Ga0496105_0005245_6653_7195 | 180 |
| 941 | 3300048908 | Ga0496105_0032335 | Ga0496105_0032335_2878_3420 | 180 |
| 942 | 3300048908 | Ga0496105_0036221 | Ga0496105_0036221_100_642 | 180 |
| 943 | 3300048908 | Ga0496105_0048740 | Ga0496105_0048740_11_556 | 180 |
| 944 | 3300048909 | Ga0496106_0102797 | Ga0496106_0102797_94_636 | 180 |
| 945 | 3300048909 | Ga0496106_0286438 | Ga0496106_0286438_720_1262 | 180 |
| 946 | 3300048911 | Ga0496108_0091996 | Ga0496108_0091996_285_830 | 180 |
| 947 | 3300048911 | Ga0496108_0463158 | Ga0496108_0463158_481_1023 | 180 |
| 948 | 3300048912 | Ga0496109_0066655 | Ga0496109_0066655_2542_3084 | 180 |
| 949 | 3300048913 | Ga0496110_0126508 | Ga0496110_0126508_279_824 | 180 |
| 950 | 3300048914 | Ga0496111_0131764 | Ga0496111_0131764_997_1539 | 180 |
| 951 | 3300048915 | Ga0496112_0071713 | Ga0496112_0071713_1301_1843 | 180 |
| 952 | 3300048915 | Ga0496112_0076624 | Ga0496112_0076624_2680_3222 | 180 |
| 953 | 3300048915 | Ga0496112_0183402 | Ga0496112_0183402_1051_1596 | 180 |
| 954 | 3300048916 | Ga0496113_0108366 | Ga0496113_0108366_83_625 | 180 |
| 955 | 3300048917 | Ga0496114_0050479 | Ga0496114_0050479_165_707 | 180 |
| 956 | 3300048917 | Ga0496114_0337485 | Ga0496114_0337485_686_1228 | 180 |
| 957 | 3300048917 | Ga0496114_0449791 | Ga0496114_0449791_122_664 | 180 |
| 958 | 3300048918 | Ga0496115_0025923 | Ga0496115_0025923_1453_1995 | 180 |
| 959 | 3300048918 | Ga0496115_0029725 | Ga0496115_0029725_292_834 | 180 |
| 960 | 3300048918 | Ga0496115_0251683 | Ga0496115_0251683_597_1142 | 180 |
| 961 | 3300048918 | Ga0496115_0429543 | Ga0496115_0429543_169_711 | 180 |
| 962 | 3300048919 | Ga0496116_0076390 | Ga0496116_0076390_1501_2043 | 180 |
| 963 | 3300048919 | Ga0496116_0178122 | Ga0496116_0178122_229_771 | 180 |
| 964 | 3300048921 | Ga0496118_0069862 | Ga0496118_0069862_1977_2519 | 180 |
| 965 | 3300048922 | Ga0496119_0037130 | Ga0496119_0037130_417_959 | 180 |
| 966 | 3300048922 | Ga0496119_0044456 | Ga0496119_0044456_475_1017 | 180 |
| 967 | 3300048923 | Ga0496120_0014100 | Ga0496120_0014100_2438_2980 | 180 |
| 968 | 3300048924 | Ga0496121_0033032 | Ga0496121_0033032_1134_1676 | 180 |
| 969 | 3300048924 | Ga0496121_0037558 | Ga0496121_0037558_751_1293 | 180 |
| 970 | 3300048924 | Ga0496121_0062533 | Ga0496121_0062533_263_805 | 180 |
| 971 | 3300048924 | Ga0496121_0217800 | Ga0496121_0217800_168_710 | 180 |
| 972 | 3300048924 | Ga0496121_0530931 | Ga0496121_0530931_171_713 | 180 |
| 973 | 3300048925 | Ga0496122_0115896 | Ga0496122_0115896_922_1464 | 180 |
| 974 | 3300048926 | Ga0496123_0070330 | Ga0496123_0070330_790_1332 | 180 |
| 975 | 3300048928 | Ga0496125_0050293 | Ga0496125_0050293_2635_3177 | 180 |
| 976 | 3300048929 | Ga0496126_0037507 | Ga0496126_0037507_2003_2545 | 180 |
| 977 | 3300048929 | Ga0496126_0099222 | Ga0496126_0099222_243_785 | 180 |
| 978 | 3300048929 | Ga0496126_0286798 | Ga0496126_0286798_660_1202 | 180 |
| 979 | 3300048929 | Ga0496126_0621102 | Ga0496126_0621102_45_587 | 180 |
| 980 | 3300049568 | Ga0501031_0112423 | Ga0501031_0112423_1160_1720 | 180 |
| 981 | 3300049569 | Ga0501032_0054807 | Ga0501032_0054807_1740_2300 | 180 |
| 982 | 3300049571 | Ga0501034_0253035 | Ga0501034_0253035_652_1212 | 180 |
| 983 | 3300049574 | Ga0501038_0531730 | Ga0501038_0531730_256_819 | 180 |
| 984 | 3300049580 | Ga0501046_0281836 | Ga0501046_0281836_413_973 | 180 |
| 985 | 3300049586 | Ga0501070_0255997 | Ga0501070_0255997_10_567 | 180 |
| 986 | 3300049590 | Ga0501074_0041653 | Ga0501074_0041653_1951_2508 | 180 |
| 987 | 3300049741 | Ga0501079_0238472 | Ga0501079_0238472_701_1261 | 180 |
| 988 | 3300049823 | Ga0501044_0357662 | Ga0501044_0357662_702_1262 | 180 |
| 989 | 3300049824 | Ga0501045_0276165 | Ga0501045_0276165_422_982 | 180 |
| 990 | 3300050492 | nmdc:mga0yw44_45512_c1 | nmdc:mga0yw44_45512_c1_361_903 | 180 |
| 991 | 3300050493 | nmdc:mga0k408_28756_c1 | nmdc:mga0k408_28756_c1_927_1469 | 180 |
| 992 | 3300050495 | nmdc:mga04h51_12410_c1 | nmdc:mga04h51_12410_c1_1684_2226 | 180 |
| 993 | 3300050512 | nmdc:mga0n895_58310_c1 | nmdc:mga0n895_58310_c1_2331_2873 | 180 |
| 994 | 3300050516 | nmdc:mga0sz30_114179_c1 | nmdc:mga0sz30_114179_c1_180_722 | 180 |
| 995 | 3300053077 | Ga0495601_0302551 | Ga0495601_0302551_390_938 | 180 |
| 996 | 3300053083 | Ga0495655_0054323 | Ga0495655_0054323_253_795 | 180 |
| 997 | 3300053084 | Ga0495595_0002792 | Ga0495595_0002792_4922_5470 | 180 |
| 998 | 3300053085 | Ga0495619_0001159 | Ga0495619_0001159_15660_16208 | 180 |
| 999 | 3300053087 | Ga0500643_000069 | Ga0500643_000069_3732_4274 | 180 |
| 1000 | 3300053092 | Ga0500583_0049077 | Ga0500583_0049077_306_848 | 180 |
| 1001 | 3300053094 | Ga0500566_0000112 | Ga0500566_0000112_31087_31629 | 180 |
| 1002 | 3300053095 | Ga0500640_029224 | Ga0500640_029224_621_1163 | 180 |
| 1003 | 3300053096 | Ga0500641_0164625 | Ga0500641_0164625_298_840 | 180 |
| 1004 | 3300053104 | Ga0500556_0068287 | Ga0500556_0068287_616_1158 | 180 |
| 1005 | 3300053108 | Ga0500562_001366 | Ga0500562_001366_169_711 | 180 |
| 1006 | 3300053109 | Ga0500569_150283 | Ga0500569_150283_229_771 | 180 |
| 1007 | 3300053119 | Ga0500595_029794 | Ga0500595_029794_101_643 | 180 |
| 1008 | 3300053130 | Ga0500642_0050838 | Ga0500642_0050838_483_1025 | 180 |
| 1009 | 3300053139 | Ga0500568_0012571 | Ga0500568_0012571_2164_2706 | 180 |
| 1010 | 3300053142 | Ga0500577_0122624 | Ga0500577_0122624_56_598 | 180 |
| 1011 | 3300053148 | Ga0500590_085681 | Ga0500590_085681_963_1505 | 180 |
| 1012 | 3300053148 | Ga0500590_104628 | Ga0500590_104628_569_1111 | 180 |
| 1013 | 3300053156 | Ga0500622_0046733 | Ga0500622_0046733_1196_1738 | 180 |
| 1014 | 3300053729 | Ga0500625_154897 | Ga0500625_154897_251_793 | 180 |
| 1015 | 3300053730 | Ga0500645_051386 | Ga0500645_051386_301_843 | 180 |
| 1016 | iso_pu_bacteria | 2508501009 | 2508541687 | 180 |
| 1017 | iso_pu_bacteria | 2515154112 | 2515626168 | 180 |
| 1018 | iso_pu_bacteria | 2744054633 | 2745080859 | 180 |
| 1019 | iso_pu_bacteria | 2874590934 | 2874598684 | 180 |
| 1020 | iso_pu_bacteria | 2874628541 | 2874634912 | 180 |
| 1021 | iso_pu_bacteria | 2874645413 | 2874652139 | 180 |
| 1022 | iso_pu_bacteria | 2876771140 | 2876778723 | 180 |
| 1023 | iso_pu_bacteria | 2876818435 | 2876823527 | 180 |
| 1024 | iso_pu_bacteria | 2879074833 | 2879082516 | 180 |
| 1025 | iso_pu_bacteria | 2935769743 | 2935776083 | 180 |
| 1026 | iso_pu_bacteria | 2935777560 | 2935785161 | 180 |
| 1027 | iso_pu_bacteria | 2935785616 | 2935791904 | 180 |
| 1028 | iso_pu_bacteria | 2935793552 | 2935800286 | 180 |
| 1029 | iso_pu_bacteria | 2935908558 | 2935909528 | 180 |
| 1030 | iso_pu_bacteria | 2935916978 | 2935917252 | 180 |
| 1031 | iso_pu_bacteria | 2935926038 | 2935927009 | 180 |
| 1032 | iso_pu_bacteria | 2935934488 | 2935937147 | 180 |
| 1033 | iso_pu_bacteria | 2935942939 | 2935944550 | 180 |
| 1034 | iso_pu_bacteria | 2935951376 | 2935952987 | 180 |
| 1035 | iso_pu_bacteria | 2935967501 | 2935969827 | 180 |
| 1036 | iso_pu_bacteria | 2935975950 | 2935976424 | 180 |
| 1037 | iso_pu_bacteria | 8016522445 | 8016528588 | 180 |
| 1038 | iso_pu_bacteria | 8016530956 | 8016533758 | 180 |
| 1039 | iso_pu_bacteria | 8016539877 | 8016546976 | 180 |
| 1040 | iso_pu_bacteria | 8016548790 | 8016555137 | 180 |
| 1041 | iso_pu_bacteria | 8016557553 | 8016563502 | 180 |
| 1042 | iso_pu_bacteria | 8016566248 | 8016572091 | 180 |
| 1043 | iso_pu_bacteria | 8016575299 | 8016576290 | 180 |
| 1044 | iso_pu_bacteria | 8016595262 | 8016601246 | 180 |
| 1045 | iso_pu_bacteria | 8016603502 | 8016609190 | 180 |
| 1046 | iso_pu_bacteria | 8016613128 | 8016615714 | 180 |
| 1047 | iso_pu_bacteria | 8016622563 | 8016625513 | 180 |
| 1048 | iso_pu_bacteria | 8019530166 | 8019533533 | 180 |
| 1049 | iso_pu_bacteria | 8019538911 | 8019546144 | 180 |
| 1050 | iso_pu_bacteria | 8019547302 | 8019552565 | 180 |
| 1051 | iso_pu_bacteria | 8019619141 | 8019619914 | 180 |
| 1052 | iso_pu_bacteria | 8019629233 | 8019633201 | 180 |
| 1053 | iso_pu_bacteria | 8019638758 | 8019646699 | 180 |
| 1054 | iso_pu_bacteria | 8019659431 | 8019661071 | 180 |
| 1055 | iso_pu_bacteria | 8019668869 | 8019670635 | 180 |
| 1056 | iso_pu_bacteria | 8019687851 | 8019691169 | 180 |
| 1057 | 3300003203 | JGI25406J46586_10000050 | JGI25406J46586_1000005030 | 181 |
| 1058 | 3300003320 | rootH2_10004786 | rootH2_100047862 | 181 |
| 1059 | 3300005327 | Ga0070658_10316039 | Ga0070658_103160392 | 181 |
| 1060 | 3300005330 | Ga0070690_100141045 | Ga0070690_1001410452 | 181 |
| 1061 | 3300005336 | Ga0070680_100567013 | Ga0070680_1005670132 | 181 |
| 1062 | 3300005338 | Ga0068868_100501825 | Ga0068868_1005018251 | 181 |
| 1063 | 3300005340 | Ga0070689_100139020 | Ga0070689_1001390202 | 181 |
| 1064 | 3300005355 | Ga0070671_100290738 | Ga0070671_1002907381 | 181 |
| 1065 | 3300005356 | Ga0070674_100244368 | Ga0070674_1002443681 | 181 |
| 1066 | 3300005434 | Ga0070709_10001579 | Ga0070709_100015795 | 181 |
| 1067 | 3300005434 | Ga0070709_10005406 | Ga0070709_100054065 | 181 |
| 1068 | 3300005434 | Ga0070709_10380775 | Ga0070709_103807752 | 181 |
| 1069 | 3300005435 | Ga0070714_100703754 | Ga0070714_1007037541 | 181 |
| 1070 | 3300005436 | Ga0070713_100005218 | Ga0070713_1000052185 | 181 |
| 1071 | 3300005436 | Ga0070713_100169747 | Ga0070713_1001697472 | 181 |
| 1072 | 3300005437 | Ga0070710_10000563 | Ga0070710_1000056311 | 181 |
| 1073 | 3300005437 | Ga0070710_10004747 | Ga0070710_100047471 | 181 |
| 1074 | 3300005437 | Ga0070710_10395793 | Ga0070710_103957931 | 181 |
| 1075 | 3300005455 | Ga0070663_100078923 | Ga0070663_1000789232 | 181 |
| 1076 | 3300005458 | Ga0070681_10416251 | Ga0070681_104162512 | 181 |
| 1077 | 3300005530 | Ga0070679_100249921 | Ga0070679_1002499212 | 181 |
| 1078 | 3300005530 | Ga0070679_100645756 | Ga0070679_1006457562 | 181 |
| 1079 | 3300005535 | Ga0070684_100000952 | Ga0070684_10000095214 | 181 |
| 1080 | 3300005539 | Ga0068853_100269422 | Ga0068853_1002694222 | 181 |
| 1081 | 3300005548 | Ga0070665_100822710 | Ga0070665_1008227102 | 181 |
| 1082 | 3300005563 | Ga0068855_100383382 | Ga0068855_1003833822 | 181 |
| 1083 | 3300005577 | Ga0068857_100293366 | Ga0068857_1002933663 | 181 |
| 1084 | 3300005616 | Ga0068852_100466182 | Ga0068852_1004661822 | 181 |
| 1085 | 3300005983 | Ga0081540_1016807 | Ga0081540_10168072 | 181 |
| 1086 | 3300005983 | Ga0081540_1056532 | Ga0081540_10565323 | 181 |
| 1087 | 3300005985 | Ga0081539_10000325 | Ga0081539_1000032531 | 181 |
| 1088 | 3300006028 | Ga0070717_10046100 | Ga0070717_100461004 | 181 |
| 1089 | 3300006028 | Ga0070717_10584610 | Ga0070717_105846102 | 181 |
| 1090 | 3300006058 | Ga0075432_10132197 | Ga0075432_101321972 | 181 |
| 1091 | 3300006163 | Ga0070715_10055764 | Ga0070715_100557642 | 181 |
| 1092 | 3300006163 | Ga0070715_10219311 | Ga0070715_102193112 | 181 |
| 1093 | 3300006163 | Ga0070715_10273242 | Ga0070715_102732421 | 181 |
| 1094 | 3300006175 | Ga0070712_100009777 | Ga0070712_1000097773 | 181 |
| 1095 | 3300006175 | Ga0070712_100014924 | Ga0070712_1000149245 | 181 |
| 1096 | 3300006175 | Ga0070712_100177856 | Ga0070712_1001778562 | 181 |
| 1097 | 3300006178 | Ga0075367_10467190 | Ga0075367_104671901 | 181 |
| 1098 | 3300006871 | Ga0075434_100250728 | Ga0075434_1002507282 | 181 |
| 1099 | 3300007788 | Ga0099795_10036743 | Ga0099795_100367432 | 181 |
| 1100 | 3300007788 | Ga0099795_10054815 | Ga0099795_100548151 | 181 |
| 1101 | 3300009093 | Ga0105240_10077860 | Ga0105240_100778602 | 181 |
| 1102 | 3300009093 | Ga0105240_10818069 | Ga0105240_108180692 | 181 |
| 1103 | 3300009098 | Ga0105245_10283167 | Ga0105245_102831672 | 181 |
| 1104 | 3300009147 | Ga0114129_11008986 | Ga0114129_110089861 | 181 |
| 1105 | 3300009176 | Ga0105242_11167832 | Ga0105242_111678321 | 181 |
| 1106 | 3300009551 | Ga0105238_10045750 | Ga0105238_100457504 | 181 |
| 1107 | 3300009551 | Ga0105238_10591728 | Ga0105238_105917282 | 181 |
| 1108 | 3300009553 | Ga0105249_11127669 | Ga0105249_111276691 | 181 |
| 1109 | 3300010159 | Ga0099796_10135143 | Ga0099796_101351432 | 181 |
| 1110 | 3300013102 | Ga0157371_10150504 | Ga0157371_101505042 | 181 |
| 1111 | 3300013104 | Ga0157370_10827658 | Ga0157370_108276582 | 181 |
| 1112 | 3300013105 | Ga0157369_10213289 | Ga0157369_102132892 | 181 |
| 1113 | 3300013296 | Ga0157374_10085901 | Ga0157374_100859014 | 181 |
| 1114 | 3300013297 | Ga0157378_10680078 | Ga0157378_106800782 | 181 |
| 1115 | 3300013306 | Ga0163162_10232236 | Ga0163162_102322361 | 181 |
| 1116 | 3300013307 | Ga0157372_10445403 | Ga0157372_104454032 | 181 |
| 1117 | 3300014325 | Ga0163163_10047093 | Ga0163163_100470935 | 181 |
| 1118 | 3300014326 | Ga0157380_10272723 | Ga0157380_102727232 | 181 |
| 1119 | 3300014968 | Ga0157379_10038813 | Ga0157379_100388133 | 181 |
| 1120 | 3300014969 | Ga0157376_10308492 | Ga0157376_103084922 | 181 |
| 1121 | 3300021377 | Ga0213874_10098188 | Ga0213874_100981882 | 181 |
| 1122 | 3300021384 | Ga0213876_10002729 | Ga0213876_100027294 | 181 |
| 1123 | 3300021384 | Ga0213876_10108796 | Ga0213876_101087962 | 181 |
| 1124 | 3300025250 | Ga0209026_1022664 | Ga0209026_10226642 | 181 |
| 1125 | 3300025898 | Ga0207692_10002141 | Ga0207692_100021414 | 181 |
| 1126 | 3300025898 | Ga0207692_10008931 | Ga0207692_100089315 | 181 |
| 1127 | 3300025898 | Ga0207692_10029494 | Ga0207692_100294942 | 181 |
| 1128 | 3300025898 | Ga0207692_10274388 | Ga0207692_102743882 | 181 |
| 1129 | 3300025903 | Ga0207680_10416025 | Ga0207680_104160252 | 181 |
| 1130 | 3300025905 | Ga0207685_10060767 | Ga0207685_100607672 | 181 |
| 1131 | 3300025905 | Ga0207685_10269519 | Ga0207685_102695192 | 181 |
| 1132 | 3300025906 | Ga0207699_10000503 | Ga0207699_1000050310 | 181 |
| 1133 | 3300025906 | Ga0207699_10010550 | Ga0207699_100105505 | 181 |
| 1134 | 3300025906 | Ga0207699_10154430 | Ga0207699_101544302 | 181 |
| 1135 | 3300025909 | Ga0207705_10282447 | Ga0207705_102824472 | 181 |
| 1136 | 3300025912 | Ga0207707_10428673 | Ga0207707_104286731 | 181 |
| 1137 | 3300025913 | Ga0207695_10265824 | Ga0207695_102658242 | 181 |
| 1138 | 3300025914 | Ga0207671_10156310 | Ga0207671_101563102 | 181 |
| 1139 | 3300025915 | Ga0207693_10010478 | Ga0207693_100104782 | 181 |
| 1140 | 3300025915 | Ga0207693_10014747 | Ga0207693_100147473 | 181 |
| 1141 | 3300025916 | Ga0207663_10001800 | Ga0207663_100018002 | 181 |
| 1142 | 3300025917 | Ga0207660_10434921 | Ga0207660_104349212 | 181 |
| 1143 | 3300025924 | Ga0207694_10084993 | Ga0207694_100849932 | 181 |
| 1144 | 3300025928 | Ga0207700_10056742 | Ga0207700_100567422 | 181 |
| 1145 | 3300025928 | Ga0207700_10198422 | Ga0207700_101984222 | 181 |
| 1146 | 3300025929 | Ga0207664_10028269 | Ga0207664_100282693 | 181 |
| 1147 | 3300025931 | Ga0207644_10427416 | Ga0207644_104274161 | 181 |
| 1148 | 3300025935 | Ga0207709_10297134 | Ga0207709_102971341 | 181 |
| 1149 | 3300025936 | Ga0207670_10070252 | Ga0207670_100702524 | 181 |
| 1150 | 3300025937 | Ga0207669_10052811 | Ga0207669_100528112 | 181 |
| 1151 | 3300025944 | Ga0207661_10000917 | Ga0207661_100009174 | 181 |
| 1152 | 3300025949 | Ga0207667_10623081 | Ga0207667_106230812 | 181 |
| 1153 | 3300026023 | Ga0207677_10416807 | Ga0207677_104168072 | 181 |
| 1154 | 3300026041 | Ga0207639_10028169 | Ga0207639_100281694 | 181 |
| 1155 | 3300026067 | Ga0207678_10021631 | Ga0207678_100216312 | 181 |
| 1156 | 3300026067 | Ga0207678_10033947 | Ga0207678_100339475 | 181 |
| 1157 | 3300026078 | Ga0207702_10997614 | Ga0207702_109976142 | 181 |
| 1158 | 3300026116 | Ga0207674_10360954 | Ga0207674_103609542 | 181 |
| 1159 | 3300027512 | Ga0209179_1004949 | Ga0209179_10049493 | 181 |
| 1160 | 3300027671 | Ga0209588_1000816 | Ga0209588_10008165 | 181 |
| 1161 | 3300028379 | Ga0268266_10108842 | Ga0268266_101088422 | 181 |
| 1162 | 3300028800 | Ga0265338_10381945 | Ga0265338_103819451 | 181 |
| 1163 | 3300030760 | Ga0265762_1022956 | Ga0265762_10229562 | 181 |
| 1164 | 3300031241 | Ga0265325_10032679 | Ga0265325_100326792 | 181 |
| 1165 | 3300031247 | Ga0265340_10044848 | Ga0265340_100448483 | 181 |
| 1166 | 3300031249 | Ga0265339_10013941 | Ga0265339_100139414 | 181 |
| 1167 | 3300031250 | Ga0265331_10055981 | Ga0265331_100559812 | 181 |
| 1168 | 3300031250 | Ga0265331_10084420 | Ga0265331_100844202 | 181 |
| 1169 | 3300031507 | Ga0307509_10503716 | Ga0307509_105037161 | 181 |
| 1170 | 3300031595 | Ga0265313_10021124 | Ga0265313_100211244 | 181 |
| 1171 | 3300031711 | Ga0265314_10067654 | Ga0265314_100676542 | 181 |
| 1172 | 3300031712 | Ga0265342_10008230 | Ga0265342_100082305 | 181 |
| 1173 | 3300031731 | Ga0307405_10076072 | Ga0307405_100760723 | 181 |
| 1174 | 3300032126 | Ga0307415_100175699 | Ga0307415_1001756991 | 181 |
| 1175 | 3300033180 | Ga0307510_10168454 | Ga0307510_101684542 | 181 |
| 1176 | 3300035083 | Ga0373926_0132831 | Ga0373926_0132831_163_708 | 181 |
| 1177 | 3300035089 | Ga0373944_0084789 | Ga0373944_0084789_336_881 | 181 |
| 1178 | 3300035111 | Ga0373923_0001465 | Ga0373923_0001465_3972_4517 | 181 |
| 1179 | 3300035113 | Ga0373936_0011859 | Ga0373936_0011859_281_826 | 181 |
| 1180 | 3300035117 | Ga0373953_0312793 | Ga0373953_0312793_54_599 | 181 |
| 1181 | 3300035118 | Ga0373954_0280203 | Ga0373954_0280203_101_646 | 181 |
| 1182 | 3300035170 | Ga0373943_0003121 | Ga0373943_0003121_1252_1797 | 181 |
| 1183 | 3300035170 | Ga0373943_0255731 | Ga0373943_0255731_112_657 | 181 |
| 1184 | 3300035171 | Ga0373946_0054567 | Ga0373946_0054567_39_584 | 181 |
| 1185 | 3300035692 | Ga0373935_0007485 | Ga0373935_0007485_3024_3569 | 181 |
| 1186 | 3300035695 | Ga0373927_0000783 | Ga0373927_0000783_6067_6612 | 181 |
| 1187 | 3300035695 | Ga0373927_0125122 | Ga0373927_0125122_457_1026 | 181 |
| 1188 | 3300035724 | Ga0373933_0000745 | Ga0373933_0000745_11616_12167 | 181 |
| 1189 | 3300035725 | Ga0373947_0001285 | Ga0373947_0001285_10763_11308 | 181 |
| 1190 | 3300036401 | Ga0373937_0055982 | Ga0373937_0055982_1204_1749 | 181 |
| 1191 | 3300037068 | Ga0373925_0009084 | Ga0373925_0009084_1967_2512 | 181 |
| 1192 | 3300037312 | Ga0395899_0052019 | Ga0395899_0052019_1753_2298 | 181 |
| 1193 | 3300037312 | Ga0395899_0155113 | Ga0395899_0155113_142_687 | 181 |
| 1194 | 3300037418 | Ga0395900_0001070 | Ga0395900_0001070_20695_21240 | 181 |
| 1195 | 3300037466 | Ga0395898_0001820 | Ga0395898_0001820_481_1026 | 181 |
| 1196 | 3300037466 | Ga0395898_0008100 | Ga0395898_0008100_6357_6902 | 181 |
| 1197 | 3300037466 | Ga0395898_1210145 | Ga0395898_1210145_101_646 | 181 |
| 1198 | 3300038443 | Ga0395901_0036584 | Ga0395901_0036584_4387_4932 | 181 |
| 1199 | 3300038443 | Ga0395901_0233509 | Ga0395901_0233509_1212_1763 | 181 |
| 1200 | 3300039437 | Ga0436365_0551209 | Ga0436365_0551209_518_1063 | 181 |
| 1201 | 3300039437 | Ga0436365_0766659 | Ga0436365_0766659_190_735 | 181 |
| 1202 | 3300039447 | Ga0436361_0733364 | Ga0436361_0733364_493_1038 | 181 |
| 1203 | 3300039447 | Ga0436361_0940506 | Ga0436361_0940506_137_682 | 181 |
| 1204 | 3300039450 | Ga0436363_0315242 | Ga0436363_0315242_217_762 | 181 |
| 1205 | 3300039450 | Ga0436363_0448550 | Ga0436363_0448550_230_775 | 181 |
| 1206 | 3300039450 | Ga0436363_0726009 | Ga0436363_0726009_62_607 | 181 |
| 1207 | 3300039450 | Ga0436363_1691007 | Ga0436363_1691007_3899_4444 | 181 |
| 1208 | 3300039453 | Ga0436362_0392249 | Ga0436362_0392249_229_774 | 181 |
| 1209 | 3300039453 | Ga0436362_0532768 | Ga0436362_0532768_2668_3213 | 181 |
| 1210 | 3300041453 | Ga0451797_1478868 | Ga0451797_1478868_126_671 | 181 |
| 1211 | 3300041498 | Ga0451841_0432165 | Ga0451841_0432165_547_1098 | 181 |
| 1212 | 3300044656 | Ga0466969_0265654 | Ga0466969_0265654_152_697 | 181 |
| 1213 | 3300044694 | Ga0466963_0018695 | Ga0466963_0018695_227_772 | 181 |
| 1214 | 3300044694 | Ga0466963_0025638 | Ga0466963_0025638_2693_3238 | 181 |
| 1215 | 3300044694 | Ga0466963_0417413 | Ga0466963_0417413_45_590 | 181 |
| 1216 | 3300044706 | Ga0466964_0256271 | Ga0466964_0256271_269_814 | 181 |
| 1217 | 3300044706 | Ga0466964_0423259 | Ga0466964_0423259_94_639 | 181 |
| 1218 | 3300044735 | Ga0466968_0152970 | Ga0466968_0152970_222_767 | 181 |
| 1219 | 3300044842 | Ga0466957_0229960 | Ga0466957_0229960_658_1203 | 181 |
| 1220 | 3300045976 | Ga0466967_0129640 | Ga0466967_0129640_16_561 | 181 |
| 1221 | 3300045976 | Ga0466967_0156615 | Ga0466967_0156615_1495_2040 | 181 |
| 1222 | 3300045976 | Ga0466967_1193165 | Ga0466967_1193165_158_703 | 181 |
| 1223 | 3300045976 | Ga0466967_1834124 | Ga0466967_1834124_22_567 | 181 |
| 1224 | 3300046455 | Ga0495603_0001681 | Ga0495603_0001681_9840_10385 | 181 |
| 1225 | 3300046455 | Ga0495603_0002554 | Ga0495603_0002554_2667_3218 | 181 |
| 1226 | 3300046459 | Ga0495629_0000165 | Ga0495629_0000165_46872_47417 | 181 |
| 1227 | 3300046460 | Ga0495638_0242061 | Ga0495638_0242061_357_902 | 181 |
| 1228 | 3300046461 | Ga0495641_0000929 | Ga0495641_0000929_10175_10720 | 181 |
| 1229 | 3300046472 | Ga0495580_0000913 | Ga0495580_0000913_6340_6885 | 181 |
| 1230 | 3300046473 | Ga0495582_0000016 | Ga0495582_0000016_100021_100566 | 181 |
| 1231 | 3300046475 | Ga0495639_0000014 | Ga0495639_0000014_7501_8046 | 181 |
| 1232 | 3300046476 | Ga0495662_0000086 | Ga0495662_0000086_4703_5248 | 181 |
| 1233 | 3300046499 | Ga0495594_0000420 | Ga0495594_0000420_8224_8769 | 181 |
| 1234 | 3300046514 | Ga0495618_0084275 | Ga0495618_0084275_353_898 | 181 |
| 1235 | 3300046516 | Ga0495628_0055901 | Ga0495628_0055901_137_682 | 181 |
| 1236 | 3300046517 | Ga0495630_0003176 | Ga0495630_0003176_276_821 | 181 |
| 1237 | 3300046517 | Ga0495630_0139089 | Ga0495630_0139089_965_1516 | 181 |
| 1238 | 3300046523 | Ga0495644_0056272 | Ga0495644_0056272_505_1050 | 181 |
| 1239 | 3300046524 | Ga0495648_0001270 | Ga0495648_0001270_1928_2587 | 181 |
| 1240 | 3300046529 | Ga0495652_0025241 | Ga0495652_0025241_439_984 | 181 |
| 1241 | 3300046531 | Ga0495665_0000665 | Ga0495665_0000665_7944_8489 | 181 |
| 1242 | 3300046533 | Ga0495640_0002399 | Ga0495640_0002399_1476_2021 | 181 |
| 1243 | 3300046557 | Ga0495622_0002786 | Ga0495622_0002786_3494_4039 | 181 |
| 1244 | 3300046559 | Ga0495667_0011830 | Ga0495667_0011830_2420_2965 | 181 |
| 1245 | 3300046642 | Ga0495634_0000859 | Ga0495634_0000859_18568_19113 | 181 |
| 1246 | 3300046648 | Ga0495611_0140338 | Ga0495611_0140338_67_618 | 181 |
| 1247 | 3300046663 | Ga0495635_0012918 | Ga0495635_0012918_2622_3167 | 181 |
| 1248 | 3300046674 | Ga0495588_0003175 | Ga0495588_0003175_5333_5878 | 181 |
| 1249 | 3300046680 | Ga0495646_0036240 | Ga0495646_0036240_378_929 | 181 |
| 1250 | 3300046681 | Ga0495647_0004777 | Ga0495647_0004777_2114_2659 | 181 |
| 1251 | 3300046683 | Ga0495658_0002129 | Ga0495658_0002129_9183_9728 | 181 |
| 1252 | 3300046689 | Ga0495613_0080984 | Ga0495613_0080984_1215_1760 | 181 |
| 1253 | 3300046690 | Ga0495624_0000138 | Ga0495624_0000138_24379_24924 | 181 |
| 1254 | 3300046809 | Ga0495600_0215981 | Ga0495600_0215981_481_1026 | 181 |
| 1255 | 3300047315 | Ga0495581_0000001 | Ga0495581_0000001_55848_56393 | 181 |
| 1256 | 3300047319 | Ga0495674_0005256 | Ga0495674_0005256_5159_5704 | 181 |
| 1257 | 3300047320 | Ga0495672_0004418 | Ga0495672_0004418_7053_7679 | 181 |
| 1258 | 3300047321 | Ga0495676_0040714 | Ga0495676_0040714_3031_3576 | 181 |
| 1259 | 3300047469 | Ga0495673_0068791 | Ga0495673_0068791_584_1129 | 181 |
| 1260 | 3300047673 | Ga0495593_0000006 | Ga0495593_0000006_83910_84455 | 181 |
| 1261 | 3300048089 | Ga0495614_0057226 | Ga0495614_0057226_952_1497 | 181 |
| 1262 | 3300048903 | Ga0496100_0247974 | Ga0496100_0247974_736_1299 | 181 |
| 1263 | 3300048905 | Ga0496102_0067901 | Ga0496102_0067901_1299_1862 | 181 |
| 1264 | 3300048905 | Ga0496102_0863936 | Ga0496102_0863936_182_727 | 181 |
| 1265 | 3300048908 | Ga0496105_0056871 | Ga0496105_0056871_556_1119 | 181 |
| 1266 | 3300048911 | Ga0496108_0029736 | Ga0496108_0029736_454_1017 | 181 |
| 1267 | 3300048912 | Ga0496109_0142003 | Ga0496109_0142003_433_996 | 181 |
| 1268 | 3300048915 | Ga0496112_0000044 | Ga0496112_0000044_25913_26464 | 181 |
| 1269 | 3300048915 | Ga0496112_0020643 | Ga0496112_0020643_5089_5652 | 181 |
| 1270 | 3300048917 | Ga0496114_0109489 | Ga0496114_0109489_1310_1873 | 181 |
| 1271 | 3300048917 | Ga0496114_0219590 | Ga0496114_0219590_1022_1567 | 181 |
| 1272 | 3300048918 | Ga0496115_0033607 | Ga0496115_0033607_2065_2610 | 181 |
| 1273 | 3300048918 | Ga0496115_0035946 | Ga0496115_0035946_2702_3265 | 181 |
| 1274 | 3300048918 | Ga0496115_0453673 | Ga0496115_0453673_459_1004 | 181 |
| 1275 | 3300048918 | Ga0496115_0761527 | Ga0496115_0761527_10_555 | 181 |
| 1276 | 3300048921 | Ga0496118_0198646 | Ga0496118_0198646_547_1092 | 181 |
| 1277 | 3300048924 | Ga0496121_0197133 | Ga0496121_0197133_828_1373 | 181 |
| 1278 | 3300048925 | Ga0496122_0024003 | Ga0496122_0024003_632_1177 | 181 |
| 1279 | 3300048929 | Ga0496126_0007021 | Ga0496126_0007021_10401_10946 | 181 |
| 1280 | 3300048929 | Ga0496126_0011784 | Ga0496126_0011784_1721_2266 | 181 |
| 1281 | 3300048929 | Ga0496126_0013214 | Ga0496126_0013214_7256_7801 | 181 |
| 1282 | 3300048929 | Ga0496126_0068932 | Ga0496126_0068932_1788_2333 | 181 |
| 1283 | 3300048929 | Ga0496126_0099061 | Ga0496126_0099061_906_1451 | 181 |
| 1284 | 3300048929 | Ga0496126_0331694 | Ga0496126_0331694_113_658 | 181 |
| 1285 | 3300049568 | Ga0501031_0032790 | Ga0501031_0032790_863_1408 | 181 |
| 1286 | 3300049569 | Ga0501032_0000198 | Ga0501032_0000198_10642_11187 | 181 |
| 1287 | 3300049570 | Ga0501033_0000091 | Ga0501033_0000091_42497_43042 | 181 |
| 1288 | 3300049571 | Ga0501034_0000039 | Ga0501034_0000039_109560_110105 | 181 |
| 1289 | 3300049572 | Ga0501036_0000347 | Ga0501036_0000347_1348_1893 | 181 |
| 1290 | 3300049573 | Ga0501037_0000025 | Ga0501037_0000025_12149_12694 | 181 |
| 1291 | 3300049574 | Ga0501038_0002497 | Ga0501038_0002497_5950_6495 | 181 |
| 1292 | 3300049575 | Ga0501039_0004443 | Ga0501039_0004443_1077_1622 | 181 |
| 1293 | 3300049579 | Ga0501043_0000233 | Ga0501043_0000233_48437_48982 | 181 |
| 1294 | 3300049580 | Ga0501046_0000995 | Ga0501046_0000995_14124_14669 | 181 |
| 1295 | 3300049581 | Ga0501047_0004251 | Ga0501047_0004251_11589_12134 | 181 |
| 1296 | 3300049581 | Ga0501047_0156948 | Ga0501047_0156948_1138_1689 | 181 |
| 1297 | 3300049581 | Ga0501047_0351056 | Ga0501047_0351056_570_1115 | 181 |
| 1298 | 3300049582 | Ga0501048_0000218 | Ga0501048_0000218_9819_10364 | 181 |
| 1299 | 3300049583 | Ga0501067_0004456 | Ga0501067_0004456_1364_1909 | 181 |
| 1300 | 3300049584 | Ga0501068_0000785 | Ga0501068_0000785_8854_9399 | 181 |
| 1301 | 3300049585 | Ga0501069_0000827 | Ga0501069_0000827_10769_11314 | 181 |
| 1302 | 3300049586 | Ga0501070_0049607 | Ga0501070_0049607_985_1530 | 181 |
| 1303 | 3300049586 | Ga0501070_0299202 | Ga0501070_0299202_103_648 | 181 |
| 1304 | 3300049588 | Ga0501072_0007128 | Ga0501072_0007128_6450_6995 | 181 |
| 1305 | 3300049589 | Ga0501073_0000118 | Ga0501073_0000118_48994_49539 | 181 |
| 1306 | 3300049590 | Ga0501074_0000273 | Ga0501074_0000273_1411_1956 | 181 |
| 1307 | 3300049741 | Ga0501079_0000590 | Ga0501079_0000590_18593_19138 | 181 |
| 1308 | 3300049742 | Ga0501080_0000124 | Ga0501080_0000124_34315_34860 | 181 |
| 1309 | 3300049744 | Ga0501083_0000184 | Ga0501083_0000184_35073_35618 | 181 |
| 1310 | 3300049822 | Ga0501035_0000052 | Ga0501035_0000052_90518_91063 | 181 |
| 1311 | 3300049822 | Ga0501035_0329775 | Ga0501035_0329775_167_718 | 181 |
| 1312 | 3300049822 | Ga0501035_0638617 | Ga0501035_0638617_187_732 | 181 |
| 1313 | 3300049823 | Ga0501044_0001974 | Ga0501044_0001974_21839_22384 | 181 |
| 1314 | 3300049823 | Ga0501044_0882526 | Ga0501044_0882526_87_638 | 181 |
| 1315 | 3300050496 | nmdc:mga07m45_332203_c1 | nmdc:mga07m45_332203_c1_169_714 | 181 |
| 1316 | 3300053080 | Ga0500635_0005505 | Ga0500635_0005505_888_1439 | 181 |
| 1317 | 3300053094 | Ga0500566_0372327 | Ga0500566_0372327_54_599 | 181 |
| 1318 | 3300053098 | Ga0500650_0268134 | Ga0500650_0268134_199_744 | 181 |
| 1319 | 3300053102 | Ga0500554_003067 | Ga0500554_003067_2447_2998 | 181 |
| 1320 | 3300053134 | Ga0500658_0412285 | Ga0500658_0412285_31_576 | 181 |
| 1321 | 3300053150 | Ga0500603_000747 | Ga0500603_000747_1751_2302 | 181 |
| 1322 | 3300053151 | Ga0500604_0053025 | Ga0500604_0053025_489_1034 | 181 |
| 1323 | 3300053158 | Ga0500627_0170721 | Ga0500627_0170721_81_626 | 181 |
| 1324 | 3300053178 | Ga0500637_0182883 | Ga0500637_0182883_20_571 | 181 |
| 1325 | 3300053724 | Ga0500570_071677 | Ga0500570_071677_631_1197 | 181 |
| 1326 | 3300053737 | Ga0500601_000736 | Ga0500601_000736_189_734 | 181 |
| 1327 | 3300054114 | Ga0501084_0002419 | Ga0501084_0002419_5950_6495 | 181 |
| 1328 | 3300060353 | Ga0501082_0000457 | Ga0501082_0000457_18945_19490 | 181 |
| 1329 | iso_pu_bacteria | 2513237141 | 2513894168 | 181 |
| 1330 | 3300031616 | Ga0307508_10065217 | Ga0307508_100652173 | 182 |
| 1331 | 3300039437 | Ga0436365_1026973 | Ga0436365_1026973_133_681 | 182 |
| 1332 | 3300046477 | Ga0495664_0096681 | Ga0495664_0096681_909_1457 | 182 |
| 1333 | 3300046517 | Ga0495630_0961129 | Ga0495630_0961129_54_602 | 182 |
| 1334 | 3300047319 | Ga0495674_0457991 | Ga0495674_0457991_14_562 | 182 |
| 1335 | 3300053105 | Ga0500557_000003 | Ga0500557_000003_138063_138611 | 182 |
| 1336 | 3300053729 | Ga0500625_005539 | Ga0500625_005539_2112_2660 | 182 |
| 1337 | iso_pu_bacteria | 2921643360 | 2921648042 | 182 |
| 1338 | 3300006175 | Ga0070712_100471136 | Ga0070712_1004711361 | 183 |
| 1339 | 3300007788 | Ga0099795_10012566 | Ga0099795_100125661 | 183 |
| 1340 | 3300025910 | Ga0207684_10347308 | Ga0207684_103473081 | 183 |
| 1341 | 3300025915 | Ga0207693_10078815 | Ga0207693_100788152 | 183 |
| 1342 | 3300025929 | Ga0207664_10455251 | Ga0207664_104552512 | 183 |
| 1343 | 3300025939 | Ga0207665_10032829 | Ga0207665_100328292 | 183 |
| 1344 | 3300027671 | Ga0209588_1060552 | Ga0209588_10605522 | 183 |
| 1345 | 3300035695 | Ga0373927_0003201 | Ga0373927_0003201_5311_5868 | 183 |
| 1346 | 3300035725 | Ga0373947_0005796 | Ga0373947_0005796_3097_3654 | 183 |
| 1347 | 3300037068 | Ga0373925_0483802 | Ga0373925_0483802_162_719 | 183 |
| 1348 | 3300046473 | Ga0495582_0228655 | Ga0495582_0228655_18_575 | 183 |
| 1349 | 3300046526 | Ga0495666_0197235 | Ga0495666_0197235_137_694 | 183 |
| 1350 | 3300046674 | Ga0495588_0089354 | Ga0495588_0089354_589_1146 | 183 |
| 1351 | 3300047321 | Ga0495676_0157359 | Ga0495676_0157359_957_1514 | 183 |
| 1352 | 3300048908 | Ga0496105_0471474 | Ga0496105_0471474_217_774 | 183 |
| 1353 | 3300048911 | Ga0496108_0030463 | Ga0496108_0030463_396_953 | 183 |
| 1354 | 3300048912 | Ga0496109_1167299 | Ga0496109_1167299_67_624 | 183 |
| 1355 | 3300048914 | Ga0496111_0091349 | Ga0496111_0091349_1614_2171 | 183 |
| 1356 | 3300048915 | Ga0496112_0165914 | Ga0496112_0165914_1131_1688 | 183 |
| 1357 | 3300048916 | Ga0496113_0548392 | Ga0496113_0548392_154_711 | 183 |
| 1358 | 3300003771 | Ga0055526_1040592 | Ga0055526_10405922 | 184 |
| 1359 | 3300005262 | Ga0065165_1006875 | Ga0065165_10068755 | 184 |
| 1360 | 3300005262 | Ga0065165_1011066 | Ga0065165_10110663 | 184 |
| 1361 | 3300005337 | Ga0070682_100130277 | Ga0070682_1001302772 | 184 |
| 1362 | 3300005344 | Ga0070661_100283551 | Ga0070661_1002835511 | 184 |
| 1363 | 3300005434 | Ga0070709_10051939 | Ga0070709_100519392 | 184 |
| 1364 | 3300005435 | Ga0070714_100038450 | Ga0070714_1000384503 | 184 |
| 1365 | 3300005436 | Ga0070713_100080887 | Ga0070713_1000808872 | 184 |
| 1366 | 3300005437 | Ga0070710_10000506 | Ga0070710_1000050610 | 184 |
| 1367 | 3300005439 | Ga0070711_100003355 | Ga0070711_1000033556 | 184 |
| 1368 | 3300005455 | Ga0070663_100116261 | Ga0070663_1001162612 | 184 |
| 1369 | 3300006028 | Ga0070717_10015855 | Ga0070717_100158557 | 184 |
| 1370 | 3300006038 | Ga0075365_10004379 | Ga0075365_100043797 | 184 |
| 1371 | 3300006048 | Ga0075363_100329241 | Ga0075363_1003292412 | 184 |
| 1372 | 3300006051 | Ga0075364_10201872 | Ga0075364_102018722 | 184 |
| 1373 | 3300006163 | Ga0070715_10000376 | Ga0070715_100003768 | 184 |
| 1374 | 3300006173 | Ga0070716_100054448 | Ga0070716_1000544482 | 184 |
| 1375 | 3300006175 | Ga0070712_100023662 | Ga0070712_1000236623 | 184 |
| 1376 | 3300006186 | Ga0075369_10128892 | Ga0075369_101288922 | 184 |
| 1377 | 3300006195 | Ga0075366_10028925 | Ga0075366_100289253 | 184 |
| 1378 | 3300014497 | Ga0182008_10279964 | Ga0182008_102799642 | 184 |
| 1379 | 3300025295 | Ga0209564_1008038 | Ga0209564_10080385 | 184 |
| 1380 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011420 | 184 |
| 1381 | 3300025298 | Ga0209050_1076411 | Ga0209050_10764112 | 184 |
| 1382 | 3300025299 | Ga0209256_1003911 | Ga0209256_10039115 | 184 |
| 1383 | 3300025302 | Ga0207426_1000292 | Ga0207426_100029276 | 184 |
| 1384 | 3300025303 | Ga0209051_1038395 | Ga0209051_10383953 | 184 |
| 1385 | 3300025304 | Ga0209257_1001242 | Ga0209257_100124216 | 184 |
| 1386 | 3300025898 | Ga0207692_10002191 | Ga0207692_100021911 | 184 |
| 1387 | 3300025905 | Ga0207685_10001380 | Ga0207685_100013802 | 184 |
| 1388 | 3300025906 | Ga0207699_10016050 | Ga0207699_100160502 | 184 |
| 1389 | 3300025906 | Ga0207699_10288892 | Ga0207699_102888922 | 184 |
| 1390 | 3300025909 | Ga0207705_10275071 | Ga0207705_102750712 | 184 |
| 1391 | 3300025915 | Ga0207693_10000085 | Ga0207693_1000008557 | 184 |
| 1392 | 3300025916 | Ga0207663_10000145 | Ga0207663_1000014512 | 184 |
| 1393 | 3300025929 | Ga0207664_10350136 | Ga0207664_103501362 | 184 |
| 1394 | 3300025939 | Ga0207665_10000229 | Ga0207665_1000022914 | 184 |
| 1395 | 3300026067 | Ga0207678_10254767 | Ga0207678_102547672 | 184 |
| 1396 | 3300036401 | Ga0373937_0017404 | Ga0373937_0017404_5225_5863 | 184 |
| 1397 | 3300037312 | Ga0395899_0658370 | Ga0395899_0658370_49_603 | 184 |
| 1398 | 3300037418 | Ga0395900_0130661 | Ga0395900_0130661_1766_2320 | 184 |
| 1399 | 3300037471 | Ga0395905_0910527 | Ga0395905_0910527_164_718 | 184 |
| 1400 | 3300041459 | Ga0451800_0883918 | Ga0451800_0883918_136_690 | 184 |
| 1401 | 3300041507 | Ga0451851_0421653 | Ga0451851_0421653_557_1111 | 184 |
| 1402 | 3300042005 | Ga0439448_0090233 | Ga0439448_0090233_189_743 | 184 |
| 1403 | 3300046679 | Ga0495623_0415218 | Ga0495623_0415218_23_577 | 184 |
| 1404 | 3300048912 | Ga0496109_0201139 | Ga0496109_0201139_428_982 | 184 |
| 1405 | 3300048913 | Ga0496110_0682134 | Ga0496110_0682134_70_624 | 184 |
| 1406 | 3300048914 | Ga0496111_0615582 | Ga0496111_0615582_200_754 | 184 |
| 1407 | 3300048915 | Ga0496112_0060244 | Ga0496112_0060244_612_1166 | 184 |
| 1408 | 3300048918 | Ga0496115_0545822 | Ga0496115_0545822_84_638 | 184 |
| 1409 | 3300050492 | nmdc:mga0yw44_266_c1 | nmdc:mga0yw44_266_c1_8800_9378 | 184 |
| 1410 | 3300050509 | nmdc:mga0qj67_639523_c1 | nmdc:mga0qj67_639523_c1_16_594 | 184 |
| 1411 | 3300053136 | Ga0500559_0083047 | Ga0500559_0083047_101_655 | 184 |
| 1412 | 3300053177 | Ga0500636_0000286 | Ga0500636_0000286_6114_6668 | 184 |
| 1413 | 3300053722 | Ga0500649_180359 | Ga0500649_180359_51_605 | 184 |
| 1414 | 3300000549 | LJQas_1002246 | LJQas_10022461 | 185 |
| 1415 | 3300005327 | Ga0070658_10109626 | Ga0070658_101096262 | 185 |
| 1416 | 3300005329 | Ga0070683_100066277 | Ga0070683_1000662774 | 185 |
| 1417 | 3300005334 | Ga0068869_100554129 | Ga0068869_1005541291 | 185 |
| 1418 | 3300005336 | Ga0070680_100004957 | Ga0070680_1000049572 | 185 |
| 1419 | 3300005336 | Ga0070680_100199398 | Ga0070680_1001993982 | 185 |
| 1420 | 3300005336 | Ga0070680_100308713 | Ga0070680_1003087132 | 185 |
| 1421 | 3300005336 | Ga0070680_100328176 | Ga0070680_1003281762 | 185 |
| 1422 | 3300005339 | Ga0070660_100229205 | Ga0070660_1002292052 | 185 |
| 1423 | 3300005366 | Ga0070659_100172269 | Ga0070659_1001722692 | 185 |
| 1424 | 3300005436 | Ga0070713_100216580 | Ga0070713_1002165802 | 185 |
| 1425 | 3300005439 | Ga0070711_100438016 | Ga0070711_1004380162 | 185 |
| 1426 | 3300005458 | Ga0070681_10019352 | Ga0070681_100193524 | 185 |
| 1427 | 3300005458 | Ga0070681_10341851 | Ga0070681_103418512 | 185 |
| 1428 | 3300005458 | Ga0070681_10441971 | Ga0070681_104419711 | 185 |
| 1429 | 3300005458 | Ga0070681_10637190 | Ga0070681_106371901 | 185 |
| 1430 | 3300005471 | Ga0070698_100199514 | Ga0070698_1001995141 | 185 |
| 1431 | 3300005530 | Ga0070679_100188624 | Ga0070679_1001886241 | 185 |
| 1432 | 3300005530 | Ga0070679_100193903 | Ga0070679_1001939032 | 185 |
| 1433 | 3300005535 | Ga0070684_100165447 | Ga0070684_1001654472 | 185 |
| 1434 | 3300005539 | Ga0068853_100011686 | Ga0068853_1000116863 | 185 |
| 1435 | 3300005547 | Ga0070693_100201142 | Ga0070693_1002011421 | 185 |
| 1436 | 3300005563 | Ga0068855_100105995 | Ga0068855_1001059952 | 185 |
| 1437 | 3300005563 | Ga0068855_100256501 | Ga0068855_1002565012 | 185 |
| 1438 | 3300005564 | Ga0070664_100424419 | Ga0070664_1004244192 | 185 |
| 1439 | 3300005577 | Ga0068857_100012744 | Ga0068857_1000127445 | 185 |
| 1440 | 3300005578 | Ga0068854_100604291 | Ga0068854_1006042911 | 185 |
| 1441 | 3300005616 | Ga0068852_100192794 | Ga0068852_1001927942 | 185 |
| 1442 | 3300005616 | Ga0068852_100330711 | Ga0068852_1003307112 | 185 |
| 1443 | 3300005834 | Ga0068851_10043794 | Ga0068851_100437943 | 185 |
| 1444 | 3300005843 | Ga0068860_100781147 | Ga0068860_1007811471 | 185 |
| 1445 | 3300005937 | Ga0081455_10006420 | Ga0081455_1000642010 | 185 |
| 1446 | 3300005983 | Ga0081540_1046363 | Ga0081540_10463633 | 185 |
| 1447 | 3300006038 | Ga0075365_10114872 | Ga0075365_101148722 | 185 |
| 1448 | 3300006358 | Ga0068871_100713106 | Ga0068871_1007131062 | 185 |
| 1449 | 3300007788 | Ga0099795_10046864 | Ga0099795_100468643 | 185 |
| 1450 | 3300007788 | Ga0099795_10283990 | Ga0099795_102839902 | 185 |
| 1451 | 3300009093 | Ga0105240_10120653 | Ga0105240_101206535 | 185 |
| 1452 | 3300009093 | Ga0105240_10370125 | Ga0105240_103701252 | 185 |
| 1453 | 3300009545 | Ga0105237_10013203 | Ga0105237_100132038 | 185 |
| 1454 | 3300009545 | Ga0105237_10169407 | Ga0105237_101694072 | 185 |
| 1455 | 3300009545 | Ga0105237_10214632 | Ga0105237_102146322 | 185 |
| 1456 | 3300009551 | Ga0105238_10196785 | Ga0105238_101967852 | 185 |
| 1457 | 3300009551 | Ga0105238_11245153 | Ga0105238_112451532 | 185 |
| 1458 | 3300010375 | Ga0105239_10019512 | Ga0105239_100195123 | 185 |
| 1459 | 3300013105 | Ga0157369_10038951 | Ga0157369_100389513 | 185 |
| 1460 | 3300013105 | Ga0157369_10047487 | Ga0157369_100474875 | 185 |
| 1461 | 3300013306 | Ga0163162_11337391 | Ga0163162_113373912 | 185 |
| 1462 | 3300013307 | Ga0157372_10089134 | Ga0157372_100891342 | 185 |
| 1463 | 3300013307 | Ga0157372_10994178 | Ga0157372_109941782 | 185 |
| 1464 | 3300014325 | Ga0163163_10184430 | Ga0163163_101844302 | 185 |
| 1465 | 3300014969 | Ga0157376_10566733 | Ga0157376_105667332 | 185 |
| 1466 | 3300020070 | Ga0206356_10863949 | Ga0206356_108639492 | 185 |
| 1467 | 3300020082 | Ga0206353_11063056 | Ga0206353_110630562 | 185 |
| 1468 | 3300021384 | Ga0213876_10051418 | Ga0213876_100514182 | 185 |
| 1469 | 3300025321 | Ga0207656_10022373 | Ga0207656_100223734 | 185 |
| 1470 | 3300025906 | Ga0207699_10062794 | Ga0207699_100627942 | 185 |
| 1471 | 3300025909 | Ga0207705_10107676 | Ga0207705_101076762 | 185 |
| 1472 | 3300025912 | Ga0207707_10000717 | Ga0207707_100007174 | 185 |
| 1473 | 3300025912 | Ga0207707_10001896 | Ga0207707_100018969 | 185 |
| 1474 | 3300025912 | Ga0207707_10409620 | Ga0207707_104096202 | 185 |
| 1475 | 3300025912 | Ga0207707_10692011 | Ga0207707_106920111 | 185 |
| 1476 | 3300025913 | Ga0207695_10092793 | Ga0207695_100927933 | 185 |
| 1477 | 3300025914 | Ga0207671_10035720 | Ga0207671_100357202 | 185 |
| 1478 | 3300025914 | Ga0207671_10646605 | Ga0207671_106466052 | 185 |
| 1479 | 3300025916 | Ga0207663_10260645 | Ga0207663_102606451 | 185 |
| 1480 | 3300025917 | Ga0207660_10012962 | Ga0207660_100129622 | 185 |
| 1481 | 3300025917 | Ga0207660_10149915 | Ga0207660_101499152 | 185 |
| 1482 | 3300025917 | Ga0207660_11010655 | Ga0207660_110106551 | 185 |
| 1483 | 3300025919 | Ga0207657_10006888 | Ga0207657_100068885 | 185 |
| 1484 | 3300025921 | Ga0207652_10022959 | Ga0207652_100229592 | 185 |
| 1485 | 3300025924 | Ga0207694_10179888 | Ga0207694_101798882 | 185 |
| 1486 | 3300025924 | Ga0207694_10558617 | Ga0207694_105586171 | 185 |
| 1487 | 3300025929 | Ga0207664_10238554 | Ga0207664_102385541 | 185 |
| 1488 | 3300025931 | Ga0207644_10404706 | Ga0207644_104047062 | 185 |
| 1489 | 3300025932 | Ga0207690_10180731 | Ga0207690_101807312 | 185 |
| 1490 | 3300025939 | Ga0207665_10009781 | Ga0207665_100097812 | 185 |
| 1491 | 3300025939 | Ga0207665_10768961 | Ga0207665_107689611 | 185 |
| 1492 | 3300025944 | Ga0207661_10238900 | Ga0207661_102389002 | 185 |
| 1493 | 3300025949 | Ga0207667_10271633 | Ga0207667_102716332 | 185 |
| 1494 | 3300026041 | Ga0207639_10006860 | Ga0207639_100068603 | 185 |
| 1495 | 3300026078 | Ga0207702_10259853 | Ga0207702_102598532 | 185 |
| 1496 | 3300026088 | Ga0207641_10294140 | Ga0207641_102941402 | 185 |
| 1497 | 3300026116 | Ga0207674_10011178 | Ga0207674_100111782 | 185 |
| 1498 | 3300026118 | Ga0207675_100854869 | Ga0207675_1008548692 | 185 |
| 1499 | 3300026142 | Ga0207698_10261855 | Ga0207698_102618553 | 185 |
| 1500 | 3300026142 | Ga0207698_10385805 | Ga0207698_103858052 | 185 |
| 1501 | 3300030521 | Ga0307511_10045798 | Ga0307511_100457984 | 185 |
| 1502 | 3300031235 | Ga0265330_10012565 | Ga0265330_100125654 | 185 |
| 1503 | 3300031239 | Ga0265328_10089696 | Ga0265328_100896961 | 185 |
| 1504 | 3300031250 | Ga0265331_10082448 | Ga0265331_100824482 | 185 |
| 1505 | 3300031250 | Ga0265331_10178250 | Ga0265331_101782501 | 185 |
| 1506 | 3300031344 | Ga0265316_10055188 | Ga0265316_100551882 | 185 |
| 1507 | 3300031507 | Ga0307509_10093399 | Ga0307509_100933994 | 185 |
| 1508 | 3300031616 | Ga0307508_10220463 | Ga0307508_102204632 | 185 |
| 1509 | 3300031616 | Ga0307508_10237559 | Ga0307508_102375592 | 185 |
| 1510 | 3300031712 | Ga0265342_10196665 | Ga0265342_101966652 | 185 |
| 1511 | 3300031730 | Ga0307516_10010277 | Ga0307516_100102776 | 185 |
| 1512 | 3300033179 | Ga0307507_10030697 | Ga0307507_100306975 | 185 |
| 1513 | 3300034819 | Ga0373958_0037397 | Ga0373958_0037397_277_840 | 185 |
| 1514 | 3300035113 | Ga0373936_0017834 | Ga0373936_0017834_744_1301 | 185 |
| 1515 | 3300035116 | Ga0373945_0198174 | Ga0373945_0198174_113_676 | 185 |
| 1516 | 3300035117 | Ga0373953_0081149 | Ga0373953_0081149_704_1267 | 185 |
| 1517 | 3300035118 | Ga0373954_0032382 | Ga0373954_0032382_1600_2163 | 185 |
| 1518 | 3300035119 | Ga0373956_0028341 | Ga0373956_0028341_899_1462 | 185 |
| 1519 | 3300035172 | Ga0373955_0175082 | Ga0373955_0175082_240_803 | 185 |
| 1520 | 3300035410 | Ga0373924_0095604 | Ga0373924_0095604_424_987 | 185 |
| 1521 | 3300035691 | Ga0373931_0006167 | Ga0373931_0006167_4202_4765 | 185 |
| 1522 | 3300035692 | Ga0373935_0223613 | Ga0373935_0223613_41_604 | 185 |
| 1523 | 3300035695 | Ga0373927_0109933 | Ga0373927_0109933_649_1212 | 185 |
| 1524 | 3300035695 | Ga0373927_0295969 | Ga0373927_0295969_94_657 | 185 |
| 1525 | 3300035725 | Ga0373947_0002225 | Ga0373947_0002225_1983_2546 | 185 |
| 1526 | 3300036401 | Ga0373937_0291115 | Ga0373937_0291115_54_617 | 185 |
| 1527 | 3300036401 | Ga0373937_0357148 | Ga0373937_0357148_562_1125 | 185 |
| 1528 | 3300037068 | Ga0373925_0571115 | Ga0373925_0571115_307_870 | 185 |
| 1529 | 3300038443 | Ga0395901_0230580 | Ga0395901_0230580_965_1540 | 185 |
| 1530 | 3300039447 | Ga0436361_0850535 | Ga0436361_0850535_242_799 | 185 |
| 1531 | 3300044684 | Ga0466966_0037736 | Ga0466966_0037736_1712_2269 | 185 |
| 1532 | 3300044765 | Ga0466970_0028528 | Ga0466970_0028528_259_816 | 185 |
| 1533 | 3300045049 | Ga0466959_0560060 | Ga0466959_0560060_25_582 | 185 |
| 1534 | 3300046462 | Ga0495651_0117801 | Ga0495651_0117801_913_1476 | 185 |
| 1535 | 3300046472 | Ga0495580_0012709 | Ga0495580_0012709_3785_4372 | 185 |
| 1536 | 3300046474 | Ga0495605_0096527 | Ga0495605_0096527_511_1098 | 185 |
| 1537 | 3300046477 | Ga0495664_0109702 | Ga0495664_0109702_667_1230 | 185 |
| 1538 | 3300046477 | Ga0495664_0168297 | Ga0495664_0168297_561_1124 | 185 |
| 1539 | 3300046491 | Ga0495584_0131219 | Ga0495584_0131219_266_853 | 185 |
| 1540 | 3300046506 | Ga0495583_0020320 | Ga0495583_0020320_447_1034 | 185 |
| 1541 | 3300046511 | Ga0495608_0085211 | Ga0495608_0085211_247_804 | 185 |
| 1542 | 3300046514 | Ga0495618_0080743 | Ga0495618_0080743_706_1269 | 185 |
| 1543 | 3300046516 | Ga0495628_0042840 | Ga0495628_0042840_1571_2134 | 185 |
| 1544 | 3300046528 | Ga0495642_0019111 | Ga0495642_0019111_1736_2323 | 185 |
| 1545 | 3300046529 | Ga0495652_0080110 | Ga0495652_0080110_922_1485 | 185 |
| 1546 | 3300046531 | Ga0495665_0050977 | Ga0495665_0050977_1298_1885 | 185 |
| 1547 | 3300046533 | Ga0495640_0045369 | Ga0495640_0045369_1585_2148 | 185 |
| 1548 | 3300046543 | Ga0495645_0039169 | Ga0495645_0039169_774_1337 | 185 |
| 1549 | 3300046543 | Ga0495645_0135638 | Ga0495645_0135638_550_1113 | 185 |
| 1550 | 3300046557 | Ga0495622_0016747 | Ga0495622_0016747_484_1071 | 185 |
| 1551 | 3300046557 | Ga0495622_0050150 | Ga0495622_0050150_254_817 | 185 |
| 1552 | 3300046559 | Ga0495667_0039008 | Ga0495667_0039008_1530_2093 | 185 |
| 1553 | 3300046642 | Ga0495634_0042688 | Ga0495634_0042688_1577_2140 | 185 |
| 1554 | 3300046663 | Ga0495635_0134480 | Ga0495635_0134480_623_1180 | 185 |
| 1555 | 3300046675 | Ga0495657_0061256 | Ga0495657_0061256_759_1322 | 185 |
| 1556 | 3300046678 | Ga0495599_0091650 | Ga0495599_0091650_148_711 | 185 |
| 1557 | 3300046689 | Ga0495613_0163535 | Ga0495613_0163535_195_758 | 185 |
| 1558 | 3300046794 | Ga0495589_0099354 | Ga0495589_0099354_402_989 | 185 |
| 1559 | 3300046809 | Ga0495600_0049648 | Ga0495600_0049648_1726_2289 | 185 |
| 1560 | 3300047315 | Ga0495581_0174967 | Ga0495581_0174967_316_891 | 185 |
| 1561 | 3300047317 | Ga0495604_0049825 | Ga0495604_0049825_1448_2011 | 185 |
| 1562 | 3300047319 | Ga0495674_0008899 | Ga0495674_0008899_8490_9077 | 185 |
| 1563 | 3300047319 | Ga0495674_0167618 | Ga0495674_0167618_711_1274 | 185 |
| 1564 | 3300047320 | Ga0495672_0029991 | Ga0495672_0029991_1197_1784 | 185 |
| 1565 | 3300047322 | Ga0495680_0044778 | Ga0495680_0044778_1792_2355 | 185 |
| 1566 | 3300047323 | Ga0495683_0036510 | Ga0495683_0036510_445_1032 | 185 |
| 1567 | 3300047443 | Ga0495687_041885 | Ga0495687_041885_466_1053 | 185 |
| 1568 | 3300047444 | Ga0495675_0046597 | Ga0495675_0046597_1937_2500 | 185 |
| 1569 | 3300047469 | Ga0495673_0023976 | Ga0495673_0023976_903_1490 | 185 |
| 1570 | 3300048088 | Ga0495602_0196436 | Ga0495602_0196436_687_1250 | 185 |
| 1571 | 3300048091 | Ga0495626_0171203 | Ga0495626_0171203_207_794 | 185 |
| 1572 | 3300048903 | Ga0496100_0006943 | Ga0496100_0006943_5110_5697 | 185 |
| 1573 | 3300048904 | Ga0496101_0085099 | Ga0496101_0085099_1068_1655 | 185 |
| 1574 | 3300048904 | Ga0496101_0128661 | Ga0496101_0128661_742_1299 | 185 |
| 1575 | 3300048904 | Ga0496101_0209036 | Ga0496101_0209036_137_700 | 185 |
| 1576 | 3300048905 | Ga0496102_0129692 | Ga0496102_0129692_970_1533 | 185 |
| 1577 | 3300048906 | Ga0496103_0155585 | Ga0496103_0155585_117_680 | 185 |
| 1578 | 3300048907 | Ga0496104_0022577 | Ga0496104_0022577_406_993 | 185 |
| 1579 | 3300048908 | Ga0496105_0311075 | Ga0496105_0311075_520_1107 | 185 |
| 1580 | 3300048908 | Ga0496105_0520715 | Ga0496105_0520715_72_629 | 185 |
| 1581 | 3300048910 | Ga0496107_0364903 | Ga0496107_0364903_121_708 | 185 |
| 1582 | 3300048912 | Ga0496109_0088762 | Ga0496109_0088762_2180_2743 | 185 |
| 1583 | 3300048913 | Ga0496110_0129876 | Ga0496110_0129876_14_571 | 185 |
| 1584 | 3300048915 | Ga0496112_0018929 | Ga0496112_0018929_5563_6150 | 185 |
| 1585 | 3300048915 | Ga0496112_0042168 | Ga0496112_0042168_1325_1888 | 185 |
| 1586 | 3300048916 | Ga0496113_0009278 | Ga0496113_0009278_4807_5394 | 185 |
| 1587 | 3300048917 | Ga0496114_0023840 | Ga0496114_0023840_119_682 | 185 |
| 1588 | 3300048918 | Ga0496115_0216934 | Ga0496115_0216934_399_956 | 185 |
| 1589 | 3300048918 | Ga0496115_0813661 | Ga0496115_0813661_124_711 | 185 |
| 1590 | 3300048922 | Ga0496119_0194322 | Ga0496119_0194322_161_748 | 185 |
| 1591 | 3300048923 | Ga0496120_0135828 | Ga0496120_0135828_578_1165 | 185 |
| 1592 | 3300048924 | Ga0496121_0001183 | Ga0496121_0001183_16649_17206 | 185 |
| 1593 | 3300048924 | Ga0496121_0051131 | Ga0496121_0051131_594_1181 | 185 |
| 1594 | 3300049568 | Ga0501031_0003098 | Ga0501031_0003098_1134_1706 | 185 |
| 1595 | 3300049570 | Ga0501033_0076980 | Ga0501033_0076980_1473_2045 | 185 |
| 1596 | 3300049570 | Ga0501033_0354966 | Ga0501033_0354966_51_623 | 185 |
| 1597 | 3300049571 | Ga0501034_0440586 | Ga0501034_0440586_74_646 | 185 |
| 1598 | 3300049574 | Ga0501038_0029365 | Ga0501038_0029365_3040_3612 | 185 |
| 1599 | 3300049581 | Ga0501047_0119159 | Ga0501047_0119159_1546_2118 | 185 |
| 1600 | 3300049582 | Ga0501048_0014866 | Ga0501048_0014866_1073_1645 | 185 |
| 1601 | 3300049586 | Ga0501070_0156786 | Ga0501070_0156786_1232_1804 | 185 |
| 1602 | 3300049741 | Ga0501079_0115213 | Ga0501079_0115213_602_1174 | 185 |
| 1603 | 3300049742 | Ga0501080_0545977 | Ga0501080_0545977_154_726 | 185 |
| 1604 | 3300049822 | Ga0501035_0107271 | Ga0501035_0107271_404_976 | 185 |
| 1605 | 3300049822 | Ga0501035_0507972 | Ga0501035_0507972_16_588 | 185 |
| 1606 | 3300049823 | Ga0501044_0176467 | Ga0501044_0176467_78_650 | 185 |
| 1607 | 3300049823 | Ga0501044_0199519 | Ga0501044_0199519_984_1556 | 185 |
| 1608 | 3300050492 | nmdc:mga0yw44_138752_c1 | nmdc:mga0yw44_138752_c1_752_1333 | 185 |
| 1609 | 3300050508 | nmdc:mga09592_573415_c1 | nmdc:mga09592_573415_c1_241_822 | 185 |
| 1610 | 3300053077 | Ga0495601_0166918 | Ga0495601_0166918_491_1054 | 185 |
| 1611 | 3300053078 | Ga0495612_0009808 | Ga0495612_0009808_789_1352 | 185 |
| 1612 | 3300053080 | Ga0500635_0102030 | Ga0500635_0102030_68_631 | 185 |
| 1613 | 3300053085 | Ga0495619_0454592 | Ga0495619_0454592_69_638 | 185 |
| 1614 | 3300053091 | Ga0500647_0070316 | Ga0500647_0070316_52_609 | 185 |
| 1615 | 3300053094 | Ga0500566_0002752 | Ga0500566_0002752_1555_2112 | 185 |
| 1616 | 3300053094 | Ga0500566_0125526 | Ga0500566_0125526_734_1297 | 185 |
| 1617 | 3300053095 | Ga0500640_011906 | Ga0500640_011906_1655_2212 | 185 |
| 1618 | 3300053111 | Ga0500572_001913 | Ga0500572_001913_1540_2097 | 185 |
| 1619 | 3300053119 | Ga0500595_002897 | Ga0500595_002897_1704_2261 | 185 |
| 1620 | 3300053119 | Ga0500595_037812 | Ga0500595_037812_800_1363 | 185 |
| 1621 | 3300053136 | Ga0500559_0007921 | Ga0500559_0007921_2574_3131 | 185 |
| 1622 | 3300053148 | Ga0500590_154222 | Ga0500590_154222_49_606 | 185 |
| 1623 | 3300053150 | Ga0500603_000314 | Ga0500603_000314_1555_2112 | 185 |
| 1624 | 3300053159 | Ga0500630_001943 | Ga0500630_001943_2141_2698 | 185 |
| 1625 | 3300053162 | Ga0500638_006964 | Ga0500638_006964_1038_1595 | 185 |
| 1626 | 3300053163 | Ga0500639_000357 | Ga0500639_000357_20429_20986 | 185 |
| 1627 | 3300053177 | Ga0500636_0098736 | Ga0500636_0098736_414_977 | 185 |
| 1628 | 3300053177 | Ga0500636_0249611 | Ga0500636_0249611_75_638 | 185 |
| 1629 | 3300053733 | Ga0500552_001281 | Ga0500552_001281_1204_1761 | 185 |
| 1630 | 3300053735 | Ga0500596_001208 | Ga0500596_001208_1555_2112 | 185 |
| 1631 | 3300054114 | Ga0501084_0057287 | Ga0501084_0057287_729_1301 | 185 |
| 1632 | iso_pu_bacteria | 2562617112 | 2563061729 | 185 |
| 1633 | iso_pu_bacteria | 2711768613 | 2713480144 | 185 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2vk1-assembly2.cif.gz_C | crystal structure of the saccharomyces cerevisiae pyruvate decarboxylase variant d28a in complex with its substrate | 0.8173 | 19 | 184 |
| 6lpi-assembly1.cif.gz_A | crystal structure of ahas holo-enzyme | 0.8137 | 18 | 180 |
| 6lpi-assembly4.cif.gz_D | crystal structure of ahas holo-enzyme | 0.8134 | 20 | 180 |
| 4gm0-assembly1.cif.gz_A | crystal structure of benzoylformate decarboxylase mutant l403n | 0.812 | 20 | 174 |
| 4gm4-assembly1.cif.gz_A | crystal structure of benzoylformate decarboxylase mutant l403i | 0.8118 | 20 | 174 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P58415_1_165_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9361 | 20 | 176 | 3.40.50.970 |
| af_P58415_1_165_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8877 | 20 | 176 | 3.40.50.970 |
| af_A4I3N7_14_187_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8793 | 19 | 174 | 3.40.50.970 |
| af_Q4D595_58_227_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8693 | 20 | 174 | 3.40.50.970 |
| af_A0A0R0ECS7_251_324_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8426 | 16 | 85 | 3.40.50.970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0E4FY14-F1-model_v4 | Phosphonopyruvate decarboxylase | 0.9854 | 20 | 185 |
GO:0016831
|
| AF-A0A3D0TJG8-F1-model_v4 | Phosphonopyruvate decarboxylase | 0.9828 | 19 | 177 |
GO:0016831
|
| AF-A0A1F4DVV5-F1-model_v4 | Phosphonopyruvate decarboxylase | 0.9796 | 24 | 185 |
GO:0016831
|
| AF-A0A7Z9M8S4-F1-model_v4 | Phosphonopyruvate decarboxylase | 0.9772 | 18 | 170 |
GO:0016831
|
| AF-A0A1Z8P0N5-F1-model_v4 | Phosphonopyruvate decarboxylase | 0.9747 | 19 | 185 |
GO:0016831
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar