F495144

General Info

Members Datasets Scaffolds Average Seq Length
1633 702 1455 182

Family's Representative Sequence

Representative Sequence 3300046524|Ga0495648_0001270|Ga0495648_0001270_1928_2587
Length 219
Sequence MLPYSLVEADMPFSLFPKSRLPLKSPPANRFADRLEMKMHARADTAAQIAPSWPEDIFTILQRFDVRQVPYVPDAGHSQLIERVLAAPSMRAVPLTTEEEGVALLAGAWAGGQRGVLLMQSSGVGNCVNMLSLTQVLRFPFLTLVTMRGEWGEFNPWQVPMGSSTAGVFELSGIKVLRASHAAEVREVVEAAAGQAYNACTPTAVLLSQRLIGAKVFTK

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
9 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
10 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
15 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
16 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
17 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
18 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
19 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
20 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
21 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
22 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
23 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
24 2791355199
25 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
26 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
27 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
28 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
29 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
30 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
31 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
32 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
33 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
34 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
35 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
36 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
37 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
38 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
39 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
40 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
41 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
42 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
43 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
44 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
45 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
46 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
47 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
48 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
49 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
50 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
51 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
52 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
53 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
54 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
55 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
56 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
57 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
58 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
59 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
60 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
61 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
62 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
63 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
64 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
65 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
66 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
67 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
68 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
69 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
70 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
71 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
72 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
73 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
74 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
75 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
76 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
77 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
78 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
79 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
80 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
81 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
82 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
83 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
84 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
85 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
86 2922368715
87 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
88 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
89 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
90 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
91 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
92 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
93 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
94 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
95 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
96 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
97 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
98 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
99 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
100 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
101 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
102 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
103 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
104 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
105 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
106 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
107 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
108 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
109 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
110 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
111 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
112 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
113 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
114 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
115 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
116 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
117 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
118 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
119 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
120 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
121 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
122 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
123 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
124 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
125 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
126 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
127 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
128 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
129 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
130 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
131 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
132 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
133 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
134 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
135 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
136 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
137 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
138 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
139 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
140 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
141 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
142 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
143 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
144 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
145 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
146 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
147 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
148 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
149 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
150 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
151 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
152 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
153 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
154 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
155 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
156 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
157 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
158 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
159 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
160 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
161 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
162 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
163 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
164 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
165 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
166 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
167 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
168 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
169 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
170 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
171 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
172 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
173 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
174 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
175 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
176 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
177 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
178 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
179 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
180 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
181 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
182 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
183 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
184 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
185 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
186 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
187 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
188 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
189 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
190 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
191 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
192 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
193 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
194 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
195 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
196 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
197 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
198 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
199 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
200 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
201 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
202 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
203 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
204 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
205 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
206 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
207 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
208 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
209 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
210 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
211 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
212 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
213 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
214 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
215 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
216 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
217 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
218 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
219 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
220 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
221 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
222 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
223 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
224 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
225 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
226 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
227 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
228 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
229 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
230 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
231 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
232 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
233 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
234 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
235 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
236 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
237 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
238 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
239 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
240 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
241 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
242 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
243 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
244 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
245 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
246 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
247 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
248 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
249 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
250 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
251 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
252 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
253 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
254 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
255 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
256 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
257 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
258 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
259 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
260 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
261 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
262 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
263 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
264 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
265 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
266 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
267 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
268 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
269 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
270 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
271 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
272 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
273 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
274 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
275 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
276 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
277 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
278 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
279 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
280 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
281 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
282 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
283 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
284 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
285 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
286 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
287 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
288 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
289 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
290 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
291 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
292 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
293 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
294 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
295 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
296 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
298 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
299 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
300 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
301 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
302 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
303 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
304 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
305 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
307 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
372 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
373 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
374 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
375 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
378 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
379 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
383 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
384 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
385 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
386 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
387 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
389 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
390 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
391 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
392 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
393 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
394 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
395 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
396 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
397 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
398 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
399 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
400 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
401 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
402 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
403 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
404 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
405 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
406 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
407 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
408 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
409 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
410 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
411 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
412 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
413 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
414 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
415 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
416 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
417 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
418 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
419 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
420 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
421 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
422 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
423 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
424 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
425 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
426 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
427 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
428 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
429 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
430 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
431 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
432 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
433 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
434 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
435 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
436 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
437 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
438 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
439 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
440 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
441 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
442 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
443 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
444 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
445 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
446 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
447 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
448 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
449 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
450 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
451 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
452 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
453 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
454 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
455 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
456 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
457 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
458 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
459 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
460 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
461 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
462 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
463 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
464 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
465 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
466 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
467 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
468 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
469 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
470 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
471 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
472 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
473 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
474 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
475 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
476 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
477 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
478 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
479 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
480 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
481 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
482 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
483 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
484 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
485 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
486 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
487 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
488 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
489 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
490 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
491 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
492 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
493 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
494 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
495 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
496 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
497 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
498 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
499 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
500 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
501 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
502 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
503 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
504 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
505 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
506 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
507 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
508 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
509 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
510 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
511 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
512 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
513 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
514 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
515 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
516 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
517 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
518 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
519 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
520 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
521 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
522 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
523 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
524 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
525 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
526 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
527 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
528 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
529 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
530 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
531 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
532 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
533 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
534 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
535 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
536 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
537 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
538 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
539 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
540 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
541 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
542 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
543 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
544 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
545 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
546 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
547 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
548 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
549 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
550 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
551 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
552 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
553 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
554 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
555 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
556 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
557 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
558 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
559 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
560 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
561 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
562 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
563 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
564 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
565 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
566 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
567 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
568 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
569 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
570 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
571 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
572 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
573 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
574 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
575 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
576 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
577 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
578 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
579 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
580 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
581 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
582 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
583 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
584 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
585 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
586 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
587 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
588 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
589 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
590 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
591 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
592 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
593 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
594 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
595 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
596 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
597 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
598 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
599 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
600 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
601 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
602 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
603 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
604 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
605 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
606 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
607 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
608 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
609 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
610 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
611 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
612 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
613 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
614 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
615 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
616 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
617 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
618 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
619 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
620 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
621 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
622 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
623 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
624 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
625 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
626 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
627 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
628 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
629 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
630 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
631 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
632 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
633 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
634 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
635 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
636 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
637 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
638 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
639 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
640 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
641 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
642 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
643 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
644 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
645 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
646 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
647 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
648 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
649 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
650 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
651 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
652 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
653 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
654 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
655 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
656 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
657 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
658 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
659 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
660 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
661 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
662 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
663 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
664 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
665 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
666 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
667 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
668 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
669 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
670 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
671 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
672 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
673 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
674 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
675 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
676 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
677 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
678 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
679 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
680 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
681 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
682 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
683 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
684 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
685 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
686 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
687 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
688 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
689 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
690 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
691 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
692 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
693 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
694 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
695 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
696 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
697 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
698 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
699 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
700 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
701 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
702 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.96
Metatranscriptomes 0.25
Isolates 10.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.37
Nodule 8.51
Rhizoplane 7.1
Rhizosphere 66.69
Stem 0
Stem Tuber 0
Unclassified 8.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1002246 3300000549 Bacteria 2722
2 JGI24749J21850_1027053 3300002076 Bacteria 818
3 JGI25406J46586_10000050 3300003203 Bacteria 54388
4 JGI25165J46597_1011970 3300003214 Bacteria 1225
5 JGI25153J46596_10000712 3300003215 Bacteria 20316
6 JGI25153J46596_10000760 3300003215 Bacteria 19717
7 JGI25153J46596_10011001 3300003215 Bacteria 4035
8 JGI25153J46596_10045521 3300003215 Bacteria 1308
9 rootH2_10004786 3300003320 Bacteria 1431
10 rootL2_10112590 3300003322 Bacteria 1798
11 JGI25160J50197_1002322 3300003354 Bacteria 8903
12 JGI25160J50197_1015410 3300003354 Bacteria 2509
13 JGI25161J50226_1011621 3300003374 Bacteria 1096
14 Ga0055526_1040592 3300003771 Bacteria 1171
15 Ga0055543_1003132 3300004625 Bacteria 5059
16 Ga0065165_1001109 3300005262 Bacteria 31984
17 Ga0065165_1006875 3300005262 Bacteria 5784
18 Ga0065165_1011066 3300005262 Bacteria 3815
19 Ga0065165_1044439 3300005262 Bacteria 1299
20 Ga0065712_10031307 3300005290 Bacteria 1312
21 Ga0070658_10001665 3300005327 Bacteria 18741
22 Ga0070658_10109626 3300005327 Bacteria 2286
23 Ga0070658_10316039 3300005327 Bacteria 1333
24 Ga0070676_10631456 3300005328 Bacteria 775
25 Ga0070683_100066277 3300005329 Bacteria 3363
26 Ga0070683_100445869 3300005329 Bacteria 1235
27 Ga0070690_100072362 3300005330 Bacteria 2241
28 Ga0070690_100141045 3300005330 Bacteria 1636
29 Ga0070690_100326214 3300005330 Bacteria 1108
30 Ga0070670_100578528 3300005331 Bacteria 1003
31 Ga0068869_100268730 3300005334 Bacteria 1367
32 Ga0068869_100504439 3300005334 Bacteria 1011
33 Ga0068869_100554129 3300005334 Bacteria 966
34 Ga0070680_100000866 3300005336 Bacteria 21501
35 Ga0070680_100004957 3300005336 Bacteria 10025
36 Ga0070680_100069793 3300005336 Bacteria 2886
37 Ga0070680_100199398 3300005336 Bacteria 1687
38 Ga0070680_100308713 3300005336 Bacteria 1342
39 Ga0070680_100328176 3300005336 Bacteria 1299
40 Ga0070680_100567013 3300005336 Bacteria 974
41 Ga0070682_100130277 3300005337 Bacteria 1701
42 Ga0070682_100268758 3300005337 Bacteria 1238
43 Ga0068868_100005376 3300005338 Bacteria 8999
44 Ga0068868_100089912 3300005338 Bacteria 2472
45 Ga0068868_100431979 3300005338 Bacteria 1142
46 Ga0068868_100501825 3300005338 Bacteria 1063
47 Ga0068868_100653356 3300005338 Bacteria 937
48 Ga0070660_100229205 3300005339 Bacteria 1511
49 Ga0070689_100087421 3300005340 Bacteria 2452
50 Ga0070689_100139020 3300005340 Bacteria 1952
51 Ga0070689_100287320 3300005340 Bacteria 1366
52 Ga0070691_10431570 3300005341 Bacteria 749
53 Ga0070687_100264188 3300005343 Bacteria 1076
54 Ga0070661_100232425 3300005344 Bacteria 1417
55 Ga0070661_100283551 3300005344 Bacteria 1285
56 Ga0070661_101033278 3300005344 Bacteria 683
57 Ga0070692_10033354 3300005345 Bacteria 2594
58 Ga0070692_10365314 3300005345 Bacteria 901
59 Ga0070692_10625378 3300005345 Bacteria 716
60 Ga0070668_100006807 3300005347 Bacteria 8475
61 Ga0070668_100030774 3300005347 Bacteria 4083
62 Ga0070668_100081083 3300005347 Bacteria 2543
63 Ga0070668_100111293 3300005347 Bacteria 2179
64 Ga0070668_100388922 3300005347 Bacteria 1188
65 Ga0070668_100427775 3300005347 Bacteria 1134
66 Ga0070668_100776849 3300005347 Bacteria 849
67 Ga0070671_100031101 3300005355 Bacteria 4408
68 Ga0070671_100127068 3300005355 Bacteria 2147
69 Ga0070671_100176438 3300005355 Bacteria 1808
70 Ga0070671_100290738 3300005355 Bacteria 1391
71 Ga0070674_100076912 3300005356 Bacteria 2374
72 Ga0070674_100095630 3300005356 Bacteria 2154
73 Ga0070674_100244368 3300005356 Bacteria 1407
74 Ga0070674_100431106 3300005356 Bacteria 1084
75 Ga0070674_100449243 3300005356 Bacteria 1063
76 Ga0070674_100808845 3300005356 Bacteria 810
77 Ga0070673_100080898 3300005364 Bacteria 2633
78 Ga0070673_100282428 3300005364 Bacteria 1456
79 Ga0070688_100005226 3300005365 Bacteria 6818
80 Ga0070688_100702752 3300005365 Bacteria 783
81 Ga0070659_100130397 3300005366 Bacteria 2042
82 Ga0070659_100172269 3300005366 Bacteria 1773
83 Ga0070659_100294566 3300005366 Bacteria 1352
84 Ga0070659_100328689 3300005366 Bacteria 1279
85 Ga0070667_100195022 3300005367 Bacteria 1795
86 Ga0070703_10027971 3300005406 Bacteria 1683
87 Ga0070709_10001579 3300005434 Bacteria 12291
88 Ga0070709_10005406 3300005434 Bacteria 6920
89 Ga0070709_10051939 3300005434 Bacteria 2574
90 Ga0070709_10380775 3300005434 Bacteria 1049
91 Ga0070714_100038450 3300005435 Bacteria 4022
92 Ga0070714_100703754 3300005435 Bacteria 975
93 Ga0070713_100005218 3300005436 Bacteria 8852
94 Ga0070713_100080887 3300005436 Bacteria 2771
95 Ga0070713_100169747 3300005436 Bacteria 1954
96 Ga0070713_100216580 3300005436 Bacteria 1736
97 Ga0070710_10000506 3300005437 Bacteria 18315
98 Ga0070710_10000563 3300005437 Bacteria 17589
99 Ga0070710_10004747 3300005437 Bacteria 6427
100 Ga0070710_10386386 3300005437 Bacteria 935
101 Ga0070710_10395793 3300005437 Bacteria 925
102 Ga0070701_10042104 3300005438 Bacteria 2329
103 Ga0070711_100003355 3300005439 Bacteria 9321
104 Ga0070711_100308013 3300005439 Bacteria 1262
105 Ga0070711_100438016 3300005439 Bacteria 1068
106 Ga0070711_100614857 3300005439 Bacteria 908
107 Ga0070700_100112513 3300005441 Bacteria 1812
108 Ga0070694_100093529 3300005444 Bacteria 2113
109 Ga0070694_101007392 3300005444 Bacteria 692
110 Ga0070708_100480141 3300005445 Bacteria 1173
111 Ga0070663_100003233 3300005455 Bacteria 9369
112 Ga0070663_100025815 3300005455 Bacteria 3971
113 Ga0070663_100063225 3300005455 Bacteria 2672
114 Ga0070663_100078923 3300005455 Bacteria 2414
115 Ga0070663_100116261 3300005455 Bacteria 2016
116 Ga0070663_100258091 3300005455 Bacteria 1382
117 Ga0070663_100302105 3300005455 Bacteria 1281
118 Ga0070663_100596437 3300005455 Bacteria 928
119 Ga0070678_100057791 3300005456 Bacteria 2844
120 Ga0070678_100072118 3300005456 Bacteria 2588
121 Ga0070678_100102787 3300005456 Bacteria 2218
122 Ga0070678_100335420 3300005456 Bacteria 1295
123 Ga0070662_100148860 3300005457 Bacteria 1820
124 Ga0070662_100691147 3300005457 Bacteria 862
125 Ga0070681_10002083 3300005458 Bacteria 18160
126 Ga0070681_10019352 3300005458 Bacteria 6813
127 Ga0070681_10341851 3300005458 Bacteria 1406
128 Ga0070681_10416251 3300005458 Bacteria 1256
129 Ga0070681_10441971 3300005458 Bacteria 1212
130 Ga0070681_10637190 3300005458 Bacteria 981
131 Ga0068867_100138427 3300005459 Bacteria 1900
132 Ga0068867_100151066 3300005459 Bacteria 1824
133 Ga0070685_10145522 3300005466 Bacteria 1497
134 Ga0070685_10323863 3300005466 Bacteria 1045
135 Ga0070706_100203771 3300005467 Bacteria 1848
136 Ga0070698_100199514 3300005471 Bacteria 1937
137 Ga0070698_100279900 3300005471 Bacteria 1600
138 Ga0070679_100008178 3300005530 Bacteria 9832
139 Ga0070679_100188624 3300005530 Bacteria 2031
140 Ga0070679_100193903 3300005530 Bacteria 1999
141 Ga0070679_100249921 3300005530 Bacteria 1730
142 Ga0070679_100645756 3300005530 Bacteria 1001
143 Ga0070684_100000952 3300005535 Bacteria 20624
144 Ga0070684_100165447 3300005535 Bacteria 2007
145 Ga0070684_100617640 3300005535 Bacteria 1008
146 Ga0068853_100011686 3300005539 Bacteria 7136
147 Ga0068853_100014119 3300005539 Bacteria 6538
148 Ga0068853_100029205 3300005539 Bacteria 4646
149 Ga0068853_100269422 3300005539 Bacteria 1567
150 Ga0068853_100290345 3300005539 Bacteria 1509
151 Ga0068853_100335693 3300005539 Bacteria 1403
152 Ga0068853_100439890 3300005539 Bacteria 1225
153 Ga0068853_101509363 3300005539 Bacteria 651
154 Ga0070672_100250216 3300005543 Bacteria 1492
155 Ga0070686_100210095 3300005544 Bacteria 1400
156 Ga0070686_100339187 3300005544 Bacteria 1126
157 Ga0070686_100764649 3300005544 Bacteria 776
158 Ga0070695_100135671 3300005545 Bacteria 1701
159 Ga0070695_100603883 3300005545 Bacteria 862
160 Ga0070696_100347513 3300005546 Bacteria 1148
161 Ga0070693_100045525 3300005547 Bacteria 2487
162 Ga0070693_100201142 3300005547 Bacteria 1294
163 Ga0070693_100308268 3300005547 Bacteria 1069
164 Ga0070665_100023863 3300005548 Bacteria 6162
165 Ga0070665_100026898 3300005548 Bacteria 5794
166 Ga0070665_100054505 3300005548 Bacteria 4010
167 Ga0070665_100098124 3300005548 Bacteria 2934
168 Ga0070665_100265908 3300005548 Bacteria 1716
169 Ga0070665_100616170 3300005548 Bacteria 1098
170 Ga0070665_100822710 3300005548 Bacteria 942
171 Ga0070665_101791805 3300005548 Bacteria 620
172 Ga0070704_100073604 3300005549 Bacteria 2489
173 Ga0070704_100374564 3300005549 Bacteria 1208
174 Ga0068855_100006305 3300005563 Bacteria 14456
175 Ga0068855_100105995 3300005563 Bacteria 3231
176 Ga0068855_100256501 3300005563 Bacteria 1949
177 Ga0068855_100383382 3300005563 Bacteria 1543
178 Ga0070664_100424419 3300005564 Bacteria 1218
179 Ga0068857_100012744 3300005577 Bacteria 7328
180 Ga0068857_100015946 3300005577 Bacteria 6580
181 Ga0068857_100293366 3300005577 Bacteria 1498
182 Ga0068857_100312135 3300005577 Bacteria 1451
183 Ga0068857_100792648 3300005577 Bacteria 904
184 Ga0068854_100333428 3300005578 Bacteria 1237
185 Ga0068854_100568824 3300005578 Bacteria 964
186 Ga0068854_100604291 3300005578 Bacteria 937
187 Ga0068856_100395192 3300005614 Bacteria 1402
188 Ga0070702_100049264 3300005615 Bacteria 2401
189 Ga0070702_100387532 3300005615 Bacteria 996
190 Ga0068852_100028208 3300005616 Bacteria 4589
191 Ga0068852_100116084 3300005616 Bacteria 2442
192 Ga0068852_100192794 3300005616 Bacteria 1924
193 Ga0068852_100330711 3300005616 Bacteria 1482
194 Ga0068852_100466182 3300005616 Bacteria 1253
195 Ga0068859_100183564 3300005617 Bacteria 2175
196 Ga0068859_101214005 3300005617 Bacteria 830
197 Ga0068864_100489555 3300005618 Bacteria 1182
198 Ga0068866_10111089 3300005718 Bacteria 1529
199 Ga0068866_10136917 3300005718 Bacteria 1401
200 Ga0068866_10472117 3300005718 Bacteria 825
201 Ga0068861_100016572 3300005719 Bacteria 5217
202 Ga0068861_100516402 3300005719 Bacteria 1083
203 Ga0068861_100633016 3300005719 Bacteria 986
204 Ga0068861_101179001 3300005719 Bacteria 740
205 Ga0068851_10043794 3300005834 Bacteria 2257
206 Ga0068870_10130231 3300005840 Bacteria 1460
207 Ga0068870_10133269 3300005840 Bacteria 1446
208 Ga0068863_100048337 3300005841 Bacteria 4034
209 Ga0068863_100116799 3300005841 Bacteria 2542
210 Ga0068863_100204103 3300005841 Bacteria 1902
211 Ga0068863_100468556 3300005841 Bacteria 1238
212 Ga0068863_100588667 3300005841 Bacteria 1100
213 Ga0068858_100093050 3300005842 Bacteria 2806
214 Ga0068858_100114861 3300005842 Bacteria 2515
215 Ga0068858_100278781 3300005842 Bacteria 1592
216 Ga0068860_100101194 3300005843 Bacteria 2749
217 Ga0068860_100130655 3300005843 Bacteria 2409
218 Ga0068860_100135352 3300005843 Bacteria 2366
219 Ga0068860_100135633 3300005843 Bacteria 2363
220 Ga0068860_100371466 3300005843 Bacteria 1410
221 Ga0068860_100781147 3300005843 Bacteria 968
222 Ga0068862_100019484 3300005844 Bacteria 5663
223 Ga0068862_100182231 3300005844 Bacteria 1886
224 Ga0068862_100297271 3300005844 Bacteria 1484
225 Ga0068862_100325651 3300005844 Bacteria 1419
226 Ga0068862_100446376 3300005844 Bacteria 1218
227 Ga0068862_100918391 3300005844 Bacteria 861
228 Ga0081455_10006420 3300005937 Bacteria 12604
229 Ga0081455_10133148 3300005937 Bacteria 1941
230 Ga0081538_10067578 3300005981 Bacteria 1994
231 Ga0081540_1002397 3300005983 Bacteria 15288
232 Ga0081540_1007919 3300005983 Bacteria 7499
233 Ga0081540_1008426 3300005983 Bacteria 7207
234 Ga0081540_1016807 3300005983 Bacteria 4560
235 Ga0081540_1024502 3300005983 Bacteria 3501
236 Ga0081540_1046363 3300005983 Bacteria 2195
237 Ga0081540_1048618 3300005983 Bacteria 2123
238 Ga0081540_1056532 3300005983 Bacteria 1904
239 Ga0081539_10000072 3300005985 Bacteria 232726
240 Ga0081539_10000325 3300005985 Bacteria 106431
241 Ga0081539_10037287 3300005985 Bacteria 2897
242 Ga0081539_10051150 3300005985 Bacteria 2331
243 Ga0070717_10015855 3300006028 Bacteria 5828
244 Ga0070717_10046100 3300006028 Bacteria 3566
245 Ga0070717_10584610 3300006028 Bacteria 1013
246 Ga0075365_10004379 3300006038 Bacteria 7469
247 Ga0075365_10021811 3300006038 Bacteria 4001
248 Ga0075365_10114872 3300006038 Bacteria 1852
249 Ga0075365_10169476 3300006038 Bacteria 1523
250 Ga0075365_10366068 3300006038 Bacteria 1016
251 Ga0075368_10005726 3300006042 Bacteria 4297
252 Ga0075363_100013638 3300006048 Bacteria 3947
253 Ga0075363_100329241 3300006048 Bacteria 890
254 Ga0075364_10071315 3300006051 Bacteria 2288
255 Ga0075364_10158221 3300006051 Bacteria 1528
256 Ga0075364_10201872 3300006051 Bacteria 1348
257 Ga0075432_10057870 3300006058 Bacteria 1376
258 Ga0075432_10132197 3300006058 Bacteria 946
259 Ga0070715_10000376 3300006163 Bacteria 11157
260 Ga0070715_10055764 3300006163 Bacteria 1717
261 Ga0070715_10219311 3300006163 Bacteria 977
262 Ga0070715_10273242 3300006163 Bacteria 893
263 Ga0070716_100054448 3300006173 Bacteria 2285
264 Ga0070712_100009777 3300006175 Bacteria 6044
265 Ga0070712_100014924 3300006175 Bacteria 4994
266 Ga0070712_100023662 3300006175 Bacteria 4061
267 Ga0070712_100034677 3300006175 Bacteria 3421
268 Ga0070712_100177856 3300006175 Bacteria 1656
269 Ga0070712_100471136 3300006175 Bacteria 1049
270 Ga0075362_10362738 3300006177 Bacteria 727
271 Ga0075367_10029919 3300006178 Bacteria 3118
272 Ga0075367_10085132 3300006178 Bacteria 1918
273 Ga0075367_10148194 3300006178 Bacteria 1455
274 Ga0075367_10161715 3300006178 Bacteria 1392
275 Ga0075367_10414353 3300006178 Bacteria 853
276 Ga0075367_10467190 3300006178 Bacteria 800
277 Ga0075369_10085068 3300006186 Bacteria 1406
278 Ga0075369_10128892 3300006186 Bacteria 1148
279 Ga0075369_10262882 3300006186 Bacteria 802
280 Ga0075366_10028925 3300006195 Bacteria 3253
281 Ga0097621_100196925 3300006237 Bacteria 1747
282 Ga0097621_100270350 3300006237 Bacteria 1493
283 Ga0075370_10005879 3300006353 Bacteria 6133
284 Ga0075370_10023578 3300006353 Bacteria 3390
285 Ga0075370_10087885 3300006353 Bacteria 1791
286 Ga0068871_100146132 3300006358 Bacteria 2013
287 Ga0068871_100308242 3300006358 Bacteria 1391
288 Ga0068871_100713106 3300006358 Bacteria 920
289 Ga0068871_100840373 3300006358 Bacteria 848
290 Ga0075428_100577288 3300006844 Bacteria 1201
291 Ga0075430_100265099 3300006846 Bacteria 1422
292 Ga0075434_100070588 3300006871 Bacteria 3484
293 Ga0075434_100250728 3300006871 Bacteria 1789
294 Ga0068865_100221282 3300006881 Bacteria 1480
295 Ga0068865_100402284 3300006881 Bacteria 1122
296 Ga0068865_100447258 3300006881 Bacteria 1067
297 Ga0097620_100183559 3300006931 Bacteria 2175
298 Ga0097620_101119457 3300006931 Bacteria 866
299 Ga0097620_101213996 3300006931 Bacteria 830
300 Ga0099825_1029470 3300006941 Bacteria 2543
301 Ga0099823_1043212 3300006944 Bacteria 3119
302 Ga0099795_10012566 3300007788 Bacteria 2572
303 Ga0099795_10036743 3300007788 Bacteria 1720
304 Ga0099795_10046864 3300007788 Bacteria 1559
305 Ga0099795_10054815 3300007788 Bacteria 1463
306 Ga0099795_10283990 3300007788 Bacteria 723
307 Ga0105251_10081614 3300009011 Bacteria 1494
308 Ga0105240_10006650 3300009093 Bacteria 16964
309 Ga0105240_10028150 3300009093 Bacteria 7346
310 Ga0105240_10077860 3300009093 Bacteria 4084
311 Ga0105240_10120653 3300009093 Bacteria 3157
312 Ga0105240_10370125 3300009093 Bacteria 1620
313 Ga0105240_10454079 3300009093 Bacteria 1433
314 Ga0105240_10818069 3300009093 Bacteria 1008
315 Ga0111539_10003570 3300009094 Bacteria 20500
316 Ga0111539_10086432 3300009094 Bacteria 3685
317 Ga0111539_10148109 3300009094 Bacteria 2748
318 Ga0111539_10169347 3300009094 Bacteria 2552
319 Ga0111539_11184709 3300009094 Bacteria 887
320 Ga0105245_10193843 3300009098 Bacteria 1948
321 Ga0105245_10283167 3300009098 Bacteria 1621
322 Ga0105245_11453011 3300009098 Bacteria 736
323 Ga0105247_10107479 3300009101 Bacteria 1792
324 Ga0105247_10257739 3300009101 Bacteria 1195
325 Ga0105247_10261783 3300009101 Bacteria 1186
326 Ga0114129_10125747 3300009147 Bacteria 3525
327 Ga0114129_10829090 3300009147 Bacteria 1177
328 Ga0114129_11008986 3300009147 Bacteria 1048
329 Ga0105243_10228334 3300009148 Bacteria 1650
330 Ga0105241_10003241 3300009174 Bacteria 12101
331 Ga0105241_10085165 3300009174 Bacteria 2483
332 Ga0105241_10133503 3300009174 Bacteria 2012
333 Ga0105241_10144748 3300009174 Bacteria 1938
334 Ga0105241_10255384 3300009174 Bacteria 1488
335 Ga0105242_10116929 3300009176 Bacteria 2282
336 Ga0105242_10171258 3300009176 Bacteria 1908
337 Ga0105242_10742190 3300009176 Bacteria 965
338 Ga0105242_11167832 3300009176 Bacteria 787
339 Ga0105248_10706575 3300009177 Bacteria 1137
340 Ga0105237_10008430 3300009545 Bacteria 11156
341 Ga0105237_10013203 3300009545 Bacteria 8665
342 Ga0105237_10024067 3300009545 Bacteria 6231
343 Ga0105237_10051706 3300009545 Bacteria 4127
344 Ga0105237_10123415 3300009545 Bacteria 2584
345 Ga0105237_10169407 3300009545 Bacteria 2183
346 Ga0105237_10214632 3300009545 Bacteria 1924
347 Ga0105237_10485619 3300009545 Bacteria 1241
348 Ga0105238_10034351 3300009551 Bacteria 5160
349 Ga0105238_10045750 3300009551 Bacteria 4421
350 Ga0105238_10074082 3300009551 Bacteria 3398
351 Ga0105238_10196785 3300009551 Bacteria 1991
352 Ga0105238_10576969 3300009551 Bacteria 1131
353 Ga0105238_10591728 3300009551 Bacteria 1117
354 Ga0105238_11051907 3300009551 Bacteria 836
355 Ga0105238_11245153 3300009551 Bacteria 769
356 Ga0105249_10743319 3300009553 Bacteria 1043
357 Ga0105249_10848567 3300009553 Bacteria 979
358 Ga0105249_11127669 3300009553 Bacteria 855
359 Ga0099796_10135143 3300010159 Bacteria 959
360 Ga0105239_10019512 3300010375 Bacteria 7484
361 Ga0105239_10643323 3300010375 Bacteria 1211
362 Ga0105246_10050204 3300011119 Bacteria 2861
363 Ga0105246_10279153 3300011119 Bacteria 1339
364 Ga0157322_1008142 3300012490 Bacteria 794
365 Ga0157371_10022069 3300013102 Bacteria 4669
366 Ga0157371_10150504 3300013102 Bacteria 1659
367 Ga0157370_10003007 3300013104 Bacteria 20010
368 Ga0157370_10827658 3300013104 Bacteria 842
369 Ga0157369_10038951 3300013105 Bacteria 5196
370 Ga0157369_10047487 3300013105 Bacteria 4661
371 Ga0157369_10213289 3300013105 Bacteria 2023
372 Ga0157369_10310892 3300013105 Bacteria 1639
373 Ga0157374_10085901 3300013296 Bacteria 2993
374 Ga0157374_10183720 3300013296 Bacteria 2044
375 Ga0157374_10506467 3300013296 Bacteria 1212
376 Ga0157378_10061196 3300013297 Bacteria 3359
377 Ga0157378_10071194 3300013297 Bacteria 3122
378 Ga0157378_10321782 3300013297 Bacteria 1503
379 Ga0157378_10680078 3300013297 Bacteria 1047
380 Ga0163162_10115670 3300013306 Bacteria 2782
381 Ga0163162_10206262 3300013306 Bacteria 2095
382 Ga0163162_10232236 3300013306 Bacteria 1975
383 Ga0163162_10402266 3300013306 Bacteria 1502
384 Ga0163162_11205287 3300013306 Bacteria 859
385 Ga0163162_11337391 3300013306 Bacteria 814
386 Ga0163162_11369024 3300013306 Bacteria 805
387 Ga0157372_10089134 3300013307 Bacteria 3504
388 Ga0157372_10445403 3300013307 Bacteria 1509
389 Ga0157372_10924417 3300013307 Bacteria 1012
390 Ga0157372_10994178 3300013307 Bacteria 972
391 Ga0157375_10065900 3300013308 Bacteria 3612
392 Ga0157375_10072080 3300013308 Bacteria 3470
393 Ga0157375_10723219 3300013308 Bacteria 1148
394 Ga0157375_11029651 3300013308 Bacteria 962
395 Ga0157375_12168896 3300013308 Bacteria 662
396 Ga0163163_10003485 3300014325 Bacteria 13361
397 Ga0163163_10047093 3300014325 Bacteria 4237
398 Ga0163163_10049822 3300014325 Bacteria 4122
399 Ga0163163_10184430 3300014325 Bacteria 2134
400 Ga0163163_10293108 3300014325 Bacteria 1679
401 Ga0163163_10436443 3300014325 Bacteria 1369
402 Ga0163163_10563742 3300014325 Bacteria 1202
403 Ga0163163_10997973 3300014325 Bacteria 900
404 Ga0163163_11453197 3300014325 Bacteria 747
405 Ga0157380_10268990 3300014326 Bacteria 1552
406 Ga0157380_10272723 3300014326 Bacteria 1543
407 Ga0182008_10279964 3300014497 Bacteria 868
408 Ga0157377_10005796 3300014745 Bacteria 5834
409 Ga0157377_10065182 3300014745 Bacteria 2092
410 Ga0157379_10038813 3300014968 Bacteria 4248
411 Ga0157379_10812939 3300014968 Bacteria 883
412 Ga0157376_10308492 3300014969 Bacteria 1501
413 Ga0157376_10454988 3300014969 Bacteria 1249
414 Ga0157376_10566733 3300014969 Bacteria 1126
415 Ga0157376_10581333 3300014969 Bacteria 1112
416 Ga0182007_10039960 3300015262 Bacteria 1567
417 Ga0163161_10612284 3300017792 Bacteria 899
418 Ga0163161_10621799 3300017792 Bacteria 892
419 Ga0206356_10863949 3300020070 Bacteria 1257
420 Ga0206356_11765100 3300020070 Bacteria 1287
421 Ga0206353_11063056 3300020082 Bacteria 861
422 Ga0214544_1000001 3300021320 Bacteria 783667
423 Ga0214542_1000037 3300021321 Bacteria 159256
424 Ga0214545_1000003 3300021324 Bacteria 720274
425 Ga0214543_1000002 3300021327 Bacteria 712733
426 Ga0213874_10098188 3300021377 Bacteria 970
427 Ga0213876_10002729 3300021384 Bacteria 10288
428 Ga0213876_10051418 3300021384 Bacteria 2178
429 Ga0213876_10108796 3300021384 Bacteria 1471
430 Ga0209563_117798 3300025230 Bacteria 845
431 Ga0209026_1022664 3300025250 Bacteria 961
432 Ga0209677_105144 3300025253 Bacteria 3511
433 Ga0209148_1000347 3300025254 Bacteria 60370
434 Ga0209233_1011115 3300025261 Bacteria 2662
435 Ga0209455_1002091 3300025272 Bacteria 7979
436 Ga0209455_1013519 3300025272 Bacteria 1890
437 Ga0209673_1034422 3300025273 Bacteria 1530
438 Ga0209564_1004821 3300025295 Bacteria 8032
439 Ga0209564_1008038 3300025295 Bacteria 5287
440 Ga0209758_1000011 3300025297 Bacteria 1049685
441 Ga0209758_1000133 3300025297 Bacteria 182442
442 Ga0209758_1000845 3300025297 Bacteria 42737
443 Ga0209758_1001269 3300025297 Bacteria 31260
444 Ga0209758_1006848 3300025297 Bacteria 7976
445 Ga0209758_1021253 3300025297 Bacteria 3032
446 Ga0209050_1076411 3300025298 Bacteria 727
447 Ga0209256_1003911 3300025299 Bacteria 9844
448 Ga0207426_1000270 3300025302 Bacteria 108404
449 Ga0207426_1000292 3300025302 Bacteria 99342
450 Ga0207426_1003805 3300025302 Bacteria 7825
451 Ga0207426_1014306 3300025302 Bacteria 2909
452 Ga0209051_1038395 3300025303 Bacteria 1743
453 Ga0209257_1001242 3300025304 Bacteria 31529
454 Ga0209257_1036953 3300025304 Bacteria 1494
455 Ga0207697_10024723 3300025315 Bacteria 2458
456 Ga0207656_10022373 3300025321 Bacteria 2536
457 Ga0207653_10043025 3300025885 Bacteria 1486
458 Ga0207682_10023362 3300025893 Bacteria 2442
459 Ga0207692_10002141 3300025898 Bacteria 7544
460 Ga0207692_10002191 3300025898 Bacteria 7469
461 Ga0207692_10008931 3300025898 Bacteria 4167
462 Ga0207692_10029494 3300025898 Bacteria 2608
463 Ga0207692_10274388 3300025898 Bacteria 1018
464 Ga0207692_10277865 3300025898 Bacteria 1012
465 Ga0207642_10087351 3300025899 Bacteria 1531
466 Ga0207710_10448879 3300025900 Bacteria 666
467 Ga0207688_10010703 3300025901 Bacteria 4991
468 Ga0207688_10258200 3300025901 Bacteria 1057
469 Ga0207680_10062786 3300025903 Bacteria 2271
470 Ga0207680_10179682 3300025903 Bacteria 1430
471 Ga0207680_10416025 3300025903 Bacteria 951
472 Ga0207647_10028027 3300025904 Bacteria 3665
473 Ga0207647_10041473 3300025904 Bacteria 2893
474 Ga0207685_10001380 3300025905 Bacteria 5033
475 Ga0207685_10060767 3300025905 Bacteria 1495
476 Ga0207685_10269519 3300025905 Bacteria 831
477 Ga0207699_10000503 3300025906 Bacteria 19503
478 Ga0207699_10010550 3300025906 Bacteria 4642
479 Ga0207699_10016050 3300025906 Bacteria 3907
480 Ga0207699_10062794 3300025906 Bacteria 2241
481 Ga0207699_10154430 3300025906 Bacteria 1522
482 Ga0207699_10288892 3300025906 Bacteria 1142
483 Ga0207645_10003034 3300025907 Bacteria 12931
484 Ga0207645_10156206 3300025907 Bacteria 1490
485 Ga0207643_10083232 3300025908 Bacteria 1856
486 Ga0207643_10123359 3300025908 Bacteria 1536
487 Ga0207643_10196076 3300025908 Bacteria 1228
488 Ga0207705_10052000 3300025909 Bacteria 2949
489 Ga0207705_10107676 3300025909 Bacteria 2056
490 Ga0207705_10275071 3300025909 Bacteria 1288
491 Ga0207705_10282447 3300025909 Bacteria 1271
492 Ga0207705_10902887 3300025909 Bacteria 684
493 Ga0207705_11043729 3300025909 Bacteria 631
494 Ga0207684_10347308 3300025910 Bacteria 1277
495 Ga0207654_10026617 3300025911 Bacteria 3134
496 Ga0207654_10132535 3300025911 Bacteria 1579
497 Ga0207707_10000717 3300025912 Bacteria 32801
498 Ga0207707_10001896 3300025912 Bacteria 19043
499 Ga0207707_10002335 3300025912 Bacteria 17083
500 Ga0207707_10409620 3300025912 Bacteria 1163
501 Ga0207707_10428673 3300025912 Bacteria 1133
502 Ga0207707_10692011 3300025912 Bacteria 856
503 Ga0207695_10000008 3300025913 Bacteria 1058268
504 Ga0207695_10025550 3300025913 Bacteria 6609
505 Ga0207695_10092793 3300025913 Bacteria 3029
506 Ga0207695_10265824 3300025913 Bacteria 1612
507 Ga0207695_10339889 3300025913 Bacteria 1389
508 Ga0207671_10033634 3300025914 Bacteria 3812
509 Ga0207671_10035720 3300025914 Bacteria 3686
510 Ga0207671_10156310 3300025914 Bacteria 1764
511 Ga0207671_10646605 3300025914 Bacteria 842
512 Ga0207693_10000085 3300025915 Bacteria 83879
513 Ga0207693_10010478 3300025915 Bacteria 7524
514 Ga0207693_10014747 3300025915 Bacteria 6278
515 Ga0207693_10078815 3300025915 Bacteria 2578
516 Ga0207693_10080001 3300025915 Bacteria 2558
517 Ga0207663_10000145 3300025916 Bacteria 32751
518 Ga0207663_10001800 3300025916 Bacteria 10116
519 Ga0207663_10260645 3300025916 Bacteria 1280
520 Ga0207663_10459253 3300025916 Bacteria 983
521 Ga0207660_10001403 3300025917 Bacteria 16191
522 Ga0207660_10012962 3300025917 Bacteria 5462
523 Ga0207660_10149915 3300025917 Bacteria 1791
524 Ga0207660_10434921 3300025917 Bacteria 1060
525 Ga0207660_10722753 3300025917 Bacteria 812
526 Ga0207660_11010655 3300025917 Bacteria 678
527 Ga0207662_10132358 3300025918 Bacteria 1574
528 Ga0207662_10477335 3300025918 Bacteria 856
529 Ga0207657_10006888 3300025919 Bacteria 11727
530 Ga0207657_10011138 3300025919 Bacteria 8938
531 Ga0207657_10052926 3300025919 Bacteria 3520
532 Ga0207657_10434435 3300025919 Bacteria 1031
533 Ga0207649_10151677 3300025920 Bacteria 1597
534 Ga0207652_10004802 3300025921 Bacteria 10944
535 Ga0207652_10022959 3300025921 Bacteria 5167
536 Ga0207681_10081029 3300025923 Bacteria 2291
537 Ga0207681_10309715 3300025923 Bacteria 1252
538 Ga0207681_10406526 3300025923 Bacteria 1100
539 Ga0207694_10084993 3300025924 Bacteria 2489
540 Ga0207694_10179888 3300025924 Bacteria 1714
541 Ga0207694_10558617 3300025924 Bacteria 961
542 Ga0207694_10668697 3300025924 Bacteria 875
543 Ga0207659_10332058 3300025926 Bacteria 1257
544 Ga0207659_10345954 3300025926 Bacteria 1232
545 Ga0207687_10006611 3300025927 Bacteria 7649
546 Ga0207687_10295986 3300025927 Bacteria 1302
547 Ga0207687_10706428 3300025927 Bacteria 856
548 Ga0207700_10056742 3300025928 Bacteria 2949
549 Ga0207700_10198422 3300025928 Bacteria 1690
550 Ga0207700_10342822 3300025928 Bacteria 1299
551 Ga0207664_10028269 3300025929 Bacteria 4260
552 Ga0207664_10238554 3300025929 Bacteria 1583
553 Ga0207664_10350136 3300025929 Bacteria 1307
554 Ga0207664_10455251 3300025929 Bacteria 1142
555 Ga0207644_10077187 3300025931 Bacteria 2452
556 Ga0207644_10404706 3300025931 Bacteria 1116
557 Ga0207644_10419244 3300025931 Bacteria 1096
558 Ga0207644_10427416 3300025931 Bacteria 1086
559 Ga0207644_11149500 3300025931 Bacteria 652
560 Ga0207690_10065349 3300025932 Bacteria 2487
561 Ga0207690_10180731 3300025932 Bacteria 1588
562 Ga0207690_10377023 3300025932 Bacteria 1127
563 Ga0207690_10471764 3300025932 Bacteria 1012
564 Ga0207706_10054196 3300025933 Bacteria 3539
565 Ga0207706_10090077 3300025933 Bacteria 2697
566 Ga0207706_10350447 3300025933 Bacteria 1284
567 Ga0207686_10080217 3300025934 Bacteria 2127
568 Ga0207686_10210725 3300025934 Bacteria 1397
569 Ga0207709_10076899 3300025935 Bacteria 2138
570 Ga0207709_10194207 3300025935 Bacteria 1445
571 Ga0207709_10297134 3300025935 Bacteria 1199
572 Ga0207670_10070252 3300025936 Bacteria 2418
573 Ga0207669_10011373 3300025937 Bacteria 4328
574 Ga0207669_10052811 3300025937 Bacteria 2444
575 Ga0207669_10127068 3300025937 Bacteria 1744
576 Ga0207669_10193128 3300025937 Bacteria 1470
577 Ga0207669_10280468 3300025937 Bacteria 1256
578 Ga0207704_10170929 3300025938 Bacteria 1559
579 Ga0207665_10000229 3300025939 Bacteria 38095
580 Ga0207665_10009781 3300025939 Bacteria 6297
581 Ga0207665_10032829 3300025939 Bacteria 3437
582 Ga0207665_10768961 3300025939 Bacteria 760
583 Ga0207691_10097500 3300025940 Bacteria 2628
584 Ga0207691_10385801 3300025940 Bacteria 1196
585 Ga0207691_10593938 3300025940 Bacteria 937
586 Ga0207711_10047118 3300025941 Bacteria 3685
587 Ga0207711_10207208 3300025941 Bacteria 1790
588 Ga0207711_10388754 3300025941 Bacteria 1295
589 Ga0207689_10003758 3300025942 Bacteria 13827
590 Ga0207689_10135366 3300025942 Bacteria 2028
591 Ga0207661_10000917 3300025944 Bacteria 19380
592 Ga0207661_10238900 3300025944 Bacteria 1611
593 Ga0207661_10370450 3300025944 Bacteria 1295
594 Ga0207667_10007040 3300025949 Bacteria 13589
595 Ga0207667_10271633 3300025949 Bacteria 1733
596 Ga0207667_10623081 3300025949 Bacteria 1086
597 Ga0207712_10122062 3300025961 Bacteria 1973
598 Ga0207712_11166605 3300025961 Bacteria 687
599 Ga0207668_10018550 3300025972 Bacteria 4382
600 Ga0207668_10088097 3300025972 Bacteria 2272
601 Ga0207668_10116175 3300025972 Bacteria 2017
602 Ga0207668_10122050 3300025972 Bacteria 1974
603 Ga0207668_10784211 3300025972 Bacteria 843
604 Ga0207640_10412368 3300025981 Bacteria 1103
605 Ga0207658_10611463 3300025986 Bacteria 980
606 Ga0207658_10991182 3300025986 Bacteria 766
607 Ga0207677_10241250 3300026023 Bacteria 1462
608 Ga0207677_10416807 3300026023 Bacteria 1143
609 Ga0207677_10430357 3300026023 Bacteria 1126
610 Ga0207677_10459412 3300026023 Bacteria 1093
611 Ga0207677_10529499 3300026023 Bacteria 1023
612 Ga0207703_10088708 3300026035 Bacteria 2596
613 Ga0207703_10094264 3300026035 Bacteria 2523
614 Ga0207703_10098345 3300026035 Bacteria 2474
615 Ga0207703_10878834 3300026035 Bacteria 858
616 Ga0207639_10006860 3300026041 Bacteria 7756
617 Ga0207639_10028169 3300026041 Bacteria 4100
618 Ga0207639_10038009 3300026041 Bacteria 3578
619 Ga0207639_10068349 3300026041 Bacteria 2768
620 Ga0207639_10127978 3300026041 Bacteria 2098
621 Ga0207639_10212637 3300026041 Bacteria 1666
622 Ga0207678_10002626 3300026067 Bacteria 16370
623 Ga0207678_10014595 3300026067 Bacteria 6913
624 Ga0207678_10021631 3300026067 Bacteria 5640
625 Ga0207678_10033947 3300026067 Bacteria 4444
626 Ga0207678_10048700 3300026067 Bacteria 3663
627 Ga0207678_10083398 3300026067 Bacteria 2734
628 Ga0207678_10089802 3300026067 Bacteria 2626
629 Ga0207678_10254767 3300026067 Bacteria 1504
630 Ga0207678_10322153 3300026067 Bacteria 1330
631 Ga0207678_10481404 3300026067 Bacteria 1081
632 Ga0207678_10751893 3300026067 Bacteria 859
633 Ga0207708_10002913 3300026075 Bacteria 12608
634 Ga0207708_10050661 3300026075 Bacteria 3161
635 Ga0207702_10259853 3300026078 Bacteria 1634
636 Ga0207702_10333030 3300026078 Bacteria 1448
637 Ga0207702_10997614 3300026078 Bacteria 831
638 Ga0207641_10294140 3300026088 Bacteria 1532
639 Ga0207641_10452139 3300026088 Bacteria 1241
640 Ga0207641_11318166 3300026088 Bacteria 722
641 Ga0207648_10111364 3300026089 Bacteria 2403
642 Ga0207648_10126456 3300026089 Bacteria 2249
643 Ga0207648_10491142 3300026089 Bacteria 1122
644 Ga0207676_10672794 3300026095 Bacteria 1000
645 Ga0207674_10011178 3300026116 Bacteria 10096
646 Ga0207674_10022614 3300026116 Bacteria 6747
647 Ga0207674_10097487 3300026116 Bacteria 2924
648 Ga0207674_10146631 3300026116 Bacteria 2318
649 Ga0207674_10360954 3300026116 Bacteria 1404
650 Ga0207674_10803679 3300026116 Bacteria 908
651 Ga0207675_100074027 3300026118 Bacteria 3187
652 Ga0207675_100154152 3300026118 Bacteria 2188
653 Ga0207675_100854869 3300026118 Bacteria 925
654 Ga0207683_10018187 3300026121 Bacteria 5995
655 Ga0207683_10082170 3300026121 Bacteria 2861
656 Ga0207683_10408897 3300026121 Bacteria 1249
657 Ga0207698_10033138 3300026142 Bacteria 3750
658 Ga0207698_10078782 3300026142 Bacteria 2647
659 Ga0207698_10261855 3300026142 Bacteria 1589
660 Ga0207698_10385805 3300026142 Bacteria 1334
661 Ga0209389_1000001 3300027296 Bacteria 463799
662 Ga0209389_1000014 3300027296 Bacteria 188621
663 Ga0209589_1000020 3300027357 Bacteria 188617
664 Ga0209489_100060 3300027361 Bacteria 147091
665 Ga0209489_101114 3300027361 Bacteria 54578
666 Ga0209700_100007 3300027363 Bacteria 454608
667 Ga0209179_1004949 3300027512 Bacteria 2050
668 Ga0209588_1000816 3300027671 Bacteria 7919
669 Ga0209588_1060552 3300027671 Bacteria 1224
670 Ga0209974_10021441 3300027876 Bacteria 2139
671 Ga0207428_10212990 3300027907 Bacteria 1451
672 Ga0207428_10390444 3300027907 Bacteria 1020
673 Ga0268266_10003290 3300028379 Bacteria 16240
674 Ga0268266_10013881 3300028379 Bacteria 6935
675 Ga0268266_10022599 3300028379 Bacteria 5356
676 Ga0268266_10092360 3300028379 Bacteria 2655
677 Ga0268266_10108842 3300028379 Bacteria 2453
678 Ga0268266_10231194 3300028379 Bacteria 1703
679 Ga0268266_10512514 3300028379 Bacteria 1146
680 Ga0268266_10891614 3300028379 Bacteria 860
681 Ga0268266_11412720 3300028379 Bacteria 671
682 Ga0268265_10009993 3300028380 Bacteria 6406
683 Ga0268265_10021737 3300028380 Bacteria 4498
684 Ga0268265_10177517 3300028380 Bacteria 1827
685 Ga0268265_10216282 3300028380 Bacteria 1673
686 Ga0268265_10454145 3300028380 Bacteria 1197
687 Ga0268264_10244025 3300028381 Bacteria 1665
688 Ga0268264_10732308 3300028381 Bacteria 984
689 Ga0265318_10011813 3300028577 Bacteria 3741
690 Ga0307517_10083264 3300028786 Bacteria 2706
691 Ga0265338_10381945 3300028800 Bacteria 1007
692 Ga0307511_10045798 3300030521 Bacteria 3609
693 Ga0307512_10294970 3300030522 Bacteria 761
694 Ga0265762_1022956 3300030760 Bacteria 1155
695 Ga0265330_10012565 3300031235 Bacteria 3959
696 Ga0265330_10030658 3300031235 Bacteria 2413
697 Ga0265332_10001601 3300031238 Bacteria 12401
698 Ga0265328_10002807 3300031239 Bacteria 7796
699 Ga0265328_10089696 3300031239 Bacteria 1136
700 Ga0265320_10018545 3300031240 Bacteria 3828
701 Ga0265325_10032679 3300031241 Bacteria 2776
702 Ga0265329_10039885 3300031242 Bacteria 1507
703 Ga0265340_10044848 3300031247 Bacteria 2162
704 Ga0265340_10356768 3300031247 Unclassified 646
705 Ga0265339_10013941 3300031249 Bacteria 4861
706 Ga0265331_10002014 3300031250 Bacteria 14136
707 Ga0265331_10055981 3300031250 Bacteria 1874
708 Ga0265331_10082448 3300031250 Bacteria 1492
709 Ga0265331_10084420 3300031250 Bacteria 1472
710 Ga0265331_10178250 3300031250 Bacteria 960
711 Ga0265316_10055188 3300031344 Bacteria 3109
712 Ga0265316_10285113 3300031344 Bacteria 1206
713 Ga0265316_10442876 3300031344 Bacteria 932
714 Ga0307513_10611209 3300031456 Bacteria 799
715 Ga0307509_10093399 3300031507 Bacteria 3070
716 Ga0307509_10205904 3300031507 Bacteria 1798
717 Ga0307509_10503716 3300031507 Bacteria 895
718 Ga0265313_10021124 3300031595 Bacteria 3568
719 Ga0307508_10000032 3300031616 Bacteria 163293
720 Ga0307508_10065217 3300031616 Bacteria 3209
721 Ga0307508_10105723 3300031616 Bacteria 2412
722 Ga0307508_10209810 3300031616 Bacteria 1548
723 Ga0307508_10220463 3300031616 Bacteria 1496
724 Ga0307508_10237559 3300031616 Bacteria 1420
725 Ga0265314_10000720 3300031711 Bacteria 40041
726 Ga0265314_10002758 3300031711 Bacteria 17547
727 Ga0265314_10067654 3300031711 Bacteria 2404
728 Ga0265342_10007374 3300031712 Bacteria 8063
729 Ga0265342_10008230 3300031712 Bacteria 7507
730 Ga0265342_10196665 3300031712 Bacteria 1098
731 Ga0307516_10010277 3300031730 Bacteria 10309
732 Ga0307516_10078471 3300031730 Bacteria 3148
733 Ga0307516_10108391 3300031730 Bacteria 2584
734 Ga0307405_10076072 3300031731 Bacteria 2177
735 Ga0326468_10009406 3300031889 Bacteria 968
736 Ga0307406_10072182 3300031901 Bacteria 2265
737 Ga0307406_10721601 3300031901 Bacteria 834
738 Ga0307407_10273882 3300031903 Bacteria 1166
739 Ga0307407_10750032 3300031903 Bacteria 739
740 Ga0307412_10850901 3300031911 Bacteria 796
741 Ga0307416_100288558 3300032002 Bacteria 1623
742 Ga0307411_10228270 3300032005 Bacteria 1449
743 Ga0307415_100175699 3300032126 Bacteria 1675
744 Ga0307415_100296861 3300032126 Bacteria 1337
745 Ga0307507_10030697 3300033179 Bacteria 5659
746 Ga0307507_10253679 3300033179 Bacteria 1133
747 Ga0307510_10016937 3300033180 Bacteria 8597
748 Ga0307510_10063397 3300033180 Bacteria 3765
749 Ga0307510_10168454 3300033180 Bacteria 1774
750 Ga0307510_10210133 3300033180 Bacteria 1469
751 Ga0373958_0037397 3300034819 Bacteria 979
752 Ga0373926_0132831 3300035083 Bacteria 943
753 Ga0373934_0001744 3300035086 Bacteria 7994
754 Ga0373944_0084789 3300035089 Bacteria 1052
755 Ga0373923_0001465 3300035111 Bacteria 6780
756 Ga0373936_0011859 3300035113 Bacteria 3307
757 Ga0373936_0017834 3300035113 Bacteria 2736
758 Ga0373941_0080388 3300035115 Bacteria 1100
759 Ga0373945_0198174 3300035116 Bacteria 833
760 Ga0373953_0081149 3300035117 Bacteria 1348
761 Ga0373953_0312793 3300035117 Bacteria 686
762 Ga0373954_0002051 3300035118 Bacteria 8373
763 Ga0373954_0009270 3300035118 Bacteria 4330
764 Ga0373954_0032382 3300035118 Bacteria 2416
765 Ga0373954_0280203 3300035118 Bacteria 822
766 Ga0373956_0006790 3300035119 Bacteria 4589
767 Ga0373956_0009916 3300035119 Bacteria 3884
768 Ga0373956_0028341 3300035119 Bacteria 2436
769 Ga0373957_0094309 3300035120 Bacteria 1192
770 Ga0373943_0003121 3300035170 Bacteria 7531
771 Ga0373943_0255731 3300035170 Bacteria 985
772 Ga0373943_0458474 3300035170 Bacteria 741
773 Ga0373946_0054567 3300035171 Bacteria 1682
774 Ga0373955_0000836 3300035172 Bacteria 13190
775 Ga0373955_0175082 3300035172 Bacteria 1271
776 Ga0373924_0009259 3300035410 Bacteria 3607
777 Ga0373924_0095604 3300035410 Bacteria 1274
778 Ga0373931_0006167 3300035691 Bacteria 5589
779 Ga0373935_0007485 3300035692 Bacteria 6537
780 Ga0373935_0041267 3300035692 Bacteria 2898
781 Ga0373935_0223613 3300035692 Bacteria 1308
782 Ga0373927_0000783 3300035695 Bacteria 24265
783 Ga0373927_0003201 3300035695 Bacteria 11796
784 Ga0373927_0014802 3300035695 Bacteria 5158
785 Ga0373927_0109933 3300035695 Bacteria 1795
786 Ga0373927_0125122 3300035695 Bacteria 1678
787 Ga0373927_0295969 3300035695 Bacteria 1065
788 Ga0373933_0000745 3300035724 Bacteria 19876
789 Ga0373933_0020123 3300035724 Bacteria 3780
790 Ga0373933_0051852 3300035724 Bacteria 2453
791 Ga0373947_0001285 3300035725 Bacteria 15466
792 Ga0373947_0002225 3300035725 Bacteria 11745
793 Ga0373947_0005796 3300035725 Bacteria 7204
794 Ga0373947_0606714 3300035725 Bacteria 746
795 Ga0373937_0010610 3300036401 Bacteria 8049
796 Ga0373937_0011733 3300036401 Bacteria 7685
797 Ga0373937_0017404 3300036401 Bacteria 6402
798 Ga0373937_0055982 3300036401 Bacteria 3621
799 Ga0373937_0065077 3300036401 Bacteria 3355
800 Ga0373937_0291115 3300036401 Bacteria 1543
801 Ga0373937_0357148 3300036401 Bacteria 1384
802 Ga0373925_0009084 3300037068 Bacteria 7235
803 Ga0373925_0159804 3300037068 Bacteria 1774
804 Ga0373925_0205571 3300037068 Bacteria 1567
805 Ga0373925_0483802 3300037068 Bacteria 1015
806 Ga0373925_0571115 3300037068 Bacteria 931
807 Ga0395899_0052019 3300037312 Bacteria 3038
808 Ga0395899_0155113 3300037312 Bacteria 1621
809 Ga0395899_0658370 3300037312 Bacteria 661
810 Ga0395900_0001070 3300037418 Bacteria 34841
811 Ga0395900_0130661 3300037418 Bacteria 2574
812 Ga0395898_0001820 3300037466 Bacteria 27513
813 Ga0395898_0008100 3300037466 Bacteria 11126
814 Ga0395898_0492649 3300037466 Bacteria 1166
815 Ga0395898_1210145 3300037466 Bacteria 686
816 Ga0395905_0009285 3300037471 Bacteria 9620
817 Ga0395905_0274201 3300037471 Bacteria 1573
818 Ga0395905_0910527 3300037471 Bacteria 782
819 Ga0436364_0253351 3300037853 Bacteria 51722
820 Ga0436364_1482475 3300037853 Bacteria 1330
821 Ga0395901_0036584 3300038443 Bacteria 5075
822 Ga0395901_0230580 3300038443 Bacteria 1933
823 Ga0395901_0233509 3300038443 Bacteria 1920
824 Ga0395901_0465594 3300038443 Bacteria 1291
825 Ga0436365_0551209 3300039437 Bacteria 2930
826 Ga0436365_0766659 3300039437 Bacteria 1020
827 Ga0436365_1026973 3300039437 Bacteria 738
828 Ga0436365_1295580 3300039437 Bacteria 811
829 Ga0436365_1550533 3300039437 Bacteria 2263
830 Ga0436365_1886582 3300039437 Bacteria 1088
831 Ga0436361_0733364 3300039447 Bacteria 1096
832 Ga0436361_0850535 3300039447 Bacteria 3280
833 Ga0436361_0940506 3300039447 Bacteria 712
834 Ga0436363_0315242 3300039450 Bacteria 980
835 Ga0436363_0448550 3300039450 Bacteria 800
836 Ga0436363_0726009 3300039450 Bacteria 1097
837 Ga0436363_1691007 3300039450 Bacteria 7615
838 Ga0436362_0392249 3300039453 Bacteria 1408
839 Ga0436362_0532768 3300039453 Bacteria 4386
840 Ga0451791_0201774 3300041451 Bacteria 1784
841 Ga0451791_0642730 3300041451 Bacteria 830
842 Ga0451797_1478868 3300041453 Bacteria 686
843 Ga0451800_0883918 3300041459 Bacteria 1225
844 Ga0451841_0432165 3300041498 Bacteria 1367
845 Ga0451851_0421653 3300041507 Bacteria 1229
846 Ga0439448_0090233 3300042005 Bacteria 1035
847 Ga0439432_184098 3300042006 Bacteria 608
848 Ga0466969_0241984 3300044656 Bacteria 819
849 Ga0466969_0265654 3300044656 Bacteria 777
850 Ga0466972_0000134 3300044658 Bacteria 61802
851 Ga0466972_0014382 3300044658 Bacteria 3964
852 Ga0466972_0026556 3300044658 Bacteria 2870
853 Ga0466972_0085058 3300044658 Bacteria 1504
854 Ga0466966_0037736 3300044684 Bacteria 3114
855 Ga0466963_0018695 3300044694 Bacteria 4337
856 Ga0466963_0025638 3300044694 Bacteria 3763
857 Ga0466963_0417413 3300044694 Bacteria 946
858 Ga0466964_0256271 3300044706 Bacteria 865
859 Ga0466964_0423259 3300044706 Bacteria 701
860 Ga0466968_0006796 3300044735 Bacteria 4327
861 Ga0466968_0152970 3300044735 Bacteria 1061
862 Ga0466968_0221446 3300044735 Bacteria 891
863 Ga0466970_0028528 3300044765 Bacteria 2934
864 Ga0466957_0229960 3300044842 Bacteria 1227
865 Ga0466960_0039333 3300044901 Bacteria 2230
866 Ga0466960_0100716 3300044901 Bacteria 1487
867 Ga0466959_0560060 3300045049 Bacteria 770
868 Ga0466967_0129640 3300045976 Bacteria 2340
869 Ga0466967_0156615 3300045976 Bacteria 2134
870 Ga0466967_0865800 3300045976 Bacteria 898
871 Ga0466967_1193165 3300045976 Bacteria 758
872 Ga0466967_1834124 3300045976 Bacteria 603
873 Ga0495617_026298 3300046452 Bacteria 1959
874 Ga0495592_0011800 3300046454 Bacteria 6619
875 Ga0495592_0024131 3300046454 Bacteria 4624
876 Ga0495592_0667153 3300046454 Bacteria 628
877 Ga0495603_0001681 3300046455 Bacteria 13000
878 Ga0495603_0002554 3300046455 Bacteria 10727
879 Ga0495603_0076353 3300046455 Bacteria 1966
880 Ga0495629_0000077 3300046459 Bacteria 85931
881 Ga0495629_0000165 3300046459 Bacteria 58366
882 Ga0495629_0001874 3300046459 Bacteria 16415
883 Ga0495629_0072547 3300046459 Bacteria 2403
884 Ga0495638_0003381 3300046460 Bacteria 12578
885 Ga0495638_0242061 3300046460 Bacteria 998
886 Ga0495638_0405853 3300046460 Bacteria 706
887 Ga0495641_0000929 3300046461 Bacteria 24998
888 Ga0495651_0000998 3300046462 Bacteria 21934
889 Ga0495651_0007709 3300046462 Bacteria 8235
890 Ga0495651_0014165 3300046462 Bacteria 6163
891 Ga0495651_0117801 3300046462 Bacteria 1954
892 Ga0495653_0002848 3300046463 Bacteria 13821
893 Ga0495653_0039737 3300046463 Bacteria 3684
894 Ga0495580_0000913 3300046472 Bacteria 25774
895 Ga0495580_0012709 3300046472 Bacteria 6453
896 Ga0495582_0000016 3300046473 Bacteria 100714
897 Ga0495582_0228655 3300046473 Bacteria 1065
898 Ga0495605_0096527 3300046474 Bacteria 1363
899 Ga0495605_0111427 3300046474 Bacteria 1248
900 Ga0495639_0000014 3300046475 Bacteria 82866
901 Ga0495639_0253721 3300046475 Bacteria 870
902 Ga0495662_0000086 3300046476 Bacteria 33465
903 Ga0495664_0009821 3300046477 Bacteria 5365
904 Ga0495664_0031350 3300046477 Bacteria 3116
905 Ga0495664_0091995 3300046477 Bacteria 1824
906 Ga0495664_0096681 3300046477 Bacteria 1778
907 Ga0495664_0109702 3300046477 Bacteria 1665
908 Ga0495664_0168297 3300046477 Bacteria 1330
909 Ga0495584_0080757 3300046491 Bacteria 1636
910 Ga0495584_0089683 3300046491 Bacteria 1550
911 Ga0495584_0097665 3300046491 Bacteria 1484
912 Ga0495584_0131219 3300046491 Bacteria 1271
913 Ga0495584_0231768 3300046491 Bacteria 939
914 Ga0495584_0310212 3300046491 Bacteria 801
915 Ga0495585_0012248 3300046492 Bacteria 5052
916 Ga0495585_0026425 3300046492 Bacteria 3315
917 Ga0495585_0180233 3300046492 Bacteria 1086
918 Ga0495585_0218648 3300046492 Bacteria 962
919 Ga0495594_0000420 3300046499 Bacteria 21403
920 Ga0495594_0251690 3300046499 Bacteria 1006
921 Ga0495594_0294615 3300046499 Bacteria 924
922 Ga0495596_0261390 3300046500 Bacteria 672
923 Ga0495583_0020320 3300046506 Bacteria 3444
924 Ga0495583_0110898 3300046506 Bacteria 1163
925 Ga0495606_0016617 3300046507 Bacteria 5601
926 Ga0495606_0094225 3300046507 Bacteria 1835
927 Ga0495608_0004861 3300046511 Bacteria 9605
928 Ga0495608_0036601 3300046511 Bacteria 3304
929 Ga0495608_0085211 3300046511 Bacteria 2048
930 Ga0495610_0034048 3300046512 Bacteria 2627
931 Ga0495616_0036445 3300046513 Bacteria 2538
932 Ga0495616_0145796 3300046513 Bacteria 1074
933 Ga0495618_0080743 3300046514 Bacteria 2075
934 Ga0495618_0084275 3300046514 Bacteria 2031
935 Ga0495628_0014816 3300046516 Bacteria 6522
936 Ga0495628_0027632 3300046516 Bacteria 4614
937 Ga0495628_0042840 3300046516 Bacteria 3608
938 Ga0495628_0055901 3300046516 Bacteria 3108
939 Ga0495628_0328876 3300046516 Bacteria 1127
940 Ga0495630_0003176 3300046517 Bacteria 11417
941 Ga0495630_0139089 3300046517 Bacteria 1846
942 Ga0495630_0961129 3300046517 Bacteria 650
943 Ga0495631_0215358 3300046518 Bacteria 820
944 Ga0495632_0092028 3300046519 Bacteria 1437
945 Ga0495632_0150184 3300046519 Bacteria 1077
946 Ga0495644_0056272 3300046523 Bacteria 1478
947 Ga0495644_0059596 3300046523 Bacteria 1435
948 Ga0495644_0105582 3300046523 Bacteria 1067
949 Ga0495648_0001270 3300046524 Bacteria 25160
950 Ga0495648_0040464 3300046524 Bacteria 2955
951 Ga0495666_0197235 3300046526 Bacteria 926
952 Ga0495642_0019111 3300046528 Bacteria 2684
953 Ga0495642_0115543 3300046528 Bacteria 1150
954 Ga0495642_0149036 3300046528 Bacteria 1012
955 Ga0495652_0025241 3300046529 Bacteria 5260
956 Ga0495652_0035210 3300046529 Bacteria 4358
957 Ga0495652_0035670 3300046529 Bacteria 4327
958 Ga0495652_0080110 3300046529 Bacteria 2698
959 Ga0495652_0085510 3300046529 Bacteria 2591
960 Ga0495652_0295280 3300046529 Bacteria 1180
961 Ga0495665_0000665 3300046531 Bacteria 17688
962 Ga0495665_0050977 3300046531 Bacteria 2193
963 Ga0495640_0002399 3300046533 Bacteria 15028
964 Ga0495640_0002839 3300046533 Bacteria 13934
965 Ga0495640_0045369 3300046533 Bacteria 3050
966 Ga0495640_0097751 3300046533 Bacteria 1930
967 Ga0495586_0016426 3300046535 Bacteria 3937
968 Ga0495587_0008879 3300046536 Bacteria 6450
969 Ga0495587_0015099 3300046536 Bacteria 4826
970 Ga0495609_0047871 3300046538 Bacteria 1912
971 Ga0495609_0115113 3300046538 Bacteria 1159
972 Ga0495621_0217536 3300046539 Bacteria 772
973 Ga0495597_0136927 3300046542 Bacteria 1012
974 Ga0495645_0039169 3300046543 Bacteria 3457
975 Ga0495645_0135638 3300046543 Bacteria 1722
976 Ga0495645_0291672 3300046543 Bacteria 1069
977 Ga0495622_0002786 3300046557 Bacteria 8343
978 Ga0495622_0016747 3300046557 Bacteria 3414
979 Ga0495622_0023742 3300046557 Bacteria 2860
980 Ga0495622_0050150 3300046557 Bacteria 1937
981 Ga0495622_0138108 3300046557 Bacteria 1107
982 Ga0495633_0053573 3300046558 Bacteria 1899
983 Ga0495633_0066574 3300046558 Bacteria 1682
984 Ga0495667_0009076 3300046559 Bacteria 6755
985 Ga0495667_0011830 3300046559 Bacteria 5911
986 Ga0495667_0039008 3300046559 Bacteria 3161
987 Ga0495667_0042791 3300046559 Bacteria 3003
988 Ga0495667_0270286 3300046559 Bacteria 1080
989 Ga0495656_0035397 3300046615 Bacteria 2051
990 Ga0495656_0041525 3300046615 Bacteria 1922
991 Ga0495656_0088098 3300046615 Bacteria 1414
992 Ga0495656_0225095 3300046615 Bacteria 939
993 Ga0495668_0057213 3300046616 Bacteria 2152
994 Ga0495668_0194231 3300046616 Bacteria 1111
995 Ga0495668_0360414 3300046616 Bacteria 798
996 Ga0495668_0366617 3300046616 Bacteria 791
997 Ga0495634_0000859 3300046642 Bacteria 29254
998 Ga0495634_0025034 3300046642 Bacteria 4183
999 Ga0495634_0042688 3300046642 Bacteria 3075
1000 Ga0495611_0073357 3300046648 Bacteria 1567
1001 Ga0495611_0140338 3300046648 Bacteria 1128
1002 Ga0495625_0039960 3300046660 Bacteria 3424
1003 Ga0495625_0226343 3300046660 Bacteria 1223
1004 Ga0495625_0276165 3300046660 Bacteria 1082
1005 Ga0495625_0388317 3300046660 Bacteria 874
1006 Ga0495635_0000160 3300046663 Bacteria 41557
1007 Ga0495635_0012918 3300046663 Bacteria 5847
1008 Ga0495635_0045294 3300046663 Bacteria 3035
1009 Ga0495635_0134480 3300046663 Bacteria 1685
1010 Ga0495635_0450937 3300046663 Bacteria 850
1011 Ga0495588_0003175 3300046674 Bacteria 7112
1012 Ga0495588_0018312 3300046674 Bacteria 3413
1013 Ga0495588_0089354 3300046674 Bacteria 1613
1014 Ga0495657_0000879 3300046675 Bacteria 26530
1015 Ga0495657_0005900 3300046675 Bacteria 9625
1016 Ga0495657_0045190 3300046675 Bacteria 2990
1017 Ga0495657_0061256 3300046675 Bacteria 2489
1018 Ga0495657_0135604 3300046675 Bacteria 1538
1019 Ga0495599_0006440 3300046678 Bacteria 7083
1020 Ga0495599_0023759 3300046678 Bacteria 3832
1021 Ga0495599_0036498 3300046678 Bacteria 3087
1022 Ga0495599_0091650 3300046678 Bacteria 1896
1023 Ga0495623_0022851 3300046679 Bacteria 4037
1024 Ga0495623_0022863 3300046679 Bacteria 4036
1025 Ga0495623_0415218 3300046679 Bacteria 722
1026 Ga0495646_0011620 3300046680 Bacteria 5595
1027 Ga0495646_0036240 3300046680 Bacteria 3056
1028 Ga0495647_0004777 3300046681 Bacteria 4421
1029 Ga0495658_0002129 3300046683 Bacteria 10021
1030 Ga0495658_0467759 3300046683 Bacteria 806
1031 Ga0495669_0004453 3300046684 Bacteria 5784
1032 Ga0495669_0019284 3300046684 Bacteria 2942
1033 Ga0495669_0166786 3300046684 Bacteria 1047
1034 Ga0495613_0080984 3300046689 Bacteria 2359
1035 Ga0495613_0163535 3300046689 Bacteria 1582
1036 Ga0495624_0000138 3300046690 Bacteria 52220
1037 Ga0495624_0060002 3300046690 Bacteria 2385
1038 Ga0495624_0367711 3300046690 Bacteria 865
1039 Ga0495670_0011657 3300046691 Bacteria 4326
1040 Ga0495670_0095461 3300046691 Bacteria 1525
1041 Ga0495670_0339782 3300046691 Bacteria 807
1042 Ga0495649_0062500 3300046694 Bacteria 2001
1043 Ga0495649_0074141 3300046694 Bacteria 1823
1044 Ga0495649_0110748 3300046694 Bacteria 1456
1045 Ga0495649_0187292 3300046694 Bacteria 1078
1046 Ga0495589_0013236 3300046794 Bacteria 4257
1047 Ga0495589_0099354 3300046794 Bacteria 1409
1048 Ga0495600_0003305 3300046809 Bacteria 9460
1049 Ga0495600_0019159 3300046809 Bacteria 4366
1050 Ga0495600_0049648 3300046809 Bacteria 2737
1051 Ga0495600_0064139 3300046809 Bacteria 2401
1052 Ga0495600_0215981 3300046809 Bacteria 1228
1053 Ga0495660_0097091 3300046810 Bacteria 1522
1054 Ga0495660_0153516 3300046810 Bacteria 1135
1055 Ga0495581_0000001 3300047315 Bacteria 104278
1056 Ga0495581_0165241 3300047315 Bacteria 1294
1057 Ga0495581_0174967 3300047315 Bacteria 1255
1058 Ga0495604_0049825 3300047317 Bacteria 3252
1059 Ga0495604_0055766 3300047317 Bacteria 3044
1060 Ga0495604_0060760 3300047317 Bacteria 2892
1061 Ga0495604_0488465 3300047317 Bacteria 800
1062 Ga0495636_0014658 3300047318 Bacteria 3119
1063 Ga0495636_0376219 3300047318 Bacteria 673
1064 Ga0495674_0005256 3300047319 Bacteria 12420
1065 Ga0495674_0008899 3300047319 Bacteria 9548
1066 Ga0495674_0167618 3300047319 Bacteria 1834
1067 Ga0495674_0457991 3300047319 Bacteria 1024
1068 Ga0495672_0004418 3300047320 Bacteria 11527
1069 Ga0495672_0029991 3300047320 Bacteria 3418
1070 Ga0495672_0059938 3300047320 Bacteria 2200
1071 Ga0495676_0040714 3300047321 Bacteria 3832
1072 Ga0495676_0157359 3300047321 Bacteria 1611
1073 Ga0495680_0003079 3300047322 Bacteria 16606
1074 Ga0495680_0022685 3300047322 Bacteria 5229
1075 Ga0495680_0044778 3300047322 Bacteria 3497
1076 Ga0495680_0150989 3300047322 Bacteria 1694
1077 Ga0495683_0031335 3300047323 Bacteria 2710
1078 Ga0495683_0036510 3300047323 Bacteria 2493
1079 Ga0495683_0049939 3300047323 Bacteria 2094
1080 Ga0495683_0203155 3300047323 Bacteria 892
1081 Ga0495687_041885 3300047443 Bacteria 2005
1082 Ga0495687_185412 3300047443 Bacteria 675
1083 Ga0495675_0046597 3300047444 Bacteria 2759
1084 Ga0495685_121617 3300047447 Bacteria 857
1085 Ga0495673_0023976 3300047469 Bacteria 2957
1086 Ga0495673_0062926 3300047469 Bacteria 1583
1087 Ga0495673_0065060 3300047469 Bacteria 1549
1088 Ga0495673_0068791 3300047469 Bacteria 1495
1089 Ga0495684_0036692 3300047471 Bacteria 3757
1090 Ga0495684_0044470 3300047471 Bacteria 3400
1091 Ga0495684_0072494 3300047471 Bacteria 2617
1092 Ga0495686_0076336 3300047472 Bacteria 2053
1093 Ga0495686_0080518 3300047472 Bacteria 1990
1094 Ga0495686_0183940 3300047472 Bacteria 1209
1095 Ga0495686_0319020 3300047472 Bacteria 852
1096 Ga0495593_0000006 3300047673 Bacteria 90370
1097 Ga0495593_0022703 3300047673 Bacteria 3491
1098 Ga0495593_0286107 3300047673 Bacteria 824
1099 Ga0495602_0011303 3300048088 Bacteria 9231
1100 Ga0495602_0017651 3300048088 Bacteria 7149
1101 Ga0495602_0038574 3300048088 Bacteria 4414
1102 Ga0495602_0196436 3300048088 Bacteria 1542
1103 Ga0495602_0346360 3300048088 Bacteria 1073
1104 Ga0495602_0384061 3300048088 Bacteria 1005
1105 Ga0495614_0057226 3300048089 Bacteria 1674
1106 Ga0495614_0200275 3300048089 Bacteria 903
1107 Ga0495626_0171203 3300048091 Bacteria 905
1108 Ga0496100_0006943 3300048903 Bacteria 6207
1109 Ga0496100_0084030 3300048903 Bacteria 2157
1110 Ga0496100_0115201 3300048903 Bacteria 1874
1111 Ga0496100_0247974 3300048903 Bacteria 1316
1112 Ga0496101_0059075 3300048904 Bacteria 2779
1113 Ga0496101_0072025 3300048904 Bacteria 2536
1114 Ga0496101_0085099 3300048904 Bacteria 2342
1115 Ga0496101_0128661 3300048904 Bacteria 1921
1116 Ga0496101_0158441 3300048904 Bacteria 1735
1117 Ga0496101_0182757 3300048904 Bacteria 1615
1118 Ga0496101_0209036 3300048904 Bacteria 1511
1119 Ga0496101_0403148 3300048904 Bacteria 1077
1120 Ga0496101_0457260 3300048904 Bacteria 1007
1121 Ga0496101_0543616 3300048904 Bacteria 918
1122 Ga0496101_1068847 3300048904 Bacteria 634
1123 Ga0496102_0067901 3300048905 Bacteria 3271
1124 Ga0496102_0071311 3300048905 Bacteria 3190
1125 Ga0496102_0129692 3300048905 Bacteria 2359
1126 Ga0496102_0157522 3300048905 Bacteria 2135
1127 Ga0496102_0281194 3300048905 Bacteria 1568
1128 Ga0496102_0863936 3300048905 Bacteria 827
1129 Ga0496103_0155585 3300048906 Bacteria 1465
1130 Ga0496103_0218081 3300048906 Bacteria 1227
1131 Ga0496104_0009233 3300048907 Bacteria 8768
1132 Ga0496104_0009595 3300048907 Bacteria 8616
1133 Ga0496104_0022577 3300048907 Bacteria 5779
1134 Ga0496104_0026681 3300048907 Bacteria 5337
1135 Ga0496104_0030806 3300048907 Bacteria 4987
1136 Ga0496104_0109706 3300048907 Bacteria 2645
1137 Ga0496104_0369287 3300048907 Bacteria 1347
1138 Ga0496104_0472106 3300048907 Bacteria 1166
1139 Ga0496105_0002418 3300048908 Bacteria 13525
1140 Ga0496105_0003634 3300048908 Bacteria 11464
1141 Ga0496105_0005245 3300048908 Bacteria 9819
1142 Ga0496105_0032335 3300048908 Bacteria 4292
1143 Ga0496105_0036221 3300048908 Bacteria 4064
1144 Ga0496105_0048740 3300048908 Bacteria 3496
1145 Ga0496105_0056871 3300048908 Bacteria 3229
1146 Ga0496105_0311075 3300048908 Bacteria 1264
1147 Ga0496105_0471474 3300048908 Bacteria 989
1148 Ga0496105_0520715 3300048908 Bacteria 931
1149 Ga0496106_0102797 3300048909 Bacteria 2217
1150 Ga0496106_0286438 3300048909 Bacteria 1320
1151 Ga0496107_0364903 3300048910 Bacteria 1074
1152 Ga0496107_0602276 3300048910 Bacteria 812
1153 Ga0496108_0011505 3300048911 Bacteria 7191
1154 Ga0496108_0029736 3300048911 Bacteria 4527
1155 Ga0496108_0030463 3300048911 Bacteria 4472
1156 Ga0496108_0091996 3300048911 Bacteria 2579
1157 Ga0496108_0106987 3300048911 Bacteria 2388
1158 Ga0496108_0111129 3300048911 Bacteria 2344
1159 Ga0496108_0463158 3300048911 Bacteria 1107
1160 Ga0496109_0031295 3300048912 Bacteria 4774
1161 Ga0496109_0066655 3300048912 Bacteria 3297
1162 Ga0496109_0088762 3300048912 Bacteria 2858
1163 Ga0496109_0142003 3300048912 Bacteria 2245
1164 Ga0496109_0201139 3300048912 Bacteria 1873
1165 Ga0496109_0270310 3300048912 Bacteria 1601
1166 Ga0496109_0296681 3300048912 Bacteria 1524
1167 Ga0496109_1167299 3300048912 Bacteria 707
1168 Ga0496110_0024962 3300048913 Bacteria 5101
1169 Ga0496110_0059210 3300048913 Bacteria 3375
1170 Ga0496110_0126508 3300048913 Bacteria 2306
1171 Ga0496110_0129862 3300048913 Bacteria 2274
1172 Ga0496110_0129876 3300048913 Bacteria 2274
1173 Ga0496110_0682134 3300048913 Bacteria 928
1174 Ga0496111_0005520 3300048914 Bacteria 8122
1175 Ga0496111_0091349 3300048914 Bacteria 2231
1176 Ga0496111_0104147 3300048914 Bacteria 2087
1177 Ga0496111_0131764 3300048914 Bacteria 1850
1178 Ga0496111_0615582 3300048914 Bacteria 794
1179 Ga0496112_0000044 3300048915 Bacteria 86865
1180 Ga0496112_0002088 3300048915 Bacteria 15846
1181 Ga0496112_0018929 3300048915 Bacteria 6489
1182 Ga0496112_0020643 3300048915 Bacteria 6247
1183 Ga0496112_0021176 3300048915 Bacteria 6179
1184 Ga0496112_0042168 3300048915 Bacteria 4464
1185 Ga0496112_0060244 3300048915 Bacteria 3740
1186 Ga0496112_0061659 3300048915 Bacteria 3698
1187 Ga0496112_0071713 3300048915 Bacteria 3423
1188 Ga0496112_0076624 3300048915 Bacteria 3307
1189 Ga0496112_0165914 3300048915 Bacteria 2174
1190 Ga0496112_0183402 3300048915 Bacteria 2057
1191 Ga0496113_0009278 3300048916 Bacteria 6453
1192 Ga0496113_0011400 3300048916 Bacteria 5927
1193 Ga0496113_0073010 3300048916 Bacteria 2613
1194 Ga0496113_0083713 3300048916 Bacteria 2448
1195 Ga0496113_0108366 3300048916 Bacteria 2159
1196 Ga0496113_0548392 3300048916 Bacteria 927
1197 Ga0496114_0023840 3300048917 Bacteria 4993
1198 Ga0496114_0050479 3300048917 Bacteria 3463
1199 Ga0496114_0109489 3300048917 Bacteria 2365
1200 Ga0496114_0219590 3300048917 Bacteria 1668
1201 Ga0496114_0337485 3300048917 Bacteria 1332
1202 Ga0496114_0387592 3300048917 Bacteria 1237
1203 Ga0496114_0449791 3300048917 Bacteria 1141
1204 Ga0496115_0020404 3300048918 Bacteria 5113
1205 Ga0496115_0025923 3300048918 Bacteria 4569
1206 Ga0496115_0029725 3300048918 Bacteria 4294
1207 Ga0496115_0033607 3300048918 Bacteria 4050
1208 Ga0496115_0035946 3300048918 Bacteria 3921
1209 Ga0496115_0060891 3300048918 Bacteria 3042
1210 Ga0496115_0078942 3300048918 Bacteria 2679
1211 Ga0496115_0143179 3300048918 Bacteria 1972
1212 Ga0496115_0216934 3300048918 Bacteria 1579
1213 Ga0496115_0251683 3300048918 Bacteria 1454
1214 Ga0496115_0429543 3300048918 Bacteria 1069
1215 Ga0496115_0453673 3300048918 Bacteria 1035
1216 Ga0496115_0545822 3300048918 Bacteria 927
1217 Ga0496115_0761527 3300048918 Bacteria 756
1218 Ga0496115_0813661 3300048918 Bacteria 726
1219 Ga0496115_0841450 3300048918 Bacteria 711
1220 Ga0496116_0076390 3300048919 Bacteria 2098
1221 Ga0496116_0178122 3300048919 Bacteria 1142
1222 Ga0496116_0331715 3300048919 Bacteria 706
1223 Ga0496117_0149557 3300048920 Bacteria 1384
1224 Ga0496118_0069862 3300048921 Bacteria 2540
1225 Ga0496118_0198646 3300048921 Bacteria 1191
1226 Ga0496119_0037130 3300048922 Bacteria 3169
1227 Ga0496119_0044456 3300048922 Bacteria 2796
1228 Ga0496119_0135227 3300048922 Bacteria 1338
1229 Ga0496119_0136853 3300048922 Bacteria 1327
1230 Ga0496119_0194322 3300048922 Bacteria 1055
1231 Ga0496120_0014100 3300048923 Bacteria 5339
1232 Ga0496120_0135828 3300048923 Bacteria 1254
1233 Ga0496121_0001183 3300048924 Bacteria 45653
1234 Ga0496121_0033032 3300048924 Bacteria 4691
1235 Ga0496121_0037558 3300048924 Bacteria 4300
1236 Ga0496121_0045446 3300048924 Bacteria 3773
1237 Ga0496121_0051131 3300048924 Bacteria 3483
1238 Ga0496121_0062533 3300048924 Bacteria 3048
1239 Ga0496121_0197133 3300048924 Bacteria 1438
1240 Ga0496121_0217800 3300048924 Bacteria 1347
1241 Ga0496121_0530931 3300048924 Bacteria 740
1242 Ga0496122_0024003 3300048925 Bacteria 5352
1243 Ga0496122_0115896 3300048925 Bacteria 1744
1244 Ga0496123_0070330 3300048926 Bacteria 2191
1245 Ga0496124_0100316 3300048927 Bacteria 2347
1246 Ga0496124_0170991 3300048927 Bacteria 1683
1247 Ga0496124_0292170 3300048927 Bacteria 1182
1248 Ga0496125_0050293 3300048928 Bacteria 3452
1249 Ga0496125_0254968 3300048928 Bacteria 1104
1250 Ga0496125_0446737 3300048928 Bacteria 742
1251 Ga0496126_0007021 3300048929 Bacteria 12429
1252 Ga0496126_0011784 3300048929 Bacteria 9001
1253 Ga0496126_0013214 3300048929 Bacteria 8419
1254 Ga0496126_0015857 3300048929 Bacteria 7567
1255 Ga0496126_0037507 3300048929 Bacteria 4522
1256 Ga0496126_0068932 3300048929 Bacteria 3156
1257 Ga0496126_0099061 3300048929 Bacteria 2553
1258 Ga0496126_0099222 3300048929 Bacteria 2551
1259 Ga0496126_0220769 3300048929 Bacteria 1592
1260 Ga0496126_0286798 3300048929 Bacteria 1362
1261 Ga0496126_0331694 3300048929 Bacteria 1248
1262 Ga0496126_0407950 3300048929 Bacteria 1101
1263 Ga0496126_0506979 3300048929 Bacteria 963
1264 Ga0496126_0621102 3300048929 Bacteria 849
1265 Ga0501031_0003098 3300049568 Bacteria 10649
1266 Ga0501031_0032790 3300049568 Bacteria 3387
1267 Ga0501031_0112423 3300049568 Bacteria 1778
1268 Ga0501032_0000198 3300049569 Bacteria 50120
1269 Ga0501032_0054807 3300049569 Bacteria 2683
1270 Ga0501033_0000091 3300049570 Bacteria 85666
1271 Ga0501033_0076980 3300049570 Bacteria 2448
1272 Ga0501033_0354966 3300049570 Bacteria 1026
1273 Ga0501033_0572433 3300049570 Bacteria 777
1274 Ga0501034_0000039 3300049571 Bacteria 237357
1275 Ga0501034_0253035 3300049571 Bacteria 1706
1276 Ga0501034_0339341 3300049571 Bacteria 1433
1277 Ga0501034_0440586 3300049571 Bacteria 1221
1278 Ga0501034_0472743 3300049571 Bacteria 1169
1279 Ga0501034_0506556 3300049571 Bacteria 1120
1280 Ga0501036_0000347 3300049572 Bacteria 32588
1281 Ga0501037_0000025 3300049573 Bacteria 143276
1282 Ga0501037_0461997 3300049573 Bacteria 865
1283 Ga0501038_0002497 3300049574 Bacteria 17114
1284 Ga0501038_0029365 3300049574 Bacteria 4874
1285 Ga0501038_0531730 3300049574 Bacteria 896
1286 Ga0501039_0004443 3300049575 Bacteria 10584
1287 Ga0501041_0263495 3300049577 Bacteria 1084
1288 Ga0501041_0472345 3300049577 Bacteria 797
1289 Ga0501043_0000233 3300049579 Bacteria 50329
1290 Ga0501046_0000995 3300049580 Bacteria 27709
1291 Ga0501046_0241526 3300049580 Bacteria 1332
1292 Ga0501046_0281836 3300049580 Bacteria 1217
1293 Ga0501047_0004251 3300049581 Bacteria 13481
1294 Ga0501047_0098158 3300049581 Bacteria 2808
1295 Ga0501047_0119159 3300049581 Bacteria 2521
1296 Ga0501047_0156948 3300049581 Bacteria 2149
1297 Ga0501047_0351056 3300049581 Bacteria 1312
1298 Ga0501048_0000218 3300049582 Bacteria 37734
1299 Ga0501048_0014866 3300049582 Bacteria 5755
1300 Ga0501048_0420367 3300049582 Bacteria 956
1301 Ga0501067_0004456 3300049583 Bacteria 7723
1302 Ga0501068_0000785 3300049584 Bacteria 16408
1303 Ga0501068_0459997 3300049584 Bacteria 824
1304 Ga0501069_0000827 3300049585 Bacteria 14627
1305 Ga0501070_0049607 3300049586 Bacteria 3485
1306 Ga0501070_0156786 3300049586 Bacteria 1877
1307 Ga0501070_0255997 3300049586 Bacteria 1431
1308 Ga0501070_0299202 3300049586 Bacteria 1311
1309 Ga0501071_0159587 3300049587 Bacteria 1685
1310 Ga0501071_0452596 3300049587 Bacteria 983
1311 Ga0501072_0007128 3300049588 Bacteria 8484
1312 Ga0501072_0252575 3300049588 Bacteria 1404
1313 Ga0501072_0489709 3300049588 Bacteria 973
1314 Ga0501073_0000118 3300049589 Bacteria 50886
1315 Ga0501074_0000273 3300049590 Bacteria 29590
1316 Ga0501074_0041653 3300049590 Bacteria 3325
1317 Ga0501076_0540342 3300049592 Bacteria 961
1318 Ga0501079_0000590 3300049741 Bacteria 24020
1319 Ga0501079_0115213 3300049741 Bacteria 2089
1320 Ga0501079_0238472 3300049741 Bacteria 1421
1321 Ga0501080_0000124 3300049742 Bacteria 54519
1322 Ga0501080_0545977 3300049742 Bacteria 1032
1323 Ga0501081_0242685 3300049743 Bacteria 1314
1324 Ga0501081_0339329 3300049743 Bacteria 1106
1325 Ga0501083_0000184 3300049744 Bacteria 40201
1326 Ga0501083_0512726 3300049744 Bacteria 781
1327 Ga0501035_0000052 3300049822 Bacteria 143038
1328 Ga0501035_0107271 3300049822 Bacteria 2448
1329 Ga0501035_0329775 3300049822 Bacteria 1281
1330 Ga0501035_0507972 3300049822 Bacteria 991
1331 Ga0501035_0638617 3300049822 Bacteria 864
1332 Ga0501044_0001974 3300049823 Bacteria 23731
1333 Ga0501044_0176467 3300049823 Bacteria 2105
1334 Ga0501044_0199519 3300049823 Bacteria 1959
1335 Ga0501044_0357662 3300049823 Bacteria 1378
1336 Ga0501044_0375631 3300049823 Bacteria 1337
1337 Ga0501044_0882526 3300049823 Bacteria 770
1338 Ga0501045_0276165 3300049824 Bacteria 1251
1339 Ga0501045_0588073 3300049824 Bacteria 825
1340 nmdc:mga00v17_32928_c1 3300050491 Bacteria 3067
1341 nmdc:mga0yw44_138752_c1 3300050492 Bacteria 1579
1342 nmdc:mga0yw44_242569_c1 3300050492 Bacteria 1198
1343 nmdc:mga0yw44_266_c1 3300050492 Bacteria 16414
1344 nmdc:mga0yw44_45512_c1 3300050492 Bacteria 2631
1345 nmdc:mga0k408_28756_c1 3300050493 Bacteria 3161
1346 nmdc:mga0k408_70684_c1 3300050493 Bacteria 2037
1347 nmdc:mga06z11_101576_c1 3300050494 Bacteria 1579
1348 nmdc:mga06z11_370749_c1 3300050494 Bacteria 859
1349 nmdc:mga06z11_48738_c1 3300050494 Bacteria 2158
1350 nmdc:mga04h51_12410_c1 3300050495 Bacteria 2391
1351 nmdc:mga07m45_332203_c1 3300050496 Bacteria 883
1352 nmdc:mga07m45_7786_c1 3300050496 Bacteria 5483
1353 nmdc:mga07m45_92436_c1 3300050496 Bacteria 1734
1354 nmdc:mga05p37_142001_c1 3300050507 Bacteria 2941
1355 nmdc:mga05p37_52588_c1 3300050507 Bacteria 5007
1356 nmdc:mga05p37_652791_c1 3300050507 Bacteria 1178
1357 nmdc:mga09592_238222_c1 3300050508 Bacteria 1576
1358 nmdc:mga09592_573415_c1 3300050508 Bacteria 968
1359 nmdc:mga09592_7795_c1 3300050508 Bacteria 8702
1360 nmdc:mga0qj67_362895_c1 3300050509 Bacteria 1170
1361 nmdc:mga0qj67_639523_c1 3300050509 Bacteria 849
1362 nmdc:mga08y16_121155_c1 3300050511 Bacteria 2722
1363 nmdc:mga08y16_15302_c1 3300050511 Bacteria 8071
1364 nmdc:mga08y16_177278_c1 3300050511 Bacteria 2213
1365 nmdc:mga08y16_381937_c1 3300050511 Bacteria 1444
1366 nmdc:mga0n895_58310_c1 3300050512 Bacteria 3806
1367 nmdc:mga0n895_94897_c1 3300050512 Bacteria 2987
1368 nmdc:mga0sz30_114179_c1 3300050516 Bacteria 1185
1369 Ga0495601_0166918 3300053077 Bacteria 1438
1370 Ga0495601_0302551 3300053077 Bacteria 1042
1371 Ga0495612_0009808 3300053078 Bacteria 3879
1372 Ga0500635_0005505 3300053080 Bacteria 3327
1373 Ga0500635_0102030 3300053080 Bacteria 1056
1374 Ga0495655_0054323 3300053083 Bacteria 1071
1375 Ga0495595_0002792 3300053084 Bacteria 6866
1376 Ga0495619_0001159 3300053085 Bacteria 17308
1377 Ga0495619_0388233 3300053085 Bacteria 965
1378 Ga0495619_0454592 3300053085 Bacteria 883
1379 Ga0500578_0180763 3300053086 Bacteria 1300
1380 Ga0500643_000069 3300053087 Bacteria 116366
1381 Ga0500646_0072983 3300053090 Bacteria 1033
1382 Ga0500646_0110759 3300053090 Bacteria 873
1383 Ga0500647_0070316 3300053091 Bacteria 1683
1384 Ga0500583_0049077 3300053092 Bacteria 1951
1385 Ga0500583_0163471 3300053092 Bacteria 1109
1386 Ga0500651_0132251 3300053093 Bacteria 1508
1387 Ga0500651_0227351 3300053093 Bacteria 1092
1388 Ga0500566_0000112 3300053094 Bacteria 41687
1389 Ga0500566_0002752 3300053094 Bacteria 10478
1390 Ga0500566_0125526 3300053094 Bacteria 1379
1391 Ga0500566_0372327 3300053094 Bacteria 648
1392 Ga0500640_011906 3300053095 Bacteria 3558
1393 Ga0500640_029224 3300053095 Bacteria 2409
1394 Ga0500641_0017803 3300053096 Bacteria 2664
1395 Ga0500641_0120070 3300053096 Bacteria 1133
1396 Ga0500641_0164625 3300053096 Bacteria 956
1397 Ga0500641_0236238 3300053096 Bacteria 771
1398 Ga0500650_0095005 3300053098 Bacteria 1396
1399 Ga0500650_0268134 3300053098 Bacteria 762
1400 Ga0500554_003067 3300053102 Bacteria 3370
1401 Ga0500556_0068287 3300053104 Bacteria 1323
1402 Ga0500557_000003 3300053105 Bacteria 228429
1403 Ga0500562_001366 3300053108 Bacteria 6024
1404 Ga0500569_150283 3300053109 Bacteria 785
1405 Ga0500569_161765 3300053109 Bacteria 758
1406 Ga0500572_001913 3300053111 Bacteria 5226
1407 Ga0500592_015608 3300053116 Bacteria 1220
1408 Ga0500595_002897 3300053119 Bacteria 8221
1409 Ga0500595_004648 3300053119 Bacteria 6117
1410 Ga0500595_028812 3300053119 Bacteria 1890
1411 Ga0500595_029794 3300053119 Bacteria 1847
1412 Ga0500595_034082 3300053119 Bacteria 1686
1413 Ga0500595_037812 3300053119 Bacteria 1572
1414 Ga0500642_0050838 3300053130 Bacteria 1829
1415 Ga0500642_0151065 3300053130 Bacteria 1090
1416 Ga0500658_0016766 3300053134 Bacteria 2731
1417 Ga0500658_0412285 3300053134 Bacteria 618
1418 Ga0500559_0007921 3300053136 Bacteria 4685
1419 Ga0500559_0083047 3300053136 Bacteria 1458
1420 Ga0500568_0012571 3300053139 Bacteria 3886
1421 Ga0500568_0022119 3300053139 Bacteria 2727
1422 Ga0500577_0122624 3300053142 Bacteria 1083
1423 Ga0500588_0051173 3300053146 Bacteria 1288
1424 Ga0500590_085681 3300053148 Bacteria 1539
1425 Ga0500590_104628 3300053148 Bacteria 1353
1426 Ga0500590_154222 3300053148 Bacteria 1032
1427 Ga0500603_000314 3300053150 Bacteria 12721
1428 Ga0500603_000747 3300053150 Bacteria 7921
1429 Ga0500604_0053025 3300053151 Bacteria 1257
1430 Ga0500622_0046733 3300053156 Bacteria 2237
1431 Ga0500622_0145377 3300053156 Bacteria 1126
1432 Ga0500627_0038837 3300053158 Bacteria 2037
1433 Ga0500627_0170721 3300053158 Bacteria 980
1434 Ga0500630_001943 3300053159 Bacteria 9925
1435 Ga0500633_0066613 3300053160 Bacteria 1278
1436 Ga0500638_006964 3300053162 Bacteria 4685
1437 Ga0500638_044881 3300053162 Bacteria 2145
1438 Ga0500639_000357 3300053163 Bacteria 22540
1439 Ga0500636_0000286 3300053177 Bacteria 27858
1440 Ga0500636_0098736 3300053177 Bacteria 1663
1441 Ga0500636_0249611 3300053177 Bacteria 905
1442 Ga0500637_0182883 3300053178 Bacteria 1200
1443 Ga0500649_180359 3300053722 Bacteria 714
1444 Ga0500570_071677 3300053724 Bacteria 1613
1445 Ga0500611_053734 3300053727 Bacteria 932
1446 Ga0500625_005539 3300053729 Bacteria 5289
1447 Ga0500625_154897 3300053729 Bacteria 854
1448 Ga0500645_051386 3300053730 Bacteria 1202
1449 Ga0500552_001281 3300053733 Bacteria 2387
1450 Ga0500596_001208 3300053735 Bacteria 5218
1451 Ga0500601_000736 3300053737 Bacteria 4272
1452 Ga0501084_0002419 3300054114 Bacteria 15019
1453 Ga0501084_0057287 3300054114 Bacteria 3261
1454 Ga0501084_0371387 3300054114 Bacteria 1209
1455 Ga0501082_0000457 3300060353 Bacteria 36134

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10125747 Ga0114129_101257475 169
2 3300009551 Ga0105238_10576969 Ga0105238_105769691 169
3 3300048915 Ga0496112_0021176 Ga0496112_0021176_2108_2752 169
4 3300050507 nmdc:mga05p37_52588_c1 nmdc:mga05p37_52588_c1_3802_4314 169
5 iso_pu_bacteria 2839993093 2839998417 172
6 iso_pu_bacteria 2871451962 2871455688 172
7 3300005985 Ga0081539_10000072 Ga0081539_1000007244 173
8 3300035170 Ga0373943_0458474 Ga0373943_0458474_50_601 173
9 3300035692 Ga0373935_0041267 Ga0373935_0041267_2057_2608 173
10 3300035695 Ga0373927_0014802 Ga0373927_0014802_2109_2660 173
11 3300037068 Ga0373925_0159804 Ga0373925_0159804_26_577 173
12 3300037853 Ga0436364_0253351 Ga0436364_0253351_23937_24488 173
13 3300026121 Ga0207683_10408897 Ga0207683_104088971 174
14 3300035118 Ga0373954_0009270 Ga0373954_0009270_394_918 174
15 3300035119 Ga0373956_0009916 Ga0373956_0009916_1738_2262 174
16 3300035724 Ga0373933_0020123 Ga0373933_0020123_62_586 174
17 3300036401 Ga0373937_0010610 Ga0373937_0010610_3925_4449 174
18 3300046454 Ga0495592_0011800 Ga0495592_0011800_45_569 174
19 3300046477 Ga0495664_0009821 Ga0495664_0009821_4412_4936 174
20 3300046533 Ga0495640_0002839 Ga0495640_0002839_7990_8514 174
21 3300046535 Ga0495586_0016426 Ga0495586_0016426_419_943 174
22 3300046678 Ga0495599_0023759 Ga0495599_0023759_45_569 174
23 3300046679 Ga0495623_0022851 Ga0495623_0022851_3446_3970 174
24 3300047471 Ga0495684_0044470 Ga0495684_0044470_1275_1799 174
25 3300048088 Ga0495602_0017651 Ga0495602_0017651_33_557 174
26 3300005338 Ga0068868_100431979 Ga0068868_1004319792 175
27 3300005719 Ga0068861_100633016 Ga0068861_1006330162 175
28 3300006237 Ga0097621_100270350 Ga0097621_1002703503 175
29 3300006846 Ga0075430_100265099 Ga0075430_1002650992 175
30 3300006881 Ga0068865_100221282 Ga0068865_1002212822 175
31 3300009098 Ga0105245_11453011 Ga0105245_114530112 175
32 3300009177 Ga0105248_10706575 Ga0105248_107065752 175
33 3300009551 Ga0105238_10034351 Ga0105238_100343513 175
34 3300013297 Ga0157378_10071194 Ga0157378_100711943 175
35 3300025927 Ga0207687_10706428 Ga0207687_107064282 175
36 3300025938 Ga0207704_10170929 Ga0207704_101709292 175
37 3300026023 Ga0207677_10529499 Ga0207677_105294992 175
38 3300031238 Ga0265332_10001601 Ga0265332_100016014 175
39 3300031901 Ga0307406_10072182 Ga0307406_100721821 175
40 3300032002 Ga0307416_100288558 Ga0307416_1002885581 175
41 3300032126 Ga0307415_100296861 Ga0307415_1002968612 175
42 3300002076 JGI24749J21850_1027053 JGI24749J21850_10270531 176
43 3300005290 Ga0065712_10031307 Ga0065712_100313071 176
44 3300005327 Ga0070658_10001665 Ga0070658_100016654 176
45 3300005328 Ga0070676_10631456 Ga0070676_106314561 176
46 3300005329 Ga0070683_100445869 Ga0070683_1004458692 176
47 3300005330 Ga0070690_100072362 Ga0070690_1000723623 176
48 3300005334 Ga0068869_100268730 Ga0068869_1002687301 176
49 3300005336 Ga0070680_100000866 Ga0070680_1000008669 176
50 3300005338 Ga0068868_100089912 Ga0068868_1000899122 176
51 3300005340 Ga0070689_100087421 Ga0070689_1000874212 176
52 3300005345 Ga0070692_10033354 Ga0070692_100333543 176
53 3300005347 Ga0070668_100111293 Ga0070668_1001112932 176
54 3300005355 Ga0070671_100176438 Ga0070671_1001764382 176
55 3300005356 Ga0070674_100076912 Ga0070674_1000769122 176
56 3300005364 Ga0070673_100282428 Ga0070673_1002824282 176
57 3300005365 Ga0070688_100005226 Ga0070688_1000052266 176
58 3300005366 Ga0070659_100328689 Ga0070659_1003286892 176
59 3300005367 Ga0070667_100195022 Ga0070667_1001950221 176
60 3300005438 Ga0070701_10042104 Ga0070701_100421042 176
61 3300005456 Ga0070678_100335420 Ga0070678_1003354201 176
62 3300005457 Ga0070662_100691147 Ga0070662_1006911472 176
63 3300005458 Ga0070681_10002083 Ga0070681_1000208313 176
64 3300005459 Ga0068867_100151066 Ga0068867_1001510662 176
65 3300005466 Ga0070685_10323863 Ga0070685_103238631 176
66 3300005467 Ga0070706_100203771 Ga0070706_1002037711 176
67 3300005530 Ga0070679_100008178 Ga0070679_1000081786 176
68 3300005539 Ga0068853_100439890 Ga0068853_1004398902 176
69 3300005539 Ga0068853_101509363 Ga0068853_1015093631 176
70 3300005543 Ga0070672_100250216 Ga0070672_1002502162 176
71 3300005544 Ga0070686_100210095 Ga0070686_1002100951 176
72 3300005548 Ga0070665_100616170 Ga0070665_1006161702 176
73 3300005549 Ga0070704_100374564 Ga0070704_1003745642 176
74 3300005563 Ga0068855_100006305 Ga0068855_1000063056 176
75 3300005577 Ga0068857_100312135 Ga0068857_1003121352 176
76 3300005614 Ga0068856_100395192 Ga0068856_1003951922 176
77 3300005615 Ga0070702_100049264 Ga0070702_1000492642 176
78 3300005718 Ga0068866_10111089 Ga0068866_101110891 176
79 3300005719 Ga0068861_100016572 Ga0068861_1000165722 176
80 3300005719 Ga0068861_101179001 Ga0068861_1011790012 176
81 3300005840 Ga0068870_10130231 Ga0068870_101302311 176
82 3300005841 Ga0068863_100588667 Ga0068863_1005886672 176
83 3300005844 Ga0068862_100446376 Ga0068862_1004463762 176
84 3300006237 Ga0097621_100196925 Ga0097621_1001969252 176
85 3300006358 Ga0068871_100146132 Ga0068871_1001461322 176
86 3300006881 Ga0068865_100447258 Ga0068865_1004472582 176
87 3300009093 Ga0105240_10006650 Ga0105240_1000665016 176
88 3300009093 Ga0105240_10454079 Ga0105240_104540792 176
89 3300009094 Ga0111539_10003570 Ga0111539_1000357016 176
90 3300009094 Ga0111539_10086432 Ga0111539_100864323 176
91 3300009094 Ga0111539_10148109 Ga0111539_101481093 176
92 3300009098 Ga0105245_10193843 Ga0105245_101938433 176
93 3300009147 Ga0114129_10829090 Ga0114129_108290902 176
94 3300009148 Ga0105243_10228334 Ga0105243_102283343 176
95 3300009176 Ga0105242_10116929 Ga0105242_101169292 176
96 3300009545 Ga0105237_10051706 Ga0105237_100517062 176
97 3300009545 Ga0105237_10485619 Ga0105237_104856192 176
98 3300009553 Ga0105249_10743319 Ga0105249_107433192 176
99 3300013102 Ga0157371_10022069 Ga0157371_100220694 176
100 3300013104 Ga0157370_10003007 Ga0157370_1000300714 176
101 3300013105 Ga0157369_10310892 Ga0157369_103108922 176
102 3300013296 Ga0157374_10183720 Ga0157374_101837202 176
103 3300013297 Ga0157378_10061196 Ga0157378_100611964 176
104 3300013297 Ga0157378_10321782 Ga0157378_103217822 176
105 3300013306 Ga0163162_11205287 Ga0163162_112052871 176
106 3300013306 Ga0163162_11369024 Ga0163162_113690242 176
107 3300013308 Ga0157375_10723219 Ga0157375_107232192 176
108 3300014326 Ga0157380_10268990 Ga0157380_102689902 176
109 3300014745 Ga0157377_10065182 Ga0157377_100651821 176
110 3300014969 Ga0157376_10581333 Ga0157376_105813332 176
111 3300020070 Ga0206356_11765100 Ga0206356_117651002 176
112 3300025315 Ga0207697_10024723 Ga0207697_100247232 176
113 3300025893 Ga0207682_10023362 Ga0207682_100233623 176
114 3300025899 Ga0207642_10087351 Ga0207642_100873513 176
115 3300025901 Ga0207688_10010703 Ga0207688_100107035 176
116 3300025903 Ga0207680_10062786 Ga0207680_100627862 176
117 3300025907 Ga0207645_10003034 Ga0207645_100030343 176
118 3300025908 Ga0207643_10083232 Ga0207643_100832322 176
119 3300025908 Ga0207643_10123359 Ga0207643_101233591 176
120 3300025909 Ga0207705_10052000 Ga0207705_100520003 176
121 3300025909 Ga0207705_11043729 Ga0207705_110437291 176
122 3300025912 Ga0207707_10002335 Ga0207707_100023358 176
123 3300025913 Ga0207695_10025550 Ga0207695_100255503 176
124 3300025913 Ga0207695_10339889 Ga0207695_103398892 176
125 3300025917 Ga0207660_10001403 Ga0207660_100014034 176
126 3300025921 Ga0207652_10004802 Ga0207652_100048026 176
127 3300025923 Ga0207681_10406526 Ga0207681_104065261 176
128 3300025926 Ga0207659_10332058 Ga0207659_103320582 176
129 3300025931 Ga0207644_10077187 Ga0207644_100771872 176
130 3300025932 Ga0207690_10471764 Ga0207690_104717642 176
131 3300025935 Ga0207709_10194207 Ga0207709_101942072 176
132 3300025937 Ga0207669_10193128 Ga0207669_101931282 176
133 3300025940 Ga0207691_10097500 Ga0207691_100975003 176
134 3300025941 Ga0207711_10207208 Ga0207711_102072082 176
135 3300025942 Ga0207689_10135366 Ga0207689_101353662 176
136 3300025944 Ga0207661_10370450 Ga0207661_103704502 176
137 3300025949 Ga0207667_10007040 Ga0207667_100070403 176
138 3300025961 Ga0207712_10122062 Ga0207712_101220622 176
139 3300025972 Ga0207668_10116175 Ga0207668_101161752 176
140 3300025986 Ga0207658_10991182 Ga0207658_109911822 176
141 3300026023 Ga0207677_10430357 Ga0207677_104303572 176
142 3300026041 Ga0207639_10127978 Ga0207639_101279782 176
143 3300026067 Ga0207678_10083398 Ga0207678_100833982 176
144 3300026075 Ga0207708_10002913 Ga0207708_1000291311 176
145 3300026078 Ga0207702_10333030 Ga0207702_103330302 176
146 3300026088 Ga0207641_10452139 Ga0207641_104521392 176
147 3300026088 Ga0207641_11318166 Ga0207641_113181662 176
148 3300026089 Ga0207648_10111364 Ga0207648_101113642 176
149 3300026095 Ga0207676_10672794 Ga0207676_106727942 176
150 3300026116 Ga0207674_10097487 Ga0207674_100974873 176
151 3300026118 Ga0207675_100154152 Ga0207675_1001541522 176
152 3300026121 Ga0207683_10018187 Ga0207683_100181872 176
153 3300026142 Ga0207698_10078782 Ga0207698_100787822 176
154 3300027876 Ga0209974_10021441 Ga0209974_100214413 176
155 3300027907 Ga0207428_10390444 Ga0207428_103904442 176
156 3300028379 Ga0268266_10092360 Ga0268266_100923603 176
157 3300028379 Ga0268266_10891614 Ga0268266_108916142 176
158 3300028380 Ga0268265_10216282 Ga0268265_102162823 176
159 3300028381 Ga0268264_10244025 Ga0268264_102440252 176
160 3300028577 Ga0265318_10011813 Ga0265318_100118132 176
161 3300031235 Ga0265330_10030658 Ga0265330_100306582 176
162 3300031239 Ga0265328_10002807 Ga0265328_100028074 176
163 3300031240 Ga0265320_10018545 Ga0265320_100185454 176
164 3300031242 Ga0265329_10039885 Ga0265329_100398853 176
165 3300031247 Ga0265340_10356768 Ga0265340_103567681 176
166 3300031250 Ga0265331_10002014 Ga0265331_1000201410 176
167 3300031344 Ga0265316_10285113 Ga0265316_102851131 176
168 3300031344 Ga0265316_10442876 Ga0265316_104428762 176
169 3300031711 Ga0265314_10000720 Ga0265314_1000072025 176
170 3300031712 Ga0265342_10007374 Ga0265342_100073745 176
171 3300036401 Ga0373937_0065077 Ga0373937_0065077_2205_2735 176
172 3300038443 Ga0395901_0465594 Ga0395901_0465594_153_698 176
173 3300046454 Ga0495592_0667153 Ga0495592_0667153_84_614 176
174 3300046460 Ga0495638_0405853 Ga0495638_0405853_134_664 176
175 3300046528 Ga0495642_0115543 Ga0495642_0115543_596_1126 176
176 3300046559 Ga0495667_0270286 Ga0495667_0270286_219_749 176
177 3300046675 Ga0495657_0135604 Ga0495657_0135604_299_829 176
178 3300047317 Ga0495604_0488465 Ga0495604_0488465_163_693 176
179 3300047320 Ga0495672_0059938 Ga0495672_0059938_1068_1625 176
180 3300047322 Ga0495680_0150989 Ga0495680_0150989_399_929 176
181 3300047472 Ga0495686_0319020 Ga0495686_0319020_174_704 176
182 3300048907 Ga0496104_0030806 Ga0496104_0030806_1649_2182 176
183 3300048908 Ga0496105_0003634 Ga0496105_0003634_858_1391 176
184 3300048911 Ga0496108_0111129 Ga0496108_0111129_1257_1787 176
185 3300048915 Ga0496112_0061659 Ga0496112_0061659_2065_2598 176
186 3300048916 Ga0496113_0073010 Ga0496113_0073010_1759_2292 176
187 3300048917 Ga0496114_0387592 Ga0496114_0387592_414_947 176
188 3300048918 Ga0496115_0020404 Ga0496115_0020404_2416_3033 176
189 3300048918 Ga0496115_0078942 Ga0496115_0078942_954_1487 176
190 3300048918 Ga0496115_0841450 Ga0496115_0841450_31_576 176
191 3300048919 Ga0496116_0331715 Ga0496116_0331715_81_611 176
192 3300048920 Ga0496117_0149557 Ga0496117_0149557_624_1154 176
193 3300048922 Ga0496119_0135227 Ga0496119_0135227_185_721 176
194 3300048922 Ga0496119_0136853 Ga0496119_0136853_485_1015 176
195 3300048927 Ga0496124_0170991 Ga0496124_0170991_926_1462 176
196 3300048928 Ga0496125_0446737 Ga0496125_0446737_194_724 176
197 3300048929 Ga0496126_0407950 Ga0496126_0407950_131_661 176
198 3300049571 Ga0501034_0339341 Ga0501034_0339341_320_850 176
199 3300049577 Ga0501041_0263495 Ga0501041_0263495_39_599 176
200 3300049582 Ga0501048_0420367 Ga0501048_0420367_358_918 176
201 3300049587 Ga0501071_0452596 Ga0501071_0452596_252_812 176
202 3300049588 Ga0501072_0489709 Ga0501072_0489709_15_575 176
203 3300049592 Ga0501076_0540342 Ga0501076_0540342_161_721 176
204 3300049743 Ga0501081_0242685 Ga0501081_0242685_55_615 176
205 3300049824 Ga0501045_0588073 Ga0501045_0588073_153_713 176
206 3300050507 nmdc:mga05p37_652791_c1 nmdc:mga05p37_652791_c1_180_710 176
207 3300050508 nmdc:mga09592_238222_c1 nmdc:mga09592_238222_c1_543_1073 176
208 3300050508 nmdc:mga09592_7795_c1 nmdc:mga09592_7795_c1_4008_4538 176
209 3300050511 nmdc:mga08y16_121155_c1 nmdc:mga08y16_121155_c1_1028_1558 176
210 3300050511 nmdc:mga08y16_15302_c1 nmdc:mga08y16_15302_c1_945_1475 176
211 3300050511 nmdc:mga08y16_177278_c1 nmdc:mga08y16_177278_c1_1069_1599 176
212 3300053085 Ga0495619_0388233 Ga0495619_0388233_423_953 176
213 3300053086 Ga0500578_0180763 Ga0500578_0180763_178_708 176
214 3300053090 Ga0500646_0110759 Ga0500646_0110759_12_542 176
215 3300053092 Ga0500583_0163471 Ga0500583_0163471_59_589 176
216 3300053093 Ga0500651_0132251 Ga0500651_0132251_805_1335 176
217 3300053093 Ga0500651_0227351 Ga0500651_0227351_330_860 176
218 3300053096 Ga0500641_0236238 Ga0500641_0236238_58_588 176
219 3300053098 Ga0500650_0095005 Ga0500650_0095005_377_907 176
220 3300053116 Ga0500592_015608 Ga0500592_015608_527_1057 176
221 3300053119 Ga0500595_004648 Ga0500595_004648_3736_4266 176
222 3300053119 Ga0500595_028812 Ga0500595_028812_132_662 176
223 3300053130 Ga0500642_0151065 Ga0500642_0151065_414_944 176
224 3300053139 Ga0500568_0022119 Ga0500568_0022119_2043_2573 176
225 3300053156 Ga0500622_0145377 Ga0500622_0145377_335_865 176
226 3300053158 Ga0500627_0038837 Ga0500627_0038837_1108_1638 176
227 3300054114 Ga0501084_0371387 Ga0501084_0371387_126_686 176
228 iso_pu_bacteria 2507262055 2507507568 176
229 iso_pu_bacteria 2511231028 2511394864 176
230 iso_pu_bacteria 2513237092 2513621769 176
231 iso_pu_bacteria 2513237095 2513647609 176
232 iso_pu_bacteria 2513237102 2513701410 176
233 iso_pu_bacteria 2513237139 2513878736 176
234 iso_pu_bacteria 2513237161 2514009336 176
235 iso_pu_bacteria 2517093001 2517104253 176
236 iso_pu_bacteria 2617270735 2617346891 176
237 iso_pu_bacteria 2617270741 2617372822 176
238 iso_pu_bacteria 2791355196 2793060969 176
239 iso_pu_bacteria 2802429603 2805921385 176
240 iso_pu_bacteria 2816332527 2818236645 176
241 iso_pu_bacteria 2824617872 2824620513 176
242 iso_pu_bacteria 2824626560 2824628439 176
243 iso_pu_bacteria 2824635225 2824637139 176
244 iso_pu_bacteria 2824644064 2824650231 176
245 iso_pu_bacteria 2824661429 2824669918 176
246 iso_pu_bacteria 2824671348 2824673677 176
247 iso_pu_bacteria 2824679649 2824685159 176
248 iso_pu_bacteria 2824687955 2824690644 176
249 iso_pu_bacteria 2824696289 2824700845 176
250 iso_pu_bacteria 2824704595 2824709919 176
251 iso_pu_bacteria 2824714736 2824720064 176
252 iso_pu_bacteria 2824723954 2824730426 176
253 iso_pu_bacteria 2824732956 2824738160 176
254 iso_pu_bacteria 2824746037 2824748770 176
255 iso_pu_bacteria 2824753945 2824756076 176
256 iso_pu_bacteria 2824763712 2824767614 176
257 iso_pu_bacteria 2824773399 2824775032 176
258 iso_pu_bacteria 2838122688 2838129313 176
259 iso_pu_bacteria 2841941048 2841948030 176
260 iso_pu_bacteria 2841949485 2841953572 176
261 iso_pu_bacteria 2841957949 2841962830 176
262 iso_pu_bacteria 2841966195 2841973023 176
263 iso_pu_bacteria 2841974524 2841978300 176
264 iso_pu_bacteria 2841983080 2841990519 176
265 iso_pu_bacteria 2847930680 2847937415 176
266 iso_pu_bacteria 2847939898 2847947839 176
267 iso_pu_bacteria 2849076700 2849078303 176
268 iso_pu_bacteria 2857509624 2857512683 176
269 iso_pu_bacteria 2874620515 2874628171 176
270 iso_pu_bacteria 2879083081 2879086716 176
271 iso_pu_bacteria 2879099564 2879107805 176
272 iso_pu_bacteria 2881364244 2881371369 176
273 iso_pu_bacteria 2881665667 2881666676 176
274 iso_pu_bacteria 2885366525 2885370059 176
275 iso_pu_bacteria 2888378607 2888385546 176
276 iso_pu_bacteria 2888388044 2888392689 176
277 iso_pu_bacteria 2904666416 2904674211 176
278 iso_pu_bacteria 2904711408 2904711879 176
279 iso_pu_bacteria 2906626472 2906627690 176
280 iso_pu_bacteria 2908775508 2908781267 176
281 iso_pu_bacteria 2922368715 2922372309 176
282 iso_pu_bacteria 2922393267 2922396984 176
283 iso_pu_bacteria 2929615660 2929621119 176
284 iso_pu_bacteria 2929624759 2929626050 176
285 iso_pu_bacteria 2932784394 2932785076 176
286 iso_pu_bacteria 2932794094 2932795058 176
287 iso_pu_bacteria 2932801729 2932805586 176
288 iso_pu_bacteria 2932809354 2932810104 176
289 iso_pu_bacteria 2932818245 2932821678 176
290 iso_pu_bacteria 2932828146 2932828912 176
291 iso_pu_bacteria 2933577622 2933583011 176
292 iso_pu_bacteria 2935616580 2935619668 176
293 iso_pu_bacteria 2935638405 2935638648 176
294 iso_pu_bacteria 2935675223 2935676457 176
295 iso_pu_bacteria 2935684952 2935691027 176
296 iso_pu_bacteria 2935694250 2935694539 176
297 iso_pu_bacteria 2935703347 2935703654 176
298 iso_pu_bacteria 2935713505 2935718408 176
299 iso_pu_bacteria 2935722832 2935727612 176
300 iso_pu_bacteria 2935732158 2935736315 176
301 iso_pu_bacteria 2935741537 2935745695 176
302 iso_pu_bacteria 2935750917 2935756076 176
303 iso_pu_bacteria 2935760218 2935760664 176
304 iso_pu_bacteria 2935801545 2935801792 176
305 iso_pu_bacteria 2935810662 2935814793 176
306 iso_pu_bacteria 2935827899 2935828142 176
307 iso_pu_bacteria 2935837841 2935842347 176
308 iso_pu_bacteria 2935855204 2935858017 176
309 iso_pu_bacteria 2935864058 2935867921 176
310 iso_pu_bacteria 2935873716 2935874055 176
311 iso_pu_bacteria 2935959822 2935962811 176
312 iso_pu_bacteria 2935992306 2935993020 176
313 iso_pu_bacteria 2936002035 2936002932 176
314 iso_pu_bacteria 2936037263 2936040564 176
315 iso_pu_bacteria 2940556831 2940561949 176
316 iso_pu_bacteria 2941531003 2941531304 176
317 iso_pu_bacteria 2941538514 2941542396 176
318 iso_pu_bacteria 3005483717 3005485496 176
319 iso_pu_bacteria 3005506211 3005508345 176
320 iso_pu_bacteria 3005587118 3005588155 176
321 iso_pu_bacteria 3005594810 3005600408 176
322 iso_pu_bacteria 3005710791 3005715900 176
323 iso_pu_bacteria 3005718088 3005723257 176
324 iso_pu_bacteria 8016511872 8016520550 176
325 iso_pu_bacteria 8016583857 8016594459 176
326 iso_pu_bacteria 8017057580 8017065025 176
327 iso_pu_bacteria 8019576017 8019584405 176
328 iso_pu_bacteria 8019586578 8019592178 176
329 iso_pu_bacteria 8019597564 8019599103 176
330 iso_pu_bacteria 8019608314 8019609254 176
331 iso_pu_bacteria 8019648815 8019649462 176
332 iso_pu_bacteria 8055742211 8055745018 176
333 3300005337 Ga0070682_100268758 Ga0070682_1002687582 177
334 3300005340 Ga0070689_100287320 Ga0070689_1002873202 177
335 3300005344 Ga0070661_100232425 Ga0070661_1002324252 177
336 3300005347 Ga0070668_100030774 Ga0070668_1000307744 177
337 3300005356 Ga0070674_100808845 Ga0070674_1008088451 177
338 3300005365 Ga0070688_100702752 Ga0070688_1007027521 177
339 3300005535 Ga0070684_100617640 Ga0070684_1006176402 177
340 3300005539 Ga0068853_100014119 Ga0068853_1000141194 177
341 3300005547 Ga0070693_100308268 Ga0070693_1003082682 177
342 3300005841 Ga0068863_100204103 Ga0068863_1002041031 177
343 3300005843 Ga0068860_100101194 Ga0068860_1001011943 177
344 3300005844 Ga0068862_100182231 Ga0068862_1001822312 177
345 3300006931 Ga0097620_101119457 Ga0097620_1011194572 177
346 3300009551 Ga0105238_10074082 Ga0105238_100740823 177
347 3300014325 Ga0163163_10003485 Ga0163163_1000348511 177
348 3300014325 Ga0163163_10563742 Ga0163163_105637422 177
349 3300025900 Ga0207710_10448879 Ga0207710_104488791 177
350 3300025909 Ga0207705_10902887 Ga0207705_109028872 177
351 3300025920 Ga0207649_10151677 Ga0207649_101516771 177
352 3300026041 Ga0207639_10038009 Ga0207639_100380094 177
353 3300028380 Ga0268265_10009993 Ga0268265_100099936 177
354 3300031456 Ga0307513_10611209 Ga0307513_106112092 177
355 3300035725 Ga0373947_0606714 Ga0373947_0606714_148_708 177
356 3300039437 Ga0436365_1295580 Ga0436365_1295580_118_678 177
357 3300046492 Ga0495585_0026425 Ga0495585_0026425_1806_2369 177
358 3300046523 Ga0495644_0059596 Ga0495644_0059596_161_724 177
359 3300046539 Ga0495621_0217536 Ga0495621_0217536_73_636 177
360 3300046558 Ga0495633_0053573 Ga0495633_0053573_1120_1683 177
361 3300046648 Ga0495611_0073357 Ga0495611_0073357_281_844 177
362 3300046691 Ga0495670_0011657 Ga0495670_0011657_2497_3060 177
363 3300047318 Ga0495636_0014658 Ga0495636_0014658_2046_2609 177
364 3300048907 Ga0496104_0009233 Ga0496104_0009233_6758_7318 177
365 3300048908 Ga0496105_0002418 Ga0496105_0002418_6436_6996 177
366 3300048911 Ga0496108_0011505 Ga0496108_0011505_4513_5073 177
367 3300048912 Ga0496109_0270310 Ga0496109_0270310_888_1448 177
368 3300048912 Ga0496109_0296681 Ga0496109_0296681_619_1179 177
369 3300048913 Ga0496110_0024962 Ga0496110_0024962_3184_3744 177
370 3300048914 Ga0496111_0005520 Ga0496111_0005520_2859_3419 177
371 3300048915 Ga0496112_0002088 Ga0496112_0002088_9952_10512 177
372 3300048916 Ga0496113_0011400 Ga0496113_0011400_23_583 177
373 3300048918 Ga0496115_0060891 Ga0496115_0060891_1737_2297 177
374 3300048927 Ga0496124_0100316 Ga0496124_0100316_442_1005 177
375 3300048929 Ga0496126_0506979 Ga0496126_0506979_16_579 177
376 3300049570 Ga0501033_0572433 Ga0501033_0572433_64_597 177
377 3300049571 Ga0501034_0472743 Ga0501034_0472743_311_844 177
378 3300049571 Ga0501034_0506556 Ga0501034_0506556_518_1054 177
379 3300049573 Ga0501037_0461997 Ga0501037_0461997_196_744 177
380 3300049580 Ga0501046_0241526 Ga0501046_0241526_135_668 177
381 3300049581 Ga0501047_0098158 Ga0501047_0098158_555_1088 177
382 3300049823 Ga0501044_0375631 Ga0501044_0375631_279_812 177
383 iso_pu_bacteria 2508501128 2509152967 177
384 iso_pu_bacteria 2513237098 2513674859 177
385 iso_pu_bacteria 2524023210 2524468239 177
386 iso_pu_bacteria 2844315083 2844320122 177
387 iso_pu_bacteria 2885383462 2885386077 177
388 iso_pu_bacteria 2903727486 2903730204 177
389 iso_pu_bacteria 2903768456 2903775274 177
390 iso_pu_bacteria 2906602504 2906609947 177
391 iso_pu_bacteria 8056681323 8056684813 177
392 iso_pu_bacteria 8056967851 8056974972 177
393 3300005330 Ga0070690_100326214 Ga0070690_1003262141 178
394 3300005334 Ga0068869_100504439 Ga0068869_1005044392 178
395 3300005338 Ga0068868_100005376 Ga0068868_1000053766 178
396 3300005338 Ga0068868_100653356 Ga0068868_1006533561 178
397 3300005341 Ga0070691_10431570 Ga0070691_104315701 178
398 3300005343 Ga0070687_100264188 Ga0070687_1002641882 178
399 3300005345 Ga0070692_10365314 Ga0070692_103653142 178
400 3300005345 Ga0070692_10625378 Ga0070692_106253781 178
401 3300005347 Ga0070668_100006807 Ga0070668_10000680710 178
402 3300005347 Ga0070668_100388922 Ga0070668_1003889222 178
403 3300005347 Ga0070668_100427775 Ga0070668_1004277751 178
404 3300005347 Ga0070668_100776849 Ga0070668_1007768491 178
405 3300005355 Ga0070671_100031101 Ga0070671_1000311013 178
406 3300005355 Ga0070671_100127068 Ga0070671_1001270682 178
407 3300005356 Ga0070674_100449243 Ga0070674_1004492431 178
408 3300005364 Ga0070673_100080898 Ga0070673_1000808983 178
409 3300005366 Ga0070659_100294566 Ga0070659_1002945662 178
410 3300005406 Ga0070703_10027971 Ga0070703_100279712 178
411 3300005441 Ga0070700_100112513 Ga0070700_1001125132 178
412 3300005444 Ga0070694_100093529 Ga0070694_1000935292 178
413 3300005444 Ga0070694_101007392 Ga0070694_1010073921 178
414 3300005445 Ga0070708_100480141 Ga0070708_1004801411 178
415 3300005455 Ga0070663_100003233 Ga0070663_1000032335 178
416 3300005455 Ga0070663_100025815 Ga0070663_1000258152 178
417 3300005455 Ga0070663_100063225 Ga0070663_1000632252 178
418 3300005455 Ga0070663_100258091 Ga0070663_1002580912 178
419 3300005455 Ga0070663_100302105 Ga0070663_1003021052 178
420 3300005456 Ga0070678_100057791 Ga0070678_1000577913 178
421 3300005456 Ga0070678_100072118 Ga0070678_1000721184 178
422 3300005456 Ga0070678_100102787 Ga0070678_1001027872 178
423 3300005459 Ga0068867_100138427 Ga0068867_1001384272 178
424 3300005466 Ga0070685_10145522 Ga0070685_101455222 178
425 3300005471 Ga0070698_100279900 Ga0070698_1002799002 178
426 3300005539 Ga0068853_100029205 Ga0068853_1000292055 178
427 3300005539 Ga0068853_100290345 Ga0068853_1002903453 178
428 3300005544 Ga0070686_100339187 Ga0070686_1003391871 178
429 3300005544 Ga0070686_100764649 Ga0070686_1007646492 178
430 3300005545 Ga0070695_100135671 Ga0070695_1001356713 178
431 3300005545 Ga0070695_100603883 Ga0070695_1006038831 178
432 3300005546 Ga0070696_100347513 Ga0070696_1003475132 178
433 3300005547 Ga0070693_100045525 Ga0070693_1000455252 178
434 3300005548 Ga0070665_100023863 Ga0070665_1000238633 178
435 3300005548 Ga0070665_100026898 Ga0070665_1000268983 178
436 3300005548 Ga0070665_100054505 Ga0070665_1000545054 178
437 3300005548 Ga0070665_100265908 Ga0070665_1002659082 178
438 3300005549 Ga0070704_100073604 Ga0070704_1000736042 178
439 3300005577 Ga0068857_100015946 Ga0068857_1000159462 178
440 3300005578 Ga0068854_100568824 Ga0068854_1005688242 178
441 3300005615 Ga0070702_100387532 Ga0070702_1003875321 178
442 3300005616 Ga0068852_100116084 Ga0068852_1001160842 178
443 3300005617 Ga0068859_100183564 Ga0068859_1001835643 178
444 3300005617 Ga0068859_101214005 Ga0068859_1012140051 178
445 3300005618 Ga0068864_100489555 Ga0068864_1004895551 178
446 3300005718 Ga0068866_10136917 Ga0068866_101369172 178
447 3300005718 Ga0068866_10472117 Ga0068866_104721172 178
448 3300005719 Ga0068861_100516402 Ga0068861_1005164022 178
449 3300005840 Ga0068870_10133269 Ga0068870_101332692 178
450 3300005841 Ga0068863_100048337 Ga0068863_1000483375 178
451 3300005841 Ga0068863_100116799 Ga0068863_1001167992 178
452 3300005842 Ga0068858_100093050 Ga0068858_1000930503 178
453 3300005842 Ga0068858_100114861 Ga0068858_1001148612 178
454 3300005843 Ga0068860_100130655 Ga0068860_1001306552 178
455 3300005843 Ga0068860_100135633 Ga0068860_1001356332 178
456 3300005843 Ga0068860_100371466 Ga0068860_1003714662 178
457 3300005844 Ga0068862_100019484 Ga0068862_1000194845 178
458 3300005844 Ga0068862_100297271 Ga0068862_1002972712 178
459 3300005844 Ga0068862_100325651 Ga0068862_1003256511 178
460 3300005844 Ga0068862_100918391 Ga0068862_1009183911 178
461 3300005983 Ga0081540_1002397 Ga0081540_100239716 178
462 3300005983 Ga0081540_1007919 Ga0081540_10079194 178
463 3300005983 Ga0081540_1024502 Ga0081540_10245022 178
464 3300005983 Ga0081540_1048618 Ga0081540_10486182 178
465 3300005985 Ga0081539_10051150 Ga0081539_100511503 178
466 3300006038 Ga0075365_10169476 Ga0075365_101694762 178
467 3300006038 Ga0075365_10366068 Ga0075365_103660681 178
468 3300006048 Ga0075363_100013638 Ga0075363_1000136384 178
469 3300006051 Ga0075364_10071315 Ga0075364_100713152 178
470 3300006058 Ga0075432_10057870 Ga0075432_100578702 178
471 3300006178 Ga0075367_10029919 Ga0075367_100299193 178
472 3300006178 Ga0075367_10161715 Ga0075367_101617152 178
473 3300006186 Ga0075369_10085068 Ga0075369_100850682 178
474 3300006353 Ga0075370_10023578 Ga0075370_100235783 178
475 3300006353 Ga0075370_10087885 Ga0075370_100878852 178
476 3300006358 Ga0068871_100308242 Ga0068871_1003082422 178
477 3300006844 Ga0075428_100577288 Ga0075428_1005772882 178
478 3300006881 Ga0068865_100402284 Ga0068865_1004022842 178
479 3300006931 Ga0097620_100183559 Ga0097620_1001835593 178
480 3300006931 Ga0097620_101213996 Ga0097620_1012139961 178
481 3300009094 Ga0111539_10169347 Ga0111539_101693471 178
482 3300009094 Ga0111539_11184709 Ga0111539_111847091 178
483 3300009101 Ga0105247_10107479 Ga0105247_101074792 178
484 3300009174 Ga0105241_10003241 Ga0105241_100032415 178
485 3300009174 Ga0105241_10085165 Ga0105241_100851652 178
486 3300009176 Ga0105242_10171258 Ga0105242_101712582 178
487 3300009545 Ga0105237_10024067 Ga0105237_100240673 178
488 3300009551 Ga0105238_11051907 Ga0105238_110519071 178
489 3300011119 Ga0105246_10279153 Ga0105246_102791533 178
490 3300013306 Ga0163162_10115670 Ga0163162_101156704 178
491 3300013306 Ga0163162_10402266 Ga0163162_104022662 178
492 3300013308 Ga0157375_10065900 Ga0157375_100659004 178
493 3300013308 Ga0157375_10072080 Ga0157375_100720801 178
494 3300013308 Ga0157375_11029651 Ga0157375_110296512 178
495 3300014325 Ga0163163_10049822 Ga0163163_100498224 178
496 3300014325 Ga0163163_10293108 Ga0163163_102931082 178
497 3300014325 Ga0163163_10436443 Ga0163163_104364432 178
498 3300014325 Ga0163163_10997973 Ga0163163_109979732 178
499 3300014325 Ga0163163_11453197 Ga0163163_114531971 178
500 3300014745 Ga0157377_10005796 Ga0157377_100057963 178
501 3300014968 Ga0157379_10812939 Ga0157379_108129391 178
502 3300017792 Ga0163161_10621799 Ga0163161_106217991 178
503 3300025297 Ga0209758_1021253 Ga0209758_10212532 178
504 3300025885 Ga0207653_10043025 Ga0207653_100430252 178
505 3300025903 Ga0207680_10179682 Ga0207680_101796821 178
506 3300025904 Ga0207647_10041473 Ga0207647_100414732 178
507 3300025907 Ga0207645_10156206 Ga0207645_101562062 178
508 3300025908 Ga0207643_10196076 Ga0207643_101960761 178
509 3300025911 Ga0207654_10026617 Ga0207654_100266171 178
510 3300025917 Ga0207660_10722753 Ga0207660_107227531 178
511 3300025918 Ga0207662_10132358 Ga0207662_101323582 178
512 3300025918 Ga0207662_10477335 Ga0207662_104773352 178
513 3300025919 Ga0207657_10052926 Ga0207657_100529263 178
514 3300025923 Ga0207681_10309715 Ga0207681_103097152 178
515 3300025924 Ga0207694_10668697 Ga0207694_106686971 178
516 3300025926 Ga0207659_10345954 Ga0207659_103459542 178
517 3300025927 Ga0207687_10006611 Ga0207687_100066116 178
518 3300025927 Ga0207687_10295986 Ga0207687_102959862 178
519 3300025931 Ga0207644_11149500 Ga0207644_111495001 178
520 3300025932 Ga0207690_10065349 Ga0207690_100653492 178
521 3300025933 Ga0207706_10054196 Ga0207706_100541963 178
522 3300025934 Ga0207686_10080217 Ga0207686_100802171 178
523 3300025937 Ga0207669_10011373 Ga0207669_100113733 178
524 3300025937 Ga0207669_10280468 Ga0207669_102804681 178
525 3300025940 Ga0207691_10385801 Ga0207691_103858012 178
526 3300025941 Ga0207711_10047118 Ga0207711_100471184 178
527 3300025942 Ga0207689_10003758 Ga0207689_1000375810 178
528 3300025961 Ga0207712_11166605 Ga0207712_111666051 178
529 3300025972 Ga0207668_10088097 Ga0207668_100880971 178
530 3300025972 Ga0207668_10122050 Ga0207668_101220503 178
531 3300025981 Ga0207640_10412368 Ga0207640_104123682 178
532 3300025986 Ga0207658_10611463 Ga0207658_106114632 178
533 3300026023 Ga0207677_10241250 Ga0207677_102412502 178
534 3300026023 Ga0207677_10459412 Ga0207677_104594122 178
535 3300026035 Ga0207703_10088708 Ga0207703_100887082 178
536 3300026035 Ga0207703_10094264 Ga0207703_100942642 178
537 3300026035 Ga0207703_10878834 Ga0207703_108788341 178
538 3300026041 Ga0207639_10068349 Ga0207639_100683494 178
539 3300026067 Ga0207678_10002626 Ga0207678_1000262612 178
540 3300026067 Ga0207678_10014595 Ga0207678_100145954 178
541 3300026067 Ga0207678_10048700 Ga0207678_100487002 178
542 3300026067 Ga0207678_10089802 Ga0207678_100898023 178
543 3300026067 Ga0207678_10322153 Ga0207678_103221532 178
544 3300026075 Ga0207708_10050661 Ga0207708_100506613 178
545 3300026089 Ga0207648_10126456 Ga0207648_101264564 178
546 3300026089 Ga0207648_10491142 Ga0207648_104911421 178
547 3300026116 Ga0207674_10022614 Ga0207674_100226145 178
548 3300026116 Ga0207674_10803679 Ga0207674_108036792 178
549 3300026118 Ga0207675_100074027 Ga0207675_1000740273 178
550 3300026121 Ga0207683_10082170 Ga0207683_100821703 178
551 3300027907 Ga0207428_10212990 Ga0207428_102129901 178
552 3300028379 Ga0268266_10003290 Ga0268266_100032907 178
553 3300028379 Ga0268266_10013881 Ga0268266_100138813 178
554 3300028379 Ga0268266_10022599 Ga0268266_100225995 178
555 3300028379 Ga0268266_10512514 Ga0268266_105125142 178
556 3300028379 Ga0268266_11412720 Ga0268266_114127201 178
557 3300028380 Ga0268265_10021737 Ga0268265_100217375 178
558 3300028380 Ga0268265_10454145 Ga0268265_104541452 178
559 3300028381 Ga0268264_10732308 Ga0268264_107323082 178
560 3300028786 Ga0307517_10083264 Ga0307517_100832644 178
561 3300030522 Ga0307512_10294970 Ga0307512_102949702 178
562 3300031507 Ga0307509_10205904 Ga0307509_102059042 178
563 3300031616 Ga0307508_10000032 Ga0307508_1000003236 178
564 3300031616 Ga0307508_10209810 Ga0307508_102098102 178
565 3300031730 Ga0307516_10078471 Ga0307516_100784715 178
566 3300031730 Ga0307516_10108391 Ga0307516_101083911 178
567 3300031889 Ga0326468_10009406 Ga0326468_100094062 178
568 3300031901 Ga0307406_10721601 Ga0307406_107216012 178
569 3300031903 Ga0307407_10273882 Ga0307407_102738822 178
570 3300031903 Ga0307407_10750032 Ga0307407_107500321 178
571 3300031911 Ga0307412_10850901 Ga0307412_108509012 178
572 3300032005 Ga0307411_10228270 Ga0307411_102282702 178
573 3300033179 Ga0307507_10253679 Ga0307507_102536791 178
574 3300033180 Ga0307510_10016937 Ga0307510_100169374 178
575 3300035115 Ga0373941_0080388 Ga0373941_0080388_439_1005 178
576 3300037068 Ga0373925_0205571 Ga0373925_0205571_338_904 178
577 3300041451 Ga0451791_0201774 Ga0451791_0201774_1038_1604 178
578 3300041451 Ga0451791_0642730 Ga0451791_0642730_149_715 178
579 3300042006 Ga0439432_184098 Ga0439432_184098_13_579 178
580 3300046452 Ga0495617_026298 Ga0495617_026298_611_1177 178
581 3300046455 Ga0495603_0076353 Ga0495603_0076353_25_591 178
582 3300046459 Ga0495629_0072547 Ga0495629_0072547_784_1350 178
583 3300046474 Ga0495605_0111427 Ga0495605_0111427_413_979 178
584 3300046475 Ga0495639_0253721 Ga0495639_0253721_68_634 178
585 3300046491 Ga0495584_0080757 Ga0495584_0080757_1053_1619 178
586 3300046491 Ga0495584_0089683 Ga0495584_0089683_544_1110 178
587 3300046492 Ga0495585_0012248 Ga0495585_0012248_3439_4005 178
588 3300046492 Ga0495585_0180233 Ga0495585_0180233_334_900 178
589 3300046499 Ga0495594_0294615 Ga0495594_0294615_296_862 178
590 3300046506 Ga0495583_0110898 Ga0495583_0110898_42_608 178
591 3300046507 Ga0495606_0094225 Ga0495606_0094225_168_734 178
592 3300046513 Ga0495616_0036445 Ga0495616_0036445_1556_2122 178
593 3300046518 Ga0495631_0215358 Ga0495631_0215358_183_749 178
594 3300046519 Ga0495632_0150184 Ga0495632_0150184_62_628 178
595 3300046523 Ga0495644_0105582 Ga0495644_0105582_215_781 178
596 3300046538 Ga0495609_0047871 Ga0495609_0047871_570_1136 178
597 3300046557 Ga0495622_0138108 Ga0495622_0138108_466_1032 178
598 3300046558 Ga0495633_0066574 Ga0495633_0066574_1004_1570 178
599 3300046615 Ga0495656_0035397 Ga0495656_0035397_521_1087 178
600 3300046615 Ga0495656_0041525 Ga0495656_0041525_1278_1844 178
601 3300046615 Ga0495656_0088098 Ga0495656_0088098_496_1062 178
602 3300046615 Ga0495656_0225095 Ga0495656_0225095_42_608 178
603 3300046616 Ga0495668_0194231 Ga0495668_0194231_528_1094 178
604 3300046616 Ga0495668_0360414 Ga0495668_0360414_183_749 178
605 3300046660 Ga0495625_0039960 Ga0495625_0039960_33_599 178
606 3300046660 Ga0495625_0226343 Ga0495625_0226343_618_1184 178
607 3300046660 Ga0495625_0276165 Ga0495625_0276165_104_670 178
608 3300046684 Ga0495669_0004453 Ga0495669_0004453_110_676 178
609 3300046684 Ga0495669_0019284 Ga0495669_0019284_229_795 178
610 3300046690 Ga0495624_0367711 Ga0495624_0367711_38_604 178
611 3300046691 Ga0495670_0095461 Ga0495670_0095461_633_1199 178
612 3300046691 Ga0495670_0339782 Ga0495670_0339782_183_749 178
613 3300046694 Ga0495649_0187292 Ga0495649_0187292_184_750 178
614 3300046794 Ga0495589_0013236 Ga0495589_0013236_1259_1825 178
615 3300046810 Ga0495660_0153516 Ga0495660_0153516_369_935 178
616 3300047315 Ga0495581_0165241 Ga0495581_0165241_236_802 178
617 3300047318 Ga0495636_0376219 Ga0495636_0376219_77_643 178
618 3300047323 Ga0495683_0049939 Ga0495683_0049939_1498_2064 178
619 3300047447 Ga0495685_121617 Ga0495685_121617_83_649 178
620 3300047469 Ga0495673_0062926 Ga0495673_0062926_391_957 178
621 3300048088 Ga0495602_0384061 Ga0495602_0384061_209_775 178
622 3300048903 Ga0496100_0115201 Ga0496100_0115201_325_891 178
623 3300048904 Ga0496101_0403148 Ga0496101_0403148_455_1021 178
624 3300048904 Ga0496101_0457260 Ga0496101_0457260_150_716 178
625 3300048904 Ga0496101_1068847 Ga0496101_1068847_17_583 178
626 3300048905 Ga0496102_0071311 Ga0496102_0071311_740_1306 178
627 3300048905 Ga0496102_0157522 Ga0496102_0157522_742_1308 178
628 3300048906 Ga0496103_0218081 Ga0496103_0218081_391_957 178
629 3300048907 Ga0496104_0109706 Ga0496104_0109706_1616_2182 178
630 3300048907 Ga0496104_0472106 Ga0496104_0472106_425_991 178
631 3300048910 Ga0496107_0602276 Ga0496107_0602276_236_802 178
632 3300048911 Ga0496108_0106987 Ga0496108_0106987_841_1407 178
633 3300048912 Ga0496109_0031295 Ga0496109_0031295_3103_3669 178
634 3300048913 Ga0496110_0059210 Ga0496110_0059210_1183_1749 178
635 3300048913 Ga0496110_0129862 Ga0496110_0129862_1042_1608 178
636 3300048914 Ga0496111_0104147 Ga0496111_0104147_891_1457 178
637 3300048916 Ga0496113_0083713 Ga0496113_0083713_1593_2159 178
638 3300048918 Ga0496115_0143179 Ga0496115_0143179_1196_1762 178
639 3300048924 Ga0496121_0045446 Ga0496121_0045446_357_923 178
640 3300048927 Ga0496124_0292170 Ga0496124_0292170_512_1078 178
641 3300048928 Ga0496125_0254968 Ga0496125_0254968_393_959 178
642 3300048929 Ga0496126_0015857 Ga0496126_0015857_6937_7503 178
643 3300048929 Ga0496126_0220769 Ga0496126_0220769_820_1386 178
644 3300049577 Ga0501041_0472345 Ga0501041_0472345_85_651 178
645 3300049584 Ga0501068_0459997 Ga0501068_0459997_97_663 178
646 3300050491 nmdc:mga00v17_32928_c1 nmdc:mga00v17_32928_c1_1458_2024 178
647 3300050492 nmdc:mga0yw44_242569_c1 nmdc:mga0yw44_242569_c1_423_989 178
648 3300050493 nmdc:mga0k408_70684_c1 nmdc:mga0k408_70684_c1_796_1362 178
649 3300050494 nmdc:mga06z11_101576_c1 nmdc:mga06z11_101576_c1_354_920 178
650 3300050494 nmdc:mga06z11_370749_c1 nmdc:mga06z11_370749_c1_38_604 178
651 3300050494 nmdc:mga06z11_48738_c1 nmdc:mga06z11_48738_c1_590_1156 178
652 3300050496 nmdc:mga07m45_7786_c1 nmdc:mga07m45_7786_c1_3031_3597 178
653 3300050496 nmdc:mga07m45_92436_c1 nmdc:mga07m45_92436_c1_1062_1628 178
654 3300050507 nmdc:mga05p37_142001_c1 nmdc:mga05p37_142001_c1_905_1471 178
655 3300050509 nmdc:mga0qj67_362895_c1 nmdc:mga0qj67_362895_c1_592_1158 178
656 3300050511 nmdc:mga08y16_381937_c1 nmdc:mga08y16_381937_c1_291_857 178
657 3300050512 nmdc:mga0n895_94897_c1 nmdc:mga0n895_94897_c1_141_707 178
658 3300053090 Ga0500646_0072983 Ga0500646_0072983_112_678 178
659 3300053096 Ga0500641_0017803 Ga0500641_0017803_1224_1790 178
660 3300053096 Ga0500641_0120070 Ga0500641_0120070_52_618 178
661 3300053109 Ga0500569_161765 Ga0500569_161765_17_583 178
662 3300053119 Ga0500595_034082 Ga0500595_034082_835_1401 178
663 3300053134 Ga0500658_0016766 Ga0500658_0016766_565_1131 178
664 3300053146 Ga0500588_0051173 Ga0500588_0051173_17_583 178
665 3300053160 Ga0500633_0066613 Ga0500633_0066613_53_619 178
666 3300053162 Ga0500638_044881 Ga0500638_044881_1503_2069 178
667 3300053727 Ga0500611_053734 Ga0500611_053734_177_743 178
668 iso_pu_bacteria 2508501042 2508692773 178
669 iso_pu_bacteria 2513237101 2513694801 178
670 iso_pu_bacteria 2721755755 2723842169 178
671 iso_pu_bacteria 2791355199 2793078074 178
672 iso_pu_bacteria 2874604998 2874610245 178
673 iso_pu_bacteria 2876808645 2876809277 178
674 iso_pu_bacteria 2879110137 2879112517 178
675 iso_pu_bacteria 2889033259 2889036260 178
676 iso_pu_bacteria 2922361189 2922366846 178
677 iso_pu_bacteria 2922386360 2922389255 178
678 iso_pu_bacteria 2935819856 2935823085 178
679 iso_pu_bacteria 2935847175 2935848667 178
680 iso_pu_bacteria 8006964411 8006966440 178
681 iso_pu_bacteria 8006984368 8006990594 178
682 iso_pu_bacteria 8006994254 8006997102 178
683 iso_pu_bacteria 8056673599 8056678308 178
684 3300003214 JGI25165J46597_1011970 JGI25165J46597_10119702 179
685 3300003374 JGI25161J50226_1011621 JGI25161J50226_10116212 179
686 3300004625 Ga0055543_1003132 Ga0055543_10031323 179
687 3300005262 Ga0065165_1001109 Ga0065165_100110919 179
688 3300005985 Ga0081539_10037287 Ga0081539_100372872 179
689 3300025261 Ga0209233_1011115 Ga0209233_10111153 179
690 3300025928 Ga0207700_10342822 Ga0207700_103428222 179
691 3300031711 Ga0265314_10002758 Ga0265314_100027589 179
692 3300039437 Ga0436365_1886582 Ga0436365_1886582_410_949 179
693 3300049587 Ga0501071_0159587 Ga0501071_0159587_766_1347 179
694 3300049588 Ga0501072_0252575 Ga0501072_0252575_40_621 179
695 3300049743 Ga0501081_0339329 Ga0501081_0339329_165_746 179
696 3300049744 Ga0501083_0512726 Ga0501083_0512726_129_710 179
697 3300003215 JGI25153J46596_10000712 JGI25153J46596_100007122 180
698 3300003215 JGI25153J46596_10000760 JGI25153J46596_1000076018 180
699 3300003215 JGI25153J46596_10011001 JGI25153J46596_100110012 180
700 3300003215 JGI25153J46596_10045521 JGI25153J46596_100455212 180
701 3300003322 rootL2_10112590 rootL2_101125902 180
702 3300003354 JGI25160J50197_1002322 JGI25160J50197_10023224 180
703 3300003354 JGI25160J50197_1015410 JGI25160J50197_10154104 180
704 3300005262 Ga0065165_1044439 Ga0065165_10444392 180
705 3300005331 Ga0070670_100578528 Ga0070670_1005785282 180
706 3300005336 Ga0070680_100069793 Ga0070680_1000697934 180
707 3300005344 Ga0070661_101033278 Ga0070661_1010332781 180
708 3300005347 Ga0070668_100081083 Ga0070668_1000810832 180
709 3300005356 Ga0070674_100095630 Ga0070674_1000956302 180
710 3300005356 Ga0070674_100431106 Ga0070674_1004311062 180
711 3300005366 Ga0070659_100130397 Ga0070659_1001303972 180
712 3300005437 Ga0070710_10386386 Ga0070710_103863861 180
713 3300005439 Ga0070711_100308013 Ga0070711_1003080132 180
714 3300005439 Ga0070711_100614857 Ga0070711_1006148572 180
715 3300005455 Ga0070663_100596437 Ga0070663_1005964372 180
716 3300005457 Ga0070662_100148860 Ga0070662_1001488602 180
717 3300005539 Ga0068853_100335693 Ga0068853_1003356932 180
718 3300005548 Ga0070665_100098124 Ga0070665_1000981244 180
719 3300005548 Ga0070665_101791805 Ga0070665_1017918051 180
720 3300005577 Ga0068857_100792648 Ga0068857_1007926481 180
721 3300005578 Ga0068854_100333428 Ga0068854_1003334282 180
722 3300005616 Ga0068852_100028208 Ga0068852_1000282083 180
723 3300005841 Ga0068863_100468556 Ga0068863_1004685562 180
724 3300005842 Ga0068858_100278781 Ga0068858_1002787812 180
725 3300005843 Ga0068860_100135352 Ga0068860_1001353522 180
726 3300005937 Ga0081455_10133148 Ga0081455_101331482 180
727 3300005981 Ga0081538_10067578 Ga0081538_100675782 180
728 3300005983 Ga0081540_1008426 Ga0081540_10084263 180
729 3300006038 Ga0075365_10021811 Ga0075365_100218113 180
730 3300006042 Ga0075368_10005726 Ga0075368_100057262 180
731 3300006051 Ga0075364_10158221 Ga0075364_101582212 180
732 3300006175 Ga0070712_100034677 Ga0070712_1000346772 180
733 3300006177 Ga0075362_10362738 Ga0075362_103627382 180
734 3300006178 Ga0075367_10085132 Ga0075367_100851322 180
735 3300006178 Ga0075367_10148194 Ga0075367_101481941 180
736 3300006178 Ga0075367_10414353 Ga0075367_104143532 180
737 3300006186 Ga0075369_10262882 Ga0075369_102628821 180
738 3300006353 Ga0075370_10005879 Ga0075370_100058793 180
739 3300006358 Ga0068871_100840373 Ga0068871_1008403731 180
740 3300006871 Ga0075434_100070588 Ga0075434_1000705884 180
741 3300006941 Ga0099825_1029470 Ga0099825_10294704 180
742 3300006944 Ga0099823_1043212 Ga0099823_10432123 180
743 3300009011 Ga0105251_10081614 Ga0105251_100816142 180
744 3300009093 Ga0105240_10028150 Ga0105240_100281504 180
745 3300009101 Ga0105247_10257739 Ga0105247_102577392 180
746 3300009101 Ga0105247_10261783 Ga0105247_102617831 180
747 3300009174 Ga0105241_10133503 Ga0105241_101335031 180
748 3300009174 Ga0105241_10144748 Ga0105241_101447482 180
749 3300009174 Ga0105241_10255384 Ga0105241_102553842 180
750 3300009176 Ga0105242_10742190 Ga0105242_107421902 180
751 3300009545 Ga0105237_10008430 Ga0105237_100084308 180
752 3300009545 Ga0105237_10123415 Ga0105237_101234152 180
753 3300009553 Ga0105249_10848567 Ga0105249_108485672 180
754 3300010375 Ga0105239_10643323 Ga0105239_106433232 180
755 3300011119 Ga0105246_10050204 Ga0105246_100502043 180
756 3300012490 Ga0157322_1008142 Ga0157322_10081422 180
757 3300013296 Ga0157374_10506467 Ga0157374_105064672 180
758 3300013306 Ga0163162_10206262 Ga0163162_102062622 180
759 3300013307 Ga0157372_10924417 Ga0157372_109244172 180
760 3300013308 Ga0157375_12168896 Ga0157375_121688961 180
761 3300014969 Ga0157376_10454988 Ga0157376_104549882 180
762 3300015262 Ga0182007_10039960 Ga0182007_100399602 180
763 3300017792 Ga0163161_10612284 Ga0163161_106122842 180
764 3300021320 Ga0214544_1000001 Ga0214544_1000001668 180
765 3300021321 Ga0214542_1000037 Ga0214542_100003753 180
766 3300021324 Ga0214545_1000003 Ga0214545_100000392 180
767 3300021327 Ga0214543_1000002 Ga0214543_1000002673 180
768 3300025230 Ga0209563_117798 Ga0209563_1177981 180
769 3300025253 Ga0209677_105144 Ga0209677_1051444 180
770 3300025254 Ga0209148_1000347 Ga0209148_100034753 180
771 3300025272 Ga0209455_1002091 Ga0209455_10020912 180
772 3300025272 Ga0209455_1013519 Ga0209455_10135192 180
773 3300025273 Ga0209673_1034422 Ga0209673_10344222 180
774 3300025295 Ga0209564_1004821 Ga0209564_10048216 180
775 3300025297 Ga0209758_1000133 Ga0209758_1000133150 180
776 3300025297 Ga0209758_1000845 Ga0209758_100084518 180
777 3300025297 Ga0209758_1001269 Ga0209758_100126923 180
778 3300025297 Ga0209758_1006848 Ga0209758_10068485 180
779 3300025302 Ga0207426_1000270 Ga0207426_100027064 180
780 3300025302 Ga0207426_1003805 Ga0207426_10038056 180
781 3300025302 Ga0207426_1014306 Ga0207426_10143064 180
782 3300025304 Ga0209257_1036953 Ga0209257_10369532 180
783 3300025898 Ga0207692_10277865 Ga0207692_102778651 180
784 3300025901 Ga0207688_10258200 Ga0207688_102582002 180
785 3300025904 Ga0207647_10028027 Ga0207647_100280272 180
786 3300025911 Ga0207654_10132535 Ga0207654_101325352 180
787 3300025913 Ga0207695_10000008 Ga0207695_10000008897 180
788 3300025914 Ga0207671_10033634 Ga0207671_100336342 180
789 3300025915 Ga0207693_10080001 Ga0207693_100800013 180
790 3300025916 Ga0207663_10459253 Ga0207663_104592532 180
791 3300025919 Ga0207657_10011138 Ga0207657_100111385 180
792 3300025919 Ga0207657_10434435 Ga0207657_104344352 180
793 3300025923 Ga0207681_10081029 Ga0207681_100810293 180
794 3300025931 Ga0207644_10419244 Ga0207644_104192442 180
795 3300025932 Ga0207690_10377023 Ga0207690_103770232 180
796 3300025933 Ga0207706_10090077 Ga0207706_100900772 180
797 3300025933 Ga0207706_10350447 Ga0207706_103504472 180
798 3300025934 Ga0207686_10210725 Ga0207686_102107252 180
799 3300025935 Ga0207709_10076899 Ga0207709_100768992 180
800 3300025937 Ga0207669_10127068 Ga0207669_101270682 180
801 3300025940 Ga0207691_10593938 Ga0207691_105939382 180
802 3300025941 Ga0207711_10388754 Ga0207711_103887542 180
803 3300025972 Ga0207668_10018550 Ga0207668_100185503 180
804 3300025972 Ga0207668_10784211 Ga0207668_107842112 180
805 3300026035 Ga0207703_10098345 Ga0207703_100983452 180
806 3300026041 Ga0207639_10212637 Ga0207639_102126372 180
807 3300026067 Ga0207678_10481404 Ga0207678_104814041 180
808 3300026067 Ga0207678_10751893 Ga0207678_107518932 180
809 3300026116 Ga0207674_10146631 Ga0207674_101466314 180
810 3300026142 Ga0207698_10033138 Ga0207698_100331383 180
811 3300027296 Ga0209389_1000001 Ga0209389_100000139 180
812 3300027296 Ga0209389_1000014 Ga0209389_100001486 180
813 3300027357 Ga0209589_1000020 Ga0209589_100002086 180
814 3300027361 Ga0209489_100060 Ga0209489_10006045 180
815 3300027361 Ga0209489_101114 Ga0209489_10111421 180
816 3300027363 Ga0209700_100007 Ga0209700_100007365 180
817 3300028379 Ga0268266_10231194 Ga0268266_102311942 180
818 3300028380 Ga0268265_10177517 Ga0268265_101775172 180
819 3300031616 Ga0307508_10105723 Ga0307508_101057233 180
820 3300033180 Ga0307510_10063397 Ga0307510_100633972 180
821 3300033180 Ga0307510_10210133 Ga0307510_102101332 180
822 3300035086 Ga0373934_0001744 Ga0373934_0001744_2648_3196 180
823 3300035118 Ga0373954_0002051 Ga0373954_0002051_6595_7143 180
824 3300035119 Ga0373956_0006790 Ga0373956_0006790_3288_3836 180
825 3300035120 Ga0373957_0094309 Ga0373957_0094309_390_938 180
826 3300035172 Ga0373955_0000836 Ga0373955_0000836_8348_8896 180
827 3300035410 Ga0373924_0009259 Ga0373924_0009259_432_980 180
828 3300035724 Ga0373933_0051852 Ga0373933_0051852_805_1353 180
829 3300036401 Ga0373937_0011733 Ga0373937_0011733_5225_5773 180
830 3300037466 Ga0395898_0492649 Ga0395898_0492649_82_624 180
831 3300037471 Ga0395905_0009285 Ga0395905_0009285_4564_5106 180
832 3300037471 Ga0395905_0274201 Ga0395905_0274201_669_1223 180
833 3300037853 Ga0436364_1482475 Ga0436364_1482475_18_560 180
834 3300039437 Ga0436365_1550533 Ga0436365_1550533_1710_2252 180
835 3300044656 Ga0466969_0241984 Ga0466969_0241984_32_574 180
836 3300044658 Ga0466972_0000134 Ga0466972_0000134_58952_59494 180
837 3300044658 Ga0466972_0014382 Ga0466972_0014382_1313_1855 180
838 3300044658 Ga0466972_0026556 Ga0466972_0026556_1707_2249 180
839 3300044658 Ga0466972_0085058 Ga0466972_0085058_917_1459 180
840 3300044735 Ga0466968_0006796 Ga0466968_0006796_1218_1760 180
841 3300044735 Ga0466968_0221446 Ga0466968_0221446_326_868 180
842 3300044901 Ga0466960_0039333 Ga0466960_0039333_397_939 180
843 3300044901 Ga0466960_0100716 Ga0466960_0100716_171_713 180
844 3300045976 Ga0466967_0865800 Ga0466967_0865800_75_617 180
845 3300046454 Ga0495592_0024131 Ga0495592_0024131_3739_4281 180
846 3300046459 Ga0495629_0000077 Ga0495629_0000077_74716_75264 180
847 3300046459 Ga0495629_0001874 Ga0495629_0001874_14096_14638 180
848 3300046460 Ga0495638_0003381 Ga0495638_0003381_3903_4445 180
849 3300046462 Ga0495651_0000998 Ga0495651_0000998_20096_20638 180
850 3300046462 Ga0495651_0007709 Ga0495651_0007709_2476_3018 180
851 3300046462 Ga0495651_0014165 Ga0495651_0014165_4443_4991 180
852 3300046463 Ga0495653_0002848 Ga0495653_0002848_2559_3107 180
853 3300046463 Ga0495653_0039737 Ga0495653_0039737_2750_3292 180
854 3300046477 Ga0495664_0031350 Ga0495664_0031350_2244_2786 180
855 3300046477 Ga0495664_0091995 Ga0495664_0091995_327_869 180
856 3300046491 Ga0495584_0097665 Ga0495584_0097665_873_1415 180
857 3300046491 Ga0495584_0231768 Ga0495584_0231768_252_794 180
858 3300046491 Ga0495584_0310212 Ga0495584_0310212_46_588 180
859 3300046492 Ga0495585_0218648 Ga0495585_0218648_155_697 180
860 3300046499 Ga0495594_0251690 Ga0495594_0251690_384_926 180
861 3300046500 Ga0495596_0261390 Ga0495596_0261390_94_636 180
862 3300046507 Ga0495606_0016617 Ga0495606_0016617_2377_2919 180
863 3300046511 Ga0495608_0004861 Ga0495608_0004861_3880_4428 180
864 3300046511 Ga0495608_0036601 Ga0495608_0036601_1205_1747 180
865 3300046512 Ga0495610_0034048 Ga0495610_0034048_1240_1782 180
866 3300046513 Ga0495616_0145796 Ga0495616_0145796_149_691 180
867 3300046516 Ga0495628_0014816 Ga0495628_0014816_1170_1718 180
868 3300046516 Ga0495628_0027632 Ga0495628_0027632_1363_1905 180
869 3300046516 Ga0495628_0328876 Ga0495628_0328876_75_617 180
870 3300046519 Ga0495632_0092028 Ga0495632_0092028_258_800 180
871 3300046524 Ga0495648_0040464 Ga0495648_0040464_1712_2254 180
872 3300046528 Ga0495642_0149036 Ga0495642_0149036_39_581 180
873 3300046529 Ga0495652_0035210 Ga0495652_0035210_1203_1745 180
874 3300046529 Ga0495652_0035670 Ga0495652_0035670_2549_3097 180
875 3300046529 Ga0495652_0085510 Ga0495652_0085510_1817_2359 180
876 3300046529 Ga0495652_0295280 Ga0495652_0295280_56_598 180
877 3300046533 Ga0495640_0097751 Ga0495640_0097751_1358_1906 180
878 3300046536 Ga0495587_0008879 Ga0495587_0008879_4915_5457 180
879 3300046536 Ga0495587_0015099 Ga0495587_0015099_3582_4130 180
880 3300046538 Ga0495609_0115113 Ga0495609_0115113_554_1096 180
881 3300046542 Ga0495597_0136927 Ga0495597_0136927_279_821 180
882 3300046543 Ga0495645_0291672 Ga0495645_0291672_444_992 180
883 3300046557 Ga0495622_0023742 Ga0495622_0023742_2008_2550 180
884 3300046559 Ga0495667_0009076 Ga0495667_0009076_1041_1589 180
885 3300046559 Ga0495667_0042791 Ga0495667_0042791_1851_2393 180
886 3300046616 Ga0495668_0057213 Ga0495668_0057213_1526_2068 180
887 3300046616 Ga0495668_0366617 Ga0495668_0366617_171_716 180
888 3300046642 Ga0495634_0025034 Ga0495634_0025034_3314_3856 180
889 3300046660 Ga0495625_0388317 Ga0495625_0388317_17_559 180
890 3300046663 Ga0495635_0000160 Ga0495635_0000160_7735_8283 180
891 3300046663 Ga0495635_0045294 Ga0495635_0045294_723_1265 180
892 3300046663 Ga0495635_0450937 Ga0495635_0450937_195_737 180
893 3300046674 Ga0495588_0018312 Ga0495588_0018312_1633_2175 180
894 3300046675 Ga0495657_0000879 Ga0495657_0000879_21193_21741 180
895 3300046675 Ga0495657_0005900 Ga0495657_0005900_7753_8295 180
896 3300046675 Ga0495657_0045190 Ga0495657_0045190_952_1494 180
897 3300046678 Ga0495599_0006440 Ga0495599_0006440_5177_5725 180
898 3300046678 Ga0495599_0036498 Ga0495599_0036498_1030_1572 180
899 3300046679 Ga0495623_0022863 Ga0495623_0022863_2388_2936 180
900 3300046680 Ga0495646_0011620 Ga0495646_0011620_1149_1691 180
901 3300046683 Ga0495658_0467759 Ga0495658_0467759_220_762 180
902 3300046684 Ga0495669_0166786 Ga0495669_0166786_415_957 180
903 3300046690 Ga0495624_0060002 Ga0495624_0060002_1788_2330 180
904 3300046694 Ga0495649_0062500 Ga0495649_0062500_60_602 180
905 3300046694 Ga0495649_0074141 Ga0495649_0074141_908_1450 180
906 3300046694 Ga0495649_0110748 Ga0495649_0110748_850_1392 180
907 3300046809 Ga0495600_0003305 Ga0495600_0003305_7872_8420 180
908 3300046809 Ga0495600_0019159 Ga0495600_0019159_1898_2440 180
909 3300046809 Ga0495600_0064139 Ga0495600_0064139_729_1271 180
910 3300046810 Ga0495660_0097091 Ga0495660_0097091_108_650 180
911 3300047317 Ga0495604_0055766 Ga0495604_0055766_2337_2879 180
912 3300047317 Ga0495604_0060760 Ga0495604_0060760_754_1302 180
913 3300047322 Ga0495680_0003079 Ga0495680_0003079_14512_15054 180
914 3300047322 Ga0495680_0022685 Ga0495680_0022685_239_787 180
915 3300047323 Ga0495683_0031335 Ga0495683_0031335_1569_2111 180
916 3300047323 Ga0495683_0203155 Ga0495683_0203155_106_648 180
917 3300047443 Ga0495687_185412 Ga0495687_185412_10_552 180
918 3300047469 Ga0495673_0065060 Ga0495673_0065060_589_1131 180
919 3300047471 Ga0495684_0036692 Ga0495684_0036692_397_945 180
920 3300047471 Ga0495684_0072494 Ga0495684_0072494_73_615 180
921 3300047472 Ga0495686_0076336 Ga0495686_0076336_769_1311 180
922 3300047472 Ga0495686_0080518 Ga0495686_0080518_26_568 180
923 3300047472 Ga0495686_0183940 Ga0495686_0183940_78_620 180
924 3300047673 Ga0495593_0022703 Ga0495593_0022703_2838_3386 180
925 3300047673 Ga0495593_0286107 Ga0495593_0286107_236_778 180
926 3300048088 Ga0495602_0011303 Ga0495602_0011303_558_1100 180
927 3300048088 Ga0495602_0038574 Ga0495602_0038574_754_1302 180
928 3300048088 Ga0495602_0346360 Ga0495602_0346360_315_857 180
929 3300048089 Ga0495614_0200275 Ga0495614_0200275_81_623 180
930 3300048903 Ga0496100_0084030 Ga0496100_0084030_32_574 180
931 3300048904 Ga0496101_0059075 Ga0496101_0059075_2002_2544 180
932 3300048904 Ga0496101_0072025 Ga0496101_0072025_648_1190 180
933 3300048904 Ga0496101_0158441 Ga0496101_0158441_343_885 180
934 3300048904 Ga0496101_0182757 Ga0496101_0182757_952_1497 180
935 3300048904 Ga0496101_0543616 Ga0496101_0543616_16_558 180
936 3300048905 Ga0496102_0281194 Ga0496102_0281194_817_1359 180
937 3300048907 Ga0496104_0009595 Ga0496104_0009595_1609_2151 180
938 3300048907 Ga0496104_0026681 Ga0496104_0026681_3912_4457 180
939 3300048907 Ga0496104_0369287 Ga0496104_0369287_452_994 180
940 3300048908 Ga0496105_0005245 Ga0496105_0005245_6653_7195 180
941 3300048908 Ga0496105_0032335 Ga0496105_0032335_2878_3420 180
942 3300048908 Ga0496105_0036221 Ga0496105_0036221_100_642 180
943 3300048908 Ga0496105_0048740 Ga0496105_0048740_11_556 180
944 3300048909 Ga0496106_0102797 Ga0496106_0102797_94_636 180
945 3300048909 Ga0496106_0286438 Ga0496106_0286438_720_1262 180
946 3300048911 Ga0496108_0091996 Ga0496108_0091996_285_830 180
947 3300048911 Ga0496108_0463158 Ga0496108_0463158_481_1023 180
948 3300048912 Ga0496109_0066655 Ga0496109_0066655_2542_3084 180
949 3300048913 Ga0496110_0126508 Ga0496110_0126508_279_824 180
950 3300048914 Ga0496111_0131764 Ga0496111_0131764_997_1539 180
951 3300048915 Ga0496112_0071713 Ga0496112_0071713_1301_1843 180
952 3300048915 Ga0496112_0076624 Ga0496112_0076624_2680_3222 180
953 3300048915 Ga0496112_0183402 Ga0496112_0183402_1051_1596 180
954 3300048916 Ga0496113_0108366 Ga0496113_0108366_83_625 180
955 3300048917 Ga0496114_0050479 Ga0496114_0050479_165_707 180
956 3300048917 Ga0496114_0337485 Ga0496114_0337485_686_1228 180
957 3300048917 Ga0496114_0449791 Ga0496114_0449791_122_664 180
958 3300048918 Ga0496115_0025923 Ga0496115_0025923_1453_1995 180
959 3300048918 Ga0496115_0029725 Ga0496115_0029725_292_834 180
960 3300048918 Ga0496115_0251683 Ga0496115_0251683_597_1142 180
961 3300048918 Ga0496115_0429543 Ga0496115_0429543_169_711 180
962 3300048919 Ga0496116_0076390 Ga0496116_0076390_1501_2043 180
963 3300048919 Ga0496116_0178122 Ga0496116_0178122_229_771 180
964 3300048921 Ga0496118_0069862 Ga0496118_0069862_1977_2519 180
965 3300048922 Ga0496119_0037130 Ga0496119_0037130_417_959 180
966 3300048922 Ga0496119_0044456 Ga0496119_0044456_475_1017 180
967 3300048923 Ga0496120_0014100 Ga0496120_0014100_2438_2980 180
968 3300048924 Ga0496121_0033032 Ga0496121_0033032_1134_1676 180
969 3300048924 Ga0496121_0037558 Ga0496121_0037558_751_1293 180
970 3300048924 Ga0496121_0062533 Ga0496121_0062533_263_805 180
971 3300048924 Ga0496121_0217800 Ga0496121_0217800_168_710 180
972 3300048924 Ga0496121_0530931 Ga0496121_0530931_171_713 180
973 3300048925 Ga0496122_0115896 Ga0496122_0115896_922_1464 180
974 3300048926 Ga0496123_0070330 Ga0496123_0070330_790_1332 180
975 3300048928 Ga0496125_0050293 Ga0496125_0050293_2635_3177 180
976 3300048929 Ga0496126_0037507 Ga0496126_0037507_2003_2545 180
977 3300048929 Ga0496126_0099222 Ga0496126_0099222_243_785 180
978 3300048929 Ga0496126_0286798 Ga0496126_0286798_660_1202 180
979 3300048929 Ga0496126_0621102 Ga0496126_0621102_45_587 180
980 3300049568 Ga0501031_0112423 Ga0501031_0112423_1160_1720 180
981 3300049569 Ga0501032_0054807 Ga0501032_0054807_1740_2300 180
982 3300049571 Ga0501034_0253035 Ga0501034_0253035_652_1212 180
983 3300049574 Ga0501038_0531730 Ga0501038_0531730_256_819 180
984 3300049580 Ga0501046_0281836 Ga0501046_0281836_413_973 180
985 3300049586 Ga0501070_0255997 Ga0501070_0255997_10_567 180
986 3300049590 Ga0501074_0041653 Ga0501074_0041653_1951_2508 180
987 3300049741 Ga0501079_0238472 Ga0501079_0238472_701_1261 180
988 3300049823 Ga0501044_0357662 Ga0501044_0357662_702_1262 180
989 3300049824 Ga0501045_0276165 Ga0501045_0276165_422_982 180
990 3300050492 nmdc:mga0yw44_45512_c1 nmdc:mga0yw44_45512_c1_361_903 180
991 3300050493 nmdc:mga0k408_28756_c1 nmdc:mga0k408_28756_c1_927_1469 180
992 3300050495 nmdc:mga04h51_12410_c1 nmdc:mga04h51_12410_c1_1684_2226 180
993 3300050512 nmdc:mga0n895_58310_c1 nmdc:mga0n895_58310_c1_2331_2873 180
994 3300050516 nmdc:mga0sz30_114179_c1 nmdc:mga0sz30_114179_c1_180_722 180
995 3300053077 Ga0495601_0302551 Ga0495601_0302551_390_938 180
996 3300053083 Ga0495655_0054323 Ga0495655_0054323_253_795 180
997 3300053084 Ga0495595_0002792 Ga0495595_0002792_4922_5470 180
998 3300053085 Ga0495619_0001159 Ga0495619_0001159_15660_16208 180
999 3300053087 Ga0500643_000069 Ga0500643_000069_3732_4274 180
1000 3300053092 Ga0500583_0049077 Ga0500583_0049077_306_848 180
1001 3300053094 Ga0500566_0000112 Ga0500566_0000112_31087_31629 180
1002 3300053095 Ga0500640_029224 Ga0500640_029224_621_1163 180
1003 3300053096 Ga0500641_0164625 Ga0500641_0164625_298_840 180
1004 3300053104 Ga0500556_0068287 Ga0500556_0068287_616_1158 180
1005 3300053108 Ga0500562_001366 Ga0500562_001366_169_711 180
1006 3300053109 Ga0500569_150283 Ga0500569_150283_229_771 180
1007 3300053119 Ga0500595_029794 Ga0500595_029794_101_643 180
1008 3300053130 Ga0500642_0050838 Ga0500642_0050838_483_1025 180
1009 3300053139 Ga0500568_0012571 Ga0500568_0012571_2164_2706 180
1010 3300053142 Ga0500577_0122624 Ga0500577_0122624_56_598 180
1011 3300053148 Ga0500590_085681 Ga0500590_085681_963_1505 180
1012 3300053148 Ga0500590_104628 Ga0500590_104628_569_1111 180
1013 3300053156 Ga0500622_0046733 Ga0500622_0046733_1196_1738 180
1014 3300053729 Ga0500625_154897 Ga0500625_154897_251_793 180
1015 3300053730 Ga0500645_051386 Ga0500645_051386_301_843 180
1016 iso_pu_bacteria 2508501009 2508541687 180
1017 iso_pu_bacteria 2515154112 2515626168 180
1018 iso_pu_bacteria 2744054633 2745080859 180
1019 iso_pu_bacteria 2874590934 2874598684 180
1020 iso_pu_bacteria 2874628541 2874634912 180
1021 iso_pu_bacteria 2874645413 2874652139 180
1022 iso_pu_bacteria 2876771140 2876778723 180
1023 iso_pu_bacteria 2876818435 2876823527 180
1024 iso_pu_bacteria 2879074833 2879082516 180
1025 iso_pu_bacteria 2935769743 2935776083 180
1026 iso_pu_bacteria 2935777560 2935785161 180
1027 iso_pu_bacteria 2935785616 2935791904 180
1028 iso_pu_bacteria 2935793552 2935800286 180
1029 iso_pu_bacteria 2935908558 2935909528 180
1030 iso_pu_bacteria 2935916978 2935917252 180
1031 iso_pu_bacteria 2935926038 2935927009 180
1032 iso_pu_bacteria 2935934488 2935937147 180
1033 iso_pu_bacteria 2935942939 2935944550 180
1034 iso_pu_bacteria 2935951376 2935952987 180
1035 iso_pu_bacteria 2935967501 2935969827 180
1036 iso_pu_bacteria 2935975950 2935976424 180
1037 iso_pu_bacteria 8016522445 8016528588 180
1038 iso_pu_bacteria 8016530956 8016533758 180
1039 iso_pu_bacteria 8016539877 8016546976 180
1040 iso_pu_bacteria 8016548790 8016555137 180
1041 iso_pu_bacteria 8016557553 8016563502 180
1042 iso_pu_bacteria 8016566248 8016572091 180
1043 iso_pu_bacteria 8016575299 8016576290 180
1044 iso_pu_bacteria 8016595262 8016601246 180
1045 iso_pu_bacteria 8016603502 8016609190 180
1046 iso_pu_bacteria 8016613128 8016615714 180
1047 iso_pu_bacteria 8016622563 8016625513 180
1048 iso_pu_bacteria 8019530166 8019533533 180
1049 iso_pu_bacteria 8019538911 8019546144 180
1050 iso_pu_bacteria 8019547302 8019552565 180
1051 iso_pu_bacteria 8019619141 8019619914 180
1052 iso_pu_bacteria 8019629233 8019633201 180
1053 iso_pu_bacteria 8019638758 8019646699 180
1054 iso_pu_bacteria 8019659431 8019661071 180
1055 iso_pu_bacteria 8019668869 8019670635 180
1056 iso_pu_bacteria 8019687851 8019691169 180
1057 3300003203 JGI25406J46586_10000050 JGI25406J46586_1000005030 181
1058 3300003320 rootH2_10004786 rootH2_100047862 181
1059 3300005327 Ga0070658_10316039 Ga0070658_103160392 181
1060 3300005330 Ga0070690_100141045 Ga0070690_1001410452 181
1061 3300005336 Ga0070680_100567013 Ga0070680_1005670132 181
1062 3300005338 Ga0068868_100501825 Ga0068868_1005018251 181
1063 3300005340 Ga0070689_100139020 Ga0070689_1001390202 181
1064 3300005355 Ga0070671_100290738 Ga0070671_1002907381 181
1065 3300005356 Ga0070674_100244368 Ga0070674_1002443681 181
1066 3300005434 Ga0070709_10001579 Ga0070709_100015795 181
1067 3300005434 Ga0070709_10005406 Ga0070709_100054065 181
1068 3300005434 Ga0070709_10380775 Ga0070709_103807752 181
1069 3300005435 Ga0070714_100703754 Ga0070714_1007037541 181
1070 3300005436 Ga0070713_100005218 Ga0070713_1000052185 181
1071 3300005436 Ga0070713_100169747 Ga0070713_1001697472 181
1072 3300005437 Ga0070710_10000563 Ga0070710_1000056311 181
1073 3300005437 Ga0070710_10004747 Ga0070710_100047471 181
1074 3300005437 Ga0070710_10395793 Ga0070710_103957931 181
1075 3300005455 Ga0070663_100078923 Ga0070663_1000789232 181
1076 3300005458 Ga0070681_10416251 Ga0070681_104162512 181
1077 3300005530 Ga0070679_100249921 Ga0070679_1002499212 181
1078 3300005530 Ga0070679_100645756 Ga0070679_1006457562 181
1079 3300005535 Ga0070684_100000952 Ga0070684_10000095214 181
1080 3300005539 Ga0068853_100269422 Ga0068853_1002694222 181
1081 3300005548 Ga0070665_100822710 Ga0070665_1008227102 181
1082 3300005563 Ga0068855_100383382 Ga0068855_1003833822 181
1083 3300005577 Ga0068857_100293366 Ga0068857_1002933663 181
1084 3300005616 Ga0068852_100466182 Ga0068852_1004661822 181
1085 3300005983 Ga0081540_1016807 Ga0081540_10168072 181
1086 3300005983 Ga0081540_1056532 Ga0081540_10565323 181
1087 3300005985 Ga0081539_10000325 Ga0081539_1000032531 181
1088 3300006028 Ga0070717_10046100 Ga0070717_100461004 181
1089 3300006028 Ga0070717_10584610 Ga0070717_105846102 181
1090 3300006058 Ga0075432_10132197 Ga0075432_101321972 181
1091 3300006163 Ga0070715_10055764 Ga0070715_100557642 181
1092 3300006163 Ga0070715_10219311 Ga0070715_102193112 181
1093 3300006163 Ga0070715_10273242 Ga0070715_102732421 181
1094 3300006175 Ga0070712_100009777 Ga0070712_1000097773 181
1095 3300006175 Ga0070712_100014924 Ga0070712_1000149245 181
1096 3300006175 Ga0070712_100177856 Ga0070712_1001778562 181
1097 3300006178 Ga0075367_10467190 Ga0075367_104671901 181
1098 3300006871 Ga0075434_100250728 Ga0075434_1002507282 181
1099 3300007788 Ga0099795_10036743 Ga0099795_100367432 181
1100 3300007788 Ga0099795_10054815 Ga0099795_100548151 181
1101 3300009093 Ga0105240_10077860 Ga0105240_100778602 181
1102 3300009093 Ga0105240_10818069 Ga0105240_108180692 181
1103 3300009098 Ga0105245_10283167 Ga0105245_102831672 181
1104 3300009147 Ga0114129_11008986 Ga0114129_110089861 181
1105 3300009176 Ga0105242_11167832 Ga0105242_111678321 181
1106 3300009551 Ga0105238_10045750 Ga0105238_100457504 181
1107 3300009551 Ga0105238_10591728 Ga0105238_105917282 181
1108 3300009553 Ga0105249_11127669 Ga0105249_111276691 181
1109 3300010159 Ga0099796_10135143 Ga0099796_101351432 181
1110 3300013102 Ga0157371_10150504 Ga0157371_101505042 181
1111 3300013104 Ga0157370_10827658 Ga0157370_108276582 181
1112 3300013105 Ga0157369_10213289 Ga0157369_102132892 181
1113 3300013296 Ga0157374_10085901 Ga0157374_100859014 181
1114 3300013297 Ga0157378_10680078 Ga0157378_106800782 181
1115 3300013306 Ga0163162_10232236 Ga0163162_102322361 181
1116 3300013307 Ga0157372_10445403 Ga0157372_104454032 181
1117 3300014325 Ga0163163_10047093 Ga0163163_100470935 181
1118 3300014326 Ga0157380_10272723 Ga0157380_102727232 181
1119 3300014968 Ga0157379_10038813 Ga0157379_100388133 181
1120 3300014969 Ga0157376_10308492 Ga0157376_103084922 181
1121 3300021377 Ga0213874_10098188 Ga0213874_100981882 181
1122 3300021384 Ga0213876_10002729 Ga0213876_100027294 181
1123 3300021384 Ga0213876_10108796 Ga0213876_101087962 181
1124 3300025250 Ga0209026_1022664 Ga0209026_10226642 181
1125 3300025898 Ga0207692_10002141 Ga0207692_100021414 181
1126 3300025898 Ga0207692_10008931 Ga0207692_100089315 181
1127 3300025898 Ga0207692_10029494 Ga0207692_100294942 181
1128 3300025898 Ga0207692_10274388 Ga0207692_102743882 181
1129 3300025903 Ga0207680_10416025 Ga0207680_104160252 181
1130 3300025905 Ga0207685_10060767 Ga0207685_100607672 181
1131 3300025905 Ga0207685_10269519 Ga0207685_102695192 181
1132 3300025906 Ga0207699_10000503 Ga0207699_1000050310 181
1133 3300025906 Ga0207699_10010550 Ga0207699_100105505 181
1134 3300025906 Ga0207699_10154430 Ga0207699_101544302 181
1135 3300025909 Ga0207705_10282447 Ga0207705_102824472 181
1136 3300025912 Ga0207707_10428673 Ga0207707_104286731 181
1137 3300025913 Ga0207695_10265824 Ga0207695_102658242 181
1138 3300025914 Ga0207671_10156310 Ga0207671_101563102 181
1139 3300025915 Ga0207693_10010478 Ga0207693_100104782 181
1140 3300025915 Ga0207693_10014747 Ga0207693_100147473 181
1141 3300025916 Ga0207663_10001800 Ga0207663_100018002 181
1142 3300025917 Ga0207660_10434921 Ga0207660_104349212 181
1143 3300025924 Ga0207694_10084993 Ga0207694_100849932 181
1144 3300025928 Ga0207700_10056742 Ga0207700_100567422 181
1145 3300025928 Ga0207700_10198422 Ga0207700_101984222 181
1146 3300025929 Ga0207664_10028269 Ga0207664_100282693 181
1147 3300025931 Ga0207644_10427416 Ga0207644_104274161 181
1148 3300025935 Ga0207709_10297134 Ga0207709_102971341 181
1149 3300025936 Ga0207670_10070252 Ga0207670_100702524 181
1150 3300025937 Ga0207669_10052811 Ga0207669_100528112 181
1151 3300025944 Ga0207661_10000917 Ga0207661_100009174 181
1152 3300025949 Ga0207667_10623081 Ga0207667_106230812 181
1153 3300026023 Ga0207677_10416807 Ga0207677_104168072 181
1154 3300026041 Ga0207639_10028169 Ga0207639_100281694 181
1155 3300026067 Ga0207678_10021631 Ga0207678_100216312 181
1156 3300026067 Ga0207678_10033947 Ga0207678_100339475 181
1157 3300026078 Ga0207702_10997614 Ga0207702_109976142 181
1158 3300026116 Ga0207674_10360954 Ga0207674_103609542 181
1159 3300027512 Ga0209179_1004949 Ga0209179_10049493 181
1160 3300027671 Ga0209588_1000816 Ga0209588_10008165 181
1161 3300028379 Ga0268266_10108842 Ga0268266_101088422 181
1162 3300028800 Ga0265338_10381945 Ga0265338_103819451 181
1163 3300030760 Ga0265762_1022956 Ga0265762_10229562 181
1164 3300031241 Ga0265325_10032679 Ga0265325_100326792 181
1165 3300031247 Ga0265340_10044848 Ga0265340_100448483 181
1166 3300031249 Ga0265339_10013941 Ga0265339_100139414 181
1167 3300031250 Ga0265331_10055981 Ga0265331_100559812 181
1168 3300031250 Ga0265331_10084420 Ga0265331_100844202 181
1169 3300031507 Ga0307509_10503716 Ga0307509_105037161 181
1170 3300031595 Ga0265313_10021124 Ga0265313_100211244 181
1171 3300031711 Ga0265314_10067654 Ga0265314_100676542 181
1172 3300031712 Ga0265342_10008230 Ga0265342_100082305 181
1173 3300031731 Ga0307405_10076072 Ga0307405_100760723 181
1174 3300032126 Ga0307415_100175699 Ga0307415_1001756991 181
1175 3300033180 Ga0307510_10168454 Ga0307510_101684542 181
1176 3300035083 Ga0373926_0132831 Ga0373926_0132831_163_708 181
1177 3300035089 Ga0373944_0084789 Ga0373944_0084789_336_881 181
1178 3300035111 Ga0373923_0001465 Ga0373923_0001465_3972_4517 181
1179 3300035113 Ga0373936_0011859 Ga0373936_0011859_281_826 181
1180 3300035117 Ga0373953_0312793 Ga0373953_0312793_54_599 181
1181 3300035118 Ga0373954_0280203 Ga0373954_0280203_101_646 181
1182 3300035170 Ga0373943_0003121 Ga0373943_0003121_1252_1797 181
1183 3300035170 Ga0373943_0255731 Ga0373943_0255731_112_657 181
1184 3300035171 Ga0373946_0054567 Ga0373946_0054567_39_584 181
1185 3300035692 Ga0373935_0007485 Ga0373935_0007485_3024_3569 181
1186 3300035695 Ga0373927_0000783 Ga0373927_0000783_6067_6612 181
1187 3300035695 Ga0373927_0125122 Ga0373927_0125122_457_1026 181
1188 3300035724 Ga0373933_0000745 Ga0373933_0000745_11616_12167 181
1189 3300035725 Ga0373947_0001285 Ga0373947_0001285_10763_11308 181
1190 3300036401 Ga0373937_0055982 Ga0373937_0055982_1204_1749 181
1191 3300037068 Ga0373925_0009084 Ga0373925_0009084_1967_2512 181
1192 3300037312 Ga0395899_0052019 Ga0395899_0052019_1753_2298 181
1193 3300037312 Ga0395899_0155113 Ga0395899_0155113_142_687 181
1194 3300037418 Ga0395900_0001070 Ga0395900_0001070_20695_21240 181
1195 3300037466 Ga0395898_0001820 Ga0395898_0001820_481_1026 181
1196 3300037466 Ga0395898_0008100 Ga0395898_0008100_6357_6902 181
1197 3300037466 Ga0395898_1210145 Ga0395898_1210145_101_646 181
1198 3300038443 Ga0395901_0036584 Ga0395901_0036584_4387_4932 181
1199 3300038443 Ga0395901_0233509 Ga0395901_0233509_1212_1763 181
1200 3300039437 Ga0436365_0551209 Ga0436365_0551209_518_1063 181
1201 3300039437 Ga0436365_0766659 Ga0436365_0766659_190_735 181
1202 3300039447 Ga0436361_0733364 Ga0436361_0733364_493_1038 181
1203 3300039447 Ga0436361_0940506 Ga0436361_0940506_137_682 181
1204 3300039450 Ga0436363_0315242 Ga0436363_0315242_217_762 181
1205 3300039450 Ga0436363_0448550 Ga0436363_0448550_230_775 181
1206 3300039450 Ga0436363_0726009 Ga0436363_0726009_62_607 181
1207 3300039450 Ga0436363_1691007 Ga0436363_1691007_3899_4444 181
1208 3300039453 Ga0436362_0392249 Ga0436362_0392249_229_774 181
1209 3300039453 Ga0436362_0532768 Ga0436362_0532768_2668_3213 181
1210 3300041453 Ga0451797_1478868 Ga0451797_1478868_126_671 181
1211 3300041498 Ga0451841_0432165 Ga0451841_0432165_547_1098 181
1212 3300044656 Ga0466969_0265654 Ga0466969_0265654_152_697 181
1213 3300044694 Ga0466963_0018695 Ga0466963_0018695_227_772 181
1214 3300044694 Ga0466963_0025638 Ga0466963_0025638_2693_3238 181
1215 3300044694 Ga0466963_0417413 Ga0466963_0417413_45_590 181
1216 3300044706 Ga0466964_0256271 Ga0466964_0256271_269_814 181
1217 3300044706 Ga0466964_0423259 Ga0466964_0423259_94_639 181
1218 3300044735 Ga0466968_0152970 Ga0466968_0152970_222_767 181
1219 3300044842 Ga0466957_0229960 Ga0466957_0229960_658_1203 181
1220 3300045976 Ga0466967_0129640 Ga0466967_0129640_16_561 181
1221 3300045976 Ga0466967_0156615 Ga0466967_0156615_1495_2040 181
1222 3300045976 Ga0466967_1193165 Ga0466967_1193165_158_703 181
1223 3300045976 Ga0466967_1834124 Ga0466967_1834124_22_567 181
1224 3300046455 Ga0495603_0001681 Ga0495603_0001681_9840_10385 181
1225 3300046455 Ga0495603_0002554 Ga0495603_0002554_2667_3218 181
1226 3300046459 Ga0495629_0000165 Ga0495629_0000165_46872_47417 181
1227 3300046460 Ga0495638_0242061 Ga0495638_0242061_357_902 181
1228 3300046461 Ga0495641_0000929 Ga0495641_0000929_10175_10720 181
1229 3300046472 Ga0495580_0000913 Ga0495580_0000913_6340_6885 181
1230 3300046473 Ga0495582_0000016 Ga0495582_0000016_100021_100566 181
1231 3300046475 Ga0495639_0000014 Ga0495639_0000014_7501_8046 181
1232 3300046476 Ga0495662_0000086 Ga0495662_0000086_4703_5248 181
1233 3300046499 Ga0495594_0000420 Ga0495594_0000420_8224_8769 181
1234 3300046514 Ga0495618_0084275 Ga0495618_0084275_353_898 181
1235 3300046516 Ga0495628_0055901 Ga0495628_0055901_137_682 181
1236 3300046517 Ga0495630_0003176 Ga0495630_0003176_276_821 181
1237 3300046517 Ga0495630_0139089 Ga0495630_0139089_965_1516 181
1238 3300046523 Ga0495644_0056272 Ga0495644_0056272_505_1050 181
1239 3300046524 Ga0495648_0001270 Ga0495648_0001270_1928_2587 181
1240 3300046529 Ga0495652_0025241 Ga0495652_0025241_439_984 181
1241 3300046531 Ga0495665_0000665 Ga0495665_0000665_7944_8489 181
1242 3300046533 Ga0495640_0002399 Ga0495640_0002399_1476_2021 181
1243 3300046557 Ga0495622_0002786 Ga0495622_0002786_3494_4039 181
1244 3300046559 Ga0495667_0011830 Ga0495667_0011830_2420_2965 181
1245 3300046642 Ga0495634_0000859 Ga0495634_0000859_18568_19113 181
1246 3300046648 Ga0495611_0140338 Ga0495611_0140338_67_618 181
1247 3300046663 Ga0495635_0012918 Ga0495635_0012918_2622_3167 181
1248 3300046674 Ga0495588_0003175 Ga0495588_0003175_5333_5878 181
1249 3300046680 Ga0495646_0036240 Ga0495646_0036240_378_929 181
1250 3300046681 Ga0495647_0004777 Ga0495647_0004777_2114_2659 181
1251 3300046683 Ga0495658_0002129 Ga0495658_0002129_9183_9728 181
1252 3300046689 Ga0495613_0080984 Ga0495613_0080984_1215_1760 181
1253 3300046690 Ga0495624_0000138 Ga0495624_0000138_24379_24924 181
1254 3300046809 Ga0495600_0215981 Ga0495600_0215981_481_1026 181
1255 3300047315 Ga0495581_0000001 Ga0495581_0000001_55848_56393 181
1256 3300047319 Ga0495674_0005256 Ga0495674_0005256_5159_5704 181
1257 3300047320 Ga0495672_0004418 Ga0495672_0004418_7053_7679 181
1258 3300047321 Ga0495676_0040714 Ga0495676_0040714_3031_3576 181
1259 3300047469 Ga0495673_0068791 Ga0495673_0068791_584_1129 181
1260 3300047673 Ga0495593_0000006 Ga0495593_0000006_83910_84455 181
1261 3300048089 Ga0495614_0057226 Ga0495614_0057226_952_1497 181
1262 3300048903 Ga0496100_0247974 Ga0496100_0247974_736_1299 181
1263 3300048905 Ga0496102_0067901 Ga0496102_0067901_1299_1862 181
1264 3300048905 Ga0496102_0863936 Ga0496102_0863936_182_727 181
1265 3300048908 Ga0496105_0056871 Ga0496105_0056871_556_1119 181
1266 3300048911 Ga0496108_0029736 Ga0496108_0029736_454_1017 181
1267 3300048912 Ga0496109_0142003 Ga0496109_0142003_433_996 181
1268 3300048915 Ga0496112_0000044 Ga0496112_0000044_25913_26464 181
1269 3300048915 Ga0496112_0020643 Ga0496112_0020643_5089_5652 181
1270 3300048917 Ga0496114_0109489 Ga0496114_0109489_1310_1873 181
1271 3300048917 Ga0496114_0219590 Ga0496114_0219590_1022_1567 181
1272 3300048918 Ga0496115_0033607 Ga0496115_0033607_2065_2610 181
1273 3300048918 Ga0496115_0035946 Ga0496115_0035946_2702_3265 181
1274 3300048918 Ga0496115_0453673 Ga0496115_0453673_459_1004 181
1275 3300048918 Ga0496115_0761527 Ga0496115_0761527_10_555 181
1276 3300048921 Ga0496118_0198646 Ga0496118_0198646_547_1092 181
1277 3300048924 Ga0496121_0197133 Ga0496121_0197133_828_1373 181
1278 3300048925 Ga0496122_0024003 Ga0496122_0024003_632_1177 181
1279 3300048929 Ga0496126_0007021 Ga0496126_0007021_10401_10946 181
1280 3300048929 Ga0496126_0011784 Ga0496126_0011784_1721_2266 181
1281 3300048929 Ga0496126_0013214 Ga0496126_0013214_7256_7801 181
1282 3300048929 Ga0496126_0068932 Ga0496126_0068932_1788_2333 181
1283 3300048929 Ga0496126_0099061 Ga0496126_0099061_906_1451 181
1284 3300048929 Ga0496126_0331694 Ga0496126_0331694_113_658 181
1285 3300049568 Ga0501031_0032790 Ga0501031_0032790_863_1408 181
1286 3300049569 Ga0501032_0000198 Ga0501032_0000198_10642_11187 181
1287 3300049570 Ga0501033_0000091 Ga0501033_0000091_42497_43042 181
1288 3300049571 Ga0501034_0000039 Ga0501034_0000039_109560_110105 181
1289 3300049572 Ga0501036_0000347 Ga0501036_0000347_1348_1893 181
1290 3300049573 Ga0501037_0000025 Ga0501037_0000025_12149_12694 181
1291 3300049574 Ga0501038_0002497 Ga0501038_0002497_5950_6495 181
1292 3300049575 Ga0501039_0004443 Ga0501039_0004443_1077_1622 181
1293 3300049579 Ga0501043_0000233 Ga0501043_0000233_48437_48982 181
1294 3300049580 Ga0501046_0000995 Ga0501046_0000995_14124_14669 181
1295 3300049581 Ga0501047_0004251 Ga0501047_0004251_11589_12134 181
1296 3300049581 Ga0501047_0156948 Ga0501047_0156948_1138_1689 181
1297 3300049581 Ga0501047_0351056 Ga0501047_0351056_570_1115 181
1298 3300049582 Ga0501048_0000218 Ga0501048_0000218_9819_10364 181
1299 3300049583 Ga0501067_0004456 Ga0501067_0004456_1364_1909 181
1300 3300049584 Ga0501068_0000785 Ga0501068_0000785_8854_9399 181
1301 3300049585 Ga0501069_0000827 Ga0501069_0000827_10769_11314 181
1302 3300049586 Ga0501070_0049607 Ga0501070_0049607_985_1530 181
1303 3300049586 Ga0501070_0299202 Ga0501070_0299202_103_648 181
1304 3300049588 Ga0501072_0007128 Ga0501072_0007128_6450_6995 181
1305 3300049589 Ga0501073_0000118 Ga0501073_0000118_48994_49539 181
1306 3300049590 Ga0501074_0000273 Ga0501074_0000273_1411_1956 181
1307 3300049741 Ga0501079_0000590 Ga0501079_0000590_18593_19138 181
1308 3300049742 Ga0501080_0000124 Ga0501080_0000124_34315_34860 181
1309 3300049744 Ga0501083_0000184 Ga0501083_0000184_35073_35618 181
1310 3300049822 Ga0501035_0000052 Ga0501035_0000052_90518_91063 181
1311 3300049822 Ga0501035_0329775 Ga0501035_0329775_167_718 181
1312 3300049822 Ga0501035_0638617 Ga0501035_0638617_187_732 181
1313 3300049823 Ga0501044_0001974 Ga0501044_0001974_21839_22384 181
1314 3300049823 Ga0501044_0882526 Ga0501044_0882526_87_638 181
1315 3300050496 nmdc:mga07m45_332203_c1 nmdc:mga07m45_332203_c1_169_714 181
1316 3300053080 Ga0500635_0005505 Ga0500635_0005505_888_1439 181
1317 3300053094 Ga0500566_0372327 Ga0500566_0372327_54_599 181
1318 3300053098 Ga0500650_0268134 Ga0500650_0268134_199_744 181
1319 3300053102 Ga0500554_003067 Ga0500554_003067_2447_2998 181
1320 3300053134 Ga0500658_0412285 Ga0500658_0412285_31_576 181
1321 3300053150 Ga0500603_000747 Ga0500603_000747_1751_2302 181
1322 3300053151 Ga0500604_0053025 Ga0500604_0053025_489_1034 181
1323 3300053158 Ga0500627_0170721 Ga0500627_0170721_81_626 181
1324 3300053178 Ga0500637_0182883 Ga0500637_0182883_20_571 181
1325 3300053724 Ga0500570_071677 Ga0500570_071677_631_1197 181
1326 3300053737 Ga0500601_000736 Ga0500601_000736_189_734 181
1327 3300054114 Ga0501084_0002419 Ga0501084_0002419_5950_6495 181
1328 3300060353 Ga0501082_0000457 Ga0501082_0000457_18945_19490 181
1329 iso_pu_bacteria 2513237141 2513894168 181
1330 3300031616 Ga0307508_10065217 Ga0307508_100652173 182
1331 3300039437 Ga0436365_1026973 Ga0436365_1026973_133_681 182
1332 3300046477 Ga0495664_0096681 Ga0495664_0096681_909_1457 182
1333 3300046517 Ga0495630_0961129 Ga0495630_0961129_54_602 182
1334 3300047319 Ga0495674_0457991 Ga0495674_0457991_14_562 182
1335 3300053105 Ga0500557_000003 Ga0500557_000003_138063_138611 182
1336 3300053729 Ga0500625_005539 Ga0500625_005539_2112_2660 182
1337 iso_pu_bacteria 2921643360 2921648042 182
1338 3300006175 Ga0070712_100471136 Ga0070712_1004711361 183
1339 3300007788 Ga0099795_10012566 Ga0099795_100125661 183
1340 3300025910 Ga0207684_10347308 Ga0207684_103473081 183
1341 3300025915 Ga0207693_10078815 Ga0207693_100788152 183
1342 3300025929 Ga0207664_10455251 Ga0207664_104552512 183
1343 3300025939 Ga0207665_10032829 Ga0207665_100328292 183
1344 3300027671 Ga0209588_1060552 Ga0209588_10605522 183
1345 3300035695 Ga0373927_0003201 Ga0373927_0003201_5311_5868 183
1346 3300035725 Ga0373947_0005796 Ga0373947_0005796_3097_3654 183
1347 3300037068 Ga0373925_0483802 Ga0373925_0483802_162_719 183
1348 3300046473 Ga0495582_0228655 Ga0495582_0228655_18_575 183
1349 3300046526 Ga0495666_0197235 Ga0495666_0197235_137_694 183
1350 3300046674 Ga0495588_0089354 Ga0495588_0089354_589_1146 183
1351 3300047321 Ga0495676_0157359 Ga0495676_0157359_957_1514 183
1352 3300048908 Ga0496105_0471474 Ga0496105_0471474_217_774 183
1353 3300048911 Ga0496108_0030463 Ga0496108_0030463_396_953 183
1354 3300048912 Ga0496109_1167299 Ga0496109_1167299_67_624 183
1355 3300048914 Ga0496111_0091349 Ga0496111_0091349_1614_2171 183
1356 3300048915 Ga0496112_0165914 Ga0496112_0165914_1131_1688 183
1357 3300048916 Ga0496113_0548392 Ga0496113_0548392_154_711 183
1358 3300003771 Ga0055526_1040592 Ga0055526_10405922 184
1359 3300005262 Ga0065165_1006875 Ga0065165_10068755 184
1360 3300005262 Ga0065165_1011066 Ga0065165_10110663 184
1361 3300005337 Ga0070682_100130277 Ga0070682_1001302772 184
1362 3300005344 Ga0070661_100283551 Ga0070661_1002835511 184
1363 3300005434 Ga0070709_10051939 Ga0070709_100519392 184
1364 3300005435 Ga0070714_100038450 Ga0070714_1000384503 184
1365 3300005436 Ga0070713_100080887 Ga0070713_1000808872 184
1366 3300005437 Ga0070710_10000506 Ga0070710_1000050610 184
1367 3300005439 Ga0070711_100003355 Ga0070711_1000033556 184
1368 3300005455 Ga0070663_100116261 Ga0070663_1001162612 184
1369 3300006028 Ga0070717_10015855 Ga0070717_100158557 184
1370 3300006038 Ga0075365_10004379 Ga0075365_100043797 184
1371 3300006048 Ga0075363_100329241 Ga0075363_1003292412 184
1372 3300006051 Ga0075364_10201872 Ga0075364_102018722 184
1373 3300006163 Ga0070715_10000376 Ga0070715_100003768 184
1374 3300006173 Ga0070716_100054448 Ga0070716_1000544482 184
1375 3300006175 Ga0070712_100023662 Ga0070712_1000236623 184
1376 3300006186 Ga0075369_10128892 Ga0075369_101288922 184
1377 3300006195 Ga0075366_10028925 Ga0075366_100289253 184
1378 3300014497 Ga0182008_10279964 Ga0182008_102799642 184
1379 3300025295 Ga0209564_1008038 Ga0209564_10080385 184
1380 3300025297 Ga0209758_1000011 Ga0209758_1000011420 184
1381 3300025298 Ga0209050_1076411 Ga0209050_10764112 184
1382 3300025299 Ga0209256_1003911 Ga0209256_10039115 184
1383 3300025302 Ga0207426_1000292 Ga0207426_100029276 184
1384 3300025303 Ga0209051_1038395 Ga0209051_10383953 184
1385 3300025304 Ga0209257_1001242 Ga0209257_100124216 184
1386 3300025898 Ga0207692_10002191 Ga0207692_100021911 184
1387 3300025905 Ga0207685_10001380 Ga0207685_100013802 184
1388 3300025906 Ga0207699_10016050 Ga0207699_100160502 184
1389 3300025906 Ga0207699_10288892 Ga0207699_102888922 184
1390 3300025909 Ga0207705_10275071 Ga0207705_102750712 184
1391 3300025915 Ga0207693_10000085 Ga0207693_1000008557 184
1392 3300025916 Ga0207663_10000145 Ga0207663_1000014512 184
1393 3300025929 Ga0207664_10350136 Ga0207664_103501362 184
1394 3300025939 Ga0207665_10000229 Ga0207665_1000022914 184
1395 3300026067 Ga0207678_10254767 Ga0207678_102547672 184
1396 3300036401 Ga0373937_0017404 Ga0373937_0017404_5225_5863 184
1397 3300037312 Ga0395899_0658370 Ga0395899_0658370_49_603 184
1398 3300037418 Ga0395900_0130661 Ga0395900_0130661_1766_2320 184
1399 3300037471 Ga0395905_0910527 Ga0395905_0910527_164_718 184
1400 3300041459 Ga0451800_0883918 Ga0451800_0883918_136_690 184
1401 3300041507 Ga0451851_0421653 Ga0451851_0421653_557_1111 184
1402 3300042005 Ga0439448_0090233 Ga0439448_0090233_189_743 184
1403 3300046679 Ga0495623_0415218 Ga0495623_0415218_23_577 184
1404 3300048912 Ga0496109_0201139 Ga0496109_0201139_428_982 184
1405 3300048913 Ga0496110_0682134 Ga0496110_0682134_70_624 184
1406 3300048914 Ga0496111_0615582 Ga0496111_0615582_200_754 184
1407 3300048915 Ga0496112_0060244 Ga0496112_0060244_612_1166 184
1408 3300048918 Ga0496115_0545822 Ga0496115_0545822_84_638 184
1409 3300050492 nmdc:mga0yw44_266_c1 nmdc:mga0yw44_266_c1_8800_9378 184
1410 3300050509 nmdc:mga0qj67_639523_c1 nmdc:mga0qj67_639523_c1_16_594 184
1411 3300053136 Ga0500559_0083047 Ga0500559_0083047_101_655 184
1412 3300053177 Ga0500636_0000286 Ga0500636_0000286_6114_6668 184
1413 3300053722 Ga0500649_180359 Ga0500649_180359_51_605 184
1414 3300000549 LJQas_1002246 LJQas_10022461 185
1415 3300005327 Ga0070658_10109626 Ga0070658_101096262 185
1416 3300005329 Ga0070683_100066277 Ga0070683_1000662774 185
1417 3300005334 Ga0068869_100554129 Ga0068869_1005541291 185
1418 3300005336 Ga0070680_100004957 Ga0070680_1000049572 185
1419 3300005336 Ga0070680_100199398 Ga0070680_1001993982 185
1420 3300005336 Ga0070680_100308713 Ga0070680_1003087132 185
1421 3300005336 Ga0070680_100328176 Ga0070680_1003281762 185
1422 3300005339 Ga0070660_100229205 Ga0070660_1002292052 185
1423 3300005366 Ga0070659_100172269 Ga0070659_1001722692 185
1424 3300005436 Ga0070713_100216580 Ga0070713_1002165802 185
1425 3300005439 Ga0070711_100438016 Ga0070711_1004380162 185
1426 3300005458 Ga0070681_10019352 Ga0070681_100193524 185
1427 3300005458 Ga0070681_10341851 Ga0070681_103418512 185
1428 3300005458 Ga0070681_10441971 Ga0070681_104419711 185
1429 3300005458 Ga0070681_10637190 Ga0070681_106371901 185
1430 3300005471 Ga0070698_100199514 Ga0070698_1001995141 185
1431 3300005530 Ga0070679_100188624 Ga0070679_1001886241 185
1432 3300005530 Ga0070679_100193903 Ga0070679_1001939032 185
1433 3300005535 Ga0070684_100165447 Ga0070684_1001654472 185
1434 3300005539 Ga0068853_100011686 Ga0068853_1000116863 185
1435 3300005547 Ga0070693_100201142 Ga0070693_1002011421 185
1436 3300005563 Ga0068855_100105995 Ga0068855_1001059952 185
1437 3300005563 Ga0068855_100256501 Ga0068855_1002565012 185
1438 3300005564 Ga0070664_100424419 Ga0070664_1004244192 185
1439 3300005577 Ga0068857_100012744 Ga0068857_1000127445 185
1440 3300005578 Ga0068854_100604291 Ga0068854_1006042911 185
1441 3300005616 Ga0068852_100192794 Ga0068852_1001927942 185
1442 3300005616 Ga0068852_100330711 Ga0068852_1003307112 185
1443 3300005834 Ga0068851_10043794 Ga0068851_100437943 185
1444 3300005843 Ga0068860_100781147 Ga0068860_1007811471 185
1445 3300005937 Ga0081455_10006420 Ga0081455_1000642010 185
1446 3300005983 Ga0081540_1046363 Ga0081540_10463633 185
1447 3300006038 Ga0075365_10114872 Ga0075365_101148722 185
1448 3300006358 Ga0068871_100713106 Ga0068871_1007131062 185
1449 3300007788 Ga0099795_10046864 Ga0099795_100468643 185
1450 3300007788 Ga0099795_10283990 Ga0099795_102839902 185
1451 3300009093 Ga0105240_10120653 Ga0105240_101206535 185
1452 3300009093 Ga0105240_10370125 Ga0105240_103701252 185
1453 3300009545 Ga0105237_10013203 Ga0105237_100132038 185
1454 3300009545 Ga0105237_10169407 Ga0105237_101694072 185
1455 3300009545 Ga0105237_10214632 Ga0105237_102146322 185
1456 3300009551 Ga0105238_10196785 Ga0105238_101967852 185
1457 3300009551 Ga0105238_11245153 Ga0105238_112451532 185
1458 3300010375 Ga0105239_10019512 Ga0105239_100195123 185
1459 3300013105 Ga0157369_10038951 Ga0157369_100389513 185
1460 3300013105 Ga0157369_10047487 Ga0157369_100474875 185
1461 3300013306 Ga0163162_11337391 Ga0163162_113373912 185
1462 3300013307 Ga0157372_10089134 Ga0157372_100891342 185
1463 3300013307 Ga0157372_10994178 Ga0157372_109941782 185
1464 3300014325 Ga0163163_10184430 Ga0163163_101844302 185
1465 3300014969 Ga0157376_10566733 Ga0157376_105667332 185
1466 3300020070 Ga0206356_10863949 Ga0206356_108639492 185
1467 3300020082 Ga0206353_11063056 Ga0206353_110630562 185
1468 3300021384 Ga0213876_10051418 Ga0213876_100514182 185
1469 3300025321 Ga0207656_10022373 Ga0207656_100223734 185
1470 3300025906 Ga0207699_10062794 Ga0207699_100627942 185
1471 3300025909 Ga0207705_10107676 Ga0207705_101076762 185
1472 3300025912 Ga0207707_10000717 Ga0207707_100007174 185
1473 3300025912 Ga0207707_10001896 Ga0207707_100018969 185
1474 3300025912 Ga0207707_10409620 Ga0207707_104096202 185
1475 3300025912 Ga0207707_10692011 Ga0207707_106920111 185
1476 3300025913 Ga0207695_10092793 Ga0207695_100927933 185
1477 3300025914 Ga0207671_10035720 Ga0207671_100357202 185
1478 3300025914 Ga0207671_10646605 Ga0207671_106466052 185
1479 3300025916 Ga0207663_10260645 Ga0207663_102606451 185
1480 3300025917 Ga0207660_10012962 Ga0207660_100129622 185
1481 3300025917 Ga0207660_10149915 Ga0207660_101499152 185
1482 3300025917 Ga0207660_11010655 Ga0207660_110106551 185
1483 3300025919 Ga0207657_10006888 Ga0207657_100068885 185
1484 3300025921 Ga0207652_10022959 Ga0207652_100229592 185
1485 3300025924 Ga0207694_10179888 Ga0207694_101798882 185
1486 3300025924 Ga0207694_10558617 Ga0207694_105586171 185
1487 3300025929 Ga0207664_10238554 Ga0207664_102385541 185
1488 3300025931 Ga0207644_10404706 Ga0207644_104047062 185
1489 3300025932 Ga0207690_10180731 Ga0207690_101807312 185
1490 3300025939 Ga0207665_10009781 Ga0207665_100097812 185
1491 3300025939 Ga0207665_10768961 Ga0207665_107689611 185
1492 3300025944 Ga0207661_10238900 Ga0207661_102389002 185
1493 3300025949 Ga0207667_10271633 Ga0207667_102716332 185
1494 3300026041 Ga0207639_10006860 Ga0207639_100068603 185
1495 3300026078 Ga0207702_10259853 Ga0207702_102598532 185
1496 3300026088 Ga0207641_10294140 Ga0207641_102941402 185
1497 3300026116 Ga0207674_10011178 Ga0207674_100111782 185
1498 3300026118 Ga0207675_100854869 Ga0207675_1008548692 185
1499 3300026142 Ga0207698_10261855 Ga0207698_102618553 185
1500 3300026142 Ga0207698_10385805 Ga0207698_103858052 185
1501 3300030521 Ga0307511_10045798 Ga0307511_100457984 185
1502 3300031235 Ga0265330_10012565 Ga0265330_100125654 185
1503 3300031239 Ga0265328_10089696 Ga0265328_100896961 185
1504 3300031250 Ga0265331_10082448 Ga0265331_100824482 185
1505 3300031250 Ga0265331_10178250 Ga0265331_101782501 185
1506 3300031344 Ga0265316_10055188 Ga0265316_100551882 185
1507 3300031507 Ga0307509_10093399 Ga0307509_100933994 185
1508 3300031616 Ga0307508_10220463 Ga0307508_102204632 185
1509 3300031616 Ga0307508_10237559 Ga0307508_102375592 185
1510 3300031712 Ga0265342_10196665 Ga0265342_101966652 185
1511 3300031730 Ga0307516_10010277 Ga0307516_100102776 185
1512 3300033179 Ga0307507_10030697 Ga0307507_100306975 185
1513 3300034819 Ga0373958_0037397 Ga0373958_0037397_277_840 185
1514 3300035113 Ga0373936_0017834 Ga0373936_0017834_744_1301 185
1515 3300035116 Ga0373945_0198174 Ga0373945_0198174_113_676 185
1516 3300035117 Ga0373953_0081149 Ga0373953_0081149_704_1267 185
1517 3300035118 Ga0373954_0032382 Ga0373954_0032382_1600_2163 185
1518 3300035119 Ga0373956_0028341 Ga0373956_0028341_899_1462 185
1519 3300035172 Ga0373955_0175082 Ga0373955_0175082_240_803 185
1520 3300035410 Ga0373924_0095604 Ga0373924_0095604_424_987 185
1521 3300035691 Ga0373931_0006167 Ga0373931_0006167_4202_4765 185
1522 3300035692 Ga0373935_0223613 Ga0373935_0223613_41_604 185
1523 3300035695 Ga0373927_0109933 Ga0373927_0109933_649_1212 185
1524 3300035695 Ga0373927_0295969 Ga0373927_0295969_94_657 185
1525 3300035725 Ga0373947_0002225 Ga0373947_0002225_1983_2546 185
1526 3300036401 Ga0373937_0291115 Ga0373937_0291115_54_617 185
1527 3300036401 Ga0373937_0357148 Ga0373937_0357148_562_1125 185
1528 3300037068 Ga0373925_0571115 Ga0373925_0571115_307_870 185
1529 3300038443 Ga0395901_0230580 Ga0395901_0230580_965_1540 185
1530 3300039447 Ga0436361_0850535 Ga0436361_0850535_242_799 185
1531 3300044684 Ga0466966_0037736 Ga0466966_0037736_1712_2269 185
1532 3300044765 Ga0466970_0028528 Ga0466970_0028528_259_816 185
1533 3300045049 Ga0466959_0560060 Ga0466959_0560060_25_582 185
1534 3300046462 Ga0495651_0117801 Ga0495651_0117801_913_1476 185
1535 3300046472 Ga0495580_0012709 Ga0495580_0012709_3785_4372 185
1536 3300046474 Ga0495605_0096527 Ga0495605_0096527_511_1098 185
1537 3300046477 Ga0495664_0109702 Ga0495664_0109702_667_1230 185
1538 3300046477 Ga0495664_0168297 Ga0495664_0168297_561_1124 185
1539 3300046491 Ga0495584_0131219 Ga0495584_0131219_266_853 185
1540 3300046506 Ga0495583_0020320 Ga0495583_0020320_447_1034 185
1541 3300046511 Ga0495608_0085211 Ga0495608_0085211_247_804 185
1542 3300046514 Ga0495618_0080743 Ga0495618_0080743_706_1269 185
1543 3300046516 Ga0495628_0042840 Ga0495628_0042840_1571_2134 185
1544 3300046528 Ga0495642_0019111 Ga0495642_0019111_1736_2323 185
1545 3300046529 Ga0495652_0080110 Ga0495652_0080110_922_1485 185
1546 3300046531 Ga0495665_0050977 Ga0495665_0050977_1298_1885 185
1547 3300046533 Ga0495640_0045369 Ga0495640_0045369_1585_2148 185
1548 3300046543 Ga0495645_0039169 Ga0495645_0039169_774_1337 185
1549 3300046543 Ga0495645_0135638 Ga0495645_0135638_550_1113 185
1550 3300046557 Ga0495622_0016747 Ga0495622_0016747_484_1071 185
1551 3300046557 Ga0495622_0050150 Ga0495622_0050150_254_817 185
1552 3300046559 Ga0495667_0039008 Ga0495667_0039008_1530_2093 185
1553 3300046642 Ga0495634_0042688 Ga0495634_0042688_1577_2140 185
1554 3300046663 Ga0495635_0134480 Ga0495635_0134480_623_1180 185
1555 3300046675 Ga0495657_0061256 Ga0495657_0061256_759_1322 185
1556 3300046678 Ga0495599_0091650 Ga0495599_0091650_148_711 185
1557 3300046689 Ga0495613_0163535 Ga0495613_0163535_195_758 185
1558 3300046794 Ga0495589_0099354 Ga0495589_0099354_402_989 185
1559 3300046809 Ga0495600_0049648 Ga0495600_0049648_1726_2289 185
1560 3300047315 Ga0495581_0174967 Ga0495581_0174967_316_891 185
1561 3300047317 Ga0495604_0049825 Ga0495604_0049825_1448_2011 185
1562 3300047319 Ga0495674_0008899 Ga0495674_0008899_8490_9077 185
1563 3300047319 Ga0495674_0167618 Ga0495674_0167618_711_1274 185
1564 3300047320 Ga0495672_0029991 Ga0495672_0029991_1197_1784 185
1565 3300047322 Ga0495680_0044778 Ga0495680_0044778_1792_2355 185
1566 3300047323 Ga0495683_0036510 Ga0495683_0036510_445_1032 185
1567 3300047443 Ga0495687_041885 Ga0495687_041885_466_1053 185
1568 3300047444 Ga0495675_0046597 Ga0495675_0046597_1937_2500 185
1569 3300047469 Ga0495673_0023976 Ga0495673_0023976_903_1490 185
1570 3300048088 Ga0495602_0196436 Ga0495602_0196436_687_1250 185
1571 3300048091 Ga0495626_0171203 Ga0495626_0171203_207_794 185
1572 3300048903 Ga0496100_0006943 Ga0496100_0006943_5110_5697 185
1573 3300048904 Ga0496101_0085099 Ga0496101_0085099_1068_1655 185
1574 3300048904 Ga0496101_0128661 Ga0496101_0128661_742_1299 185
1575 3300048904 Ga0496101_0209036 Ga0496101_0209036_137_700 185
1576 3300048905 Ga0496102_0129692 Ga0496102_0129692_970_1533 185
1577 3300048906 Ga0496103_0155585 Ga0496103_0155585_117_680 185
1578 3300048907 Ga0496104_0022577 Ga0496104_0022577_406_993 185
1579 3300048908 Ga0496105_0311075 Ga0496105_0311075_520_1107 185
1580 3300048908 Ga0496105_0520715 Ga0496105_0520715_72_629 185
1581 3300048910 Ga0496107_0364903 Ga0496107_0364903_121_708 185
1582 3300048912 Ga0496109_0088762 Ga0496109_0088762_2180_2743 185
1583 3300048913 Ga0496110_0129876 Ga0496110_0129876_14_571 185
1584 3300048915 Ga0496112_0018929 Ga0496112_0018929_5563_6150 185
1585 3300048915 Ga0496112_0042168 Ga0496112_0042168_1325_1888 185
1586 3300048916 Ga0496113_0009278 Ga0496113_0009278_4807_5394 185
1587 3300048917 Ga0496114_0023840 Ga0496114_0023840_119_682 185
1588 3300048918 Ga0496115_0216934 Ga0496115_0216934_399_956 185
1589 3300048918 Ga0496115_0813661 Ga0496115_0813661_124_711 185
1590 3300048922 Ga0496119_0194322 Ga0496119_0194322_161_748 185
1591 3300048923 Ga0496120_0135828 Ga0496120_0135828_578_1165 185
1592 3300048924 Ga0496121_0001183 Ga0496121_0001183_16649_17206 185
1593 3300048924 Ga0496121_0051131 Ga0496121_0051131_594_1181 185
1594 3300049568 Ga0501031_0003098 Ga0501031_0003098_1134_1706 185
1595 3300049570 Ga0501033_0076980 Ga0501033_0076980_1473_2045 185
1596 3300049570 Ga0501033_0354966 Ga0501033_0354966_51_623 185
1597 3300049571 Ga0501034_0440586 Ga0501034_0440586_74_646 185
1598 3300049574 Ga0501038_0029365 Ga0501038_0029365_3040_3612 185
1599 3300049581 Ga0501047_0119159 Ga0501047_0119159_1546_2118 185
1600 3300049582 Ga0501048_0014866 Ga0501048_0014866_1073_1645 185
1601 3300049586 Ga0501070_0156786 Ga0501070_0156786_1232_1804 185
1602 3300049741 Ga0501079_0115213 Ga0501079_0115213_602_1174 185
1603 3300049742 Ga0501080_0545977 Ga0501080_0545977_154_726 185
1604 3300049822 Ga0501035_0107271 Ga0501035_0107271_404_976 185
1605 3300049822 Ga0501035_0507972 Ga0501035_0507972_16_588 185
1606 3300049823 Ga0501044_0176467 Ga0501044_0176467_78_650 185
1607 3300049823 Ga0501044_0199519 Ga0501044_0199519_984_1556 185
1608 3300050492 nmdc:mga0yw44_138752_c1 nmdc:mga0yw44_138752_c1_752_1333 185
1609 3300050508 nmdc:mga09592_573415_c1 nmdc:mga09592_573415_c1_241_822 185
1610 3300053077 Ga0495601_0166918 Ga0495601_0166918_491_1054 185
1611 3300053078 Ga0495612_0009808 Ga0495612_0009808_789_1352 185
1612 3300053080 Ga0500635_0102030 Ga0500635_0102030_68_631 185
1613 3300053085 Ga0495619_0454592 Ga0495619_0454592_69_638 185
1614 3300053091 Ga0500647_0070316 Ga0500647_0070316_52_609 185
1615 3300053094 Ga0500566_0002752 Ga0500566_0002752_1555_2112 185
1616 3300053094 Ga0500566_0125526 Ga0500566_0125526_734_1297 185
1617 3300053095 Ga0500640_011906 Ga0500640_011906_1655_2212 185
1618 3300053111 Ga0500572_001913 Ga0500572_001913_1540_2097 185
1619 3300053119 Ga0500595_002897 Ga0500595_002897_1704_2261 185
1620 3300053119 Ga0500595_037812 Ga0500595_037812_800_1363 185
1621 3300053136 Ga0500559_0007921 Ga0500559_0007921_2574_3131 185
1622 3300053148 Ga0500590_154222 Ga0500590_154222_49_606 185
1623 3300053150 Ga0500603_000314 Ga0500603_000314_1555_2112 185
1624 3300053159 Ga0500630_001943 Ga0500630_001943_2141_2698 185
1625 3300053162 Ga0500638_006964 Ga0500638_006964_1038_1595 185
1626 3300053163 Ga0500639_000357 Ga0500639_000357_20429_20986 185
1627 3300053177 Ga0500636_0098736 Ga0500636_0098736_414_977 185
1628 3300053177 Ga0500636_0249611 Ga0500636_0249611_75_638 185
1629 3300053733 Ga0500552_001281 Ga0500552_001281_1204_1761 185
1630 3300053735 Ga0500596_001208 Ga0500596_001208_1555_2112 185
1631 3300054114 Ga0501084_0057287 Ga0501084_0057287_729_1301 185
1632 iso_pu_bacteria 2562617112 2563061729 185
1633 iso_pu_bacteria 2711768613 2713480144 185

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vk1-assembly2.cif.gz_C crystal structure of the saccharomyces cerevisiae pyruvate decarboxylase variant d28a in complex with its substrate 0.8173 19 184
6lpi-assembly1.cif.gz_A crystal structure of ahas holo-enzyme 0.8137 18 180
6lpi-assembly4.cif.gz_D crystal structure of ahas holo-enzyme 0.8134 20 180
4gm0-assembly1.cif.gz_A crystal structure of benzoylformate decarboxylase mutant l403n 0.812 20 174
4gm4-assembly1.cif.gz_A crystal structure of benzoylformate decarboxylase mutant l403i 0.8118 20 174
ID Description Score Start End Superfamily
af_P58415_1_165_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9361 20 176 3.40.50.970
af_P58415_1_165_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8877 20 176 3.40.50.970
af_A4I3N7_14_187_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8793 19 174 3.40.50.970
af_Q4D595_58_227_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8693 20 174 3.40.50.970
af_A0A0R0ECS7_251_324_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8426 16 85 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A0E4FY14-F1-model_v4 Phosphonopyruvate decarboxylase 0.9854 20 185 GO:0016831
AF-A0A3D0TJG8-F1-model_v4 Phosphonopyruvate decarboxylase 0.9828 19 177 GO:0016831
AF-A0A1F4DVV5-F1-model_v4 Phosphonopyruvate decarboxylase 0.9796 24 185 GO:0016831
AF-A0A7Z9M8S4-F1-model_v4 Phosphonopyruvate decarboxylase 0.9772 18 170 GO:0016831
AF-A0A1Z8P0N5-F1-model_v4 Phosphonopyruvate decarboxylase 0.9747 19 185 GO:0016831

Feature Viewer

pLDDT pTM Quality
86.5 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map